KEGG   Roseibacterium elongatum: roselon_02145Help
Entry
roselon_02145     CDS       T03060                                 

Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
red  Roseibacterium elongatum
Pathway
red00860  Porphyrin and chlorophyll metabolism
red01100  Metabolic pathways
Module
red_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:red00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    roselon_02145
Enzymes [BR:red01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     roselon_02145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 Peptidase_S51
Motif
Other DBs
NCBI-ProteinID: AHM04490
UniProt: W8SPQ4
Position
2066675..2068249
Genome map
AA seq 524 aa AA seqDB search
MTYDLPPDDAPPPMPDIDVPMLTPAPPRRGPALMIQGTSSDVGKSLLVAGLCRAYARRGL
TVAPFKAQNMSNNAAVAADGDLPPGPDGTVRRGEIGRAQALQARAAGRAPSIHMNPILLK
PQAMVGSQVVLRGRALGNWPARHYHKLKPALMPAVIDSYNRTAAEADLVLVEGAGAATET
HLRRSDIANMRFAEAVDLPVVLLTDNDRGGALAAMVGSWLLHTEAERDRIVGYLVNKFRG
YFSLYEPACRTITETTGWPFLGVARWFDGAALLPAEDALALERPGRSEGGALKVAVPQID
RVANFDDLDPLSSEPGVDLIWVKPGQTIPADADVVLLPGSKTTRPALEALRRQGWDIDIL
AHVRRGGRVVGICAGYQMLGRMVRDPDGIEGAPGETEGLGLLDLETTITDDKRLIEIDTV
DTISGARITGYEMHMGRTVGPGLAQPWLRLDGQDEGAVSADGRVMGGYVHGLFGAADYRD
HWLTALGGRASGRDHEAQIETTLDALADQLETDMDLDALLALAR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgacctgccgcccgacgacgcgccgccgccgatgcccgacatcgatgtcccg
atgctgacccccgcgccgccgcgacggggccccgccctgatgatccagggcacaagctcg
gacgtgggcaagagcctgctggtcgcgggcctgtgccgggcctatgcgcgccggggcctg
acggtcgcgccgttcaaggcgcagaacatgtcgaacaatgccgccgttgccgccgatggc
gaccttccgcccggacccgacggcacggtgcgccgcggcgagatcggtcgcgcgcaggcc
ctgcaggcgcgcgcagcggggcgcgcgccctcgatccacatgaacccgatcctgctgaaa
ccgcaggcgatggtgggctcgcaggtggtgctgcggggccgggcgctgggcaactggccc
gcgcggcattaccacaagctcaagccggcgctgatgcctgcggtgatcgacagctacaac
cgcaccgcggccgaggcggatctggtcctcgtcgaaggtgccggcgccgcgaccgagacg
catctgcgtcgttccgacatcgccaatatgcgctttgccgaggcggtcgacctgcccgtg
gtgctgttgaccgacaatgaccggggcggtgcgctggccgccatggtcggcagttggctg
ttgcataccgaggcggagcgcgatcggatcgtgggctacctggtgaacaagttccggggt
tatttctcgctctacgaaccggcctgtcgcaccatcaccgaaacgaccggctggccgttt
ctgggggtggcgcgctggttcgacggcgctgccctgctgcccgccgaggacgcgctggcg
ctggaacggcccggccggtccgaaggcggggcgcttaaggtcgccgtgccccagatcgac
cgggtcgccaatttcgacgatctcgatcccctgtcctccgagccgggggtcgacctgatc
tgggtgaaacccggccagacgatccccgccgacgccgatgtcgtgctgctgcccggatcg
aagacgacgcgccccgcgctcgaggcgctgcgccggcaaggctgggacatcgacatcctc
gcccatgtgcgccggggcggccgggtcgtgggcatttgcgcgggctaccagatgctgggc
cggatggtgcgcgacccggacggcatcgagggcgcgcccggcgagaccgaggggttgggc
ctgctcgatctcgagaccacgatcaccgatgacaagcgtctgatcgagatcgataccgtc
gacacgatcagcggcgcgcgcatcaccggctatgaaatgcacatgggccggaccgtgggc
cccggcctggcacagccatggctcaggctcgacgggcaggacgaaggggccgtgtccgcc
gacgggcgtgtcatggggggctatgtccatggcctgttcggggcggccgactatcgcgat
cattggctgacggcgttgggggggcgggcctcggggcgcgatcacgaggcacagatcgag
acgacgctcgatgcgctggccgatcaactggaaacggatatggatctcgacgcgctgctg
gcgctggcgcgatga

DBGET integrated database retrieval system