KEGG   Rhodococcus erythropolis BG43: XU06_25480Help
Entry
XU06_25480        CDS       T03842                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reb  Rhodococcus erythropolis BG43
Pathway
reb00071  Fatty acid degradation
reb00072  Synthesis and degradation of ketone bodies
reb00280  Valine, leucine and isoleucine degradation
reb00310  Lysine degradation
reb00362  Benzoate degradation
reb00380  Tryptophan metabolism
reb00620  Pyruvate metabolism
reb00630  Glyoxylate and dicarboxylate metabolism
reb00640  Propanoate metabolism
reb00650  Butanoate metabolism
reb00900  Terpenoid backbone biosynthesis
reb01100  Metabolic pathways
reb01110  Biosynthesis of secondary metabolites
reb01120  Microbial metabolism in diverse environments
reb01130  Biosynthesis of antibiotics
reb01200  Carbon metabolism
reb01212  Fatty acid metabolism
reb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XU06_25480
   00630 Glyoxylate and dicarboxylate metabolism
    XU06_25480
   00640 Propanoate metabolism
    XU06_25480
   00650 Butanoate metabolism
    XU06_25480
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XU06_25480
   00072 Synthesis and degradation of ketone bodies
    XU06_25480
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XU06_25480
   00310 Lysine degradation
    XU06_25480
   00380 Tryptophan metabolism
    XU06_25480
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XU06_25480
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XU06_25480
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XU06_25480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reb04147]
    XU06_25480
Enzymes [BR:reb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XU06_25480
Exosome [BR:reb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XU06_25480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Death
Motif
Other DBs
NCBI-ProteinID: AKD99651
UniProt: A0A0C2ZQ41
Position
5529733..5530944
Genome map
AA seq 403 aa AA seqDB search
MPDVVICEPLRTPVGRFGGVFRDVAPEDLASTLIAELVTRTGISGAEIDDVILGQASPNG
EAPAIGRIAALNAGLGVDVPGMQVDRRCGSGLQAIIQAVMQVQSGGSDLVLAGGAESMSQ
AEFYATGMRWGVKGEGVALSDRLARARVTAGGRDFPVPGGMIETAENLRAEFSISREDQD
ALAVQSHQRAVAAQKNGVFAEEIVPVSVPQRKGEALLVDTDEHPRADTSMESLARLRPMR
AKIDPDSTVTAGNASGQNDGAALAIVTTADKARALGLRPLARLASWSVAGVPPRTMGIGP
VPASEKALGRLGLTLADMDVIELNEAFAAQALAVLQSWKLEADDPRVNPNGSGISLGHPV
GATGGRILATLLREMDRREARYGLETMCIGGGQGLAAVFERLS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgttgtcatctgtgaaccgctccgtacccctgtcggccgcttcggcggtgtc
ttccgtgacgtagccccggaagatctcgcctcgacgttgatcgccgaactcgtcacgcgt
accggcatttccggcgcggagatcgacgacgtcattctcggccaggcttcgccgaacggt
gaagctccggcgatcggacgcatcgcggcgctcaacgccggtctgggcgtcgatgttccc
ggcatgcaggtggatcgccggtgcgggtcgggattgcaggcaatcatccaggccgtcatg
caggttcagtccggtggcagtgatctggtcctcgcgggtggtgccgagtcgatgagccag
gcagagttctacgcaaccggaatgcgttggggtgtcaagggtgaaggtgttgcgctcagc
gatcgtctcgcgcgcgcccgcgtgacagccggcggacgcgacttcccggttcccggcgga
atgatcgaaacggcagagaacctgcgcgccgagttctccatcagccgcgaagatcaggac
gcactcgcggtgcagtcgcatcagcgtgccgttgccgcacagaagaacggcgtcttcgcc
gaggaaatcgttccggtatccgttccgcagcgcaagggcgaggccctgctcgtcgacacc
gacgagcatccgcgggccgacacttcgatggaatcgcttgcacgccttcgtcccatgcgc
gcaaagatcgacccggactccaccgtgacggcaggtaatgccagcggccagaacgacggc
gcagcgctggcgatcgtcaccaccgcagacaaagcccgcgcactcggactgcgacccctc
gcacgcctggcaagttggagcgttgccggagttcccccgcgcaccatgggcatcggtccc
gtcccggcgtcggagaaggcactcggccgcctcggattgaccttggcggacatggatgtc
atcgaactcaacgaagcctttgcggcacaagcacttgcagtcctgcagagttggaagctc
gaagccgacgacccgcgcgtcaaccccaacggctccggcatctccctcggccatccggtc
ggtgccacgggtggacgaatcctggccaccctgttgcgcgagatggaccgtcgcgaagcg
cgttacggcctcgagacgatgtgcatcggcggcgggcagggcctggctgcagtgttcgag
cgcctgtcctga

DBGET integrated database retrieval system