GenomeNet

Database: RefSeq
Entry: NC_001880
LinkDB: NC_001880
Original site: NC_001880 
LOCUS       NC_001880              39456 bp    DNA     circular CON 23-MAR-2021
DEFINITION  Aquifex aeolicus VF5 plasmid ece1, complete sequence.
ACCESSION   NC_001880
VERSION     NC_001880.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603207
            Assembly: GCF_000008625.1
KEYWORDS    RefSeq.
SOURCE      Aquifex aeolicus VF5
  ORGANISM  Aquifex aeolicus VF5
            Bacteria; Aquificae; Aquificales; Aquificaceae; Aquifex.
REFERENCE   1  (bases 1 to 39456)
  AUTHORS   Deckert,G., Warren,P.V., Gaasterland,T., Young,W.G., Lenox,A.L.,
            Graham,D.E., Overbeek,R., Snead,M.A., Keller,M., Aujay,M.,
            Huber,R., Feldman,R.A., Short,J.M., Olsen,G.J. and Swanson,R.V.
  TITLE     The complete genome of the hyperthermophilic bacterium Aquifex
            aeolicus
  JOURNAL   Nature 392 (6674), 353-358 (1998)
   PUBMED   9537320
REFERENCE   2  (bases 1 to 39456)
  AUTHORS   Deckert,G., Warren,P.V., Gaasterland,T., Young,W.G., Lenox,A.L.,
            Graham,D.E., Overbeek,R., Snead,M.A., Keller,M., Aujay,M.,
            Huber,R., Feldman,R.A., Short,J.M., Olsen,G.J. and Swanson,R.V.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-1997) Genomics, Diversa Corporation, San Diego,
            CA 92121, USA
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            AE000667.1.
            Putative indicates similarity to known proteins
            Hypothetical indicates similarity to a protein of unknown function.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 03/23/2021 01:15:51
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 5.1
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 1,796
            CDSs (total)                      :: 1,744
            Genes (coding)                    :: 1,701
            CDSs (with protein)               :: 1,701
            Genes (RNA)                       :: 52
            rRNAs                             :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                    :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                             :: 44
            ncRNAs                            :: 2
            Pseudo Genes (total)              :: 43
            CDSs (without protein)            :: 43
            Pseudo Genes (ambiguous residues) :: 0 of 43
            Pseudo Genes (frameshifted)       :: 33 of 43
            Pseudo Genes (incomplete)         :: 5 of 43
            Pseudo Genes (internal stop)      :: 8 of 43
            Pseudo Genes (multiple problems)  :: 3 of 43
            CRISPR Arrays                     :: 6
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..39456
                     /organism="Aquifex aeolicus VF5"
                     /mol_type="genomic DNA"
                     /strain="VF5"
                     /type_material="type strain of Aquifex aeolicus"
                     /db_xref="taxon:224324"
                     /plasmid="ece1"
     gene            complement(join(39342..39456,1..122))
                     /locus_tag="AQ_RS08655"
     CDS             complement(join(39342..39456,1..122))
                     /locus_tag="AQ_RS08655"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930915.1"
                     /translation="MYVDVLERGAKNWDDFELVMGSGFRMTLGKNKNLLPESDIKLVR
                     KLDERVKTLFQKTKDTRLRQILEAYVDAIERYPL"
     gene            complement(91..432)
                     /locus_tag="AQ_RS08660"
                     /old_locus_tag="aq_aa01"
     CDS             complement(91..432)
                     /locus_tag="AQ_RS08660"
                     /old_locus_tag="aq_aa01"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_165438805.1"
                     /translation="MTRLKYKQIIDELDYLLKTFKALAQSSRVIIMKPKSEKSWTRVY
                     YLEDLSWCVILGRGGIITSFRVEKDWFKDRLEFYREKLGYEPYGGSPSEELKRSAKRI
                     YDVCRRFRERS"
     repeat_region   437..664
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=437..466
                     /rpt_unit_seq="ctttctatcccatatatgggaactaaaacc"
     gene            902..1150
                     /locus_tag="AQ_RS08665"
     CDS             902..1150
                     /locus_tag="AQ_RS08665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008287521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930888.1"
                     /translation="MKVRKNITLSKKAEEYLRMLAREKKKSQSEVIEELIEKEAKEYE
                     KKKRLEAFERLVKNAKYYSGKIGNKTIQQIKEEMGSEL"
     gene            1140..1574
                     /locus_tag="AQ_RS08670"
                     /old_locus_tag="aq_aa03"
     CDS             1140..1574
                     /locus_tag="AQ_RS08670"
