KEGG   Rhodococcus erythropolis BG43: XU06_14150Help
Entry
XU06_14150        CDS       T03842                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
reb  Rhodococcus erythropolis BG43
Pathway
reb00030  Pentose phosphate pathway
reb00480  Glutathione metabolism
reb01100  Metabolic pathways
reb01110  Biosynthesis of secondary metabolites
reb01120  Microbial metabolism in diverse environments
reb01130  Biosynthesis of antibiotics
reb01200  Carbon metabolism
Module
reb_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
reb_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:reb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XU06_14150
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XU06_14150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reb04147]
    XU06_14150
Enzymes [BR:reb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     XU06_14150
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     XU06_14150
Exosome [BR:reb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   XU06_14150
  Exosomal proteins of colorectal cancer cells
   XU06_14150
  Exosomal proteins of bladder cancer cells
   XU06_14150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AKD97747
UniProt: A0A0E3VCA4
Position
complement(3047087..3048631)
Genome map
AA seq 514 aa AA seqDB search
MSDSAAASDWVNPLRDSTDKRLPHIAGPCALVIFGVTGDLARRKLMPAIYDLANRGLLPP
GFALVGFARREWTDEDFANVVLEAVKDGARTKFRQDVWERLAEGIRFVEGSFDEAEAFQN
LSETLATLDNERGIGGNHGFYLAIPPNAFPQVLEQLSASGLAQAEDGQWRRVVIEKPFGH
DLESARELNAVVNKVFPEDTVFRIDHYLGKETVQNILALRFANQLFDPIWNAHYVDHVQI
TMAEDIGLGGRAGYYDGIGAARDVIQNHLLQLLAFTAMEEPISFEPLNLQAEKIKVLSAT
RLAEPLDETTARGQYEGGWQGGLPVVGLLEEEGFAADSTTETFAAITLEVDTRRWAGVPF
YLRTGKRLGRRVTEIAVVFKRAPHLPFDKTMTEDLGQNALVIRVQPDEGVTMRFGSKVPG
SSMEVRDVNMDFSYGQAFTESSPEAYERLILDVLLGEPSLFPVNAEVELSWEILDPVLEH
WAAGGKPEPYEAGTWGPPSADEMMQRTGREWRRP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgattccgcggcggcatcagattgggtgaatccccttcgggacagcaccgacaaa
cggcttccgcacattgcggggccctgtgccctggtgatcttcggtgttaccggcgacctc
gccaggcgcaagctcatgccagccatctacgacctcgccaaccgtggactgttgccgccc
ggattcgctctggtcgggttcgcccggcgtgaatggacggacgaggacttcgcgaacgtc
gtcctcgaagcagtcaaggacggtgctcgcaccaagttccgtcaggacgtctgggagagg
ctcgccgaaggtatccggttcgtggagggcagtttcgacgaggccgaggccttccagaac
ctgtccgagacgttggccaccctcgacaacgaacgtggtatcggcggcaatcacgggttc
taccttgcgattccgcccaacgcgtttcctcaggtgctcgagcaactgtcggcgtcgggc
ctcgcgcaggccgaggacggtcagtggcgacgagttgtcatcgagaagccgttcggtcac
gacctcgagagcgctcgcgaactgaacgccgtcgtcaacaaggtgttccccgaggacacg
gtcttccgtatcgaccactacctcggcaaggaaacggtccagaacatcctggctctgcgc
ttcgcgaaccagttgttcgatccgatctggaacgcgcactacgtcgaccacgtccagatc
acgatggccgaggacatcggcctcggtgggcgtgccgggtactacgacggcatcggcgcg
gcccgtgacgtgatccagaaccacctgctccaattgctcgcgttcacggcgatggaagaa
cccatcagcttcgaaccgctcaatctgcaggcggagaagatcaaggttctttcggcaacg
cgtctggccgaaccactcgacgagaccactgcccgcggacaatacgaaggtggttggcag
ggcgggttgccggtggtcggactcctcgaagaagagggcttcgcagcggactccacgacg
gagacctttgccgccatcaccctcgaggtcgacacccgtcgctgggcgggcgtgccgttc
tacctgcgcacgggcaagcgtctcggccgccgcgtcaccgagatcgcggtggtcttcaag
cgcgcaccacacctgccgttcgacaagaccatgaccgaagatctcggccagaacgcactc
gtgatccgcgtgcagcctgacgagggcgtcaccatgcggttcggctcgaaggttcccgga
tcgagcatggaagtccgtgacgtcaacatggacttctcgtacggtcaggctttcaccgag
tcgtcaccggaggcgtacgagcgactcatcctcgacgtgttgctcggcgagccgtctctg
ttccccgtcaatgccgaagtcgaattgtcttgggaaatcctcgatcccgtcctcgaacac
tgggcagccggcggcaagccggaaccctacgaggctggaacgtggggaccaccgtctgcg
gacgaaatgatgcaacgcaccggacgcgaatggaggcgaccctag

DBGET integrated database retrieval system