GenomeNet

Database: RefSeq
Entry: NC_001905
LinkDB: NC_001905
Original site: NC_001905 
LOCUS       NC_001905             268986 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 1.
ACCESSION   NC_001905 AE001274
VERSION     NC_001905.3
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 268986)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 268986)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796397.
            On Jun 1, 2012 this sequence version replaced NC_001905.2.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..268986
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="1"
     gene            complement(<3704..>4702)
                     /locus_tag="LMJF_01_0010"
                     /db_xref="GeneID:12983155"
     mRNA            complement(<3704..>4702)
                     /locus_tag="LMJF_01_0010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721473.1"
                     /db_xref="GeneID:12983155"
     CDS             complement(3704..4702)
                     /locus_tag="LMJF_01_0010"
                     /note="previous protein_id=AAC24613.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721521.1"
                     /db_xref="GeneID:12983155"
                     /db_xref="InterPro:IPR021333"
                     /db_xref="UniProtKB/TrEMBL:E9ABZ0"
                     /translation="MRCALVFVLVVAVLACFAPAMTHAYSTTYTARSAGSGAFAFDPL
                     EIDFCKLQDAGSHTAMSTSASIQEALESAYQREGIRGNIPLGGMTEQAVCAGTQCEWR
                     WYRGLFRTTRPLFLRGVNYWGVNDDATPVDRTTAVSGSYTNFETNYPRSWGNLSYWGK
                     RLVVMQPSGKWVNTEVSTSFTNFLCEYYVYADSDGVNRLVPTFPGGSAIPFVSSSGHT
                     YKYCGKKVEVDSQSRWILPKCNETFPWWGGLLIAVVLYIILIALIISIWCCCCIRRRN
                     KEEKRRRNIIGSQYDNQGAIPTQSELGLSRHNSFRGTSMYNSDDTDSDADAYSSRE"
     gene            complement(<5790..>7439)
                     /locus_tag="LMJF_01_0020"
                     /db_xref="GeneID:12983095"
     mRNA            complement(<5790..>7439)
                     /locus_tag="LMJF_01_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721474.1"
                     /db_xref="GeneID:12983095"
     CDS             complement(5790..7439)
                     /locus_tag="LMJF_01_0020"
                     /note="previous protein_id=AAC24614.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721522.1"
                     /db_xref="GeneID:12983095"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:E9ABZ1"
                     /translation="MLRRCSVLLNDPPLVSGGPVVGLMRDTGTRTTIRPSIMDAQIAQ
                     SALEVKMSSLLAREMQAEKMEAEREPPLKRKWVKAPVSQLSTSLSRRDWFRLMSFNMM
                     TDAWGPGHTTPVEAVRVRVPEFTRNPECDDPNACCDYDPSIDKEFPPFLTPEHRRKHL
                     VELLRCYDPDIACLNEVKRTFFNTELWRYVRFLGYGTLYQSSRGAQVRALRKGDNAAA
                     PSNQGKIAEEEDIGNVLLFHKGRFFPLMMPGRDIGQRFHFAHFVGMRDKVTNMTLYVA
                     CVQLTAGATAEAADVRLHEARQVLTILDALGRNDADRSHQSHIVCGDLNNQADDEPCV
                     ELLRDRFFSTHDLVGGPRWTAWHYRDDARAAAYDTYYTKNVEQAHRSDKAYQAEEEIH
                     RFRRKDAGGYHGVFSKVRLVRDEIAARAHKKQQQQLTTPKTAPEVATPPPADTVAAAP
                     APSPASAPAPSDTAVRVDQLALLKESRKAKGITYNTQDFIFYDPSTLALHQVLDVPED
                     EEVNEAQLFPNHKLPSHHLPLFIDISWIDSFPDVAARTLKE"
     gene            complement(<9061..>11067)
                     /locus_tag="LMJF_01_0030"
                     /db_xref="GeneID:12983096"
     mRNA            complement(<9061..>11067)
                     /locus_tag="LMJF_01_0030"
                     /product="putative MCAK-like kinesin"
                     /transcript_id="XM_003721475.1"
                     /db_xref="GeneID:12983096"
     CDS             complement(9061..11067)
                     /locus_tag="LMJF_01_0030"
                     /note="previous protein_id=AAC24615.1"
                     /codon_start=1
                     /product="putative MCAK-like kinesin"
                     /protein_id="XP_003721523.1"
                     /db_xref="GeneID:12983096"
                     /db_xref="GOA:E9ABZ2"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9ABZ2"
                     /translation="MMSAEPPSSQPYISDVLRRYQLERFQCAFASSMTIKDLLALQPE
                     DFNRYGVVEAMDILRLRDAIEYIKANPLPASRSGSDVLDNDGDGDGEGDDSTPEGKEG
                     CSTERRRQYTARGTTVLCRSTDTAEEVKRKSRILVAIRKRPLSAGEQTNGFTDIMDAD
                     NSGEIVLKEPKVKVDLRKYTHVHRFFFDEVFDEACDNVDVYNRAARALIDTVFDGGCA
                     TCFAYGQTGSGKTHTMLGKGPEPGLYALAAKDMFDRLTSDTRIVVSFYEIYSGKLFDL
                     LNGRRPLRALEDDKGRVNIRGLTEHCSTSVEDLMTIIDQGSGVRSCGSTGANDTSSRS
                     HAILEIKLKAKRTSKQSGKFTFIDLAGSERGADTVDCARQTRLEGAEINKSLLALKEC
                     IRFLDQNRKHVPFRGSKLTEVLRDSFIGNCRTVMIGAVSPSNNNAEHTLNTLRYADRV
                     KELKRNATERRTVCMPDDQEEAFFDTTESRPPSRRTTTRLSTAAPLFSGSSTAAPALR
                     STLLSSRSVNTLSPSSQAKSTLVTPKPPSRDRTPDMVCTKRPRDSDRSGEDEVVARPS
                     GRPSFKRFESGAELVAAQRSRVIDQYNAYLETDMNCIKEEYQVKYDAEQMNANTRSFV
                     ERARLLVSEKRRAMESFLTQLEELDKIAQQVADITAFQQHLPPT"
     gene            complement(<12073..>12642)
                     /locus_tag="LMJF_01_0040"
                     /db_xref="GeneID:12983097"
     mRNA            complement(<12073..>12642)
                     /locus_tag="LMJF_01_0040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721476.1"
                     /db_xref="GeneID:12983097"
     CDS             complement(12073..12642)
                     /locus_tag="LMJF_01_0040"
                     /note="previous protein_id=AAC24616.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721524.1"
                     /db_xref="GeneID:12983097"
                     /db_xref="InterPro:IPR003169"
                     /db_xref="UniProtKB/TrEMBL:E9ABZ3"
                     /translation="MKRARSPSADSTVSASAPSAASLSSTAVFDRSPSSSSSLSAVEE
                     NEEPTARPLLSILEPVLAQLKEGELFADALRRYSKENAAAFEALAQLHQEAMAQHEFV
                     MMRMTREAILLRALEEARRTSTTLPHVWMMRWKAKPTVQHGPFTDDAIQQWGRDGYFG
                     KKEAELRDINGVGKSWRPALSVAHGPCVA"
     gene            complement(<15025..>17022)
                     /locus_tag="LMJF_01_0050"
                     /db_xref="GeneID:12983098"
     mRNA            complement(<15025..>17022)
                     /locus_tag="LMJF_01_0050"
                     /product="putative carboxylase"
                     /transcript_id="XM_003721477.1"
                     /db_xref="GeneID:12983098"
     CDS             complement(15025..17022)
                     /locus_tag="LMJF_01_0050"
                     /EC_number="6.4.-.-"
                     /note="previous protein_id=AAC24617.1"
                     /codon_start=1
                     /product="putative carboxylase"
                     /protein_id="XP_003721525.1"
                     /db_xref="GeneID:12983098"
                     /db_xref="GOA:E9ABZ4"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:E9ABZ4"
                     /translation="MPAPIFDKVLVANRGEIACRVMATCQRLGIKTVAVYSTADEQAK
                     HVKVADEGVCIGPPASVESYLCIDKIVDACKKTGAQAVHPGYGFLSENGEFQAALHKN
                     NIIFVGPDAHSIEAMGDKIESKRLAHSAGVTCIPGFIGEVKTHEDVLKFAREVGYPVM
                     IKASGGGGGKGMRVAYNDSQCVEYYDMCREEAKAAFNSDKMLVEKFIENPRHIEIQVI
                     ADRRGNTLYLPERECSIQRRNQKVIEEAPSVLLDAKTRKAMGEEAVAMARAVQYVSAG
                     TVENVVNPQKQFYFLEMNTRLQVEHPITEEITGIDLVEQMLRAAADLPLSITQDDIKI
                     NGHATECRVYAEDPMKNYFPSIGRLTMYQEPTGPGVRCDSGIIEGSQISVYYDPLICK
                     LSTWGKDRAACIERMEKALDEYVIRGLRHNICLLRDVVTEPRYQSGNLTTNYLPEQYP
                     NGFKKAELTAEETQLMYEAAACMHLKRERTHYTQGIAPSERQFYVSVGARQEGEMPVY
                     VQQLDDSHFEVAASKSGPFKKLEMAWKVSYPIIRVNDGEKETVLQFWGTNEVTYGIQM
                     KGTTFDVNVMSDLQSVLGHFVPAVEITVNTKQILSPMPGVIVAIKVQPGQTVVAGEEL
                     LTLEAMKMRNKIHAQADGKVKEIKVTLGATVEDSEVLVELE"
     gene            complement(<18137..>18886)
                     /locus_tag="LMJF_01_0060"
                     /db_xref="GeneID:12983099"
     mRNA            complement(<18137..>18886)
                     /locus_tag="LMJF_01_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721478.1"
                     /db_xref="GeneID:12983099"
     CDS             complement(18137..18886)
                     /locus_tag="LMJF_01_0060"
                     /note="previous protein_id=AAC24618.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721526.1"
                     /db_xref="GeneID:12983099"
                     /db_xref="UniProtKB/TrEMBL:E9ABZ5"
                     /translation="MRRLPLFCRRPSRCCGATASGSGSSSAAVLAASAAPSVLVLAAR
                     GIATSGRVTNEDRRWWLVHLECAPDVTPGTFVSWLDCCGTHTTKKLIERNIWTIEQVA
                     ELDSDRVDELKYKEGCLKMDVVWEHARTIITPLKQREVSGGVESQLQSRILELRKKRE
                     LERQRELLARERATVSDKREETLRRLRESVAAKKAALRKKLDEQHGEATPAASESAST
                     EAHRGTAEAAVEDEAVGNIVDRMSGGNPPRA"
     gene            complement(<19951..>21747)
                     /locus_tag="LMJF_01_0070"
                     /db_xref="GeneID:12983100"
     mRNA            complement(<19951..>21747)
                     /locus_tag="LMJF_01_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721479.1"
                     /db_xref="GeneID:12983100"
     CDS             complement(19951..21747)
                     /locus_tag="LMJF_01_0070"
                     /note="previous protein_id=AAC24619.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721527.1"
                     /db_xref="GeneID:12983100"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="UniProtKB/TrEMBL:E9ABZ6"
                     /translation="MSSAEFLRNVDARTTIYRWEAAGLDELNRQNKLSSLPFWIPNST
                     TRHHQFRVVLLRGLVQTATPASDPFGVLVELIAPPPPAVRTANVPAASDAVPSSSSSG
                     GCPGGCAVTCEVLPIDSVTPTAAEEKQRRRDDGTDAAQRKAITSTKMAVLDANNAQVS
