KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000785Help
Entry
RHECIAT_CH0000785 CDS       T00720                                 

Gene name
zwf1
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase protein
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00030  Pentose phosphate pathway
rec00480  Glutathione metabolism
rec01100  Metabolic pathways
rec01110  Biosynthesis of secondary metabolites
rec01120  Microbial metabolism in diverse environments
rec01130  Biosynthesis of antibiotics
rec01200  Carbon metabolism
Module
rec_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rec_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
rec_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:rec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RHECIAT_CH0000785 (zwf1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RHECIAT_CH0000785 (zwf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rec04147]
    RHECIAT_CH0000785 (zwf1)
Enzymes [BR:rec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     RHECIAT_CH0000785 (zwf1)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     RHECIAT_CH0000785 (zwf1)
Exosome [BR:rec04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   RHECIAT_CH0000785 (zwf1)
  Exosomal proteins of colorectal cancer cells
   RHECIAT_CH0000785 (zwf1)
  Exosomal proteins of bladder cancer cells
   RHECIAT_CH0000785 (zwf1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ACE89774
UniProt: B3PQC8
Position
complement(777899..779374)
Genome map
AA seq 491 aa AA seqDB search
MSSQIIPVEPFDYVVFGGSGDLAERKLLPALYHRQIEGQFGEPTRVIGASRSPLTHEEYR
KFARDALKEHLKKGEYDENEVEKFCARLSYVSVDARADSGWDELKKLLDEGKDRVRAFYL
AVAPGIFGDISQKIHDHKLITKSTRIVVEKPIGRDLASALQLNDMIGRAFKEEQIFRIDH
YLGKETVQNLMALRFANALYEPLWNANYIDHVQITVAEAVGLEGRAGYYDTAGALRDMVQ
NHILQLLCLTAMEVPSSMDSEAVRDEKLKVLRALKPLDASNVEQATVRGQYRAGASGSGP
VKGYLEELEGGVSNTETFVAIKAEINNWRWAGVPFYIRTGKRLAGRMSEIVITFKSIPHA
IFDQAAGRISQNQLIIRLQPDEGVKQSLMIKDPGPGGMRLRNVSLDMSFAQAFNVRNPDA
YERLLMDVIRSNQTLFMRRDEVEAAWKWVDPILKGWETTGQQVQGYTAGTWGPSQAIALI
ERDGRTWHDDI
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagatcattcccgttgagccttttgattacgtcgtcttcggcggcagcggc
gacctcgccgaacgcaagttgctgcccgccctctatcatcgccagatcgaaggccagttc
ggcgaaccgacccgggtaatcggcgcttcgcgcagcccgctgacccacgaggaatatcgc
aaattcgcccgcgacgcgctgaaggaacacctgaagaagggcgaatatgacgagaacgaa
gtcgagaaattctgcgcccgcctctcttacgtctcggtcgatgcccgcgccgacagcggc
tgggatgagctgaagaagctgctcgacgagggcaaggatcgggtgcgcgccttctatctg
gcggtcgcgcccggcatcttcggcgacatttcgcagaagatccacgaccataagctgatc
accaaatcgacccgcatcgtcgtcgagaagccgatcggccgcgacctcgcctcggcgctg
cagctcaacgacatgatcggccgcgccttcaaggaagagcagatcttccgcatcgaccac
tatctcggcaaggaaacggtgcagaacctgatggcgctgcgctttgccaatgcgctctac
gagccgctgtggaatgccaattacatcgatcacgtgcagatcaccgtggccgaagcggtc
ggcctcgaaggccgcgccggctattacgacaccgcgggcgcgctgcgcgacatggtgcag
aaccacattctgcagctgctctgcctgacggcgatggaagtgccctcgtcgatggattcg
gaagccgttcgcgacgagaagctcaaggtgctgcgggcgctgaagccgctcgatgcctcg
aatgtcgagcaggcgacggtgcgcggccaatatcgcgccggcgcctccggcagcggcccg
gtcaagggctatctcgaagagctcgaaggcggcgtctccaacaccgagaccttcgtcgcc
atcaaggccgagatcaacaactggcgctgggccggcgttcccttttacatcagaaccggc
aagcgcctcgccgggcgcatgtccgagatcgtcatcaccttcaagtcgatcccgcatgcg
atcttcgatcaggccgccggccgcatcagccagaaccagctgatcatccgcctgcagccg
gacgagggcgtcaagcagtcgctgatgatcaaggatccgggcccgggcggcatgcgcctg
cgcaatgtctcgctcgacatgagcttcgcccaggccttcaacgtccgcaatcccgacgcc
tacgagcgcctgctgatggacgtaatccgctccaaccagacattgttcatgcgccgcgac
gaagtcgaagccgcatggaagtgggtcgacccgatcctgaaaggttgggaaaccaccggc
cagcaggtgcagggctatacggccggcacctggggcccgagccaggccatcgcgctgatc
gagcgcgacggccgcacctggcatgacgatatctag

DBGET integrated database retrieval system