KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000936
Entry
RHECIAT_PC0000936 CDS       T00720                                 

Definition
(GenBank) hypothetical conserved membrane protein
  KO
K03286  OmpA-OmpF porin, OOP family
Organism
rec  Rhizobium etli CIAT 652
Brite
KEGG Orthology (KO) [BR:rec00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rec02000]
    RHECIAT_PC0000936
Transporters [BR:rec02000]
 Other transporters
  Pores ion channels [TC:1]
   RHECIAT_PC0000936
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-ProteinID: ACE95006
UniProt: B3Q499
Position
pC:1026979..1027719
AA seq 246 aa
MKRLLTVKLLVSLALVFTLQSGLRAQELDETALKERFQRQMELFKAAKLGPSRGLVLTNS
GPAPEATPLPIATPETTPTKVGSTQASSNPEASANPAKQETVGASPTPGNGPAETAPTTA
AATITTPQTYWKLPDDDQVNYRVQFAFDSSAIAPKQKPMLQKLCSVVKEMDIKLIRIVGH
TDASGGARYNQNLSMLRAREVARFFTEDCHIPPERLEAVGVGEQFPLDPQKPKADENRRV
EFQAVS
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaagcgcctgctgactgtgaagctgctggtgtctctcgctttagtcttcacgctacaa
agtggattgcgtgcacaggaactggatgagacggcgctcaaggaacgtttccagagacaa
atggaattgttcaaggccgccaagctggggccgtcacgcggcctcgtgctgaccaattcc
gggcctgcgccggaggcgacgccactgccgatcgccacgcccgagaccacgccgaccaag
gtcggttccactcaagcgagcagcaatccggaggcttcggcaaatccggctaaacaggaa
actgtcggggccagtccgaccccgggaaacgggccggccgagacagcaccaacaactgca
gcagcgacgataacaacacctcagacatattggaaactgcccgacgatgatcaggttaac
taccgggtgcagtttgccttcgattcctccgcgatcgcacccaagcaaaagccgatgctg
cagaagctctgcagtgtggtgaaggaaatggatattaagctcattcgcattgtcggccac
accgacgcctccggtggagcccggtacaatcagaatctctccatgctgcgggcaagggaa
gtggcgcgcttcttcacggaggattgccatattcctcctgaacgcctcgaggctgtcggt
gttggcgagcaatttccgctcgatccacaaaagccgaaagctgacgagaaccgacgtgtc
gaattccaggccgtcagctaa

DBGET integrated database retrieval system