KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000903Help
Entry
RHECIAT_PC0000903 CDS       T00720                                 

Gene name
virB8c
Definition
(GenBank) transport secretion system IV protein, VirB8
  KO
K03203  type IV secretion system protein VirB8
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rec00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RHECIAT_PC0000903 (virB8c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rec02044]
    RHECIAT_PC0000903 (virB8c)
Secretion system [BR:rec02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RHECIAT_PC0000903 (virB8c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: ACE94973
UniProt: B3Q3W3
Position
pC:complement(993903..994574)
Genome map
AA seq 223 aa AA seqDB search
MVTTDSLKSYFEKARRFDQERMMQVERSARIAWFVAVSAGALAAASVFAIAGLTPLKTVE
PFVVRVDNSTGIVDVVSALTSTAGTYDEAVTKYFAAKYVRAREGYVWSEGEENFRTVALL
STQPEQTRFSALYRGSNPDSPQNIYGRSATSRINIVSISLINANVASVRYMRTVTRGDEV
RTTHWVATLTFSYANAPMSSTDRLINPLGFVVSEYRADPEAIN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccacggacagcctcaaaagttacttcgaaaaggcccgccggttcgatcaggaa
cggatgatgcaggttgaacgttccgcccgcattgcctggttcgtcgccgtttccgccggc
gcccttgctgctgcctccgtctttgccattgccggcctcacgcctctgaaaactgtcgaa
cccttcgtcgtgcgggtcgacaattcaacaggcatcgtcgacgtggtctcggcgctgaca
tccaccgccggcacctacgacgaggccgtcaccaaatattttgcggccaaatacgtccgc
gcccgcgaaggttacgtctggagcgagggcgaggagaatttccggacggtggcattgctg
tcgacgcagccggagcaaacgcggttttcagcactctatcgcggcagcaatccggattcg
ccgcagaacatttatggccgcagcgcgacctcgcggatcaacatcgtttccatctcgctg
atcaacgccaacgttgcatccgtccgctatatgaggaccgtgacccgtggtgacgaggtg
cgcaccacgcactgggttgcgaccctgaccttttcctacgccaacgcgccgatgtcctca
accgatcggctgatcaatccgctcggcttcgtcgtcagcgaatatcgcgccgatccggag
gccatcaattga

DBGET integrated database retrieval system