                     FPDFIPAEVLHNTRYVRGAPKSFTLQITIETGISVPLHQAATTAFSFFSSLATSVGHL
                     LGNTAQLYHEGRESISSAILAPAASALTHPSALWNTTTSSPSATVAYVATAPTKTTAS
                     TAATLPPWEQPPEEWRDRVAEWHSLVSERLPGLGGTYRHGVEKALSPDEAGLLAEVGL
                     VEADLWALHSLFDFDRDVQEGLLASAEVRAHRYRLVPARLKEVTFWANYFWKVHCVGQ
                     CVTERQVAAVLVALCMPSRSVHANLSTPVEVLPHILDGEEAAAVVEDFVKRGEAAEPW
                     CTVAAETARHCRNVLDTASQRTDLAPNTRKHVESTLSSLEKVLLWYGNALEGPTDPPA
                     LSLDADTGAAAAAAASAAPLQMEKAQTPPRQQQQQQQQQREPSPTASPAAAVPPAVET
                     ATPSPRDDTSGGLRSVSQVAFMKMPWEEEDDV"
     gene            complement(<22613..>23326)
                     /locus_tag="LMJF_01_0080"
                     /db_xref="GeneID:12983101"
     mRNA            complement(<22613..>23326)
                     /locus_tag="LMJF_01_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721480.1"
                     /db_xref="GeneID:12983101"
     CDS             complement(22613..23326)
                     /locus_tag="LMJF_01_0080"
                     /note="previous protein_id=AAC24620.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721528.1"
                     /db_xref="GeneID:12983101"
                     /db_xref="UniProtKB/TrEMBL:E9ABZ7"
                     /translation="MPDASSTTVVAAPPAKERSGSSGGVLLPLTVAGAGLLCLWKAFQ
                     ICSVPVHPRCVTVVYDTRRKTVLCTSADREMRRGSLPRVSHFNVSMYFGSALMYWSGT
                     RLLVPPSSFFGVFTLPRSVLEEPGESVNCAVEEVAVRDGTVNMMVTVFYTIPFDQVER
                     YLAAVGPEPPNEVIGKAVAHIARVRCAEQSAGILLSKTRREAFMGPYKDHLTSKLMSE
                     AAVLVRDVAVENVVLLEGG"
     gene            complement(<24859..>25683)
                     /locus_tag="LMJF_01_0090"
                     /db_xref="GeneID:12983102"
     mRNA            complement(<24859..>25683)
                     /locus_tag="LMJF_01_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721481.1"
                     /db_xref="GeneID:12983102"
     CDS             complement(24859..25683)
                     /locus_tag="LMJF_01_0090"
                     /note="previous protein_id=AAC24621.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721529.1"
                     /db_xref="GeneID:12983102"
                     /db_xref="InterPro:IPR014505"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ABZ8"
                     /translation="MTTIAALARTLHGGANVYRSRLDCLKVLHAVEQSSPPPPWWTPD
                     CSNFVRQAEALSTSASATAARKNPVIVVEGLDGTGKTLVTRTLAEKLSGVAISTPPPQ
                     FTEIRNTFRGQEEAVARAFYSAANYIAAEGILAASQSSVVVVDRWWCSTCAMALANGC
                     LYDSLPPSGAAVYRWPEDLPAPDAGFLLCVDEAVRVARIRRRAPEDAEERRLSSQREM
                     RCVAMEAYRRTNMLIEVAAPSYRVAVNSILRLLPESGVTHCAAPFTQAELDSIEPF"
     gene            complement(<26405..>27361)
                     /locus_tag="LMJF_01_0100"
                     /db_xref="GeneID:12983103"
     mRNA            complement(<26405..>27361)
                     /locus_tag="LMJF_01_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721482.1"
                     /db_xref="GeneID:12983103"
     CDS             complement(26405..27361)
                     /locus_tag="LMJF_01_0100"
                     /note="previous protein_id=AAC24622.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721530.1"
                     /db_xref="GeneID:12983103"
                     /db_xref="GOA:E9ABZ9"
                     /db_xref="InterPro:IPR002516"
                     /db_xref="UniProtKB/TrEMBL:E9ABZ9"
                     /translation="MGNQLFLVANLLATAHRTGIPAYLEAVPFSSSAEDPRPTYWDTL
                     FRDLGHYGVQMCASSPPLPVVTVPETRPVRKVQLDAQRPCVFHMIGFFQSDAFFDDHP
                     IMSSVIPRELWDSAGKHLATYYGGGSCHTVALHVRRGDYTRFTDIFEQLDVVEYYDAA
                     VRQLLGGLLLQSPSLLRQQQSPVDSAQAPTAGAPPLLPLHLLVFCDEERFGRTVVGYF
                     RTKYKGAVMVSLVCAATEASAISARPTASSPSVPIMPRDVLELLMMSQCNDVVMANST
                     FSWWGAYLNRVSLRRVIAPSRWFVKDPYPASNHLYCPGWILI"
     gene            complement(<28521..>29108)
                     /locus_tag="LMJF_01_0110"
                     /db_xref="GeneID:12983104"
     mRNA            complement(<28521..>29108)
                     /locus_tag="LMJF_01_0110"
                     /product="glutaredoxin-like protein"
                     /transcript_id="XM_003721483.1"
                     /db_xref="GeneID:12983104"
     CDS             complement(28521..29108)
                     /locus_tag="LMJF_01_0110"
                     /note="previous protein_id=AAC24623.1"
                     /codon_start=1
                     /product="glutaredoxin-like protein"
                     /protein_id="XP_003721531.1"
                     /db_xref="GeneID:12983104"
                     /db_xref="GOA:E9AC00"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9AC00"
                     /translation="MLPFSYRVLMRGVSAVSGALSVALQHRALAGTTRSFSSSRPVWL
                     APAAPTKQAPPAMGGDTDAEETHPDFQPRMVSSDLAQDEIAMIKKDIDDTIRDEDVVV
                     FIKGVPEAPMCAFSKRMIDVMEALGVEYTSFDVLAHPVVRSYVKEVSEWPTIPQLFVK
                     GEFAGGVDIILKMAESGDLQMLLDQKSIKHRDTKP"
     gene            complement(<30278..>32251)
                     /locus_tag="LMJF_01_0120"
                     /db_xref="GeneID:12983105"
     mRNA            complement(<30278..>32251)
                     /locus_tag="LMJF_01_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721484.1"
                     /db_xref="GeneID:12983105"
     CDS             complement(30278..32251)
                     /locus_tag="LMJF_01_0120"
                     /note="previous protein_id=AAC24625.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721532.1"
                     /db_xref="GeneID:12983105"
                     /db_xref="UniProtKB/TrEMBL:E9AC01"
                     /translation="MHFASGPCSRHQRPQRENRYTVHYNVDGRAASSSTATLLPLRRY
                     SRARDISATLTAPVVEYRQPQWTMPLGKLIWTLSSVPNPTAAATGVERRSGGSRSGAP
                     HAHCIPSPCPAAFTAARTLSCLGGAAASAARATETTLRSSSKVMRQPFTSPYMESSPP
                     SAAAADQRDYEAEGSRVRGERPGGATATAGRHSSGSSPPPRSATSDRQSHRSRDIAQV
                     RPGCTTPMERVRYRSSVTRKLIDLYDEVAELYDCRENMRNQVTQAMRIDPRYCKERHG
                     EVRLACKPTLQQQSAVESVENALEGLHDAVHELVAAYLTQEEKRHLGIDTHLFQTSTE
                     KANTYQYAPPPPKPRSSSSNAARRARQKTSAAATFPHPSTRHREVRVEKEEGDAHENT
                     AATAPTPAAPTLTVPVDTPAPQQQPLTNTTTNKKISNSVWDSSAPAASAAFSSAAISL
                     PASSVKLAQQSVVELSQLAAPQQPVTSSSQPLCSSIVHVAAPEKHEDGSGTAAEQKPV
                     AASHTQDTEIAEGTPERVVASAVSASTLSVTWPTDTGAGSTLHLPTGSQPPLATERLL
                     KVPVSSPDALTPIAKTPPAIPPRPTSVQAQAQEPALTSANPTPPPSHPPSQDAVAASC
                     NDASAAKASASQARTAVVGFKRFLIDSDSNSSC"
     gene            complement(<33630..>34724)
                     /locus_tag="LMJF_01_0130"
                     /db_xref="GeneID:12983106"
     mRNA            complement(<33630..>34724)
                     /locus_tag="LMJF_01_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721485.1"
                     /db_xref="GeneID:12983106"
     CDS             complement(33630..34724)
                     /locus_tag="LMJF_01_0130"
                     /note="previous protein_id=AAC24624.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721533.1"
                     /db_xref="GeneID:12983106"
                     /db_xref="UniProtKB/TrEMBL:E9AC02"
                     /translation="MALTQSSGEPLRSMQGGVGGVSYADGAGQAPEHINRASATPVLT
                     EEAVQSSIETFEDAACVREEAVRSYAEFHNNVESLHATMHTQLRPVWRTAMQLRPEIL
                     SDVRDEWCLRRRDNIPDGIPIPAAAAQHIALQETILSEVEDMLQVLRNTSVRFAAHFL
                     SDEEKISMGANPAYLRAPDIDKEVVVSRSQSTSTSPQRALPASVMSVSSSAGAVASAP
                     IKPSASSAATAAVHTPREGHSRHHQGSYVQHHHHHSDDEAGLVSSSSNRHVCSGKSSC
                     GSRSAGEDPLLEELRKQYQLRIRELKAQSEAGASRRSEHGASQSAAAPPPRRGNRARV
                     AASRSLSLPSWASSASASVLTSSSSTVSRR"
     gene            complement(<36878..>37126)
                     /locus_tag="LMJF_01_0140"
                     /db_xref="GeneID:12983107"
     mRNA            complement(<36878..>37126)
                     /locus_tag="LMJF_01_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721486.1"
                     /db_xref="GeneID:12983107"
     CDS             complement(36878..37126)
                     /locus_tag="LMJF_01_0140"
                     /note="previous protein_id=AAC24691.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721534.1"
                     /db_xref="GeneID:12983107"
                     /db_xref="UniProtKB/TrEMBL:E9AC03"
                     /translation="MKITVHVREKIIPLQCGDGTQQVVWLGNAAMIHYDASFGKRFGP
                     PVSIRKEGGVQCDFEARVCDVLEDGQHVFVTLESDRGQ"
     gene            complement(<37714..>38064)
                     /locus_tag="LMJF_01_0150"
                     /db_xref="GeneID:12983108"
     mRNA            complement(<37714..>38064)
                     /locus_tag="LMJF_01_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721487.1"
                     /db_xref="GeneID:12983108"
     CDS             complement(37714..38064)
                     /locus_tag="LMJF_01_0150"
                     /note="previous protein_id=AAC24626.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721535.1"
                     /db_xref="GeneID:12983108"
                     /db_xref="UniProtKB/TrEMBL:E9AC04"
                     /translation="MVLPGVSHYERMPTRTKIQFFWISMLTMGFAYQFLKMTVLRVQP
                     KREEQMYMHIRKVYGDNIPEELLQRAKRQREAQDALTLTNMLRTPTPGQTSNALQNDL
                     DPRALIELKSWNGH"
     gene            complement(<38940..>39182)
                     /locus_tag="LMJF_01_0160"
                     /db_xref="GeneID:12983109"
     mRNA            complement(<38940..>39182)