                     /old_locus_tag="aq_aa03"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system VapC family
                     toxin"
                     /protein_id="WP_010890545.1"
                     /translation="MNSEKVFVDGNVIVDIFDERRVNHKYSVQAIRILLANKFDLLTS
                     SDLITTVYYVLSKIDKKKALSDIKEVVNILEIIPFGKAEVEKAIELMEGDKNFKDLED
                     TLQYVLAKKEGCKLILSNDKSFYSPDIEVLTTEEFCERWNTL"
     gene            1711..2235
                     /locus_tag="AQ_RS08675"
                     /old_locus_tag="aq_aa04"
     CDS             1711..2235
                     /locus_tag="AQ_RS08675"
                     /old_locus_tag="aq_aa04"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890546.1"
                     /translation="MKVIKKTVLLKVYEPNKGKKECLDRVIDLYAKTLDFYLDVIKKA
                     GIYRIVALARKKKERKSGRKSNYALNLLEKLTVPTQAHPNPLYPIPFSVRVDIRRSAI
                     NQAIGMVSSYVSNLKNWYEEGKELGHSKPSYPNPKSYSPQLYSTLVELDDLLVRENKE
                     FHFVRIKVLNEKER"
     gene            2254..3174
                     /locus_tag="AQ_RS08680"
                     /old_locus_tag="aq_aa05"
     CDS             2254..3174
                     /locus_tag="AQ_RS08680"
                     /old_locus_tag="aq_aa05"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_010890547.1"
                     /translation="MKVYKRLYELLGRGYKPLKSARLIKRGKDYYIGITLQKAVKEKK
                     IKKPRYVINVDLNVQRNLACIGIFEVDWEKRESKLYGIKFVNGKLLRLVYKRDYLFEE
                     IRKKQRQTGRSPQVGDNSRLWKKVNNLNRDIALKVAKEISDIAREFSEKGEVIVVFEK
                     LKGLRGRKGRSKKLNRKINFWMRRKIQERVKELGLEEGFGLDFVYPHYTSKKCSKCGY
                     EGERFSPSGSKALFLCKKCGYVVNADVNAVFNQHFLYLSHLLNGGGKARPVVRVGTSL
                     KSPSREGHNLSGVPKATTTFFYISSLLSTF"
     gene            3448..3669
                     /locus_tag="AQ_RS08685"
     CDS             3448..3669
                     /locus_tag="AQ_RS08685"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine:tRNA
                     ribosyltransferase-isomerase"
                     /protein_id="WP_164930889.1"
                     /translation="MTVKQEDKLLSTPELLEELKKRGIDISRVTLYFWIKKGKIPKKF
                     YTVKKRLERQFYYFKPELVEFLTQKLSSR"
     gene            4111..5064
                     /locus_tag="AQ_RS08690"
                     /old_locus_tag="aq_aa07"
     CDS             4111..5064
                     /locus_tag="AQ_RS08690"
                     /old_locus_tag="aq_aa07"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890548.1"
                     /translation="MEHEKAIKEILGIDDRIRLYAIEKYEKKKKTFYRFTGWDTYKKK
                     MVKVHIPRKLEKEIFSLWKEHQKEKQQLKALEQEVKALLEKYKDAEKIKEVLERIAQE
                     SITKTASSHALKTYTDKAKELFKKFEKDLINLYKEGVLKRLTILQVLYLLANLKEMSE
                     EQKNPQFLFKKGISTIIKVAKNERIPNPFGTLKNDFFLSGTQTPYDFLLSSFLEEVLE
                     ETLRELLEKEIEKIEAERRAKEYEEKMEKIKEIVEWFESLPHKIKQTAKEVISQNTVE
                     VAEKILKDMEDGNFSLKEVQDYLEKSTRENLVDYFRYLKNL"
     gene            5115..5387
                     /locus_tag="AQ_RS08695"
     CDS             5115..5387
                     /locus_tag="AQ_RS08695"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930890.1"
                     /translation="MKAKDDFEKILFEEAEALEKILELLQKVRQKEIPTEKLCNLLEG
                     VPKIKISPLSVDTKRATIVIQIEGEGRKLVAEKWNRIVRWEEDDTL"
     gene            5460..5702
                     /locus_tag="AQ_RS08700"
     CDS             5460..5702
                     /locus_tag="AQ_RS08700"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930891.1"
                     /translation="MEDRKIEAIKERIRFYTEAFKTLLIISATLTGGIAGLLFKLNSP
                     TSVFLIVVGLIIDVILISVAIKLYLNIEELFRRIEK"
     gene            5877..6824
                     /locus_tag="AQ_RS08705"
                     /old_locus_tag="aq_aa09"
     CDS             5877..6824
                     /locus_tag="AQ_RS08705"
                     /old_locus_tag="aq_aa09"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="WP_010890549.1"
                     /translation="MEHFIDTYLYELRKVRDEKTIKKKEYLLKHLQDYSEDLPAFDQS
                     EIFSFYEYLKNKNLKETTIRDILKEVRLFYEWLQEQGLNLKFDEKALKKLFQSKKSQE
                     ALKSKKKYYSDDEINLILNAIRGAVEGISTKHPIYYILTIFLLCSGLRISEAVKVRKK
                     DFEVKRILTEEGEEKEVWFVKVREGKFGKERKALIYFFRPEWKRIFEERLKKLKPEDF
                     FFTYAVKYPKSVKVFTLTDKTAKWFYWKLEKELREKGYEIEVNAHRFRNTYITKLATK
                     GFPVNLIADWVGHSKISTTMDVYMEAEREKQLEAILERI"
     gene            complement(6832..7101)
                     /locus_tag="AQ_RS08710"
     CDS             complement(6832..7101)
                     /locus_tag="AQ_RS08710"
