KEGG   Rhodococcus erythropolis BG43: XU06_18855Help
Entry
XU06_18855        CDS       T03842                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
reb  Rhodococcus erythropolis BG43
Pathway
reb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:reb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    XU06_18855
Enzymes [BR:reb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     XU06_18855
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     XU06_18855
    1.1.1.-  
     XU06_18855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 FAD_binding_3 2-Hacid_dh_C AlaDh_PNT_C AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AKD98531
UniProt: A0A0E4A9D6
Position
4126517..4127572
Genome map
AA seq 351 aa AA seqDB search
MKAARFHGQKDIRIEEIPEPELRPGTVKLKVAWCGICGTDLHEYLEGPIFISAPGHPHPL
SHENAPVTMGHEFSGTVEEVGEGVTDVEVGENVVVEPYFVCNECAPCKAGNYHLCTKMGF
IGLAGGGGGLSEKVVVDRRWIHKIGNIPLDEAALIEPLSVAHHAVVRSGAESGNVAIVGG
AGPIGLLVAAVLKGLGVTTIVTELSEARKAKALSSGVADYVIDPTTEDVKARVLELSGGI
GADIGFECAGVNAVLDTMLDTVRPAGVVVNVSIWGKPATIDMQKLVLKEIDLRGTIAYVR
DHEAVIKMVQDGVVDLAPFITGRIQLEELISEGFTTLIEHNDTAVKILVRS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacggttccacgggcagaaagacatccggatcgaagagatccctgagccc
gaattgcggccaggaacagtcaagctgaaggtcgcatggtgcggaatctgcggcaccgat
ctccacgagtacctcgagggaccgatcttcatctccgcacccggacacccgcatcctctc
tcacacgagaatgcgccggtcacgatgggccacgagttctccggcaccgtcgaagaggtc
ggcgaaggtgtcacggacgtcgaggtcggtgaaaatgttgtcgtcgagccgtacttcgtc
tgcaacgagtgcgccccgtgcaaggcgggcaactaccacctgtgtacgaagatggggttc
atcggcttggccggcggtggtggcgggctcagcgagaaggtagtcgtcgaccgtcgctgg
atccacaagatcggcaacatcccgctcgacgaggcagctctcatcgaaccgttgagcgtc
gcccatcacgcagtcgtacgcagtggagccgaaagcggcaacgtcgccatcgtgggcgga
gccggaccgatcggactcctcgttgcggcagttctcaaagggctgggtgtcacgacgatc
gtcaccgaactcagcgaagcccgtaaggccaaggcgctctccagtggcgtggccgactac
gtcatcgatcccaccaccgaagacgtcaaagcgcgcgtcctcgaactcagcggaggcatc
ggcgcagacatcggcttcgagtgcgcaggcgtcaacgcggtcctcgacaccatgctcgac
acggtccgtcccgccggagttgttgtcaacgtgtcgatttggggcaaacccgcgaccatc
gacatgcagaagctggtcctcaaggaaattgatctacgcggaaccatcgcgtacgtacgc
gaccatgaagcggtcatcaagatggtccaggacggtgtcgtcgatctggcgccattcatc
accggtcgtattcagctcgaagaattgatctccgaaggattcaccactctgatcgagcac
aacgacactgcagtcaagattctcgtcaggtcgtaa

DBGET integrated database retrieval system