                     /locus_tag="LMJF_01_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721488.1"
                     /db_xref="GeneID:12983109"
     CDS             complement(38940..39182)
                     /locus_tag="LMJF_01_0160"
                     /note="previous protein_id=AAZ09189.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721536.1"
                     /db_xref="GeneID:12983109"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:E9AC05"
                     /translation="MSVVLESLLHRSVCCHLAHGEEYRGQLEALDGTFDVVLSQCTRS
                     RAAPKQPAEPLVFLRGENIIYIGFDESSRGEDGTTA"
     gene            complement(<41273..>42649)
                     /locus_tag="LMJF_01_0170"
                     /db_xref="GeneID:12983110"
     mRNA            complement(<41273..>42649)
                     /locus_tag="LMJF_01_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721489.1"
                     /db_xref="GeneID:12983110"
     CDS             complement(41273..42649)
                     /locus_tag="LMJF_01_0170"
                     /note="previous protein_id=AAC24627.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721537.1"
                     /db_xref="GeneID:12983110"
                     /db_xref="UniProtKB/TrEMBL:E9AC06"
                     /translation="MGGCCGVASEAGTASSNGTVSSTPLSPPSHRRGWRGSTRSTTKT
                     EQAALKRSSRLESASSFLAKILQSKDRGDTDSAPLRGTVVNAVSSATPRKLRDSATHA
                     APAHDQDLPFKATLQHGANGSSPDLLLPDLFYISASSSSSLLANGDVDDKAEDGIGAR
                     LDGEGQSSLVEVSQPTQSFAGDVHTYSELDLTSEWEPPSFDCLGRRSERRGRSGTDRS
                     RLRQLIIREAEVRVSLRAMYTYQHQRFSLNLAKEHFIAVHIRMRQEYESEWTVQCICW
                     IVAVESVTREALAREWWAERAALVRRVGSLRTPPPPPPLQSVHDDARLGITAIRALKR
                     EDRPPYVSKLYTAADLTPSEEAAEGDLLNMCIPPMRASSSIALFSPPLQQQLSVLGGS
                     RSASAGVSRGLRSVPRVRAPHASSFVSSPASVFYSPEPTQRVAAAQQAQKSRLVRGRS
                     MAVTEALL"
     gene            complement(<44148..>46466)
                     /locus_tag="LMJF_01_0180"
                     /db_xref="GeneID:12983111"
     mRNA            complement(<44148..>46466)
                     /locus_tag="LMJF_01_0180"
                     /product="putative CLC-type chloride channel"
                     /transcript_id="XM_003721490.1"
                     /db_xref="GeneID:12983111"
     CDS             complement(44148..46466)
                     /locus_tag="LMJF_01_0180"
                     /note="previous protein_id=AAC24628.1"
                     /codon_start=1
                     /product="putative CLC-type chloride channel"
                     /protein_id="XP_003721538.1"
                     /db_xref="GeneID:12983111"
                     /db_xref="GOA:E9AC07"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:E9AC07"
                     /translation="MHSSLPMAEQTARAGGGGGGGAGNGADESITNLVVNVSEADWAT
                     IDCIRSHTEAAERAAMWRRHSATAAASSSYGDKWSVYSPEGEAFFAAMACGIVLGCLG
                     VFSDACAHWVSAFRSGICANFFWLGRNMCCVDCRECGEYYSWGEFFLGRDNHVVAFVD
                     FVMYVSFSTMAAVTAAYLCKTYAPYASGGGIAEVKTIVSGHHVKRYLGGWTLITKVVG
                     MCFSTGSGLTVGKEGPFVHIGACVGGIISGALPSYQQEAKERELITAGAGGGMAVAFG
                     APVGGVIFALEDVSTSYNFKALMAALICGVTAVLLQSRVDLWHTGRIVQFSVNYQHNW
                     HFFELPMFAAIGCFGGFMGSTFSVVNLHVGRWRKKHLRQWRIVEVAVVAAVTGVVNFL
                     TPYGSGSMLELLGDCFQDCTPSGTMEMCEDSDLRAFFSLLVTATAKFAMFAYTVGTFL
                     PAGILVPSLTIGALYGRAFGMMFRALQETYASSYIFTECYDQDLCVIPGVYAIVGAAA
                     MLTGVTHMTICLAIIMFELTGSLEYMVPVIVGILCAKAAGEAVGVKGTYEIGIEENKL
                     PYLDPKKEFYLDFVAKDVYGNKQFTVLTAYGLQVRDINELVTKMNVTGFPVVESLSDV
                     TLLGYAPVKKIVRALQVAAARNSDMNLNTYIRFKTKPSHSRDATFLEVDLTGILESCL
                     LQVEPECSVKKLLYLFKSLGTHHIFVCRYSKFEGFISKKDFINFMRVKEREENMEDDE
                     LERERRERVQQGRHHEAATAAVDVAPVAARYN"
     gene            complement(<47548..>48138)
                     /locus_tag="LMJF_01_0190"
                     /db_xref="GeneID:12983112"
     mRNA            complement(<47548..>48138)
                     /locus_tag="LMJF_01_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721491.1"
                     /db_xref="GeneID:12983112"
     CDS             complement(47548..48138)
                     /locus_tag="LMJF_01_0190"
                     /note="previous protein_id=AAC24629.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721539.1"
                     /db_xref="GeneID:12983112"
                     /db_xref="UniProtKB/TrEMBL:E9AC08"
                     /translation="MYNGVEAAAVKGTGLSGYVQRSRVNVLATGRVPAEEGAAVMEGG
                     ASINPLEQRRAQGENREMAARLESHRALREVRLGIMLYREEREAAGVDPVTIDRECGE
                     LYDSLLVAAKRRLKAQQQTENAKTAAKFAAAFGVKATAAVTTSGGGAGSGSAFDRSVQ
                     EVEKHRTEEERRRHQEAQLVEHLKRMRREAGDAGAQ"
     gene            complement(<48851..>49753)
                     /locus_tag="LMJF_01_0200"
                     /db_xref="GeneID:12983113"
     mRNA            complement(<48851..>49753)
                     /locus_tag="LMJF_01_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721492.1"
                     /db_xref="GeneID:12983113"
     CDS             complement(48851..49753)
                     /locus_tag="LMJF_01_0200"
                     /note="previous protein_id=AAC24630.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721540.1"
                     /db_xref="GeneID:12983113"
                     /db_xref="GOA:E9AC09"
                     /db_xref="InterPro:IPR017867"
                     /db_xref="InterPro:IPR023485"
                     /db_xref="UniProtKB/TrEMBL:E9AC09"
                     /translation="MGLACRSPLSVLHTPACSPTDTGLQEHNHSKRRLMSSCRGIVVA
                     GVTNQARTQMAEAFLRAFTGGRVFVCSGGVHHLGTVHPLAVVTMAEMGIDVSRQSSSS
                     LAGVRRQRETYDVYVSVDAPYTERTSDRYQRRYTDTQAAQQSSMGAAGLSAPCASSTS
                     DFCDPLLASATPAHWTVSQDTTDGRQSWTLWSPRNPAIYHERSTRKLQDHLYEGEPLF
                     MRVRPHGLRKACRVQRRWEVPELTQRFALETEAEQKARFVQARDLLGSLALVLVRDLE
                     REYGETMLDEAAVAAYEKVAATEC"
     gene            complement(<50677..>53370)
                     /locus_tag="LMJF_01_0210"
                     /db_xref="GeneID:12983114"
     mRNA            complement(<50677..>53370)
                     /locus_tag="LMJF_01_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721493.1"
                     /db_xref="GeneID:12983114"
     CDS             complement(50677..53370)
                     /locus_tag="LMJF_01_0210"
                     /note="previous protein_id=AAC24631.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721541.1"
                     /db_xref="GeneID:12983114"
                     /db_xref="GOA:E9AC10"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR013899"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:E9AC10"
                     /translation="MKRGGSGQQDNVARLTARGFGKAKATQALKDAGNNVEVALRILE
                     RQRDQQQQQQQLRARGIDGACTSTSTASAAIPSLNRTKPPPTSTLLASFSPAAEAMRR
                     QRERLHPCVVQFGSCQYGQYCVLKDLPGDVCVQHFQGSCVYGSACRHRHTIDGANVRD
                     YVWGASKDGDAEPVLRNGVLMYRVRAVDGMGSKVQAAEPIGGQANTHALDDDGECDGG
                     DVAHRRLAAPPLLASDFNRIRGSIPSYTEPMLSSPPYAFQGEVVESEGREEGDAAGCG
                     ATKSDPAEVLVAHPTPFRDLVQGSAGAAQPPPPQRPLPPSSTPTSPPATAAARRARAR
                     HPCIAQYGSCKFGDACAHADRDAGVCVHFLNRRCRYSADECRYRHETEAEYHAALLAR
                     TRLPGSTADAMGERKEPQYTDKPRSRLQGGPSRNATAPGSGRDTSSDAQAPSLALPSV
                     EDLTALPEALQPVDHAVATHHDDGDHLSGASEMQVFLGLLEVFSNVEPAVVLQALRVS
                     GGDPIRASDVIAHVGAVPTTAEVNDVAAALALAAAEEAAEREAAVDDAAAAVTLERHN
                     ALLTLISLFPGVDPVAVEAVLSQHHGAFADAYNVLLCAQENVARSAMWSGSTAAMTPA
                     DQLRVEKLCVMFPGLDADVVRSAYCAADHQWSRATVALNALTQELLSLDSAEATPAKT
                     AAAATVEWRPPHPATATTADAGDDGSGAGGVQRTREETSAEVYSAYRAAENEILELGD
                     WRRVRERAYLMNTQRLRVLGQATAAFSSGDGRTARVLSSEGRRLGLEYNRLNRLAMLA
                     LEQERLRTDATSTLDLHGFHSTEVHDVLVRRVRVCQRHRIGHLRIVTGQGKHSRHGHQ
                     SLYPTVMEDLRTDTFLSAVVKVKSIKAGYIDVTVRLPATES"
     gene            complement(<57026..>58033)
                     /gene="CYP12"
                     /locus_tag="LMJF_01_0220"
                     /db_xref="GeneID:12983115"
     mRNA            complement(<57026..>58033)
                     /gene="CYP12"
                     /locus_tag="LMJF_01_0220"
                     /product="putative cyclophilin 12"
                     /transcript_id="XM_003721494.1"
                     /db_xref="GeneID:12983115"
     CDS             complement(57026..58033)
                     /gene="CYP12"
                     /locus_tag="LMJF_01_0220"
                     /EC_number="5.2.1.8"
                     /note="previous protein_id=AAC24632.1"
                     /codon_start=1
                     /product="putative cyclophilin 12"
                     /protein_id="XP_003721542.1"
                     /db_xref="GeneID:12983115"
                     /db_xref="GOA:E9AC11"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:E9AC11"
                     /translation="MKGVTSFTVYGLVPAADFQRCAEAAAYVNDKYPESYAVIVKLEL
                     PRDFAERRAAWASAGHLPSQQQQPTDASFGESGGSATTASTAAAELAAVLVEQHGSDS
                     EPQCLLTAETFLHNIATHTDYKPDATEDYYTARGKRAWRAFLASRGRQYCWMDVSVDG
                     VAVGRVWFELYASVAPLTCKNFCELCRGTTVAMGDTVAHSSVFDPPPAQHIGYKGTTF
                     FRTLKDAWVMGGDVTGAHSGNGGYSCYGRCFPDETYAVPHDAAGILGMCNDGPHTSSS
                     AFYITLRPMSWMNGKYVAFGRVMDGMHVVDAIHAVEARHNQAPKASIVITDCDVLDTS
                     V"
     gene            complement(<58837..>59253)
                     /locus_tag="LMJF_01_0230"
                     /db_xref="GeneID:12983094"
     mRNA            complement(<58837..>59253)