                     /inference="COORDINATES: protein motif:HMM:NF016876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system mRNA interferase
                     toxin, RelE/StbE family"
                     /protein_id="WP_164930892.1"
                     /translation="MSWTIKLSSTAERKYKKLDRNTRKRITKALEELSECEDPLMHKH
                     VRPLVGKLKGFYRLRVGDYRVIFALIPEEKIIAVVNIAPRGEAYK"
     gene            complement(7085..7327)
                     /locus_tag="AQ_RS08715"
     CDS             complement(7085..7327)
                     /locus_tag="AQ_RS08715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020258866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930893.1"
                     /translation="MKRVTTTIRIDEEKARLLRALAGYEGRKINDILNELIDEYIKRH
                     KETLELLSIPNFLEECQKGLEEIKRGGGKKLDELDD"
     gene            7395..7979
                     /locus_tag="AQ_RS08720"
                     /old_locus_tag="aq_aa10"
     CDS             7395..7979
                     /locus_tag="AQ_RS08720"
                     /old_locus_tag="aq_aa10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="segregation/condensation protein A"
                     /protein_id="WP_010890550.1"
                     /translation="MNKLLESPYDIVLEEVREGKVNPFDVDLDHLIALFRKKAKELKG
                     SEYMLEAGKFLEASSKLLLLKLEYFFPKSQKERKKVSLKEVQEVLIEEGEEDLSRFDT
                     SFLWEYSPEVGRPKSSKGEKPKILEWREFWKLSKERVPLHREPNWQEEAKRVYEEIKR
                     GVFRIRNLRDFIAFLFAYMEYEEVQKEELLRRLL"
     gene            complement(8069..8290)
                     /locus_tag="AQ_RS08725"
     CDS             complement(8069..8290)
                     /locus_tag="AQ_RS08725"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930894.1"
                     /translation="MVQMTEEKLISLSELLEELNKKGIPITRSGIYYWILRGFIPQEY
                     MHIKRLGGRKRLYYFKPEVVDYLLEKLSE"
     gene            8785..9741
                     /locus_tag="AQ_RS08730"
                     /old_locus_tag="aq_aa11"
     CDS             8785..9741
                     /locus_tag="AQ_RS08730"
                     /old_locus_tag="aq_aa11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890551.1"
                     /translation="MREEVERKIKEVLGVKEETLKYEGVFRRRKRKGAKEYEYLEAKF
                     YDIEEKKIVNVHVPVKKENLVLELDRHWKESKKREKELEKRLKEIISEYKNPDLIREI
                     LERLLEEGIRREAKDYAYEKYKKEALELFERFKPYLIKLRRERLKRINLLQALYLLAN
                     VKEMFQEKEEELEKVMERAVKTILFRDQNQKLQSPLGVLKNDFFLPKETPYDFLLSRF
                     LQAELEPVLEKLLKAEIEKEETQEAMGEIAEFLTELSEEAKSRVLKVFPSFSQFSKVL
                     YREWKKSGQSLKDFLVDWKSFLEFKGKEAEKEVLNVLSKLNL"
     gene            10149..10436
                     /locus_tag="AQ_RS08735"
     CDS             10149..10436
                     /locus_tag="AQ_RS08735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012514624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase domain-containing
                     protein"
                     /protein_id="WP_164930916.1"
                     /translation="MKTEEDVKEAIKEIFKDKKVKVYLFGSRARGENTPRSDLNLGFL
                     SDEDIGYELSLLREILEESNLPFSVDVVDLSKAGREFREMVLKEGKLWISL"
     gene            10597..10893
                     /locus_tag="AQ_RS08740"
     CDS             10597..10893
                     /locus_tag="AQ_RS08740"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930895.1"
                     /translation="MWELLKLLESYFSYLDYWVGKQESEIGKVLVLLVFLFTPVAVWR
                     VLGKKYRFLERYLRLVAFVMFIATGAYVFHRYFEVGLLWGLVLSSKVYEFLWSD"
     gene            complement(11078..11410)
                     /locus_tag="AQ_RS08745"
                     /old_locus_tag="aq_aa15"
     CDS             complement(11078..11410)
                     /locus_tag="AQ_RS08745"
                     /old_locus_tag="aq_aa15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M48 family metallopeptidase"
                     /protein_id="WP_010890553.1"
                     /translation="MKERVENLLKELKERLGIEREVKIELKRFKRKLAPVSLTKRVIY
                     INRELIPKLSDEELGYLIAHELLHLKHGIYHISEFEKELLELSGKDLYLSLYRKTWKG
                     YNFPILQI"
     gene            complement(11394..11627)
                     /locus_tag="AQ_RS08750"
     CDS             complement(11394..11627)
                     /locus_tag="AQ_RS08750"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930896.1"
                     /translation="MYVKSKGGNLRETEGLKKVIGELLSRNLITEEMKAKLKEELILT
                     LEMEPSRLAELVNFAVEEVILLMVKELRNEGEG"
     gene            11814..12860
                     /locus_tag="AQ_RS08755"
                     /old_locus_tag="aq_aa17"
     CDS             11814..12860
                     /locus_tag="AQ_RS08755"
