KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000940
Entry
RHECIAT_PC0000940 CDS       T00720                                 

Definition
(GenBank) hypothetical conserved protein
  KO
K11901  type VI secretion system protein ImpB
Organism
rec  Rhizobium etli CIAT 652
Brite
KEGG Orthology (KO) [BR:rec00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rec02044]
    RHECIAT_PC0000940
Secretion system [BR:rec02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RHECIAT_PC0000940
SSDB
Motif
Pfam: T6SS_VipA Peripla_BP_2
Other DBs
NCBI-ProteinID: ACE95010
UniProt: B3Q4A3
Position
pC:1033976..1034512
AA seq 178 aa
MSETKAKVIERNRAPRVQIAYEVETYGSPTTIELPFVMGVMADLAGASQTPEALKSVRDR
TFVETDANRFGRFMEALSPRVKARVKNTLPQPPGEERDEELAVDLTFTSMGDFAPDRIAE
QVPQLAELLRMRRQLEELLGFMDGRVDAEKRIAQLLNNEPLLAKIADQAIDDGSKSEG
NT seq 537 nt   +upstreamnt  +downstreamnt
atgagcgaaactaaggcgaaggtgatcgaacgcaacagggcgcctcgcgtccagatcgcc
tatgaagtggaaacatatggcagcccgaccacgatcgaattgcctttcgtgatgggggtg
atggcagatctcgccggcgcgtcccaaacgccggaggcactgaaatccgttcgggaccgg
acctttgtcgagaccgacgccaaccgcttcggccgcttcatggaagcactgagcccgcgc
gtgaaggcgcgggtcaagaacacgcttccccaaccgcccggcgaagagcgggacgaggaa
cttgccgtcgacctgacctttacgagcatgggcgatttcgctccggaccggattgccgaa
caggttccccagctcgccgaactcctgaggatgcgccgccaactcgaggaattgctgggc
ttcatggatggccgtgtcgacgccgaaaagcgtatcgcccagcttttgaacaacgagccc
cttttggcaaaaatcgccgaccaggcgatcgatgatggcagcaagtcggagggctga

DBGET integrated database retrieval system