KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000788Help
Entry
RHECIAT_PC0000788 CDS       T00720                                 

Definition
(GenBank) putative glycoside hydrolase protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00520  Amino sugar and nucleotide sugar metabolism
rec01100  Metabolic pathways
rec01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RHECIAT_PC0000788
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RHECIAT_PC0000788
Enzymes [BR:rec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RHECIAT_PC0000788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ACE94861
UniProt: B3Q457
Position
pC:845957..846958
Genome map
AA seq 333 aa AA seqDB search
MSFTINQDAHAVLLPAFASLDFDEVMVPFLENGGWSILIGETRAEYVARSMSDERLRSET
AEFFAARLKKLTKLRPELIVAVDQELAGIERLKGIVPELPRLDEALAMDRKELENRCFEM
AVAARALGVALFLAPVADVVTGTNPWLEKRTMSSDPIEVARLVQAFVTGVQRAGIASATK
HFPGFNDLAGDPAVEDVALETPLDEILANAATFRAAIHAGSKAVMVGPTVVRSIDPTEPA
CTSPAIISLLRKEFGFSGLIVSDDLDAPATMRDRSLAETAIASLVAGADLLLVAGSANLE
NLSSAIVDAVERGTLPATRLAEAADRIRRMAAT
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgagttttactataaatcaggatgctcatgctgtcctgctgccagcattcgccagcctc
gacttcgacgaggtgatggtgccgttccttgaaaacgggggctggtccatcctgattgga
gaaacgcgggcggaatatgtcgccagatcgatgtccgacgaacgtctgcgatccgagacg
gctgaatttttcgcggcacgtcttaagaagctgacgaagcttcggcctgagctgattgta
gccgtcgatcaggagttggctggtatcgagcgtctcaagggcatcgtcccggagctgccg
cgtctcgatgaggcccttgcgatggacagaaaggagctcgaaaatcgctgctttgagatg
gctgtcgccgcccgagcgcttggtgtcgcactctttctcgctccggtagccgatgtcgtc
accggcacgaacccgtggcttgaaaagcggacgatgagttccgaccctattgaggtcgcg
cgtctggtgcaggcctttgtcacgggggtccaacgcgcgggaattgcttcggcgaccaag
cattttccaggctttaacgatctcgcgggagatccggctgttgaggacgttgctcttgaa
acgccgcttgacgaaatcttggctaacgcggccacgttcagggcagcaattcacgccggc
tcaaaggcggtcatggtcggaccgacggttgttcgctcgatcgatccaaccgagcccgcc
tgcacgtctccggcgatcatctctttgctacgaaaagagttcggtttttcaggtctgatc
gtcagcgacgacctcgacgctcctgcaaccatgcgcgatcgctcgctcgcggaaacggca
atcgcatcattggtcgcaggcgccgatcttttgctcgttgcaggcagcgccaatcttgaa
aatctttcctcagcgatagtcgatgctgtcgaacgcggcacgctcccagcgacgcgactg
gcggaagccgcggatcgaatacgcaggatggcagccacatga

DBGET integrated database retrieval system