                     /old_locus_tag="aq_aa17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890554.1"
                     /translation="MRREILSRTLLLSSLFVAGGFLTACGGGGGGTGGGEQGKITNEL
                     QAKAALGNSLSAIRSSAGLTEDTQTGVGAASVGNKGGWLRDALKLYKSAAPQTGTLAS
                     QQQYTCDNGGTATIDYSYDSNTRTASATITFDNCGNTCSLNKYVIFNGTMRFSGKDIN
                     QNYILESGSISVDSGFSYTDQCENEGVYFEGNFSISVKGYIPNTGDIEDGNNNYKADL
                     TLDGGPVKVTDGSKWERGSFDNLTFYINEYYPASADYEWKVNGGFRYQDSYCVTDPVY
                     LSFNTTNIFKGYNTVECEYTGRLSVNNDLIVAESYDPDSKPSETENYLKILFNGNVVF
                     DNLCTNFNPPDTCS"
     gene            complement(12951..13616)
                     /locus_tag="AQ_RS08760"
                     /old_locus_tag="aq_aa18"
     CDS             complement(12951..13616)
                     /locus_tag="AQ_RS08760"
                     /old_locus_tag="aq_aa18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S8 family serine peptidase"
                     /protein_id="WP_010890555.1"
                     /translation="MDSGKDTNGYERVWETNCGAMNSGLIMWVISGSGSFSDHYERDP
                     TGGITFTVTNPGTSKRVITVGAFASRPLDTQSFYNAGRIAYFSSRGPTRNGRIKPNIV
                     AGGYFICSTNSEFSSHSDPYICAEGHYYVPFAGTSMATAVVMGLVALYLQDHSFAIPE
                     EVKEWFSSNAVEDDNFLYPNVVYCSEKAVYVLETRFKGSGKTSEQKLRRVTFSYRLAE
                     MGL"
     gene            14070..14231
                     /locus_tag="AQ_RS08765"
     CDS             14070..14231
                     /locus_tag="AQ_RS08765"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930897.1"
                     /translation="MFKLDSFLKVILLIVGVALTTAFAGLTIIFYRKAIDLLEELEKL
                     EKNNEAKNV"
     gene            14360..14563
                     /locus_tag="AQ_RS08770"
     CDS             14360..14563
                     /locus_tag="AQ_RS08770"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930898.1"
                     /translation="MRLKRETLKETGKLFYDLSKISAGLGLLLPFLKGENVSIFSALI
                     ALFSSLVFFVIGLILINKGAEND"
     gene            complement(14803..15075)
                     /locus_tag="AQ_RS08775"
     CDS             complement(14803..15075)
                     /locus_tag="AQ_RS08775"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930899.1"
                     /translation="MGFLKTEAVSRTIQMLYLQLKGEERKTVSGAIVPFSEYQKTQEQ
                     LQKAIYKLGELEGRLKEKDELIRELQERIKKLEAKPQKRWWEFWRR"
     gene            complement(15620..15958)
                     /locus_tag="AQ_RS08780"
                     /old_locus_tag="aq_aa19"
     CDS             complement(15620..15958)
                     /locus_tag="AQ_RS08780"
                     /old_locus_tag="aq_aa19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890556.1"
                     /translation="MERIRMKTLEKSLEDSLKIYVSEALYTDIEDFKVDYPTALDFEL
                     TQVLLIREDLAKNKENIPQQLLDEIRQADKRYLDLYEQVKDLKTKNPHIQVAIKVLKA
                     LVELIKTEPI"
     gene            complement(15894..16100)
                     /locus_tag="AQ_RS08785"
     CDS             complement(15894..16100)
                     /locus_tag="AQ_RS08785"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930900.1"
                     /translation="MSLTAETQTKNLRKVLNAYTMYVDVLERGAKNWDDFELVTGSGF
                     RMILGKNKNENFRKELRRLLEDLR"
     gene            complement(16475..17431)
                     /locus_tag="AQ_RS08790"
                     /old_locus_tag="aq_aa20"
     CDS             complement(16475..17431)
                     /locus_tag="AQ_RS08790"
                     /old_locus_tag="aq_aa20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_010890557.1"
                     /translation="MRLSEYKRSNSAQNFDEFFRKGYVSILYGDSGVGKTTISLYLCL
                     LAGAGKNLFHNLLKVKEPKKVAYISLELYKEDILEKLEPIRKRYRISTSEMEIMDLDD
                     ISDYRSFEKILEQKRYDFVVVDSFVAFYEGKSIYDPVEVKEFIKKTRKLARNSESHIM
                     FIHHTIKSSGKNKTDRYQGVSTIKFLTTPFMQAYTEGKSFRVLTIEKHNFAYPFEKIY
                     YYINKNGAITWYINEKAKYEEILHKFEPILKHLKDREYGMKTDELLNLSGLKKRTFYA
                     HLNKLEEMGIIEWHHKGSKVSRVSISKRFKFILKRNNKFKRE"
     gene            17567..18208
                     /locus_tag="AQ_RS08795"
                     /old_locus_tag="aq_aa21"
     CDS             17567..18208
                     /locus_tag="AQ_RS08795"
                     /old_locus_tag="aq_aa21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890558.1"
                     /translation="MKELTLLKKIKGGKEMNEYYERMEELFKREFAKEYLELAEQYYG
                     IEESYYEEEQKLDEEEREITDWTGQIDEVYSNITIDEDWLFEKLIKRIELGGKVYTLF
                     VEPYNSLLHRKPIVVVLKPLKGSKKLEEIVAKAYYSRFYWMEDPFYRDILLSRAYEAE
