KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000950Help
Entry
RHECIAT_PC0000950 CDS       T00720                                 

Definition
(GenBank) hypothetical conserved protein
  KO
K11891  type VI secretion system protein ImpL
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rec00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RHECIAT_PC0000950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rec02044]
    RHECIAT_PC0000950
Secretion system [BR:rec02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RHECIAT_PC0000950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C Asparaginase Fig1
Motif
Other DBs
NCBI-ProteinID: ACE95020
UniProt: B3Q4B3
Position
pC:1044562..1048092
Genome map
AA seq 1176 aa AA seqDB search
MAIFRFLWAFLTSRWLWTFIGLILLSLIVWIFGPIVSVGDSAPFASEIVRLVIIGLLFLV
FIIWWVAARRRAMRANRLFVSEIAPQPEAPPSPAEEGVAAVGVKFREVMADLKRRKVGGR
KFLREMPWYVIIGPPATGKTTALRQSGLNFPIDLSDDLHGVGGTRNCDWFFTEEAVLIDT
AGRYVQQESQPEVDAAEWLGFLDLLKKHRGRRALNGVVVALGIDTLSEDDAAIRMHGRQI
RKRLAELQERIGIRLPVYLMLTKADLIKGFESFFGALSTADREQVWGVTFPPGARIDGTE
VTGEFSALAGVLERRLIPRLEGEENLAARAEIFRFPAQVESLSEPVRVLIETVFGESKYS
ESAWLRGIYLTSATQEGTAIDRLTAALASSFGLPAQPAAPMLRAEKRSFFLKDLLTKVIF
KEAGLGTFDPAAEDRRIWIWRGAAVAATAFVVIASLLFTISYRKNDAALAAQAEQLEALQ
LPLTPVAARQAPVDPLDLDLALEAVTDVANARTDQPGGIAALIGPSAETEIGQAQSDAYN
RTLRNILEPRMVALLEATMWRQIRDPEFQLGALKTYRMMTGLSPMDPDFAKQWWTEKLPE
SAPVPPFKTEMAADHQLAAIDNMATEQTFVAPDEALVGEALRTICSIPLPVRAYSALLSD
PEVTALKEWVPADHVGPNGLKVLARRSDKTLRVGISGAFTYDGFHNVILTRLEDVATQAA
LDRSVFAGGCSESASPSVAALSQDILKLYYDDYIAKWDSFMRDIRLAPLADLQTASENLK
DLSSADSSMKRLLTAIVRETELTRPDDDGGGQAPPPGASKLLSKLGKIGKLAAKGVKMMP
AAGSKSDVDLSGALVADHFKPIKAAIVEVDGQPPALNDAVAALTALSNMLQTVSASPDAQ
DAMKRQGGLAELTGAVAKQAVTLPDPLDDWLAGLAGNTSALATGAVTSELNAIWRADVLP
FCQAALTNRYPFVPDSAIDVNVVDFQRVFGPGGLIDSFINNNLVNYIDTTSHPWKWRSDI
KLDPGPLAALEQARLIRDSLFPGGAGPILTFTLEPKDLSPTVSRVTLNVDGQSLSYFNNP
TRPQPMTWPGKDGTGVITLAFQPLDGSPEVMVSETGSWAFLRMLRAGRLSGTNLAELYKL
RLAAQGYYADFELRAASVANPFDLKMFARFSCPTQL
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcttccggttcctctgggccttcctcacctctcgttggctatggaccttcatc
gggctcattttgctatccctcatcgtctggatcttcggtccgatcgtcagcgtcggagat
agcgcgccgtttgcttccgaaatcgtgcgattggtcatcatcggccttttgttcctcgtg
ttcatcatctggtgggttgcggcgcggcggcgtgcgatgcgcgccaaccgcctgttcgtt
tccgagattgccccgcagcccgaggcgccgccaagtccggctgaagagggcgttgccgcc
gtcggagtgaagttccgggaggtcatggcggatctcaagcgccggaaggtcggcggccga
aagtttctccgcgagatgccttggtacgtgattatcggcccccctgcgacgggcaagaca
acagccctgcgtcaatccggactaaactttccaatcgatctcagcgacgatcttcatggt
gttggcggcacgcgcaattgcgattggttcttcaccgaggaggcggtgctgatcgatacc
gccggccgctacgttcagcaggagagccagccggaggtcgatgcagcggaatggctgggc
ttcctcgatctcttgaaaaagcacagaggccgacgtgcgctaaatggcgtcgtcgtggcg
ctcggcatagacacgctctccgaggacgatgcggcgatccggatgcatggaagacagatc
cgcaaacgcttggccgagcttcaggaacgcatcggtattcgcttgcccgtctacctcatg
