KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001895Help
Entry
RHECIAT_CH0001895 CDS       T00720                                 

Gene name
pcm1
Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rec  Rhizobium etli CIAT 652
Brite
Enzymes [BR:rec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RHECIAT_CH0001895 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 Methyltransf_32 Methyltransf_18 Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: ACE90862
UniProt: B3PXS6
Position
1879057..1879722
Genome map
AA seq 221 aa AA seqDB search
MMDFEAARAKMVDNQVRTTDVTSHSVLTAFLTVPREAFVPEKAKLLAYVDNDVEISAAAP
GKPARFLMEASPLAKLLQLAAISKDDFVLEVGCGTGYTSALLSIIAGSVIALECDEGLAA
EAKAKLAGYGKVEVVTGPLEKGYAAGAPYDLIFINGAVEEVPAALLGQLRDGGRLVTVEG
HGNAARAKVFVAERGAVSENVFFNASVKPLPGFAKAREFVF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatggatttcgaagcagcgcgcgcaaagatggtcgacaaccaagttcgcacgacggac
gttacctcgcattccgtgctgacggcgtttctcacggtgccgcgtgaggctttcgtgccg
gagaaggcaaagctgctggcctatgtcgacaacgacgtcgagatctccgctgccgcgccg
ggcaagccggcccgcttcctgatggaggcgtcgccgctcgccaagctgctgcagctggcg
gccatcagcaaggatgatttcgtgctcgaagtcggttgcggcaccggttacacatcggcg
ctgctgtcgatcatcgccggctccgtcattgcgctcgaatgcgacgagggtctggccgcc
gaggcgaaggcaaagcttgccggctacggcaaggtggaagttgtgaccggcccgctcgaa
aagggctacgccgccggcgctccctatgatctgatcttcatcaatggcgctgtcgaggaa
gttccggccgctcttctcggccaattgcgtgatggcggtcgtctggtcacggtcgaaggt
cacggcaatgccgcccgcgccaaggtcttcgtcgccgagcgcggcgccgtttcggagaat
gtcttcttcaatgcttcggtcaagccgctgccgggtttcgccaaggcgcgcgaattcgtt
ttctga

DBGET integrated database retrieval system