                     NTIKEDPEKFEEFVKMAEVLKEHEDRFLNIENIGIKFVEKNLSEFTLGFDLEE"
     gene            18282..18800
                     /locus_tag="AQ_RS08800"
                     /old_locus_tag="aq_aa22"
     CDS             18282..18800
                     /locus_tag="AQ_RS08800"
                     /old_locus_tag="aq_aa22"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890559.1"
                     /translation="MDIKLDKNVVKMVMSSKEEELMPSIGWEGKKEIPVLITNVETKI
                     PKGHPVIFKMVPIDEGKVTAVFIFLTVGEQLWTVFNPANTYYRLFLKAMTEADKLAIC
                     FPNKKAISIKTTEEMKKAARILLDTIEEFQWDSEEFAEALEKIAENYTLEDIEMIAVQ
                     EWKKRTGQEKEN"
     gene            18855..19670
                     /locus_tag="AQ_RS08805"
                     /old_locus_tag="aq_aa23"
     CDS             18855..19670
                     /locus_tag="AQ_RS08805"
                     /old_locus_tag="aq_aa23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890560.1"
                     /translation="MNSKELTKEVLNLFQTLPEFYFEHFHEYGIWFPIVVGIIASAVG
                     MFGMLLFYAAEPDTEFEKLPFFVRKIASREGDEDTYFALGIYPIIILPAEGKIIKAAA
                     IHEFFHVLFKFPWVIFQPVTGIFMTQLPYRFFNMLTQFLYTVLPKHIVLMLILLSMPI
                     LKKFGMEKSQVYELLSLASKYITFVYICALAAVIEELLVNIATAIYFLITFKFNENTF
                     LVTVGSSLTYLSNIPMIFACMWMDFHYADGQGVEMAKKFIELVFKTELSSLFF"
     gene            complement(19683..20048)
                     /locus_tag="AQ_RS08810"
                     /old_locus_tag="aq_aa24"
     CDS             complement(19683..20048)
                     /locus_tag="AQ_RS08810"
                     /old_locus_tag="aq_aa24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890561.1"
                     /translation="MWIACNLKGVPTFVWLSAKKSSHVAKLVLYNSKGYVFVTDKGPW
                     YRKACRELNCGWIHETFGGRNVVERWFKHIKQRMKGFHKRFPHNAKYETVGLDLPLLF
                     SLDHSTPLTLNLAISKFWK"
     gene            complement(20296..20556)
                     /locus_tag="AQ_RS08815"
     CDS             complement(20296..20556)
                     /locus_tag="AQ_RS08815"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930901.1"
                     /translation="MNKEEYVKEKIKFLTELLKLFWITIIAIGGGTISLLLNLDNKIK
                     VFLLFVGAFTEIILISLTLRLLIKIEDYIELLSKLNNKEADK"
     gene            complement(20690..21104)
                     /locus_tag="AQ_RS08820"
                     /pseudo
     CDS             complement(20690..21104)
                     /locus_tag="AQ_RS08820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003870451.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system VapC family
                     toxin"
     gene            complement(21067..21315)
                     /locus_tag="AQ_RS08825"
     CDS             complement(21067..21315)
                     /locus_tag="AQ_RS08825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008287623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB/MazE/SpoVT family DNA-binding
                     domain-containing protein"
                     /protein_id="WP_164930902.1"
                     /translation="MKIAKLTKKGQITIPAEYRKLLGTDIVEITYEKGKVIIKPVKKL
                     GGILHKYATRDRSIEEIMKTEKEAIGDGLAERGKRDNC"
     gene            complement(21417..21566)
                     /locus_tag="AQ_RS08830"
     CDS             complement(21417..21566)
                     /locus_tag="AQ_RS08830"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930903.1"
                     /translation="MGIKLTEEQKEIIKAFKNEERMKINAYAGTPIYLFSYTLILAVS
                     NKQHS"
     gene            complement(21713..22333)
                     /locus_tag="AQ_RS08835"
                     /old_locus_tag="aq_aa25"
     CDS             complement(21713..22333)
                     /locus_tag="AQ_RS08835"
                     /old_locus_tag="aq_aa25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyl transferase AbiEii/AbiGii toxin
                     family protein"
                     /protein_id="WP_010890562.1"
                     /translation="MRKLKKEQREALEKVVSLGICNDFYLAGGTALLIRYGHRFSDDF
                     DFFTFPEKPFDSFSISRQIDKLSRVRWLYQSKDTLIFLLDGIKFSFFEYRYPLLENPE
                     KNNDLGIFIAGDKDIACMKAVAIAQRGSKKDFYDLWFLMRKHGWDLKELEKLVKKKYR
                     NIDFSIIVKSLVYFEDAREEVYEDIEPYWEEVEEFFKRKVKEYLEN"
     gene            complement(22269..22523)
                     /locus_tag="AQ_RS08840"
     CDS             complement(22269..22523)
                     /locus_tag="AQ_RS08840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008287502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930917.1"
                     /translation="MEMFNWDKVKSERELLIREMLYGNVKEVLKKYPRKKLREAFLKN
