KEGG   Rhodococcus erythropolis BG43: XU06_28705Help
Entry
XU06_28705        CDS       T03842                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
reb  Rhodococcus erythropolis BG43
Pathway
reb00330  Arginine and proline metabolism
reb00360  Phenylalanine metabolism
reb00380  Tryptophan metabolism
reb00627  Aminobenzoate degradation
reb00643  Styrene degradation
reb01100  Metabolic pathways
reb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    XU06_28705
   00360 Phenylalanine metabolism
    XU06_28705
   00380 Tryptophan metabolism
    XU06_28705
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    XU06_28705
   00643 Styrene degradation
    XU06_28705
Enzymes [BR:reb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     XU06_28705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKE00201
UniProt: A0A0E4AD90
Position
complement(6204948..6206339)
Genome map
AA seq 463 aa AA seqDB search
MSRESWVGRDARSIAEAVRSGQASARTVVEEHLARVDECNGELNALVTVCAEDARAAADS
LDERRLLGETLGPLAGVPFTVKDLIATAGVRTTAGSRTLADNVPAVDAPAVAAFKAAGAI
LIGKTNTPEFGACGLTRNELFGTTASPVRPDGVVRSPGGSSGGESASVAAGMSVLGLGTD
FGGSVRWPAHCTGLTSVRPTLGRIDPEGQFPGVLSDGRVLANPATMHGTIQTIGPLARNL
GDATLALRVLSKPYLAWTEPDSVDVEHLDIRWAPGEGTMPVDEKILSAVRSVANSLDASE
YDGLALPRANALFGALRSVETHADIHSLAAGSAHSFDADITAMLAAGHDRSSAEVEALWA
DRAMLIADFLGEMGDVLILPVASVLAPPLGVESFEVGGRELTWMDALASCRAISVLGLPS
VVVPVGLSRNGLPVGVQVVARPFHEHVALSVAARITSNAQALV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtgagagctgggtgggccgtgatgcccgatccatcgccgaggccgtgcggtcg
ggtcaggcgtcggcgcggaccgtcgtcgaagaacatctcgcacgggtcgacgaatgcaac
ggcgaactcaacgcactggtcaccgtgtgcgccgaggacgcgcgtgcggccgcagacagc
ctggacgaacgtcgccttctcggcgagacactcggcccccttgccggggttccgttcacg
gtcaaggacctgatcgccacagccggcgtgcgtaccaccgccggttctcgcactctggcg
gacaacgtcccggccgtcgacgccccggccgtcgccgcgttcaaggctgccggcgcaatc
ctgatcggcaagaccaacaccccggaattcggcgcgtgcggcctgactcgcaacgaattg
ttcggaaccacggccagcccggtgcgaccggacggcgtcgtccggtcccccggcggatcg
agtggcggcgagtccgcgtcggttgctgccggaatgagcgtgctcggactcggtacggat
tttggtggttcggtgcgttggcccgcccactgcaccgggctcacttcggttcgcccgacg
ctcggccgtatcgaccctgaagggcaattccccggcgtgctttcggatggacgggtactc
gccaatccggcgacgatgcacggcacgatccagaccatcggcccactggcccgcaacctc
ggtgatgcgacgcttgcgctgcgcgtcctgtcgaagccgtatctcgcgtggaccgagccg
gactcggtcgacgtcgaacacctcgacatccgctgggcacccggcgaagggaccatgcct
gtcgacgaaaaaatcctgtcggcggttcgctcggtggcgaacagcctggacgcgagtgag
tacgacggtctggctttgccgcgggccaacgcgcttttcggcgcgttgcgatcggtcgag
acccatgcggacatccactctctcgccgcgggttcagcgcactctttcgacgcggacatc
actgccatgcttgccgcaggccatgatcggagttcagccgaggtggaagcgctgtgggcg
gatcgtgcgatgttgatcgccgacttcctcggcgagatgggcgacgtgctgattctgccg
gttgcgtcggtgctcgctccgccgctcggtgtggagagcttcgaggtgggcggtcgtgaa
ctcacgtggatggacgcgctcgcgagttgccgggcgatcagtgtgctcggccttccgtcg
gtcgtggttccggtaggactctcccgcaacggtttaccggtcggagtgcaagtggtggcg
cggccgttccacgagcacgttgcgctgtccgtggcggcgcgaatcacgtcgaatgcgcaa
gctctagtctga

DBGET integrated database retrieval system