KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000425Help
Entry
RHECIAT_PC0000425 CDS       T00720                                 

Definition
(GenBank) putative UDP-glucose 4-epimerase protein
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00053  Ascorbate and aldarate metabolism
rec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    RHECIAT_PC0000425
Enzymes [BR:rec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     RHECIAT_PC0000425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ACE94503
UniProt: B3Q5M2
Position
pC:454068..454898
Genome map
AA seq 276 aa AA seqDB search
MRRIAMTGAAGRVGTLLRPFLRQHVEHLSLIDVHEPADLAENESFIVADLSKLDEATTAL
AGIDGVVHLAGLAGGVDMNAILQANVLGTYNLYEAARINRVARVVYASSNHATGFYPRGQ
IISPLDPMRPDSPYGLSKCWGELVAGLYYDTSGIRSLSIRIGNAGTYPNSERSIAIWISA
RDLAQLVRIGLTHPSIGATVVYGVSDTDEKWWDNDLAARLGYQPQDRPRDHAHIEDGAES
AVARAFQGGGFCEFNHDGTIRMRDGEGLAKNPETVS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagacggatcgccatgacaggcgccgcgggacgggtcggaacgctgctgcgcccgttt
cttcggcagcatgtcgagcatctcagtttgatcgacgttcatgaacctgcggatctggcc
gagaacgaaagctttatcgtcgccgatctgtcaaagctcgacgaggcgacgacggctctg
gccggcatcgacggcgtcgttcatctcgccggccttgccggcggcgtcgacatgaacgcg
atcttgcaggcgaatgtcctcggtacctacaatctttacgaggctgcgcggatcaacagg
gtcgcgcgggtggtctacgcctccagcaatcacgcgaccggcttttatccgcgcggccag
atcatctctccgctcgatcccatgcgaccggacagcccttacgggctttccaaatgctgg
ggcgagttggtggcggggctctattacgacacttcgggcatccggtctctttccatccgc
atcggcaatgccggcacctatccgaacagcgagcggtcgatcgcgatctggatcagcgcg
cgggatctggcgcaactcgtgcggatcgggctcacccatccttcgattggcgcaacggtc
gtctacggcgtctccgatacggacgaaaaatggtgggacaacgatctggcggcacggctc
ggctaccagccgcaggaccggccacgtgatcacgcccacatcgaggatggcgcggagagt
gcggtcgcccgcgcattccagggcggcggtttctgcgaattcaatcacgacggcaccatt
cgcatgcgcgatggcgagggtctcgccaaaaacccggagacggtctcgtga

DBGET integrated database retrieval system