KEGG   Rhizobium etli CIAT 652: RHECIAT_PB0000162
Entry
RHECIAT_PB0000162 CDS       T00720                                 
Symbol
virB5b
Name
(GenBank) transport secretion system IV protein, VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rec00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RHECIAT_PB0000162 (virB5b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rec02044]
    RHECIAT_PB0000162 (virB5b)
Secretion system [BR:rec02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RHECIAT_PB0000162 (virB5b)
SSDB
Motif
Pfam: T4SS COMMD9_N DUF1690 NPV_P10 DUF4349 THOC7 MutS_III Baculo_F TORC_C
Other DBs
NCBI-ProteinID: ACE93875
UniProt: B3Q2G9
Position
pB:180729..181430
AA seq 233 aa
MIRTGTMRPLFVSAALLASAMLASAQGIPVIDQTSIAKQIESITQLKSQLDTLNQQLQQA
QQLYGSLNKITNMADVANLLNDPSIRKALPQEFNAIEGLLKGSGSGVFGSSASKFRQDNS
SYRTDADDFYAQELSRIQNQNAGQMSLGQQIYDAATKRIDGIDELRQKISSAADAKDIAD
LQARLQAETAFLQTDVLRMQGLQMVQQAQVQVDDQRKAEDWRKRMDTMGAALK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgatccgaacaggaacgatgcggccgttgtttgtatcggccgctcttttggcgtcggcg
atgctggcatcggcccaaggcatccccgtcatcgatcagacatcgatcgctaagcagatc
gagagcatcacgcagctgaagtcccagctcgacaccttgaaccagcagctccagcaggcc
cagcagctctacggctcgctgaacaagatcaccaacatggccgacgtcgccaatctgctg
aacgatccgtcgatccgcaaggcgcttccacaggagtttaacgcgatcgaggggctgctc
aaaggttccggcagcggcgtcttcggcagttccgcttcgaaattccgccaggacaactcc
agctatcgcaccgatgccgacgatttctatgcgcaggagttgtcgcgcatccagaaccag
aacgccgggcagatgagcctcggccagcagatctacgatgcagcgaccaagcgcatcgac
ggcatcgatgagcttcgccagaaaatctccagtgctgccgacgccaaggacatcgccgat
ctgcaggcccgcctccaggccgagaccgccttcctgcaaaccgacgtcctgcgcatgcag
ggcctgcagatggtccagcaggcccaggtgcaggtcgacgaccaacgcaaggccgaggac
tggcgcaagcgcatggacacgatgggagcggcgctcaaatga

DBGET integrated database retrieval system