                     LHRFDAKNRAFWKLALNISDEEVKERTERGFRKSSFFRDL"
     gene            22680..22904
                     /locus_tag="AQ_RS08845"
     CDS             22680..22904
                     /locus_tag="AQ_RS08845"
                     /inference="COORDINATES: protein motif:HMM:NF013561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribbon-helix-helix protein, CopG family"
                     /protein_id="WP_164930904.1"
                     /translation="MKRTTIFINEETKQKIKLIAKKKQKSMAEIIREAINEYIVKHKK
                     NKKYSFIGLGKSKRSDISEIHEEKLWKYSQ"
     gene            complement(23621..23869)
                     /locus_tag="AQ_RS08850"
     CDS             complement(23621..23869)
                     /locus_tag="AQ_RS08850"
                     /inference="COORDINATES: protein motif:HMM:NF021613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930918.1"
                     /translation="MLIQKFWEEIIKADRIVSYNGYKFDGYIMKIRSILHDIDIPMKF
                     LKDRTFHIDLLQFLSEGDTKRNINLNLYVVSLEFLHQF"
     gene            complement(23958..24209)
                     /locus_tag="AQ_RS08855"
     CDS             complement(23958..24209)
                     /locus_tag="AQ_RS08855"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930905.1"
                     /translation="MKVIVFDIETVPDKRNITYDDYLYIQKRGKREKTQEDIEREFSF
                     NPFTLILVSFSTVLIEDSDNKRRKSSISFRSNKPERQKN"
     gene            complement(24247..24828)
                     /locus_tag="AQ_RS08860"
                     /old_locus_tag="aq_aa26"
     CDS             complement(24247..24828)
                     /locus_tag="AQ_RS08860"
                     /old_locus_tag="aq_aa26"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890563.1"
                     /translation="MSGDSGVKRGAMLTSNLFDLTGERQIFRRACFLPFEVQISSKKS
                     VNKLLGKANNSLFLKFLKCVNPEKIELKEEDPLYFSRDFLLNEGIPVPENYYGNFERA
                     MLKGWKKLYLTSPEKFEEVRYYHKQDQKKLVPCYKVQIKDAGYLTPLEEFDNGFLQDS
                     YLILKEEFLKTIGVSEKRNIFTSLFSVIRISKR"
     gene            complement(24782..25561)
                     /locus_tag="AQ_RS08865"
                     /old_locus_tag="aq_aa27"
     CDS             complement(24782..25561)
                     /locus_tag="AQ_RS08865"
                     /old_locus_tag="aq_aa27"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890564.1"
                     /translation="MIKEFEKNEKVKNVVLNYYYTKVINSPIFNEAQKSLVRKKAVEE
                     SAEMFQKLAEKKKEILISPQKIQEILKNKREDKDEKVNVAVCDGEIFYNGKSVVEISI
                     PEESVKKTVIAIKDYIELSTETSEEHRFLTGEAIIFSFYSVFLKEVREKATELMKDIN
                     KFPVFSLLIGTPKAGKTTLLNFIAKLLGTEKIYYGKLKETRNSKANTFEAILYIDNRM
                     PVLIDEVPPEHLRDKRALGSKLKAKGIEWRLGSKKRSYVNQ"
     gene            complement(25741..26196)
                     /locus_tag="AQ_RS08870"
                     /old_locus_tag="aq_aa28"
     CDS             complement(25741..26196)
                     /locus_tag="AQ_RS08870"
                     /old_locus_tag="aq_aa28"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890565.1"
                     /translation="MGGIMNKQLFSEEPEKDTKKPILSIGEEEIKLLYDIPGKYLRQF
                     NRIKAITFSSLKSILDLLKDYREVEILIGLEEQGRELYNLEVIVEKFLKEGEEISKQA
                     MFKDFSVYYIPNCHTKLYILESEERKIVVAGSGNLSSLAWRGPQEEFFL"
     gene            complement(26335..27090)
                     /locus_tag="AQ_RS08875"
                     /old_locus_tag="aq_aa29"
     CDS             complement(26335..27090)
                     /locus_tag="AQ_RS08875"
                     /old_locus_tag="aq_aa29"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_164930906.1"
                     /translation="MEELIKEAGYPSLVSGNSHQARENRSKLSQNIKPSLRLTSLSKK
                     TLVNLIESLNAGSKEIQEITTYLKETYGENSLSNQTTVFDAINSGLESEKRVIIFNFR
                     NITHPQTRINIAGLIMEELFTRNKKQPSKRFLVLEEAHNFAPEKGFGDVSAGKENLSL
                     TFARKIASEGRKFNLGLMVITQRPAQVSKYILSQLNTQVMFRTINASDIDTVSTFVEF
                     AGSDIANILPKLPTGKGIVSGTGVPFPLLVEVV"
     gene            complement(27142..27954)
                     /locus_tag="AQ_RS08880"
                     /old_locus_tag="aq_aa31"
     CDS             complement(27142..27954)
                     /locus_tag="AQ_RS08880"
                     /old_locus_tag="aq_aa31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF87 domain-containing protein"
                     /protein_id="WP_010890567.1"
                     /translation="MSTGNIEAGVYYESDGSDEHIKKLREYFEKIKEEYSESFGDDLL
                     GFTVNPVKPQSFEFILVGNDDIGLHSYVEVKLQEGIVLGKITSIFAYDMGFFANPFTS
                     QESSVFAPVEDFKTIFSKGKDDEWKKAAIYAYLNNNGNKLKIATADVIGILKDGKLDI