                     /locus_tag="LMJF_01_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721495.1"
                     /db_xref="GeneID:12983094"
     CDS             complement(58837..59253)
                     /locus_tag="LMJF_01_0230"
                     /note="previous protein_id=AAC24633.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721543.1"
                     /db_xref="GeneID:12983094"
                     /db_xref="UniProtKB/TrEMBL:E9AC12"
                     /translation="MYRTAPQILFQFVGGLSITQYTYPILYDVFTGEKTGAHATTITT
                     SSSSGSFSGLWGSWKGSFQAPIADCTLADDIEELLRTHCWLAAAALSLTVVSGGAPAL
                     LGSGLSMYCNGGPEGKARYSLLKQRLRNFSENGHHA"
     gene            complement(<60056..>62833)
                     /locus_tag="LMJF_01_0240"
                     /db_xref="GeneID:12983116"
     mRNA            complement(<60056..>62833)
                     /locus_tag="LMJF_01_0240"
                     /product="putative DNA excision/repair protein SNF2"
                     /transcript_id="XM_003721496.1"
                     /db_xref="GeneID:12983116"
     CDS             complement(60056..62833)
                     /locus_tag="LMJF_01_0240"
                     /note="previous protein_id=AAC24634.1"
                     /codon_start=1
                     /product="putative DNA excision/repair protein SNF2"
                     /protein_id="XP_003721544.1"
                     /db_xref="GeneID:12983116"
                     /db_xref="GOA:E9AC13"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AC13"
                     /translation="MEHDDLLDDLLSWTPSAPRGNVAKSSSCITTAATTSSSSTSPHV
                     VSRQPRAGSLQETCVNTAAATTKAGNVSASHCHRNASDADDEQSAPCTASVSAETSPP
                     PPPTSGPPFSLPPDVDARLYPHQRAGVQWLYSRHCKSRACLLADEMGLGKTVQVAAFL
                     GQLYARQMIKTTILVVPPTLVPIWTAAFAEWGGASLSRVVEVIHNEPRKKRQARWRKL
                     RYGLPCVLVTTYGVLRQDAADVSVTLVDYVVLDEAHLIKDPNTCVFKSALTLAARHKI
                     ALTGTPLMNTFDDMWSIFRFLDGSILDMDKSDFNAISATLLRGNERDASAAQREAASS
                     ELAKLQAAIRPFMLRREKKDVAAQVLSSSKEDVVVWVRLTDVQRQLYAAFLDSKEVAS
                     AREGAADVDLTEGTADEDGVGMQKSCLGGGGSSAAAAVSTNPLLLLTMLSQICSHPWL
                     SLLDEAFAAALARNPYKAPVAEMGDIFSGAKLWVALQLLLHCVSEQRKTLVFSRSRRI
                     LRLLSFLLQEWRLTHTQVDGDTPSERRCAEVDRFNNDAGVWVCLLTTQVGGVGLTFNA
                     ASAVVLLDPSWNPSADAQAVDRVHRIGQRRDVVVFRLVTCDTVEEKVYRNQIFKRMAA
                     LQSMKGDGGSSGGEGRRPPTADAGGELYRYFTRVQLRNMFSMDDGAQRSTAEQLEVLH
                     PGRVRAQLREELRRIDGVYDVSDNACVLTEPVDADAAGRDEAQLTHSPSASPERTWRA
                     GSVSPPPSQASLSQQALTRVRSRSDGAGGDDDAPRRRRVDVEDTLATAHAATVGCGAS
                     ADPGEALDVAARMTMLATSPVAVLRGTQHLSNSPSPSLLPVSCTTTTTALNQLEGSAS
                     ASLAAPRPTEVTAGDDAEMVSSPFPLLGDSLEHANDAISAAAAAAAAVARGRASDDCS
                     SADFASCRSSF"
     gene            complement(<63619..>65985)
                     /locus_tag="LMJF_01_0250"
                     /db_xref="GeneID:12983117"
     mRNA            complement(<63619..>65985)
                     /locus_tag="LMJF_01_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721497.1"
                     /db_xref="GeneID:12983117"
     CDS             complement(63619..65985)
                     /locus_tag="LMJF_01_0250"
                     /note="previous protein_id=AAC24635.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721545.1"
                     /db_xref="GeneID:12983117"
                     /db_xref="InterPro:IPR006626"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR012334"
                     /db_xref="UniProtKB/TrEMBL:E9AC14"
                     /translation="MMTALRAKYARHGASTDSSFAGSSAASWAEVLPRQTVSQTLEAA
                     AAAPAAVDKTASSTPAPALSLFRTADAPCAESASGDAPPAAAFRAIITPSCTGRPVTE
                     HTTTATAAAAAAARHQRHREMVQLIDQLRSVDVGRLADRMAVLSASAPSPASRTPWLL
                     WRQGREASALEVDNDRSDGRYNDNNRELAELLRHTAVFLNFFSQCASRFLLLAEEEER
                     LADAALTTPEGASPSRAPPQLQERQAAVEMPQRPPHHGDHTTCGRQDNAEQMRRGAGG
                     LPHRSGSHRHDHLCGGSSRGGNAERAARGTDTSASSSKTHMEHPATIVSTPVHCAASS
                     PTPSAAAAAPVHSREVDHADATVSSHHRRSSCVRGIRQLPLPSTLPPRSSSASPPPRA
                     TGQDEDRVTSVGNRGGGSRSPTYRTTTVSPLTSPKDRRSGHSPHTPSQPRYSRGGAVP
                     RASAAATTVRAPAGQRSSSSPLESSPAATPPRPPTSPPMHGGALVVRSPPSPLARRRV
                     HTWTPSSQLNHYAAACAALQSGDCVVLQPGVYYEELVLDDCGHVELTSAYPGAAVVLR
                     PSSDLAPALRIRGAYSRVELKGVVLVQGEWVEAEGAAASVAPRSSFSTAPPLPLLSVS
                     DGAALQATACHFYGGAGGGVVIAGPHTHATLDLCLISLCGFAGIYVHHGASVEVRQSK
                     VKKSEAGLRVLQSSFYVHESTLEENKTDGIVVYEGGVGVLEGSSVMNNGGNGLFLEGG
                     AGEEVRVIASTIELNALYGVHRFRGSTLHIRSSYIRDNGLLPISEDGG"
     gene            complement(<67443..>68288)
                     /locus_tag="LMJF_01_0260"
                     /db_xref="GeneID:12983118"
     mRNA            complement(<67443..>68288)
                     /locus_tag="LMJF_01_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721498.1"
                     /db_xref="GeneID:12983118"
     CDS             complement(67443..68288)
                     /locus_tag="LMJF_01_0260"
                     /note="previous protein_id=AAC24636.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721546.1"
                     /db_xref="GeneID:12983118"
                     /db_xref="InterPro:IPR027012"
                     /db_xref="UniProtKB/TrEMBL:E9AC15"
                     /translation="MPQSAARLNRMQIREQEALNRQRRMQDDAVARREEEELRRTKAQ
                     YDHVSSHGYGRAGSGAAAPSGSRGTSDDVQIRVYVRECDEEASQCFSYREATAANTSS
                     HTGPRSGASASTSAASHVARRGVNGALPPIGSPGRLGSPCAPGASAASGGGGGTSDAS
                     GGAASCGVGAPNRARVPRYLQQRKAELAAEKEAIAAEAERQRQLSLIPAGQRRVSEEE
                     KADTLRQLDERQRELEGQLARIPIRFDTQSIQQRRRAIEEELRQIETTRNKYSTKGTL
                     FMPLC"
     gene            complement(<69584..>69907)
                     /locus_tag="LMJF_01_0270"
                     /db_xref="GeneID:12983119"
     mRNA            complement(<69584..>69907)
                     /locus_tag="LMJF_01_0270"
                     /product="putative thioredoxin"
                     /transcript_id="XM_003721499.1"
                     /db_xref="GeneID:12983119"
     CDS             complement(69584..69907)
                     /locus_tag="LMJF_01_0270"
                     /note="previous protein_id=AAC24637.1"
                     /codon_start=1
                     /product="putative thioredoxin"
                     /protein_id="XP_003721547.1"
                     /db_xref="GeneID:12983119"
                     /db_xref="GOA:E9AC16"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:E9AC16"
                     /translation="MPFTEVYGVEQFRDIANDPTLTVVCFSAVWCGPCKTIEKDLDRL
                     TYEFASVRFAKVDADNNTDIVSKCRVMQLPTFMLVRAGQMLGYVIGADLAQLKAKIRE
                     EANKS"
     gene            complement(<71546..>72787)
                     /locus_tag="LMJF_01_0280"
                     /db_xref="GeneID:12983120"
     mRNA            complement(<71546..>72787)
                     /locus_tag="LMJF_01_0280"
                     /product="pseudouridylate synthase-like protein"
                     /transcript_id="XM_003721500.1"
                     /db_xref="GeneID:12983120"
     CDS             complement(71546..72787)
                     /locus_tag="LMJF_01_0280"
                     /note="previous protein_id=AAC24638.1"
                     /codon_start=1
                     /product="pseudouridylate synthase-like protein"
                     /protein_id="XP_003721548.1"
                     /db_xref="GeneID:12983120"
                     /db_xref="GOA:E9AC17"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:E9AC17"
                     /translation="MRRLFLLLAWQPSFAKHLSELEPVPQRAPVEKRRRQHIPLSLQA
                     REELSRKSNELQYHVVTQDWFGQRVDDFVTQHHPEWDYETVKRLVQQGHIYRYRKNGK
                     KRYTRLTDRLEFDELVVVPTASFWERQLAPPSGVELQSSSTSQQQERRQKFHLSAKTR
                     EMAQEMVLFKNEHVIVINKPSGVPIMPTHDPLAMNITDLLPAWRYTNTQTPVICHNLD
                     TETSGCVVLARSANTHRMLGRMFVKRVVPNSVYWGFAVGKPPVNFGRIRMHFEVQKGQ
                     GGDVIVARPTPTADSKVGIAEFVVNASALEFGSFISFYPLTTRRHQERIMAAHALRAP
                     LLGDAKYGGESAFPHSLSLFWDPARKDVPLHLHHRKIQLPYKNGAGEFVCVTAPLPPH
                     MEKTFKRLGWPVDADDPLIPG"
     gene            complement(<74034..>74552)
                     /locus_tag="LMJF_01_0290"
                     /db_xref="GeneID:12983121"
     mRNA            complement(<74034..>74552)
                     /locus_tag="LMJF_01_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721501.1"
                     /db_xref="GeneID:12983121"
     CDS             complement(74034..74552)
                     /locus_tag="LMJF_01_0290"
                     /note="previous protein_id=AAC24639.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721549.1"
                     /db_xref="GeneID:12983121"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:E9AC18"
                     /translation="MSTYDKSDQIGYDETDHTLNAELEEMMARTPPEVQRHLQHRIHD
                     GILQRMKEETTRKCITFIQKYEQCVNSQKPYNMKLCYPHRDAMNGCAQEVNREENYQR
                     YRIMYLRGELLKYHEKRTAGKMEAFKVRAPDAIRAWKHDYAPKYMHIMEDLGVAPLGT
                     AAGTAEESTNSK"
     gene            complement(<75474..>75653)
                     /locus_tag="LMJF_01_0300"
                     /db_xref="GeneID:12983122"
     mRNA            complement(<75474..>75653)
                     /locus_tag="LMJF_01_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721502.1"
                     /db_xref="GeneID:12983122"
     CDS             complement(75474..75653)
                     /locus_tag="LMJF_01_0300"
