KEGG   Roseibacterium elongatum: roselon_00054Help
Entry
roselon_00054     CDS       T03060                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
red  Roseibacterium elongatum
Pathway
red00450  Selenocompound metabolism
red00970  Aminoacyl-tRNA biosynthesis
red01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:red00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    roselon_00054
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    roselon_00054
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:red01007]
    roselon_00054
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:red03016]
    roselon_00054
Enzymes [BR:red01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     roselon_00054
Amino acid related enzymes [BR:red01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   roselon_00054
Transfer RNA biogenesis [BR:red03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    roselon_00054
 Prokaryotic type
   Other AARSs
    roselon_00054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AHM02521
UniProt: W8S1C7
Position
50944..52653
Genome map
AA seq 569 aa AA seqDB search
MARTLITSAIPYINGIKHLGNLIGSQLPADLYARYMRARGNEVLFLCATDEHGTPAELAA
AKAGKPVAEYCAEMWEVQAKLADGFRLSFDHFGRSSSPQNHKLTQHFAGKLAEAGLIREV
TEKQVYSKADGRFLPDRYIEGTCPNCGYDKARGDQCENCTKQLDPTDLIEPHSAISGSTD
LEVRETKHLYLRQSAMRDRLEAWIDSKSDWPVLTTSIAKKWLNDGDGLQDRGITRDLDWG
IPVKKGDADWPGMEGKVFYVWFDAPIEYIACAAEWVDAGKGDDWERWWRTDKGADGVRYV
QFMGKDNVPFHTLSFPATILGSGEPWKLVDYIKSFNYLNYDGGQFSTSQGRGVFMDQALE
ILPADYWRWWLLSHAPETSDSEFTWENFQAGVNKDLADVLGNFVSRITKFCRSKFGEVVP
EGGEMGEQEQALIAELETRLAGYQHHMDAIEIRKAAAELRAIWAAGNEYLQSAAPWSAFK
EDPDRAAAITRFALNLIPVYAGLSAPFIPDAAAAMAKAMGTELSWPESVAQAISTLPAGH
AFTVPDVLFAKISDEAREDWQARFSGIRT
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaccctcatcacctcggcgatcccctacatcaacgggatcaagcatctgggc
aatctgatcggcagccagttgccggccgatctctatgcccgctacatgcgtgcgcgcggc
aacgaggtgctgtttctctgcgccacggacgagcatggcacccctgccgaactggccgcg
gccaaggccggcaagcccgtggccgagtattgcgccgaaatgtgggaggtgcaggcgaaa
ctcgcggacggtttccgcctgtccttcgaccatttcgggcgctcctccagcccgcagaac
cacaagctgacccagcatttcgcgggcaaactggccgaggccgggctgatccgcgaagtc
accgaaaaacaggtctattccaaggccgacgggcggttcctgcccgaccgctatatcgag
ggcacctgccccaactgcggctatgacaaggcccgcggcgaccagtgcgagaactgcacc
aaacagctcgacccgactgacctgatcgagccgcacagcgcgatctcgggctcgaccgat
ctggaggtgcgcgaaaccaagcatctttacctgcgccaatcagccatgcgcgaccggctt
gaggcatggatcgactcgaaatccgactggcccgtgctgaccacctccatcgccaagaaa
tggctgaacgatggcgacggcctgcaggatcgtggcatcacccgcgaccttgattggggc
atcccggtgaaaaagggcgacgcggactggcccggcatggagggcaaggtcttctacgtc
tggttcgatgcccccatcgaatacatcgcctgcgccgccgaatgggtcgatgccggcaag
ggggatgactgggaacgctggtggcgcaccgacaagggcgcggatggcgtgcgctatgtg
caattcatgggcaaggacaatgtgccattccacaccctcagcttcccggccacgatcctc
ggctcgggcgagccgtggaaactggtcgattacatcaagtccttcaattacttgaactac
gatggcgggcaattctcgaccagccaggggcgtggcgtcttcatggaccaggcgctcgag
atcctgcccgccgattactggcgctggtggcttctgtcgcatgcgcccgaaacctcggac
agcgaattcacatgggagaatttccaggccggcgtgaacaaggacctggccgacgtcctg
ggcaatttcgtcagccggatcaccaagttctgccgctcgaaatttggcgaggtcgtgccg
gaaggtggcgagatgggcgagcaggaacaggccctgatcgcggaactggaaacccgactg
gccggctaccagcaccacatggacgcgatcgagatccgaaaggcggcggccgaactgcgc
gccatctgggctgcgggcaacgagtatttgcaatccgccgccccctggagcgcctttaag
gaagacccggaccgcgccgcggcgatcacacggtttgccttgaacctcatcccggtctac
gcgggcctctccgccccgttcatccccgatgcggctgcggcgatggccaaggccatgggc
accgagctgtcctggcccgaaagcgtggcgcaggcgatcagtacccttccggccggtcat
gccttcacggtgcccgatgtccttttcgccaagatcagcgacgaggcccgcgaggattgg
caggcgcgcttttccggcatccgtacctga

DBGET integrated database retrieval system