                     LRNPFHVGEPVYKISEKTLGKILKKNFSGRDMEVPVKVGVIENSDIDVFVDANEVISK
                     HMLVLGTTGSGKSYFTKRFISSLLESDKEVEVYVLDPHGEYFNDLKSYIDEN"
     gene            complement(27956..28267)
                     /locus_tag="AQ_RS08885"
     CDS             complement(27956..28267)
                     /locus_tag="AQ_RS08885"
                     /inference="COORDINATES: protein motif:HMM:NF024491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930919.1"
                     /translation="MYKKILEITKEAKESIKIASAWIKGSIFEEILNIAKSKNISPEI
                     ILRASELRDFLITNDRVFRNIKDINGKIYLCNRLHAKFIIVDNKRAVVGSANFTGCRI
                     I"
     gene            complement(28405..28995)
                     /locus_tag="AQ_RS08890"
                     /old_locus_tag="aq_aa32"
     CDS             complement(28405..28995)
                     /locus_tag="AQ_RS08890"
                     /old_locus_tag="aq_aa32"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890568.1"
                     /translation="MYFDSWTCEALENLPDYFKHILDEVAQINLYKMKENRKHFRKND
                     YGFEQAMVTYLAEKFIRNIRNLPNNLELGIAETLTKTKLESNKQPDFSLVKKDDGTVI
                     EVMEVKTIIDNNFSWLREDVCKLRELDEVQNKFLLSINLYISRSAYTQTIKRLSKFME
                     NDKNNSLSILCHGLLYRSRHGVQNFQLTYYYYLFKI"
     gene            complement(29079..29318)
                     /locus_tag="AQ_RS08895"
     CDS             complement(29079..29318)
                     /locus_tag="AQ_RS08895"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930907.1"
                     /translation="MRSSRKCITPFLFKEIKLKNSIISIVDQPVRAIRIERRDGTYFL
                     PIKEFLEGKKFLEGLSKEEKKVLTILKNTLQNYVI"
     gene            complement(29330..29548)
                     /locus_tag="AQ_RS08900"
     CDS             complement(29330..29548)
                     /locus_tag="AQ_RS08900"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930908.1"
                     /translation="MPAIRIQGYLTSTQVLRELKERGIEISDRTLIRYVKRGFIPGEL
                     VRIKRRGLVNYYYFKPEVVDFLVQELSV"
     gene            30009..30965
                     /locus_tag="AQ_RS08905"
                     /old_locus_tag="aq_aa34"
     CDS             30009..30965
                     /locus_tag="AQ_RS08905"
                     /old_locus_tag="aq_aa34"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890569.1"
                     /translation="MLEVEKKIKQKLGIDETEVLSSLTSYRKKGKTYYKIVTYDSKTK
                     QSRRYHVPRMFEEEILALWKQRQKYIEEERELEREVKSLLKKYGDAEKIKEILEKVAG
                     ESFDKAVSSYAIKTYTNKAKELFKSFKEDLIKLYREGVLKRLSVLQVLYLLANLKEIS
                     EDTERGSYFFKKGLNTIIKVAKNERIPNPFGTLKNDFFLSGKQTPYDFLLSNFLEELI
                     GETLGELLEKEIEKLVAEEKAKEIEGKVKKLKEIVSWFETLPYEIKQIAKEVISDNVL
                     DIAEKFYKDMKECNYSLDEAKAFLTSSPRDNLVNYMQYLKSI"
     gene            complement(30971..31174)
                     /locus_tag="AQ_RS08910"
     CDS             complement(30971..31174)
                     /locus_tag="AQ_RS08910"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930909.1"
                     /translation="MAIPKKPSKKPEEFIASAKIKEGEEKPQVKKLLIELPYDVWFSL
                     KMRALKEGKTLKDLITEILSENA"
     gene            complement(31205..31846)
                     /locus_tag="AQ_RS08915"
                     /old_locus_tag="aq_aa35"
     CDS             complement(31205..31846)
                     /locus_tag="AQ_RS08915"
                     /old_locus_tag="aq_aa35"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018703623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_010890570.1"
                     /translation="MKVIVVGNQKGGVGKSTVACNLAVGYSLRGKSVLLIDADIQESS
                     LNFRALREKDDIKAIGITKPTIHKDIKGFENFDVVVIDVGGRDSAVFRSAILAASNGA
                     LIIPVLPSVYDVWATEDTLKVLQEARTFADIPAYILFNQVIKSNIVKEAEETLRELAQ
                     QYSVGVLNSRLHSRVVYRNSVKEGKGVLEMNDKKAIEELESLINEISNIINIA"
     gene            32065..32223
                     /locus_tag="AQ_RS08920"
     CDS             32065..32223
                     /locus_tag="AQ_RS08920"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930910.1"
                     /translation="MRIFKKKIIKTLLGHILVRRKKRKNLTDLVGAIKGGDSFNAVED
                     KHKLYQVC"
     gene            complement(32633..33070)
                     /locus_tag="AQ_RS08925"
     CDS             complement(32633..33070)
                     /locus_tag="AQ_RS08925"
                     /inference="COORDINATES: protein motif:HMM:NF013970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PIN domain-containing protein"
                     /protein_id="WP_164930911.1"
                     /translation="MKKEVLIDTNLLGYFFGIDKDEIKQKFLQEYISGLLHNGWKIYI