                     /note="previous protein_id=AAZ09190.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721550.1"
                     /db_xref="GeneID:12983122"
                     /db_xref="InterPro:IPR007513"
                     /db_xref="UniProtKB/TrEMBL:E9AC19"
                     /translation="MTRGNQRDLAREKNIKKQQEKNKGHREDGLSHAARREADAEAMR
                     LKQAAAAERKAAGGS"
     gene            complement(<76217..>77383)
                     /locus_tag="LMJF_01_0310"
                     /db_xref="GeneID:12983123"
     mRNA            complement(<76217..>77383)
                     /locus_tag="LMJF_01_0310"
                     /product="putative acidocalcisomal exopolyphosphatase"
                     /transcript_id="XM_003721503.1"
                     /db_xref="GeneID:12983123"
     CDS             complement(76217..77383)
                     /locus_tag="LMJF_01_0310"
                     /EC_number="3.6.1.11"
                     /note="previous protein_id=AAC24640.1"
                     /codon_start=1
                     /product="putative acidocalcisomal exopolyphosphatase"
                     /protein_id="XP_003721551.1"
                     /db_xref="GeneID:12983123"
                     /db_xref="GOA:E9AC20"
                     /db_xref="InterPro:IPR001667"
                     /db_xref="InterPro:IPR004097"
                     /db_xref="UniProtKB/TrEMBL:E9AC20"
                     /translation="MSGVINDFLRRCLKKVAGKVQPLTVVQGNEGGDMDSIVGCIYLA
                     MLFDKQPKFGFENPVPALNFPQEDFGLRNDVTNLFKELGIDASLLMSVQRGQIAHNLV
                     DIAALNASVVLYDHNKLRENQSDLASRVVGVVDHHFDEQQYLKTASKLRVLRTVGSAC
                     TLVTELYRECGEDVVCPTLLTAPIVLDTVNFEPAQKKVTPEDIAAYEWLRAKEVADSA
                     DAAALFEKLSKWKDDVLALSVPQILRRDYKQFSFKARTQKGVMSAGTSSVPCACKQLE
                     AHFSVDLIVAEAAKYVEQHQLDVLIVAFAGKVGGKHTREVAFCAKPDVISFFAPFVAE
                     APDGVSFTVITKCQTVDGSYEYASYSLSDPSISRKKLVPALSEFLAEGTRSLCE"
     gene            complement(<77741..>78172)
                     /locus_tag="LMJF_01_0315"
                     /db_xref="GeneID:12983124"
     mRNA            complement(<77741..>78172)
                     /locus_tag="LMJF_01_0315"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721504.1"
                     /db_xref="GeneID:12983124"
     CDS             complement(77741..78172)
                     /locus_tag="LMJF_01_0315"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721552.1"
                     /db_xref="GeneID:12983124"
                     /db_xref="GOA:E9AC21"
                     /db_xref="UniProtKB/TrEMBL:E9AC21"
                     /translation="MLFRCIRVVRPPALHTRRMSMRTVVMEHGVPLSLYYFITNELLV
                     CLLTCLLHYGYFGQEDLIGFLKSVGASKYVDLNSIEGKSWSLFGGQLVVSARLVANFT
                     AASLFMSLWTPVQLPICIATYPYLKRSRQLLMKRDSVSKPI"
     gene            <79145..>80068
                     /locus_tag="LMJF_01_0320"
                     /db_xref="GeneID:12983125"
     mRNA            <79145..>80068
                     /locus_tag="LMJF_01_0320"
                     /product="putative poly(A) export protein"
                     /transcript_id="XM_003721505.1"
                     /db_xref="GeneID:12983125"
     CDS             79145..80068
                     /locus_tag="LMJF_01_0320"
                     /note="previous protein_id=AAC24641.2"
                     /codon_start=1
                     /product="putative poly(A) export protein"
                     /protein_id="XP_003721553.1"
                     /db_xref="GeneID:12983125"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9AC22"
                     /translation="MLMTGVASWDGSCSIWQVARNPAGAVISQPAWTTTHDSPLLTMS
                     FSADGRVFFGGCSKTAVMWDLNSNQKAVVASHDLPISCLDFLTLPQTMSQMLITGSWD
                     GKLRWWDLRQQSYVREENLGEPVFALDAQKTVPMMAAATGRLAHVYDVQQMQKVNELK
                     LPDVMKFNLRCITCAPQYDGVGVGSSEGRVSFISMKDAPGCTFKAHITTEKSHYILSQ
                     TNFCVHHPTLPLLLSGGGDGNLTVINRADRKVIKTLQCEQKVGTQAIPISAGDISADG
                     SLVAYAHSYDWAMGKSGYRNQPTSVHIRPLS"
     gene            <80535..>81164
                     /locus_tag="LMJF_01_0330"
                     /db_xref="GeneID:12983126"
     mRNA            <80535..>81164
                     /locus_tag="LMJF_01_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721506.1"
                     /db_xref="GeneID:12983126"
     CDS             80535..81164
                     /locus_tag="LMJF_01_0330"
                     /note="previous protein_id=AAZ09191.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721554.1"
                     /db_xref="GeneID:12983126"
                     /db_xref="UniProtKB/TrEMBL:E9AC23"
                     /translation="MSSTLYEFGYELNSKQVRVYQTHDVGSVHRAITANLQEYLAYEG
                     VQEEDPTSLKNLFVKALTLGVATEVYVLSKFRVSGLLLASSFFFFGILIAFQLTCSFL
                     QRNGDIIFVGTGRLIEGPRPQKRCFRKLKNQRLCVRLTQESMCAPLVKFEFQLIGPSR
                     LFSPPPVYSQVEKSVQYGQFFGSTGFFFPPPLQKLVDGMLEAVVSKKQK"
     gene            <81749..>82042
                     /locus_tag="LMJF_01_0335"
                     /db_xref="GeneID:12983127"
     mRNA            <81749..>82042
                     /locus_tag="LMJF_01_0335"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721507.1"
                     /db_xref="GeneID:12983127"
     CDS             81749..82042
                     /locus_tag="LMJF_01_0335"
                     /note="previous protein_id=AAZ09192.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721555.1"
                     /db_xref="GeneID:12983127"
                     /db_xref="GOA:E9AC24"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:E9AC24"
                     /translation="MVSRNFVRYVGYAGAAANWLIPIAGIMNLPTRPMSDIDPVMTSV
                     MCVYSMFFMRWSVSILPANYPLFACHATNSTVQAVTLGRWCYGTATKPQKAIP"
     gene            <83341..>84117
                     /locus_tag="LMJF_01_0340"
                     /db_xref="GeneID:12983128"
     mRNA            <83341..>84117
                     /locus_tag="LMJF_01_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721508.1"
                     /db_xref="GeneID:12983128"
     CDS             83341..84117
                     /locus_tag="LMJF_01_0340"
                     /note="previous protein_id=AAC24642.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721556.1"
                     /db_xref="GeneID:12983128"
                     /db_xref="UniProtKB/TrEMBL:E9AC25"
                     /translation="MSESTAELQRARRRYKALVRERGSLASSGASDPVVEEEIRKLEE
                     KYAELKPHSPPPLPDHRAAISAPVAPSATSEEVAKPSLAMAPSASPSTELHPAPSMPQ
                     PCAPMDEVCVEAVNADQQARAAQSRAGAQLPAKLGSHLALFFLRLFNEAHQKSLLGCW
                     NCAAIAALSIAVAVLHCTVLDPSSTTGSLITPSFLCCLVHANNLASLYTQHRRRLNVP
                     MLVVYVCLDAVPSLALDLVVYNLSLTLMGFCGLHPASFVC"
     gene            <85901..>88105
                     /locus_tag="LMJF_01_0350"
                     /db_xref="GeneID:12983129"
     mRNA            <85901..>88105
                     /locus_tag="LMJF_01_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721509.1"
                     /db_xref="GeneID:12983129"
     CDS             85901..88105
                     /locus_tag="LMJF_01_0350"
                     /note="previous protein_id=AAC24645.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721557.1"
                     /db_xref="GeneID:12983129"
                     /db_xref="UniProtKB/TrEMBL:E9AC26"
                     /translation="MSSLEALLSSPTDVIAECPVIGPGDVRLVAANLEVILNKCLYCV
                     RRTLPGPLEVLLTVMGDASDLQANNVCAGLLQPAEEGTCADVFCDLAEQLLARRAAVI
                     RLQFDVEVFFKVTQVFCCAASLKDRLGARLGEVLLGFLKDVDMHADDYRVHRHCCSAL
                     ISLLRGSQENKKRFGPECATIAACLDASHDFFFQMQCVEVLYRLYKHRSSFLTHAAAP
                     ATSTSLSSSSANAMTLGVAINPYLLRGIEALPNDSTLLLCIHQLLDSYNRDVHPDKVI
                     SFSVLNIEVGGVTMARATTLYFSPLLLVVLLPDTSDCSRGGGGGGGYLTIPYEHVRSV
                     KLTKDHKLELRLYVIPQKLSHVMSLAQDGMDKLHVSLTRATMRELRTSAVHEWVAERK
                     RTAPRRVTAPAPPPSRRTEAAGAGHALPAASSASPAPPSSSHASSRAGSTARPPLTTT
                     MTERPVNTHQGVGTDSQEQPLARGKAPHPQLVEAVQQQQQQAQQEQGGPAHVNSSGDY
                     AAADEEAGGQCKRPCLEEVHRAASLKAMRYREEQHEALQHAVDSAKEELEALHRWSAR
                     ERDQYEVRFREDMEVIRRSEAVLKESATDCVRALNAELEDVQALGALLKGEVDKLRER
                     LAKSLGKSEGVEEALLARIKHTVDAQMRSIEATMLSVDSAASSLAGAGGGSISDVSNY
                     IAQQMQAISSGAVVVGAAGARASTAAAAGGTAVISSARGTGSGRAGKARHEP"
     gene            <88974..>89543
                     /locus_tag="LMJF_01_0360"
                     /db_xref="GeneID:12983130"
     mRNA            <88974..>89543
                     /locus_tag="LMJF_01_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721510.1"
                     /db_xref="GeneID:12983130"
     CDS             88974..89543
                     /locus_tag="LMJF_01_0360"
                     /note="previous protein_id=AAC24643.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721558.1"
                     /db_xref="GeneID:12983130"
                     /db_xref="UniProtKB/TrEMBL:E9AC27"
                     /translation="MAPPVGRIATDVVVRSSKRVPSLAAPRSYPLASTIICASLRSTV
                     TAAAVAEPGTVASPASALVCSSRTFYDKIREKRDGSEDEGPDQMFQDFPKDPNRQRVP
                     AELHRSNQTAVEDAEKISRVFCVFLLLLFGGLLYVLNPFQSDPYGRPDGYGMTERKLV
                     YGSSDLACNNSSSGRRREEEDMRSIRRLA"
     gene            <90100..>90666
                     /locus_tag="LMJF_01_0370"
                     /db_xref="GeneID:12983131"
     mRNA            <90100..>90666
                     /locus_tag="LMJF_01_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721511.1"
                     /db_xref="GeneID:12983131"
     CDS             90100..90666
