KEGG   Roseibacterium elongatum: roselon_03215Help
Entry
roselon_03215     CDS       T03060                                 

Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
red  Roseibacterium elongatum
Pathway
red00430  Taurine and hypotaurine metabolism
red00620  Pyruvate metabolism
red00640  Propanoate metabolism
red00680  Methane metabolism
red01100  Metabolic pathways
red01120  Microbial metabolism in diverse environments
red01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:red00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    roselon_03215
   00640 Propanoate metabolism
    roselon_03215
  09102 Energy metabolism
   00680 Methane metabolism
    roselon_03215
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    roselon_03215
Enzymes [BR:red01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     roselon_03215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AHM05478
UniProt: W8RW18
Position
complement(3082746..3083771)
Genome map
AA seq 341 aa AA seqDB search
MNRAILTLNAGSSSIKFGLYHAADDPVEEARGQVDGIGPEAALVLSDDGGRTRTAVDAPD
HGAALAAIIAALRPRLAGDEIAGVGHRVVHGGPYLDGPRHIDDDLITYLDTLSPLAPLHQ
PHNLAGIAAARRAFPGAPQIACFDTAFHRGHPWVNDTFALPRRFHDDGVRRYGFHGLSYD
YITSLLRHDFNNISQGNVIIAHLGNGSSLCATRDGVSIDSTMGFSALDGMPMGTRSGQLD
PGVMLYLMQSGMAAEALTTLLYKESGLKGLSGISHDMRTLRPRRTRARHRPWPITPPACR
ARSARWRPRSADWTGWFLPAGSARTPRPCGPWRLKSSGFWV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgccatcctgacgctcaacgccgggtccagttcgatcaagttcgggctgtat
catgcggcggacgaccctgtcgaagaggcgcgcggccaggtcgatggcatcggccccgag
gcagcgctggtcctcagcgacgatggcggccggacgcgcacggccgtggacgccccggat
cacggcgcggcccttgccgcgatcatcgcggcgttgcggccgcgcctggctggtgacgag
atcgcaggcgtggggcatcgcgtcgtccacggcgggccatatctcgacgggccgcgccat
attgacgacgacctgatcacctatctcgacacgctctcgccgctggcccccttgcatcag
ccgcacaacctggccgggatcgcggccgcgcgacgggcctttccgggggcgccccagatc
gcctgtttcgacacggcctttcaccgcggtcacccttgggtgaacgacaccttcgccttg
ccgcgccggtttcatgacgacggcgtgcggcgctacggctttcacgggctcagctacgac
tacatcaccagcctgttaaggcatgacttcaataacatatctcaaggcaatgttatcatt
gcgcatcttggcaatggctcgtccctgtgtgccacgcgggacggcgtctcgatcgacagc
accatggggttctcggcgcttgacggcatgcccatgggcacccggtcggggcaactcgac
cccggtgtgatgctctacctcatgcaatcgggcatggcggccgaggcgctcacgacgctg
ctgtacaaggaaagcggcctcaagggtctgtcggggatcagccatgacatgcgcacgctg
cggcctcggaggacccgcgcgcggcacaggccgtggcctattacgccgcccgcctgtcgc
gcgagatcggcgcgctggcggcctcgctcggcggattggacgggttggtttttaccggcg
ggatcggcgagaacgccgcgcccgtgcgggccatggcgcttgaaaagctcgggtttctgg
gtctga

DBGET integrated database retrieval system