KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000019Help
Entry
RHECIAT_PC0000019 CDS       T00720                                 

Gene name
phbAc
Definition
(GenBank) acetyl-CoA acetyltransferase protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00071  Fatty acid degradation
rec00072  Synthesis and degradation of ketone bodies
rec00280  Valine, leucine and isoleucine degradation
rec00310  Lysine degradation
rec00362  Benzoate degradation
rec00380  Tryptophan metabolism
rec00620  Pyruvate metabolism
rec00630  Glyoxylate and dicarboxylate metabolism
rec00640  Propanoate metabolism
rec00650  Butanoate metabolism
rec00900  Terpenoid backbone biosynthesis
rec01100  Metabolic pathways
rec01110  Biosynthesis of secondary metabolites
rec01120  Microbial metabolism in diverse environments
rec01130  Biosynthesis of antibiotics
rec01200  Carbon metabolism
rec01212  Fatty acid metabolism
rec02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHECIAT_PC0000019 (phbAc)
   00630 Glyoxylate and dicarboxylate metabolism
    RHECIAT_PC0000019 (phbAc)
   00640 Propanoate metabolism
    RHECIAT_PC0000019 (phbAc)
   00650 Butanoate metabolism
    RHECIAT_PC0000019 (phbAc)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RHECIAT_PC0000019 (phbAc)
   00072 Synthesis and degradation of ketone bodies
    RHECIAT_PC0000019 (phbAc)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHECIAT_PC0000019 (phbAc)
   00310 Lysine degradation
    RHECIAT_PC0000019 (phbAc)
   00380 Tryptophan metabolism
    RHECIAT_PC0000019 (phbAc)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RHECIAT_PC0000019 (phbAc)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHECIAT_PC0000019 (phbAc)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RHECIAT_PC0000019 (phbAc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rec04147]
    RHECIAT_PC0000019 (phbAc)
Enzymes [BR:rec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RHECIAT_PC0000019 (phbAc)
Exosome [BR:rec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHECIAT_PC0000019 (phbAc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ACE94102
UniProt: B3Q4H1
Position
pC:17551..18750
Genome map
AA seq 399 aa AA seqDB search
MVLSYAYQPDEDWQPVVVAAYRTPIGRAFGALATVTAEDLLAPIIRRILAETAIAPEDID
DVLVGNAAGGGGNIGRLAALAAGLPVAVPGVAIDRQCGSGLEAIIMAARLIQAKAGACFL
AGGVESVSTAPWRVERPKANGALPRFYGRARFSPEMVGDPDMGIAAENVAREFGISRERQ
DEFALRSHRLAVAAAEAGAFRPEIVGIAAGHGLIERDECPRPTTSLEALANLRPVFLADG
TVTAGNACPVNDGACLVLVMSRGMARHLGIEKGLAFIDSAAAGVDPNLLGIGPVASTKKL
LQRQPGLSLSGVDAIEFNEAFAAQVLASLDQLAISSDAVNREGGAIALGHPFGASGAILV
IRLHTQLVRSGAPGTAGLAMIGIGGGIGLTALFETVALS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgtcctacgcctaccagcctgacgaggattggcagcctgtcgtggttgccgcc
taccgcacgccgatcggccgggccttcggcgcgcttgcgacggtgacggccgaagacctg
cttgcgccgatcatccgccgcatcctcgccgaaacggcgatcgcgcccgaggacatagac
gacgtgctggtcggcaacgccgccggcggcggcggcaatatcggccggctggcggcactc
gctgccggcctgcccgttgccgttcccggcgtcgccatcgaccggcaatgcggctcgggg
ctggaggcgatcatcatggccgcacggctgatccaggcaaaggccggcgcctgctttctc
gccggcggcgtggaaagcgtcagcaccgcgccatggcgtgtcgaaaggccgaaagccaat
ggcgcgctgccgcgcttttacgggcgcgcccggttctcgcccgaaatggtcggcgacccg
gatatgggcatcgccgccgaaaacgtcgcgcgggaattcggcatctcacgtgagcggcag
gatgaattcgcgctgcgcagccaccggctcgccgtcgcagctgccgaagcgggcgccttc
cggcccgagatcgtcggcatcgccgccggccacgggctgatcgaacgcgacgagtgcccg
cgcccgacgacatcgctcgaggcgctggcaaacctccggccggtcttcttggccgacggc
acggtgacggcaggcaatgcctgccctgtgaatgacggcgcctgcctggtgctcgtcatg
agccgcggcatggcaagacacctgggcatcgaaaaaggcctcgcctttatcgacagcgcc
gccgccggcgtcgatcccaacctgctcggcataggcccggtcgcctcgacgaagaagctt
ctgcagcgccagcccgggctctcgctctccggcgtcgacgccatcgaattcaatgaggct
ttcgccgcccaggttctggcttcgctggatcagctcgcaatctcttcggatgcggtcaac
agggaaggcggcgccatcgcgctcggccatcccttcggcgcctcgggcgcgattctcgtt
atccggctacatacccagttggtgcgcagcggcgctcccggaacagccgggctcgccatg
atcggcatcggcggcggcatcgggctgacggcgctgttcgagactgtcgcgctttcctga

DBGET integrated database retrieval system