KEGG   Rhodococcus erythropolis BG43: XU06_19600Help
Entry
XU06_19600        CDS       T03842                                 

Definition
(GenBank) methyltransferase type 11
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
reb  Rhodococcus erythropolis BG43
Brite
KEGG Orthology (KO) [BR:reb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:reb03009]
    XU06_19600
Enzymes [BR:reb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     XU06_19600
Ribosome biogenesis [BR:reb03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    XU06_19600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_12 Methyltransf_11 Methyltransf_32 DUF938 Methyltransf_2 PhnA_Zn_Ribbon Methyltransf_33 Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: AKE00833
Position
complement(4329228..4330067)
Genome map
AA seq 279 aa AA seqDB search
MLAAVVDLLSCPQCAAELELVDGAAECDRGHRFDVARQGYVSLISGGATKFTGDSAEMIA
ARARLLGAGHFGPLMDAVSRACATTAGEDPARIVEIGSGTGQYLAHVVDSLPESRAIALD
VSKFAARRAAKIHERIGSIVADVWQPLPIRDGALSHVLCVFAPRNGPQSHRVLADDGVLV
VLTPTDRHLRELIDILEMVKVDDRKVERLESSMAGLFERVSSDEVEFTMSLSHQDVLDLV
GMGPSARHLTPADLAAAVAKLPQPSTVTASATVSTYRKI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccgccgtggtcgatcttctgtcctgcccgcagtgcgctgctgagttggaattg
gtggacggcgccgccgagtgcgatcgcggacatcgattcgacgtggctcgccagggttac
gtgagcctgatcagtggcggtgccacgaagttcaccggcgacagtgccgagatgatcgct
gcgcgtgcacgactgctcggcgccggccacttcggcccgctgatggatgccgtttcccgg
gcctgcgcgacgacggcaggggaggatcctgcgcggatcgtcgaaatcggttcaggcaca
ggacaatacctcgcacacgtcgtggattcgctgcctgagtctcgggcaatagccttggac
gtgtccaagttcgcggcacggcgagcggcgaagatccacgaaaggatcggctcgatcgtc
gcggacgtctggcaaccacttccgattcgagacggagcgctctcccacgtgctctgtgtg
ttcgctccacgcaacggtccgcagtcccatcgagttctcgccgatgacggcgttctggtg
gtcctgacgcccaccgacaggcatctgcgcgagctgatcgacattctcgagatggtcaag
gtcgacgatcgaaaggtggaacgtctcgaatcgtcgatggccggcttgttcgagcgcgtg
agcagcgacgaggtcgagttcacgatgtcactctcacaccaggacgtcctcgacttggtg
gggatgggaccgtcggcgaggcacctgacgcccgccgatctggctgccgccgtggcgaag
ctgccgcagccgagcaccgtcaccgcgtcggctacggtctcgacctatcgcaagatctga

DBGET integrated database retrieval system