KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000947
Entry
RHECIAT_PC0000947 CDS       T00720                                 

Definition
(GenBank) hypothetical conserved protein
  KO
K11906  type VI secretion system protein VasD
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rec00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RHECIAT_PC0000947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rec02044]
    RHECIAT_PC0000947
Secretion system [BR:rec02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RHECIAT_PC0000947
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ACE95017
UniProt: B3Q4B0
Position
pC:1041417..1041878
AA seq 153 aa
MLQRRGFLMMLGMTGLISGCVGGPPKSSTVTVKATGQAGMNLAADGGDRPVTVLVLRLKD
VGKFNSADIFALQSDPASALGADLIGSDQLTVSPGGSATKTVAFPPEATFLGVVAFFRTP
GGRVWRQAVPIKPESTVTANVALSSGGMALALA
NT seq 462 nt   +upstreamnt  +downstreamnt
atgcttcaacgacgtggttttttgatgatgctcggcatgacaggcttgatttccggctgc
gtgggcggtccgccaaaatcctcgaccgtgaccgtcaaggcgacgggacaggcgggaatg
aatcttgccgctgatggcggagatcgcccggtgaccgtgctcgtcctcaggctcaaggat
gtcggaaagttcaattctgccgatattttcgccctccagtccgaccctgcttccgcactc
ggggcagaccttatcggctccgaccaattgacggtctctcccggcggatcggcgaccaag
acggtggcgttcccgccggaagcaacgttcctcggggtggtcgcctttttcaggacgccg
ggcggccgtgtctggcgacaggcggtcccgatcaagccggaatcgacggtgacggcgaat
gtagcattgagtagcggcggcatggcgctcgcgctcgcctga

DBGET integrated database retrieval system