KEGG   Roseibacterium elongatum: roselon_00839Help
Entry
roselon_00839     CDS       T03060                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
red  Roseibacterium elongatum
Pathway
red00970  Aminoacyl-tRNA biosynthesis
red01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:red00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    roselon_00839
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:red03029]
    roselon_00839
Enzymes [BR:red01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     roselon_00839
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     roselon_00839
Mitochondrial biogenesis [BR:red03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    roselon_00839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHM03251
UniProt: W8S3A9
Position
complement(816577..817920)
Genome map
AA seq 447 aa AA seqDB search
MDDWRGMSAGDLGRAIGAGRIDPVDLTEAFLGACDSHAYTDRIYTVLTPDRARAEARAAS
ERAKNGVRRGLLDGVPISWKDLFDSAGVATEAGSALLQGRVPDTDAEVLARATRAGLVCL
GKTHMSELAFSGLGLNPAYRGSVEAGTPPNVNDPALIPGGSSSGAATSVGYGLAAAGIGS
DTGGSVRVPAAWNDVVGLKTTSSRLSLKGVVPLAARFDTVGPLARTVEDCAHLLAVMEGG
RAPDLRGATLTGRRFLLLEPYSRDVREAPGAGFSAAVERMARAGARIETGSVDGIEEAMD
LSAVLFAPEAYGTWKDVIEAAPDKMFPRILERFRGGSEVSGPDFVASWQRLDALRDSWLA
QTAGYDAVILPTVPNLPPDTQRLMTDADYYVTENLLTLRNTRVGNLMGLCGLSLPTGVPS
TGLMLLCPPMAEERLLRLGAAAEAALA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggacgattggcgagggatgagcgcgggtgacctagggcgcgcgatcggcgcggggcgg
atcgatcccgtggacctgaccgaggcgttcctgggggcctgcgacagccacgcatacacc
gatcggatctatactgtcctgacgcccgatcgcgcacgggccgaggccagggcggccagc
gagcgcgcgaaaaacggcgtgcggcgcgggctgctggacggggttccgatcagctggaag
gacctgttcgacagcgccggcgtggcgacagaggcaggctcggcccttttgcaaggccgg
gtgcccgacacggatgccgaggttctggcgcgggccacgcgcgcggggttggtgtgcctt
ggcaaaacccacatgtccgaactggcgttttccggactgggcctaaacccggcctatcgc
ggcagcgtcgaggcgggcacgccgcccaacgtgaacgaccccgcgctgatccccgggggg
tcctcctctggggcggcgacctcggttggctacggcttggcggcggctggcatcggctcg
gacacgggcgggtcggtgcgggtgccggcggcctggaacgatgtcgtcggcctgaaaacc
accagcagccggctgtcgctgaaaggcgtcgtgcccttggctgcgcggttcgacacggtc
ggccccctggcccgcacggtcgaggattgcgcgcatctgctggcggtgatggagggcggg
cgcgcgcccgatctgcggggtgccacgctgacggggcggcggtttctgctgctggagccc
tacagccgcgatgtgcgcgaggcccccggcgcgggcttttccgcagcggtcgagcggatg
gccagggccggcgcccggatcgagacaggcagcgtggacggtatcgaagaggcgatggac
ctgtcggccgtgttgttcgcccccgaggcctatggcacgtggaaagacgtgatcgaggcc
gcgccggacaagatgttcccgcggatcctcgaacgctttcgcggcgggtccgaggtgtcg
ggccccgatttcgtcgcttcatggcaacggctggacgccctgcgtgacagctggctggcg
caaacggcgggctatgacgcggtgatcctgccaacggtgccgaacctgccgcccgacacg
cagcgcctgatgaccgatgcggactactacgtgaccgagaacctcctgacgctgcgtaat
acccgtgtgggcaacctgatgggcctgtgtggcctgtcgctgccgacaggggtgccgtcg
accgggctgatgctgttgtgcccgcccatggccgaggaacgcctgctgcgcctgggggcg
gcggccgaggcggcccttgcctga

DBGET integrated database retrieval system