ctgacgaaagccgacctgataaagggcttcgaaagcttcttcggtgcgctctccaccgcc
gatcgtgaacaggtgtggggtgtaacattccccccgggcgcgcgcatcgacggcaccgaa
gtcaccggggaattctccgccttggcgggcgtgctcgaacgacgtctcattccgcgcctc
gaaggtgaagagaatctggccgcccgggccgaaatttttcgtttcccagcccaggtcgaa
agcctttcagaaccggttcgtgtgctgatcgagaccgtcttcggcgaaagcaaatattcg
gagagcgcctggttgcggggtatctatctcacctccgccactcaggaaggcacggcaata
gaccggctgacagcagcattggcatcatccttcggcctgcctgcccaacccgccgcacca
atgctgcgggccgaaaagcgcagcttctttctcaaagacctgctgacgaaggtcattttc
aaggaggctggcctcggcaccttcgatccggcggccgaggatcggcgtatctggatatgg
cgcggcgccgccgtggcagcaacggcattcgtggtcattgccagtctgttgttcacgata
tcctatcggaagaacgatgccgccctcgcggcgcaggccgagcagctcgaagccctgcag
cttcccctgaccccggttgcggcacgccaagcgccggtcgaccctcttgatctcgatttg
gcgctcgaagccgtcacggacgtggcgaatgcacggaccgaccagccaggcggaatagct
gccctgataggtccttccgccgaaaccgaaattggccaggcgcagtcggacgcctataac
cgcaccctgcgcaatatattggaacctcgcatggtcgccctgctcgaggcgacgatgtgg
cggcagatccgcgatccagagttccagttgggcgcgctgaaaacctatcgcatgatgacc
ggcctgtcgccgatggacccggactttgccaaacaatggtggacggagaaattgcccgaa
tcggcccccgtgccgcctttcaagaccgagatggcagcggatcatcagcttgcagcgatc
gacaatatggccacggaacagactttcgtcgctcctgacgaagcgctggtgggtgaagcg
ctccgcacgatttgctcaatcccgctgccggtgcgcgcctatagcgcattgctctccgat
ccggaggtcacggctctgaaggaatgggtcccggcggaccatgtcggccccaacggcctg
aaggttctggcgcgacgctccgacaagacgctgagggtcggtatcagcggtgccttcacc
tatgacggatttcataatgtgatcctgacccggcttgaagatgttgcaacgcaggccgcg
ctggaccgctcagtctttgccggcgggtgttcggagagcgccagcccctcggtcgccgct
ctctcgcaggatatcctcaagctctactatgacgactatatcgccaagtgggacagcttc
atgcgtgacatcaggcttgcaccactggccgacctgcagaccgccagcgaaaaccttaag
gatctctccagcgccgattcctcgatgaagcgtctgctaaccgccatcgtacgggagacg
gaactgacccgtcccgatgacgatggcggcggccaggcacctccgccgggagcatccaag
ctgttgtccaagctcggcaagataggcaaactcgccgccaagggcgtgaagatgatgcct
gcagccggctccaagtcggacgtcgatctttctggcgcgctggtcgcggaccatttcaaa
cccatcaaggctgctattgtcgaggtcgatggccagcctcccgcactcaacgatgccgtc
gcagccttgaccgcgctgtcgaacatgcttcagaccgtgtcggcaagcccggatgcgcag
gacgcgatgaaaagacagggcggactggccgagctgaccggcgcagtggcaaaacaagcc
gtgacccttcccgatccgctggacgactggctggccggactggccggcaatacgagcgct
ctggcaacaggagcggtcacttcagagctcaatgccatctggcgtgccgacgtgcttccc
ttctgccaggcagcgctcaccaaccgctatccgttcgtccccgacagcgcaatcgacgtc
aatgtcgtcgattttcagcgcgtctttggtcccggcggcctgatcgacagtttcatcaat
aataatctggtcaactacatcgacacgaccagccatccctggaaatggcgctccgacatc
aagctcgatcccgggcctctggcggcgctggagcaggcgcggctgatccgcgacagtctc
tttccggggggcgccgggccaatcctgaccttcacgctcgagccgaaagatctctcgccg
acagtcagccgcgtgaccttgaatgtcgacggtcagagtctctcctacttcaacaacccg
acgcgcccgcagccaatgacctggcccggcaaggatggcaccggtgtgatcaccctcgcc
ttccagcccctcgatggttcgccggaagtgatggtcagcgagactggaagctgggcattt
ctgcggatgctgcgcgccggtcggctgagcgggaccaatcttgccgaactttacaagctg
cgccttgctgcccaagggtattacgccgatttcgagcttcgcgcggcaagtgtcgccaat
cccttcgacttgaagatgtttgcgaggttctcgtgcccgacgcagctttga

DBGET integrated database retrieval system