KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002495
Entry
RHECIAT_CH0002495 CDS       T00720                                 

Gene name
rbsBch2
Definition
(GenBank) ribose ABC transporter, substrate-binding protein
  KO
K10439  ribose transport system substrate-binding protein
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec02010  ABC transporters
rec02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rec00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RHECIAT_CH0002495 (rbsBch2)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    RHECIAT_CH0002495 (rbsBch2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rec02000]
    RHECIAT_CH0002495 (rbsBch2)
Transporters [BR:rec02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    RHECIAT_CH0002495 (rbsBch2)
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_6 Peripla_BP_3 DUF917 PCP_red DUF3798 OrfB_Zn_ribbon 2-Hacid_dh
Other DBs
NCBI-ProteinID: ACE91447
UniProt: B3PQ18
Position
2508726..2509655
AA seq 309 aa
MKIARTMLASAALLGLMLGPVHAAELKKLGLAVANLQANFFNQIKQSVEAEAKKRGIEVI
TVDAKGDGPTQVNQIQDLLTQKIDALIYIPAGAAAATVPVKLAKNAGIPVVNVDRNAEGA
PGDTFLATDSVASAKAVCDYILKEAGGKGKMVIIHGQKGTTPEVDRSKGCGESLKAYPDV
KVVAEQYSNIWSQDEGFQIMQNMLQANPDVSIVFAQADGLALGAAQAIKVANPSQKIVVG
GFDGDTAALEALSKGVFNVTATQQTQKMGRDAVENAAKLVAGEKVPPVQLLDATLTTKEN
VAGFIANHP
NT seq 930 nt   +upstreamnt  +downstreamnt
atgaaaattgcgcgcaccatgctcgcgtccgctgcactgctcggcctcatgctcggtccc
gtacacgccgcggaactgaagaagcttggcctggccgttgcgaaccttcaggcaaacttc
ttcaaccagatcaagcaatcggtcgaggccgaagccaagaagcgcggcatcgaagtcatc
accgtcgacgcaaagggtgacgggccgacgcaggtcaaccagatccaggatcttctgacc
cagaaaatcgacgcgctgatctacattccggcaggtgcggcagcggcgaccgttccagtc
aagctcgcgaagaacgccggcattccggtcgtcaacgtcgaccgcaacgccgaaggcgcg
ccgggcgatacattcctcgcaaccgattccgtcgcgtctgccaaggcggtgtgcgactac
atcctgaaggaagccggcggcaaggggaagatggtcatcatccatggccagaagggcacg
acgccggaagtcgatcgctcgaagggctgcggcgaatccctcaaggcctatccggatgtg
aaggttgtcgccgaacaatattccaacatctggagccaggacgaaggcttccagatcatg
cagaatatgctgcaggcaaatcccgatgtctcgatcgtcttcgcacaggccgatggcctc
gcacttggcgccgctcaggcaatcaaggtcgcaaatccctcgcagaagatcgtggtcggc
ggcttcgatggcgacactgcggctctcgaagcgctcagcaagggcgtcttcaacgtgacg
gcaacccagcagacgcagaaaatgggccgcgatgcggtcgaaaacgccgccaagcttgtc
gccggtgaaaaggtaccgccggtacagctcttggatgccacgctgacaaccaaggaaaac
gtcgcaggcttcatcgccaaccacccgtaa

DBGET integrated database retrieval system