KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000957
Entry
RHECIAT_PC0000957 CDS       T00720                                 

Definition
(GenBank) hypothetical conserved protein
Organism
rec  Rhizobium etli CIAT 652
SSDB
Motif
Pfam: Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: ACE95027
UniProt: B3Q4C0
Position
pC:complement(1053024..1053449)
AA seq 141 aa
MSDILERIEGVVIGLLLGFDAGVPLVVFPGNPEETALRAKSLAELTSAMVGAEVALLFEG
GDPSRPLIVGRIVDPARGAPTPNVVRDGERVQITAGERIELRCGKATIIMEKDGHITIRG
TYVTSHASAANRVRGGSVNLN
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtccgacattctggagcggattgagggagtagtcatcgggctgttgctgggtttcgat
gcaggcgtgccattggtcgtgtttcccggcaatcccgaggagacagcgctccgtgcgaaa
agcttggcagagctcacgtctgccatggtcggggctgaggtagcgttactcttcgagggc
ggggacccgtctcggccgctgatcgtagggcgcatcgtcgatccggcgcgcggggcgccg
acgccgaatgtcgttcgtgacggcgagcgtgtccagatcacagccggagagcggatcgag
cttcgttgcggcaaagcgacgatcatcatggaaaaggatgggcacatcaccatccgtggc
acttatgtgacgagccacgctagcgcagccaatcgcgtccgtggtgggtcggtgaacctc
aactga

DBGET integrated database retrieval system