                     /locus_tag="LMJF_01_0370"
                     /note="previous protein_id=AAC24644.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721559.1"
                     /db_xref="GeneID:12983131"
                     /db_xref="InterPro:IPR008506"
                     /db_xref="UniProtKB/TrEMBL:E9AC28"
                     /translation="MAKETAKRNRKKNSVRMRVFSMMTAAVNLLYVLAILYRNGSLPS
                     FHDLMAIGFWAGQEYLAYSMLSKVAQPTISPEGHLLDCIDASNPQELGYYTLAQDVLW
                     VCWVVQALCIMHPAFIVFYLPVPATLIYKVWGSVLKPLVAAYLGGSGAGAGADEDSSH
                     GPPRNRQERRKEELKQRKVTRRGKSATD"
     gene            <91351..>93807
                     /locus_tag="LMJF_01_0380"
                     /db_xref="GeneID:12983132"
     mRNA            <91351..>93807
                     /locus_tag="LMJF_01_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721512.1"
                     /db_xref="GeneID:12983132"
     CDS             91351..93807
                     /locus_tag="LMJF_01_0380"
                     /note="previous protein_id=AAC24646.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721560.1"
                     /db_xref="GeneID:12983132"
                     /db_xref="InterPro:IPR019142"
                     /db_xref="UniProtKB/TrEMBL:E9AC29"
                     /translation="MGAALRKEASEYFTAALTSDAAAAPGESEFLEKVKQYERGLCGG
                     SELYGMAEPIAAAVMSKAAETGRVRWLLRLCSEVMRRCVEAPYGVDASTPAVLHLAEV
                     LLRHILRLTKGQSAELVGVLEAVGARGETTPSNSAPCEDTAALLCRMAFAFLVSVPLD
                     SATVATHLEVLRLLLTMTSSALHHGTDFQEDTMDLFTELMMSSPLLGDCLAVLLQTVV
                     SWGRPGWTAQSPVLYHEGHQPSFLNLFNIFSTTVTAPRLASDKAAYVLEVPSSTMVKA
                     SAAAIGAGGPSALKAGALPKDPAAVLVNSCSCWEQVGRHATALLCVLIVHQKGSGRNP
                     ALEYVTATRDGSPVSFAALLSAIRCQLTSFPQLSILLYVLLHDHCEFLHTVLAEDAAL
                     LVSTLQQLLEITNKTCRVTTRLATSLAADAADDVLQNAVLGRIIFQLRVFSYPFINFM
                     SSTLLLLVSQDRVVNRLLCNTPCLGRHLLERYDASASVGALAVVVLSRGIIKGLNERN
                     EALVAVFAPCLVNLVPFLHDMDTYTAQRVCALLTTALKKIHRASALLMESTAAAAATT
                     TAEGQTGGSVTAVATTTAEDAQALEQILAMYVRQLRIILEGVEALLRGADRRNEHLIY
                     ELLYVRSRIIDDAEAAVEAQRPYAEPTKQLLANLAEMIKNCEADIASSSHAQSPQEIL
                     AILRRGQQQQHGQSQSNSISGSNGKDVSGGGGDDDDAGSEDRRDGDSCDGGGGHKDVS
                     LSRAGSLLSASAVETSIAADAMAGADGASVDLVYSYEELPHSYDFFGPFVWATLLSAG
                     QLPGGALWCRQSNELPLFPH"
     gene            <94762..>97230
                     /locus_tag="LMJF_01_0390"
                     /db_xref="GeneID:12983133"
     mRNA            <94762..>97230
                     /locus_tag="LMJF_01_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721513.1"
                     /db_xref="GeneID:12983133"
     CDS             94762..97230
                     /locus_tag="LMJF_01_0390"
                     /note="previous protein_id=AAC24647.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721561.1"
                     /db_xref="GeneID:12983133"
                     /db_xref="UniProtKB/TrEMBL:E9AC30"
                     /translation="MQRPPRPQPTRLSPYFFQQVVSHVPHAAVCAGDGAEAGVSDGLQ
                     PQGSDPLRSEAAAAEPATTVACSPSVSPLPSMSAPGANAGVLDLDPDALAAVTARADA
                     GAPVRVTSDAATDAVMWQYFTPASFRQNFEAFMRAESAQTESLRRAVEAAWRDVEQIQ
                     QRNVVRRATLTDILADPGAAWREEVRAKVYWQAADIVQRYGFDVVMDEDGKAGGGEAE
                     QAGRERITLDFSVSRERVRANRGGSSSSSGDDDEDDDIEDAVSGLKSSPQPEREPQPL
                     AARLGTQAAAADPLMSKPQAKAHDNLLNPCARAHFLRHIFAPLQRMRDSLPKWTTLLL
                     QDVHDVQKAALPSLEKRVQDSVLFKVPLHRPFLDARVALQSCVQQRRVAPDAEVAQVP
                     AYRQLEQHGKLWIDFVQAHESAAAAVAAAAETERLIRVGGPVPTADSSEDEIADVAQR
                     WATAEALWTLLLDELDTCKCFFADAIHRRNAVHEGVTVEMESLQQSVHRHRHNCDATV
                     AALKSDAEACAELLSRNRQRMVTAVEEMEKTFISERDRLQQSITQGEALLTRLAGQQE
                     KCVRRVREALKAFFTEQLQYEEAAQALLQDHLSLTHLEASHGELRQALQLGYKGALDS
                     RENAAALLQLLTDGDTAVRQLFDACEAHCRRIETENHFIQCRLVDQCTLALQQRCRCV
                     HAMAALYEQRYATLEARSGDSWQRQFLLSGERDWAVANLSDVRAELVQLEQDWRKVCA
                     LREELELEPAQLNAHVLTPEWQRLLSTLRNLDAPPSLQRRLPTLRAHAAEKVRPAAGC
                     GQQAVRHLLRDAAAAAQASVLPAP"
     gene            <98194..>99873
                     /locus_tag="LMJF_01_0400"
                     /db_xref="GeneID:12983134"
     mRNA            <98194..>99873
                     /locus_tag="LMJF_01_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721514.1"
                     /db_xref="GeneID:12983134"
     CDS             98194..99873
                     /locus_tag="LMJF_01_0400"
                     /note="previous protein_id=AAC24648.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721562.1"
                     /db_xref="GeneID:12983134"
                     /db_xref="UniProtKB/TrEMBL:E9AC31"
                     /translation="MKLPLTLHPANHLAVQCLLLHAALSSDSVSGFTMDDAQHEQYNT
                     AASIARLRTRYHWEGQHGRRHMVRLSHCWQGLLRPPAVAAAASVTGSSAAQSTTVAAP
                     TGVPVSCGGAPSSPVPPSSVLETRQQQPADDNRALAFAAPARLIALYAPPVLLRGLHR
                     RLHDMVSYDAAVHHASLLRQLLAPYGIHVAVTGATRRGCPFSLQAEYLLCLTEAATFE
                     VEAVHPGDAGGLAESDRGAVEDAINDHGDDASGSRASAVSTAAIAVTDPRTREARCSK
                     MRAKRAAIQRDALMLRPPSLPSASSLAAAASVSREEDGAASAVAGGGTGHRDQARIRV
                     CLGGSLRRRYCDRRSAFSSADVVSPQVSYRVRRALESLVRCGYIVSAAQPFPPSQSHL
                     EARKVMYLTARYDPHLPAQVPPRACTDPAVLRRLQLHRLVLRLCPWHAFAARQLLLTG
                     PADFTTHVMLQALDHGIDVNMNGAFMCGEACAASGDGGVGNTTPAIAATTASEAHGGS
                     LPPVHHKGQTRRRCDLVEQLILQDEEDLVSLAGLPRIDPMLRGLYCQQNHL"
     gene            <100528..>101130
                     /locus_tag="LMJF_01_0410"
                     /db_xref="GeneID:12983135"
     mRNA            <100528..>101130
                     /locus_tag="LMJF_01_0410"
                     /product="putative ribosomal protein S7"
                     /transcript_id="XM_003721515.1"
                     /db_xref="GeneID:12983135"
     CDS             100528..101130
                     /locus_tag="LMJF_01_0410"
                     /note="previous protein_id=AAC24650.1"
                     /codon_start=1
                     /product="putative ribosomal protein S7"
                     /protein_id="XP_003721563.1"
                     /db_xref="GeneID:12983135"
                     /db_xref="GOA:E9AC32"
                     /db_xref="InterPro:IPR000554"
                     /db_xref="UniProtKB/TrEMBL:E9AC32"
                     /translation="MQPHLRKLRKLKRGKPSDLEESVAKALFELEASHKTLRQELPRF
                     HVNTVREVKVPRSKKTVLVVFYPLRFLMLVRKVQRALTSELEKRHPGCLVMLVAQRQI
                     TKRPTDVYKLQKVQRSKTSTAVFENILNDMIYPSDVVGRRWRCRTDGSKLMKVFLDAR
                     DRKRIESRLRAVAYVYKQLTHRRVSFGFMWNPKLQQVSTR"
     gene            <102444..>103046
                     /locus_tag="LMJF_01_0420"
                     /db_xref="GeneID:12983136"
     mRNA            <102444..>103046
                     /locus_tag="LMJF_01_0420"
                     /product="putative ribosomal protein S7"
                     /transcript_id="XM_003721516.1"
                     /db_xref="GeneID:12983136"
     CDS             102444..103046
                     /locus_tag="LMJF_01_0420"
                     /note="previous protein_id=AAC24649.1"
                     /codon_start=1
                     /product="putative ribosomal protein S7"
                     /protein_id="XP_003721564.1"
                     /db_xref="GeneID:12983136"
                     /db_xref="GOA:E9AC32"
                     /db_xref="InterPro:IPR000554"
                     /db_xref="UniProtKB/TrEMBL:E9AC32"
                     /translation="MQPHLRKLRKLKRGKPSDLEESVAKALFELEASHKTLRQELPRF
                     HVNTVREVKVPRSKKTVLVVFYPLRFLMLVRKVQRALTSELEKRHPGCLVMLVAQRQI
                     TKRPTDVYKLQKVQRSKTSTAVFENILNDMIYPSDVVGRRWRCRTDGSKLMKVFLDAR
                     DRKRIESRLRAVAYVYKQLTHRRVSFGFMWNPKLQQVSTR"
     gene            <103842..>106073
                     /locus_tag="LMJF_01_0430"
                     /db_xref="GeneID:12983137"
     mRNA            <103842..>106073
                     /locus_tag="LMJF_01_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721517.1"
                     /db_xref="GeneID:12983137"
     CDS             103842..106073
                     /locus_tag="LMJF_01_0430"
                     /note="previous protein_id=AAC24651.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721565.1"
                     /db_xref="GeneID:12983137"
                     /db_xref="GOA:E9AC34"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:E9AC34"
                     /translation="MELMATMALDRDAINTVTLRLLPPSAAPGAAVSLWLLWHTIPIT
                     ASLSRTLSRLVSIEASAMAQTPLDDTADTAAMYHAAHPSHDQKARSPSAASASSSSSS
                     ASTSSALSTRTRHTCSTAEAEKTSWIELVRVGYVVSEIHAYCVLLKCRRAAQAARLKA
                     ALEEGAALGLTAPVEYVSDARPVVVTHCAFAERRGKVEAVGPDDASTTDHHPPRASAR
                     WCTGDHMVSLWEAIATVYPVRGNGNSGDDGDGDSASDGDGEHHDTRGSLQRHHRYHHH
                     PHHLQSSPHTASSAPVTPSPARQSPAASSVMRKGAAPPPSRHAPTVTAAAAASTPKHM
                     PLSSATAVGRASPSRPPHKPPHFPLAGRGGGGLGSLRSGDFCTICLDPLYLSACVTTL
                     CQHSFHLSCYAQLPSGSAECPLCRFSVYDLLNDARCKVCGTYEDLWVCLICGHVACGR
                     ARRDHQQKHYHASGHSCSWQSTTNRMRNLSSRMFLHQEVALLLDEGGADDAATADSPH
                     SIGSTTQLRSAEAGTSSVEAATTAMGATLSPSGADRVRYRSWSDSLVDSDLQEALNES
                     KEEAVAQYYTQFLRQLAEEQQRWYEARLAERRRRRHERQMAAVAMAGGRRAENASSPA
                     AEWLSHVAPSAHTALQCIALDERRLRRRVFSEYVQATISLLQAAQREYAGMAHMLRAV
                     RDDAQQQVLLRSHFNSGLMAQVERVRQRTRELQRKGATAAQQKAAEEAELQRLVDEAL
                     SSL"
     gene            <107438..>109201
                     /locus_tag="LMJF_01_0440"