                     SSQVCKELARISHEKYSLPFEEVDSIIKGISKMFNILYEDCEDLRVAIFLRERYYLQF
                     WDAVIIASALNNNIPIVLSEDTPYKEVELFNKKVRLLNPFSET"
     gene            33210..33650
                     /locus_tag="AQ_RS08930"
                     /old_locus_tag="aq_aa37"
     CDS             33210..33650
                     /locus_tag="AQ_RS08930"
                     /old_locus_tag="aq_aa37"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890571.1"
                     /translation="MAFHILPTFERGNEKGAVIGRVKHRRENPLEYEIKVVKKGSVKV
                     FVGNKGVFVIEDDLAKEIIKALWEKYVRETYGRRKPKTNKEIVEHPIEVRESFLINFF
                     KEKGFITSFKSCMYLIEGTSSDESTIKDLILLTKKIKEKVTKTT"
     gene            33892..34854
                     /locus_tag="AQ_RS08935"
                     /old_locus_tag="aq_aa38"
     CDS             33892..34854
                     /locus_tag="AQ_RS08935"
                     /old_locus_tag="aq_aa38"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fic family protein"
                     /protein_id="WP_010890572.1"
                     /translation="MTYQNGVEVLLEEFLDYLTKEETICSLEIEKLKVSIDELEKETD
                     EPRVLQGINYFRTAKEVYQLSRKAYETKEEVVSEALILWIYENLWKGFNVPKGYRKSD
                     MVIFGAKFSPPPPYVVPNLIRTIVNWLRNEKTIDVVKKSIIFHTLFEVIHPFPDGNGR
                     VGRILLNAILVENGLLNVAFRNREKYISALREAEEGAIVVVEKLSRGRKIDYSSITET
                     VEYYGNLNVFDELIRTEMMHSLKVYSNIKQVFLTPEEAAKLLGLKNKDYVRVLIHRGK
                     LKAVKEEGKWKIPLSEVVKNFEHKLKGEEFKLANNLFKGKLSPS"
     gene            complement(35238..35933)
                     /locus_tag="AQ_RS08940"
                     /old_locus_tag="aq_aa39"
     CDS             complement(35238..35933)
                     /locus_tag="AQ_RS08940"
                     /old_locus_tag="aq_aa39"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010890573.1"
                     /translation="MDGKKREVENGKNGNNIKDGNSSNTTNYGKDTKTTQTIKDVKDV
                     KSVKKAFKELQEWLREKMKKEGLVRFMKDGYPLEFVEEDVVYFLGSRKRPNLKDFIKG
                     ITLVRTYAKLRERRKQFHKRSKKPIVKKYSAPKYTRVVAYMYRVLEEKGYTPDDRKRL
                     IVYFFNFIKPDYMSNAGIYVCLEKFRTAKFLRNKKIEELRKELIKEIPPHLFLQIEAF
                     LSLFPTFKRKKAT"
     gene            36344..36496
                     /locus_tag="AQ_RS08945"
     CDS             36344..36496
                     /locus_tag="AQ_RS08945"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930912.1"
                     /translation="MSTLIKYSPYFLAYMVKLLGEEPKVVISDLPLVLKDKKEQYKEV
                     LKSVLR"
     gene            complement(37072..38037)
                     /locus_tag="AQ_RS08950"
                     /old_locus_tag="aq_aa40"
     CDS             complement(37072..38037)
                     /locus_tag="AQ_RS08950"
                     /old_locus_tag="aq_aa40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS5-like element ISAae1 family transposase"
                     /protein_id="WP_010880899.1"
                     /translation="MTQWKRRSRRKGMRTRNNKQLIKLILTKSREICNTIRPSQYNKR
                     GRPRVYEDHLIVAALLIKILENLSLRDLEERLKDLFPKVPDFTTLHYRFRKLNRGYLK
                     ELIHRTAKEIMEKLQAKEFYCLIADGTGFGYAQAYELKWKKGKELRNVKSHVKTEVLV
                     GVVRNKAIVVDINTGKSYADENMLLRSMLKELGFRARYFLGDAYYGKSAGVLEEIKKL
                     RMESIVPVRDTAHTRVRNMYRLWAKRNYEIRRKVYRKNRYRVEQVIGIVKNRFGDRDN
                     VYDFEIASLYVLGRFVLYNLILLLKLLLLCLNLLRITWASSRFIL"
     gene            38152..38400
                     /locus_tag="AQ_RS08955"
     CDS             38152..38400
                     /locus_tag="AQ_RS08955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008287623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB/MazE/SpoVT family DNA-binding
                     domain-containing protein"
                     /protein_id="WP_164930913.1"
                     /translation="MKIAKLTKKGQFTIPTGYRKLLGTYIVEITYEKGKVIIKPAKKL
                     GGILHKYAIRDRSIEEIMKTEKEAIGDGLAERGKRDNC"
     gene            38363..38777
                     /locus_tag="AQ_RS08960"
                     /pseudo
     CDS             38363..38777
                     /locus_tag="AQ_RS08960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003870451.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system VapC family
                     toxin"
     gene            39209..39364
                     /locus_tag="AQ_RS08965"
     CDS             39209..39364
                     /locus_tag="AQ_RS08965"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164930914.1"
                     /translation="MNIQMGKAGLAVVFDKLQEGEFFENEGEGEKEYVWVEKWKGAIV
                     LREDTVL"
CONTIG      join(AE000667.1:1..39456)
//
DBGET integrated database retrieval system