KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000814Help
Entry
RHECIAT_PC0000814 CDS       T00720                                 

Definition
(GenBank) hypothetical conserved protein
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00260  Glycine, serine and threonine metabolism
rec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHECIAT_PC0000814
Enzymes [BR:rec01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     RHECIAT_PC0000814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: D-ser_dehydrat Ala_racemase_N
Motif
Other DBs
NCBI-ProteinID: ACE94887
UniProt: B3Q483
Position
pC:complement(874708..876024)
Genome map
AA seq 438 aa AA seqDB search
MSMIEKLAAEIGTFNLSPGLRGIPVGNAPVSSANIPDAHWRPAGGEMSLPLLTLDLQAYE
TNKKTMLGICSDFDCQIAPHAKTPMSPVLARDLVSAGAWGVSVADLRQAEVMLHHGLRRV
LIANEIGGKSAVTRLARLLRNYCEAEIFMFVDSTDVVSALARSWLGDDTLPPLNLLVEVG
CGRGGVNSDTEARHLVRSIAGLNSKHIRLAGIAAYEGTANHPDEKELLENLDDLFDRVSF
ALKAARETVGPERPLVLSMGGSSLFDYVIDRCRPIVGGDSNVTLLLRSGACFFSDHGPIR
ARLQAISSRGMLGKAASDSIAGAFTPVLRIWAEVLSMNGPHNAICGFGLRDVAHDQGLPV
PVAVWRNGERVITLGDVSVVSKLNDQHAFVHAPELELSVGDVIEFGIKHPCTTIDKHDVI
FGLDERGEVKVALRTFFG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgatcgagaaactggccgcagaaattggcaccttcaacctgtcaccgggactg
cgcggcattccggtcgggaacgcgccggtcagttccgccaacatcccggatgcgcactgg
cgtcccgccggcggcgagatgagcctcccgctgctgacgctcgatctgcaagcctatgag
acaaacaagaagacaatgcttggcatctgcagtgacttcgactgccagatcgctccgcat
gccaagacgccgatgtcgcctgttctcgcccgagatctcgtatctgccggcgcgtggggt
gtatccgtcgcggaccttcgccaagcggaggtgatgctgcatcacggactccgccgggtg
ctgatcgccaacgaaattggtggtaaatccgccgtgacgcggctggcacgactgcttcga
aactattgcgaagcagagatcttcatgttcgttgactcgaccgacgtggtatcggccttg
gccagatcgtggttgggcgacgacacgcttccgccgctgaacctgctggtggaggtcggc
tgcggccggggtggagtaaactccgatacggaagctcggcatcttgtccggtcgatcgcg
ggcctcaattcgaagcatatccgattggcaggaattgccgcgtatgagggaacggcaaac
catccagacgagaaggagcttctagagaatctcgacgaccttttcgatcgcgtctccttt
gccttgaaagcagctcgggaaacggtcgggccggaaaggccgctcgtcttgtcgatgggg
ggctccagtcttttcgactacgtaattgatcgctgtcggccgatcgtgggcggcgattct
aacgtcacactcctcttgaggagcggagcctgcttcttcagcgatcacggaccaattcgt
gcgagactacaggcgatctcttcacgtggaatgctgggcaaagctgcaagcgacagcatc
gcaggagccttcacgcccgtgctcaggatttgggccgaggtcctgtctatgaatggccct
cataatgccatctgcggctttggccttcgcgacgtcgcacatgatcagggtcttccggtc
cccgtcgcggtatggcgcaacggcgaacgggtgataaccctaggcgacgtatcggtcgtc
tcgaagcttaacgaccagcacgcattcgttcatgccccggaactcgagctgagcgtcggc
gacgtcatcgagttcggcatcaagcatccgtgcacgacgatcgataagcacgacgtgatc
ttcggtctcgacgagcggggtgaggtgaaggtcgctttgcgaacattcttcggctga

DBGET integrated database retrieval system