                     /db_xref="GeneID:12983138"
     mRNA            <107438..>109201
                     /locus_tag="LMJF_01_0440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721518.1"
                     /db_xref="GeneID:12983138"
     CDS             107438..109201
                     /locus_tag="LMJF_01_0440"
                     /note="previous protein_id=AAC24652.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721566.1"
                     /db_xref="GeneID:12983138"
                     /db_xref="InterPro:IPR008509"
                     /db_xref="UniProtKB/TrEMBL:E9AC35"
                     /translation="MEVNVTVTTKPYKPAASIYDAWKETLLPFLVPATVLSAWPTIML
                     IRDRNCVPIKLLTIAALVSLADGLLGSCAFSLQHQHAFSLSANSAFFYAGTVTYWLSG
                     AALSPLMEVWGCRRSCMALALAGAAGAWGSGQSITLFVLCGRIATAAATSGLSTWVEC
                     ALYHEAHGHHSPSPAAGDDKDMADGNGGEALGGSGALTIFHQVRPVMLFFSMIASQYV
                     MAVTPTVSVAPCWVALLCYLGVFVVAWGLSVLPAASAAGSSWWTGSNPFHVNGGSNGV
                     HGKSASMKEASSSCSEFESTVATLLPGVVLSCCSAGGSRLSAPQRLLRHYVHAYSASI
                     RTLCMPRYLARHIVDIIFGAAFLTGSLLWVPTLELYDDSIPFGFVFELFMIATFLGST
                     FSLPVWAVGGAEAALVVLLSLSQRTLSTSRDYAIPVTIMLGGIVLHLTYGCVLTMGSL
                     WRAEYAISSAPLTLLFLLKACTGVLGWVFLNAIDGKYMEDAFVFEAQWMWVLMWVQAV
                     ALTQCIVARMAPGCGRRANRVAIAKDGSAVLVQKPDSGNVKDLSSNGVKETAVAGGPT
                     ARLQTDILSHAPFNDVETAKL"
     gene            <112139..>112795
                     /locus_tag="LMJF_01_0450"
                     /db_xref="GeneID:12983139"
     mRNA            <112139..>112795
                     /locus_tag="LMJF_01_0450"
                     /product="alpha/beta-hydrolase-like protein"
                     /transcript_id="XM_003721519.1"
                     /db_xref="GeneID:12983139"
     CDS             112139..112795
                     /locus_tag="LMJF_01_0450"
                     /note="previous protein_id=AAC24653.1"
                     /codon_start=1
                     /product="alpha/beta-hydrolase-like protein"
                     /protein_id="XP_003721567.1"
                     /db_xref="GeneID:12983139"
                     /db_xref="GOA:E9AC36"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:E9AC36"
                     /translation="MPWATTLDLKATPPPTLCVTVSNTTDVLIIADMQVDFLTPGGSL
                     HVKGGEALLDGINAVSSQLPFRYQVATQDWHPENHCSFVTHGGPWPPHCVQGSSGAQL
                     HAGLHTHRINAVLRKGATQQADSYSAFVDDNGVSTGLAGLLHSIGARRVFVCGVAYDF
                     CVFFTAMDARKNGFGVVLLEDLTAAVDDAAWSARAAELKEAGVVLLSSSALVAEGTET
                     "
     gene            <114903..>119183
                     /locus_tag="LMJF_01_0460"
                     /db_xref="GeneID:12983140"
     mRNA            <114903..>119183
                     /locus_tag="LMJF_01_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721520.1"
                     /db_xref="GeneID:12983140"
     CDS             114903..119183
                     /locus_tag="LMJF_01_0460"
                     /note="previous protein_id=AAC24654.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721568.1"
                     /db_xref="GeneID:12983140"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AC37"
                     /translation="MMMMMPPPPRFPEMAGMVPGMPPPMPGAASTGGMMSAGFMPPPP
                     PPPPPPPMMMPPLNGMIFQPPGTPGMPHHHHHPAGMATPQQHLASQHQHQHQHGMMPM
                     WMPPPPTQTQQHQQQQPGMMMPMNSMMPMSMPMSMPMGAASSPLPPGQHSSGPQQHPP
                     QQPGMMMPFYPPPQAPHGTMPPMASMPPPAPGMGVPRAPPPTAGAAPGGGMIPPQAAG
                     AAATAAMMAPPPHHSYMHPYPGSNTASGANASAAASSISNARSIHNHTQNHINTGAQA
                     AASRPASMSMPPQPPPPMMMMNHTGGAMMPPPPPPPPPPTVAANARVSVGNATLAALN
                     SKEPPKFSCVLLSGIPAVGKTTLGRELVNSLKTDGMGWAFFSGADFLTEQQGKRSIWE
                     TTKDVFDALSSRLDELLEKQHKDRNIKGLVIDKNCKGIEDVYYLSALLLSKSIPFVGI
                     VGMECADDDVLVKRMGGDDYLKEKLKFHRVIHARIVSLAKSAGMYRYVDATKSKEEVV
                     QMLRTMVLGCCAQPPTRSIGNHQYDDSRANIMVDDYKEYNEVLTHLFRCVNNRGSQFP
                     GSTDLVPFSEKEMKDKGRINAIKSRYGIRRKVDGHRYLLVYREKKLYLVPPHMRAVLQ
                     MPLKAWLGSRLDSDSVGMFVLEGDLTRLIRDRQKELFLVYDAHYWSEAEQPSSNKMIR
                     MTFSERQAFLAANMCSESKAFFAQDGVECVVVHQPTQKMSEAVDMLDSEEYPSDGLVF
                     QAVNPIHRSDHVFVWQQPFYMTVDFRVGQLLHTHQPPETDADGIPTSVKGTTSDLRRN
                     ASGAVSPQQQQPLPLTTRRGNVDAFSDHPIRTFMLEVYDKTEKMYVQYENATVDVRHP
                     DVVEGCIVTCSLVDDTPRRWVFRRIRYDVSRPIYKLDLEELLGSCLIPRTKMVAWLLN
                     EQIVPSEIQLDGNGSGAGGSGSATNVPNVPPPSYDAAAAAVAAASAKGAAASMGMMQG
                     LTTPLPTQGMMPPLMKDIGSPPAFHAPTAAATAIPMASTAPARSIYPSASAMLSRVAA
                     VPANPAPPPAVPAPRPPAQMSTEAQLKQLASIVPSFHVVDGSKEGGAAAVAAASSTPA
                     AAGSNGTAAGVAGKSAASRATGGAASDGSRNCAQCHKPKQSEDLRVDRRDHRHYCYSC
                     WAKSGYGFCVVCGEFKEVRRESKGRQKGSTVCAPCGKAAATAPADAASSNASPAAATT
                     AAAVMKTAASAPTTPAAQEAAEAKVDVVLPSVKARKKAAAKEKKAVGVPPATGEATPS
                     TDSAAPAVAAAKTTGGEGGKAVKDTGGGSRAAPASVPSSPTSGKGGGTAHGGKTNDSV
                     KVSSSSLDALMSASPPDAAAEAALSQAPTSEKSTKSVPFQVDVAPALAAPAVAEAPTA
                     KPADSKVAEPPEEAVAAPAAPAMATAVQDPSKAQVHEEKRSVGGCRQQ"
     gene            <121759..>123849
                     /locus_tag="LMJF_01_0470"
                     /db_xref="GeneID:12983141"
     mRNA            <121759..>123849
                     /locus_tag="LMJF_01_0470"
                     /product="putative fatty acyl CoA syntetase 1"
                     /transcript_id="XM_003721521.1"
                     /db_xref="GeneID:12983141"
     CDS             121759..123849
                     /locus_tag="LMJF_01_0470"
                     /EC_number="6.2.1.3"
                     /note="previous protein_id=AAC24655.1"
                     /codon_start=1
                     /product="putative fatty acyl CoA syntetase 1"
                     /protein_id="XP_003721569.1"
                     /db_xref="GeneID:12983141"
                     /db_xref="GOA:E9AC38"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:E9AC38"
                     /translation="MGGCVVSLMEVLNSTRLVEYPDFAARRVYGVINQRITEDEADRS
                     GVYRCARLTDAQHAECCNWYDGPTILQRLAVICEERGDQRAMAYRTVEKVVKESTKDE
                     KGGTREWVYTFLNEPTYITYAEVWSRLVSFGRGLVELGLQKGSHVALYEDTRWEWLVT
                     MLGAWTQEMIGVTVYANLGEDALLYALKEATCEALVCNGNSVGKLISLMDKYGVHDAT
                     IIYLDALPSNLNTESHKVVAWTDVLAKGTSSTAPYKVQDKKDEEVLVMYTSGTTGNPK
                     GVIHTIGALTQGALGLEERLTDLIGKEENESYVAYLPAAHIFEFTCENIMLLRGTLIC
                     FGTPRTLTDAFARPCGDLRAFNPFFFIGVPRIFDTLKKAVEAKLPPVGTLKRQVFDHA
                     YQSRLAALKEGKDTPYWNEKVFSQPRKILGSKVRGICCGGAPLSDKTQEWLSVVLGRP
                     VAQGYGMTESVCNASVQRSGELKCEAGQLLHGVEACLLDTENYKHTDKPHPRGELLLR
                     GRFVFKGYYKQPELTEQSILPGGWLRTGDVAEMEAETGQMRIIGRVKALAKNCLGEYI
                     ALEALEALYCECSVVVPNGICILVDPQHPFITALVLTDEEKAMRFARAHKVENARWPD
                     ILKDPAFIAAVTASLAEIGRQAGKKSFELLKRVCVLSDEWTPENNLVTASMKVRRSVI
                     DTHYADIIKELFAD"
     gene            <124711..>125790
                     /locus_tag="LMJF_01_0480"
                     /db_xref="GeneID:12983142"
     mRNA            <124711..>125790
                     /locus_tag="LMJF_01_0480"
                     /product="putative beta eliminating lyase"
                     /transcript_id="XM_003721522.1"
                     /db_xref="GeneID:12983142"
     CDS             124711..125790
                     /locus_tag="LMJF_01_0480"
                     /note="previous protein_id=AAC24656.1"
                     /codon_start=1
                     /product="putative beta eliminating lyase"
                     /protein_id="XP_003721570.1"
                     /db_xref="GeneID:12983142"
                     /db_xref="GOA:E9AC39"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PDB:1SVV"
                     /db_xref="UniProtKB/TrEMBL:E9AC39"
                     /translation="MSTPRTTATAAKPKPYSFVNDYSVGMHPKILDLMARDNMTQHAG
                     YGQDSHCAKAARLIGELLERPDADVHFISGGTQTNLIACSLALRPWEAVIATQLGHIS
                     THETGAIEATGHKVVTAPCPDGKLRVADIESALHENRSEHMVIPKLVYISNTTEVGTQ
                     YTKQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLADIARLTDMFYIGATKAG
                     GMFGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDNLFFELGAHSNKM
                     AAILKAGLEACGIRLAWPSASNQLFPILENTMIAELNNDFDMYTVEPLKDGTCIMRLC
                     TSWATEEKECHRFVEVLKRLVASTA"
     gene            <127704..>129800
                     /locus_tag="LMJF_01_0490"
                     /db_xref="GeneID:12983143"
     mRNA            <127704..>129800
                     /locus_tag="LMJF_01_0490"
                     /product="putative long-chain-fatty-acid-CoA ligase"
                     /transcript_id="XM_003721523.1"
                     /db_xref="GeneID:12983143"
     CDS             127704..129800
                     /locus_tag="LMJF_01_0490"
                     /EC_number="6.2.1.3"
                     /note="previous protein_id=AAC24657.1"
                     /codon_start=1
                     /product="putative long-chain-fatty-acid-CoA ligase"
                     /protein_id="XP_003721571.1"
                     /db_xref="GeneID:12983143"
                     /db_xref="GOA:E9AC40"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:E9AC40"
                     /translation="MGGCVVSLMECKARSNEVPWELSEDVKSYGPLSVAVAGTQTPNS
                     SAVYVNGKQSTLAAQQECGKQFYYGPNQPQRFAKLCQENLDSVALAYRRIEKMEKEQV
                     AGASRPMDVAYFSEQCNLTYRELWHAVTGFSRGLAELGLEKRVNVTIYEETRWEWLAS
                     IYGIWMQDMVAATVYANLGEGALFHALRETECKAILCNGKSVPNLLRGVGSGAFPACT
