KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002136Help
Entry
RHECIAT_CH0002136 CDS       T00720                                 

Definition
(GenBank) probable sugar ABC transporter, ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rec00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RHECIAT_CH0002136
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rec02000]
    RHECIAT_CH0002136
Enzymes [BR:rec01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     RHECIAT_CH0002136
Transporters [BR:rec02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    RHECIAT_CH0002136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_30 AAA_23 AAA_29 RsgA_GTPase Zeta_toxin AAA_16 AAA_27 DUF815 AAA_22 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ACE91094
UniProt: B3PZM9
Position
2116117..2117637
Genome map
AA seq 506 aa AA seqDB search
MVHNNETILAASAISKFFPGAVALDKVDFTLRRGEVHALLGENGAGKSTLIKCITGAYHR
DGGSLVLDGHEINPANTLAAQKLGIGTVYQEVNLLTNLSVAENLFLGRQPRRFGMTDVRA
MNRKARELLAGYGIDIDVTAELSRFSVAVQQVVAIARAVDLSGKVLILDEPTASLDNQEV
ALLFRIIEDLKKRGLGIVFITHFLEQVYAISDRITVLRNGKLVGTRDAADLPRQGLIAMM
LGRELAQAEETVREHSIAAGEVRYRFAGYGKRGKVKPFDLDVRAGEVVGIAGLLGSGRTE
TAELLFGVEHADSGSATIDGQPATLSSPRAAIEKGFGFCPEDRKTDGIVGDLSIRENIAL
ALQARRGWTRPLSRAEQNALADRYIKALDIRTTDREKPIRLLSGGNQQKAILARWLATNP
KFLILDEPTRGIDVGAHAEIIRLIEQLCAEGMSLIVISSELEELVAYSSRVIVLRDRQHI
AELTGERITAAAIVDAIAAAEHKEEA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggttcacaataacgagactatcctcgcagcctcggccatatcgaaattcttccccggc
gccgttgccctggacaaggtggatttcacgctgcgccgcggcgaggttcatgcgcttctc
ggcgagaacggcgcgggaaaatcgacgctgatcaaatgcatcaccggcgcctatcatcgt
gacggtggcagcctggtgctcgatggccatgaaatcaatccggccaatacgcttgccgcc
cagaagctcggcatcggcaccgtctatcaggaggtcaacctcctcaccaatctgagtgtc
gccgaaaatctctttctcggacgccagccgcggcgtttcggcatgaccgacgtgcgtgcg
atgaaccgcaaagcgcgcgaactgcttgccggctacggcatcgacatcgacgtcaccgcc
gagctcagccgcttctccgtcgccgtccagcaagtggtcgccatcgcccgcgccgttgat
ctctccggcaaggtgctgatactggacgagccgacggcaagcctcgacaaccaggaagtg
gcgctgctcttccgcatcatcgaggatctgaagaagcgcggtctcggcatcgtcttcatc
acccatttcctcgagcaggtctatgcgatcagcgatcgcatcaccgtgctgcgcaacggc
aagctcgtcggtacccgcgacgccgccgatctgccgcgccagggcctgatcgccatgatg
ctcggccgggaactcgcccaggccgaagagacggtcagggaacacagcattgcggcgggc
gaagtccgctacagatttgccggctacggcaaacgcggcaaggtcaagcccttcgatctc
gatgtgcgtgcgggcgaggtggtcggcatcgccggtctgctcggctcggggcgcaccgaa
accgccgagttgctcttcggcgtcgagcatgccgatagcggcagcgccacgatcgacggt
cagcccgcaaccctttccagcccgcgcgccgcgatcgaaaagggcttcggcttctgcccc
gaggaccgcaagaccgacggcatcgtcggcgacctgtcgatcagggaaaatatcgccttg
gcgctgcaggcccgccgcggctggacccggccgctgtcgcgtgccgagcagaatgcgctc
gccgaccgctacatcaaggcgctcgacatccgcactaccgaccgcgaaaagccgatccgc
ctgctctccggcggcaaccaacagaaggcgatcctcgcccgttggctggcgaccaatccc
aaatttctcatcctcgacgagcccacccgcggcatcgatgtcggcgcccatgccgagatc
atccggctcatcgaacagctctgcgccgaaggcatgtcattgatcgtaatttcctcggaa
cttgaagagcttgtcgcctatagttcacgcgtcatcgtgcttcgcgaccggcagcatatc
gccgaactgacaggcgagcgcatcaccgccgccgccatcgtcgatgccattgccgccgcc
gagcacaaggaggaagcatga

DBGET integrated database retrieval system