KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001458Help
Entry
RHECIAT_CH0001458 CDS       T00720                                 

Gene name
rnc
Definition
(GenBank) ribonuclease III protein
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
rec  Rhizobium etli CIAT 652
Brite
Enzymes [BR:rec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     RHECIAT_CH0001458 (rnc)
Messenger RNA biogenesis [BR:rec03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     RHECIAT_CH0001458 (rnc)
Ribosome biogenesis [BR:rec03009]
 Eukaryotic Type
  90S particles
   RNase
    RHECIAT_CH0001458 (rnc)
 Prokaryotic Type
  rRNA processing factors
   RHECIAT_CH0001458 (rnc)
Chromosome and associated proteins [BR:rec03036]
 Eukaryotic Type
  RNA silencing
   microRNA pathway
    Microprocessor complex
     RHECIAT_CH0001458 (rnc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm DND1_DSRM
Motif
Other DBs
NCBI-ProteinID: ACE90437
UniProt: B3PUN8
Position
1444773..1445492
Genome map
AA seq 239 aa AA seqDB search
MSKAQTLSAADRAKLESLIGHDFAEKERLDRALTHASARTEKGSNYERLEFLGDRVLGLC
IAELLFRTFGTAGEGELSVRLNQLVSAETCAAVADELNLHLYIRTGADVKKLTGKRMMNV
RADVVESLIAAIYLDGGLEVARRFILRYWQGRAVRADGAKRDAKTELQEWSHAKFGVTPL
YRVDERSGPDHDPRFKVTVEVAGIKPETGVERSKRAAEQVAATKMLEREGIWQQSPAGN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgcagacgctttctgcggccgaccgcgcaaagcttgaaagcctgatcggt
catgacttcgccgaaaaggagcgcctggatcgcgcgctgacccatgccagcgcccggacg
gaaaagggcagcaattacgaacgtctggaatttctcggcgacagggtcctcgggctctgc
atcgccgagctcttgttccgcaccttcggcacggcgggggaaggcgagctctcggttcgt
ctcaaccagctcgtcagcgccgaaacctgtgctgcggtcgccgacgaactcaaccttcat
ctctatatccgcaccggcgccgatgtgaagaaactgaccggcaagcgcatgatgaacgtg
cgcgccgatgtcgtcgaaagcctgatcgcggcgatctatctcgacggtggcctcgaagtc
gcgcgccgcttcatcctgcgttattggcagggcagggcggtcagagccgatggcgccaag
cgcgacgccaagaccgagctgcaggaatggtcgcacgcgaagttcggcgtcacgccgctc
taccgggttgatgaacgcagcggaccggatcatgatccgcgcttcaaggtgacggtggaa
gttgctggcataaagccggaaaccggcgtagagcgttcgaagcgcgccgccgaacaggtt
gcggcgaccaagatgctcgagcgcgaaggcatttggcagcaatcgcctgccggaaactga

DBGET integrated database retrieval system