KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000933
Entry
RHECIAT_PC0000933 CDS       T00720                                 

Definition
(GenBank) hypothetical conserved protein
Organism
rec  Rhizobium etli CIAT 652
SSDB
Motif
Pfam: IcmF-related IcmF_C DotU
Other DBs
NCBI-ProteinID: ACE95003
UniProt: B3Q3Z3
Position
pC:complement(1022721..1025150)
AA seq 809 aa
MQADVLAALAQPLLDLARRAESEKNPDPRELAAMARTLVAAFETEARRRKVPPDWLLDAR
DALVALVDARARNNPALPIRKWERALAAALPIGGVMAASTLAERARAAAKAGPARRDLAR
FLGHCNDAVQAALLSRTQHKTDRGLAAPVIGIFLAVLVVWAGWAEWRFRERLLSQLPDVA
RVVEAGRTAKPAARAAQLDAFLAGVRLVETDAQRSPLGLIHHLRIFDPAEAARRRYGQAV
DALASGPLADALGVALATEGEATALYDSLRAWSILKGTSDWQPRFLAGWIEDRTQTFPEL
AGMAMHVAAMSGPPADLEEPDPEAIAQARQFASEGLANERAMLELARAEKTAGLPGWSLG
QAAPGLDKILIRRSGLPIEQAVPGLYTEAGWAYARSGAAEEAIGKAKAETASLLHAGGET
SADAVMDLLQKRTLETWSRYLGDLRVRPFTDQPSAVIVSGVLSASNSPLSALIREVWRQA
GGTDRSRSHANQLRIAATLGPAIQFVEQGRMSEISRLFVSLNVALAFLDGNSDIGKKSLM
DAQERANSVVALQQAPLLVVQMVEDVISQTASPKPVEKAEDPVPTAKPSGAWGEIATACQ
AAVAGHYPFFDGSDADLAEVARIFAPNGLVETYFRTQLAPLMDISTTPWRWKPGARLSGY
APESATFFQKASAIGDALFRQGNAPRLPVLLEALAQRGAATISIGGAHAPVTTSGGAVSF
NWPGDLPSRGFEISFDSGSAVEKKSTPGPWGLLRFLDGSRLRPRDGGRRFLIDVRATGAR
AYLQMSFAEPANPVSVRILMRELTCPSSL
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgcaagcagatgtgctcgccgcactggcgcagccgctgctggatcttgctagacgtgcc
gaaagcgaaaagaatccagatccacgcgagcttgcggccatggcacggaccctcgtcgcc
gccttcgagacggaagcacgacgcaggaaagttccccccgactggctcctggatgcccgc
gatgcccttgtcgctttggttgatgcgcgagcgcgcaacaatccggcattgccgatccga
aaatgggagcgcgcgcttgccgctgctcttccaatcgggggcgttatggcggccagcacc
cttgccgaacgggcgagggcggcagcgaaagcagggcctgcacgccgggatctcgcccgc
ttcctcggccactgtaacgacgctgtccaggcagcacttctatctcgcacgcagcacaaa
accgatcgcggtcttgccgctcctgtgatcggcatcttcctggcagttctggtggtttgg
gccggatgggccgaatggcggtttcgtgagcggcttttgtcgcagctgcccgatgtcgca
cgtgtcgtagaagcaggacgcacggcaaaaccggcagcccgcgcagcccaactcgacgca
ttccttgcaggagttcgacttgttgagacggatgcgcagcgttccccccttggtctcatt
catcatttaaggatctttgatccggcagaggccgcacgccgacgctatggccaagccgtc
gacgccctggccagcggcccgcttgccgacgcccttggtgttgctctcgccacggaaggt
gaggcaactgcactttacgattcgctgcgtgcctggtctatcttgaagggcacatcggac
tggcaaccgcggttcctggcgggctggatcgaagatcgcactcagacatttcccgaactt
gccggcatggcaatgcatgtcgctgccatgtccgggcctccagcagatcttgaagagccg
gatcctgaagcaatcgctcaagccagacagtttgcttcagagggcttggcaaacgagcgc
gccatgctggaactcgcccgggccgagaaaactgcgggcctgcctggctggtccctcggg
caggcagcaccgggcctcgacaagatcctgattcgcaggtccggactgcccatcgagcaa
gccgtgcctggtctttacactgaggcaggatgggcttacgcgcgctccggcgctgcagaa
gaggcgatcgggaaggcgaaggccgaaactgccagcctcctgcacgccggaggcgagaca
agcgccgatgcagttatggacctgcttcagaagcgaaccctggagacctggtcccggtac
ctcggcgatcttcgcgtcaggccattcaccgaccaaccgagtgcggttattgtcagcggc
gtgctcagcgcgtctaactcgccgctctcggcgctgatccgcgaggtatggcgtcaggcg
ggcggcaccgaccgcagccgcagccacgcgaaccagcttcgaattgccgcaacactcgga
cctgccatccaattcgtggagcagggtcgcatgtcggaaatctcccgacttttcgtgtcg
ctgaatgtcgcgcttgcctttctcgacggaaattccgatatcggcaaaaagtcgctgatg
gacgcacaggagcgtgcgaactccgtcgtcgccctgcagcaggcgccgctcctcgtcgtc
caaatggtcgaagacgtgatctcgcagacggcatctccaaagccggtagaaaaggccgaa
gatcccgtcccgacggcaaagccgtcaggggcttggggcgagatcgcgacggcctgccag
gctgctgtcgcaggccactatccgttctttgacgggtcggatgcggatctggctgaagtc
gcgcgcatttttgcgcccaatggtctcgtggagacctatttccggacgcaactggcgcct
ttgatggatatatcaacgacgccgtggcgctggaaaccgggagcacggctttctggttac
gcgcccgaaagtgcgacattctttcagaaagcttccgcgatcggcgacgcgctctttcgc
cagggaaacgcgccgcgtcttcctgtattgctggaggcacttgcgcaacgcggtgcggct
accatctcaatcggcggcgctcacgcgccggttaccacatcaggcggggcggtgtccttt
aactggccgggggatctgccatcacgcggcttcgagatctccttcgatagcggcagtgcg
gttgagaagaagagcacgcccgggccgtggggcctgctgcgatttctggacgggtcgcgc
ttgcggccacgcgacggcggccggcgttttctcatagacgtgcgggcaaccggcgcacgc
gcctacctgcagatgtcgttcgccgagcctgccaaccctgtctccgtgcgcatcctgatg
cgggaactgacatgtccatcgagcctctga

DBGET integrated database retrieval system