KEGG   Raoultella electrica: electrica_00128Help
Entry
electrica_00128   CDS       T06174                                 

Gene name
hldD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
ree  Raoultella electrica
Pathway
ree00540  Lipopolysaccharide biosynthesis
ree01100  Metabolic pathways
Module
ree_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ree00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    electrica_00128 (hldD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ree01005]
    electrica_00128 (hldD)
Enzymes [BR:ree01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     electrica_00128 (hldD)
Lipopolysaccharide biosynthesis proteins [BR:ree01005]
 Unusual sugar
  electrica_00128 (hldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR adh_short
Motif
Other DBs
NCBI-ProteinID: QDI06380
UniProt: A0A514EK70
Position
complement(129781..130713)
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFANLVDLDIADYMDKEDFLIQV
MAGEEFGEIEAIFHEGACSSTTEWDGKYMMDNNYQYSKEVLHYCLERQIPFLYASSAATY
GGRTSDFIESREYEQPLNVYGYSKFLFDEYVRQILPEADSQIVGFRYFNVYGPREGHKGS
MASVAFHLNTQLNNGESPKLFEGSDGFKRDFVYVGDVAAVNLWFWENGVSGIFNLGTGRA
ESFQAVADAALAYHQKGSIEYIPFPEKLKGRYQAFTQADLTNLRAAGYDKPFKTVAEGVT
EYMAWLNRDA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgttaccggcggcgcaggctttatcggcagcaacatcgttaaagcactgaat
gacaaaggcattaccgacattttggtcgtagataatctgaaagacggcaccaagtttgct
aacctggtagacctggatatcgctgattacatggataaagaagacttcctgattcaggtg
atggccggggaagagttcggcgaaattgaagccatattccacgaaggcgcctgctcttcc
accacagagtgggatggcaagtacatgatggataacaactatcagtactctaaagaggtg
ctgcactactgcctggagcgtcagatcccgttcctgtacgcctcgtcggcggccacctac
ggcggtcgcaccagcgactttatcgaatcccgtgaatatgagcagccgctgaacgtttac
ggttactccaaattcctgtttgacgaatacgtccgccagatcctgccggaagccgactcg
cagatcgtcggtttccgctatttcaacgtctacgggccgcgtgaaggccacaaaggcagc
atggcgagcgtagctttccacctcaacacccaactgaataatggcgaaagtccgaaactg
ttcgaaggcagcgatggcttcaaacgcgatttcgtctacgtgggcgacgtggcggcggtg
aatctgtggttctgggaaaacggcgtatccggcattttcaacctcggcaccggccgcgcg
gaatctttccaggcggtagccgatgccgcgctggcatatcaccagaaaggcagcatcgaa
tacatcccgttcccggagaagctgaaaggccgctaccaggcatttacccaggcggatctg
accaacctgcgcgcagcaggctacgacaaaccgtttaaaaccgttgccgagggcgtaacg
gaatatatggcctggctcaaccgcgacgcgtaa

DBGET integrated database retrieval system