                     LIYLDNLPVAGCAELHGCRVVSWKDVVALGHGAGAHHGAAPPEDNESVALIMYTSGTT
                     GDPKGVMHTHGSIVAGILTMDDWLYSVIKHRPDDVYLSYLPMAHIMEFGVVNILLARR
                     AHVAFGTPRTLTDATARPHGDFTHFRPTLLIGVPRIFDTLKKAVEAKLPPVGTLKRQV
                     FDHAYQSRLAALKEGKDTPFWNEKVFSQPRAALGGRVRAFLSGGGPLSETTQEFVNVV
                     FGCIVNGWGLTETVCIGAIQRLGDLTPSAVGQVLCSEQLKLRDIDEYKHTDTPYPRGE
                     ICLRGPFLFKGYYKQPELTREVLDEDGWFHTGDVGSIDCEGRVSIVGRIKALAKNCLG
                     EYIALEVLEAVYSSHPLVLHNCVCVLVDPCKNYICALVLTDESHVMRFAKANGIEGEY
                     PSLLEKKELLEKAAASMAETARAARRRDFEVVRRVSLIDDEWSPEKGQLTAALKLRRG
                     AIAKQYEKQITCLFAE"
     gene            <130947..>133070
                     /locus_tag="LMJF_01_0500"
                     /db_xref="GeneID:12983144"
     mRNA            <130947..>133070
                     /locus_tag="LMJF_01_0500"
                     /product="putative fatty acyl CoA synthetase 2"
                     /transcript_id="XM_003721524.1"
                     /db_xref="GeneID:12983144"
     CDS             130947..133070
                     /locus_tag="LMJF_01_0500"
                     /EC_number="6.2.1.3"
                     /note="previous protein_id=AAC24658.1"
                     /codon_start=1
                     /product="putative fatty acyl CoA synthetase 2"
                     /protein_id="XP_003721572.1"
                     /db_xref="GeneID:12983144"
                     /db_xref="GOA:E9AC41"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:E9AC41"
                     /translation="MDIPSHCSSLEATVLQLMDDANARRVVPDPRAMRYQQLGDENVA
                     LEGTESENSTPIYRQAKVTDAMQRRLENEWYNGPNFVQCFESMCKSRGSKRALAYRPI
                     SRVSHQLVREPESGLERLFEVTCYDATQYLTYDDVWTVVQNFGRGLRELALTPGCKVG
                     MYLETRWEWLASAYGVWSQSMVLATVYANLGKEALSEAFAETSCAAIVAVGERVPSLI
                     AMMRSGAMPHCILIYLDTLPEGIDATGVTLKAWEDVVRDGALSSYPLNLPTNNDDVSL
                     IMYTSGTTGGPKGVMHTYGSMTAGINGMGGRLNELCGGVEPDERYCSSLPLAHIFEFT
                     VTNVFLARGCWIGFGHTRTLLSTYARPHGDLVEFKPIFLIGVPRIFDSYKKMMETSLA
                     QRGVLERKVFEHAFASRLKYLHAGMETPFWNEVVFAPLREMVGGRVRSMFGGGGPISA
                     PTQNFMNVVLGGFIQGYGLTETVGNGPKQLVGDLEPACVGRLEMACEMKLVDTPDYKH
                     TDTPEPRGEVCLRGPMLFKGYYKKESITKAAIDADGWFHTGDVGAIADRGRLRIVSRI
                     KSLAKNALGEYIPMESLESLYAQVSLCVPNGVCVVVHSAKYYVCAIACTTESKAMVFA
                     RQHDIQCEWPAILKNPDFQKAATEAFRELAINAGRGKQEIVRYVHVVGDQWTPENDML
                     TAAGKLKRHAVAERYKDLICSLYVD"
     gene            <136526..>137110
                     /locus_tag="LMJF_01_0510"
                     /db_xref="GeneID:12983145"
     mRNA            <136526..>137110
                     /locus_tag="LMJF_01_0510"
                     /product="putative fatty acyl CoA synthetase 2"
                     /transcript_id="XM_003721525.1"
                     /db_xref="GeneID:12983145"
     CDS             136526..137110
                     /locus_tag="LMJF_01_0510"
                     /EC_number="6.2.1.3"
                     /note="previous protein_id=AAZ09193.1"
                     /codon_start=1
                     /product="putative fatty acyl CoA synthetase 2"
                     /protein_id="XP_003721573.1"
                     /db_xref="GeneID:12983145"
                     /db_xref="GOA:E9AC42"
                     /db_xref="UniProtKB/TrEMBL:E9AC42"
                     /translation="MESLESLYAQVSLCVPNGVCVVVHSAKYYVCAIACTTESKAMVF
                     ARQHDTAKVAEGRHAIGGVRRVSDHWTMEERDRLPRSNKRREGYCSPCSRAACEAEQS
                     EREQGQWRADDDVDRHDEAHYDLWPCLRRHPPHSNTTPHCDNDFVSFFPSLSQFFTAA
                     EADGGRPRGRGRHRLAYGGLTGSSTESSSSSRGC"
     gene            <137710..>139857
                     /locus_tag="LMJF_01_0520"
                     /db_xref="GeneID:12983146"
     mRNA            <137710..>139857
                     /locus_tag="LMJF_01_0520"
                     /product="putative long-chain-fatty-acid-CoA ligase"
                     /transcript_id="XM_003721526.1"
                     /db_xref="GeneID:12983146"
     CDS             137710..139857
                     /locus_tag="LMJF_01_0520"
                     /EC_number="6.2.1.3"
                     /note="previous protein_id=AAC24659.1"
                     /codon_start=1
                     /product="putative long-chain-fatty-acid-CoA ligase"
                     /protein_id="XP_003721574.1"
                     /db_xref="GeneID:12983146"
                     /db_xref="GOA:E9AC43"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:E9AC43"
                     /translation="MGGCVVSVMAKRNAAQVMPDPRAEALERRRAQCGGNFVQRVPGT
                     ESEHASAIYRIAGVTAEQHEAILAAAAARPTFYTTLMRHCAERTDQRVLGYRPVKCVT
                     KEPAPSKSSGSTSEPAKKERLMSITHFDEVVHVTYSEMEERIFHFGAGLAALGVTANG
                     NVSIYLDTCVEWLIGIYGIWSCSAVAATVYANLGEAALAHALHETESQAILCGSVNVA
                     NVLKLMKNGVMPQVPIIHVGALPASLDTHGVQVVSFKQVEMIGAAHLEGGAAKGTGPL
                     NDDDLALIMYTSGTTGDPKGVMHTHRTLAAGLHTLEPRVIDLLGQPRPDDVYLSYLPM
                     AHIMEFTITNLFIFRGAFIGFGTPRTLTDTTARPHGDLLTFNPSMLAGVPRIFDTLKK
                     AVEAKLPPVGTLKRQVFDHAYQSRLAAMKEGKDTPFWNEKVFAAPRAVLGSRLRIMLS
                     GGGPLSAATHEFVNVVFGRVVIGYGLTETICVGAIQIPGDTETNVTGLMEPGQEIKLL
                     DIDEYKHTDTPEPRGEMLSRGPYLFKGYYKQPELTREVLDEDGWFHTGDVGSFTADGK
                     MRIVGRVKALAKNCLGEYIALEALEAVYSSNELLQPNGVCVLVHPDKPYITALALTDE
                     ARATSFAAKHGIEGTYPALLKDQRFQQAAAISMADTARASNRASFECVKRVRVIDDEW
                     TPENEILTAAQKLKRRVIDAQYAQTIAELFADD"
     gene            <143750..>148573
                     /locus_tag="LMJF_01_0530"
                     /db_xref="GeneID:12983147"
     mRNA            <143750..>148573
                     /locus_tag="LMJF_01_0530"
                     /product="putative long-chain-fatty-acid-CoA ligase"
                     /transcript_id="XM_003721527.1"
                     /db_xref="GeneID:12983147"
     CDS             143750..148573
                     /locus_tag="LMJF_01_0530"
                     /EC_number="6.2.1.3"
                     /note="previous protein_id=AAC24660.1"
                     /codon_start=1
                     /product="putative long-chain-fatty-acid-CoA ligase"
                     /protein_id="XP_003721575.1"
                     /db_xref="GeneID:12983147"
                     /db_xref="GOA:E9AC44"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="UniProtKB/TrEMBL:E9AC44"
                     /translation="MGALLVTLLQCRNNQSLYPNLSATHHNQYVSCRQPCSVPLLADA
                     RAYGRQSHQHSSLMTSTTATMPTDAAGDEATSGPPVARRVQSTHAGTPSSTSFAGAVS
                     DMRGADKQPVNLSKVCQDGGATGATTVDADGDAAAAISRLLATKSTPTPAVGNALCTN
                     TLPTVPPLSSARMASPPSATPPTQPQNCPSLPSATVFMPSATAAAPLAPTAPLKRQCS
                     NDAESRLAMLLPATSMPMPTPTLAAAGGLSLTSQDAPVATDCDTVKRMALPGDNAAAA
                     RPGAANNAGGNVDIDDDELGPMDCADAFQYFFDEDEGVYRDVESAVYAAPQMAHVSMP
                     VLRDHYLSLRTALCTEKSSAALTTPSVPPLQGGSVAPTIPSIFLLGASANAGGGGVAI
                     KMAAWSLAQQPPPQQALKALGRPQQTPLNLHDALHASLTRALLETGEDLDDNAHNAAT
                     ANDVAAADAPSGLPPGAGRFVSLVQEMAAACRRIGAAPFVCWRSIDRVTALPPENPLW
                     RRLHNGGGGRVDNAHGEAEDDTSCPPVSDAPRKRRSHPSALPDGVGGSGTEAHPSSSQ
                     QQSESLSLYYLGPQQYMTATVWWSRVEAFGFGLRSMGLHPGDLIGIVEDTRWEWLVTC
                     YAAWSVGLVVVVFDSSARTMARVAMDTAPDMKALVCSPMVHRDVRRHYDAAAAAAAAA
                     ARSARAPAPVTPTASCDMTDCYGGEEDNDQHSHSACASGEAAAATWTGQRGKHDSAEA
                     TAPSERTAAKPRTKQPAPPPMFIVIRSAGPPRGGRSDGGDGRASATAAPRPWWSRTSM
                     RERQPSHQAHGVTAEGHDEVVDAEEEDEEEEALWWSDVLMHGETKLKVWRQRKLRERR
                     LQHQQQARLRHLKPQQRGARAGVGGNAVASSPPSSASLRRPRLCGGIGTDDLRGATSA
                     AAASQDGSTTSVATSTQPGPTEAVSDSGTATACATSCAANTMPIMLVGAAAAATRDGK
                     SGGSASFSSNDAARRALVPLRERNALTESPPRGSSGRSLSTLPAASALAGSAPTIAAP
                     LMMIDDGPPQLPLAPLQPDDLAFILYTEGDPKGVLLTHGAVKASVAAHHEYLNSTDVD
                     GDDGLRRVAGGCDALTGTATTSKNSGSTAESTGRGGQGSSRIARYTTAYMPALRSRTA
                     PAGRPSYMAYLPLHDICEFVAETASLLRGLLVCYGTRRTLFDTWARPHGDLTEYKPTI
                     FPALPATLARLRRTVESMVSTGYRQLLFEAAYEARRQAVRRGLHTPFLLSTIFAPSRK
                     LLGGRCRLVLIRGGPGAAALHPRDQEYVEVVCGASLVQSYGVAETAGCGLQQAYCATQ
                     LDSIGGPLGPVHVKMRDVFATGATFVGSAATAAAASGSGCSPGWRVWTHQSERPTGEL
                     LLRGPTIMAGYYRQPEKTAAVLEKSGWLHTEEVVERCPDGSFRRIASLRPHHATTSNG
                     HCVALEPLEALYAQHPLCLEGGVCVLVHPYRRYVCALVLTDEHHLRNFLQTTAAAAAT
                     LPSPHSQPTSPTSPLPSSPSPQRLLNWAALLAGEGWPQCLGDPALNQAAAASLAAWAT
                     QHGEAAPHERVRHVRVLYDVWDVAHHTRTATGRLFRPAIHYRYSGVIQELFAEED"
     gene            <149673..>151652
                     /locus_tag="LMJF_01_0540"
                     /db_xref="GeneID:12983148"
     mRNA            <149673..>151652
                     /locus_tag="LMJF_01_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721528.1"
                     /db_xref="GeneID:12983148"
     CDS             149673..151652
                     /locus_tag="LMJF_01_0540"
                     /note="previous protein_id=AAC24661.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721576.1"
                     /db_xref="GeneID:12983148"
                     /db_xref="UniProtKB/TrEMBL:E9AC45"
                     /translation="MTSRVQLDFFVPPPERRQCVRERLAQQRAPMFEWRHDFAESAFD
                     AATGERRPLRRIFNPVAKERPASVRRIHAAAHNAGAHAAATTASSARPATAPVWEAAA
                     SGSADRRSAWKQSGFRFTENYFRKSAHLPVSQLRPHTSASASGLLRSARRGGVYVPYL
                     HDTILFCEPLPRSMELHRGGPGGGGGGDGAAAAADQLPPVKRPSSTASVVLAVTCNAA
                     ESRARELQASVDAKRAALLGCSKPANCLYAAGVKSFTCDDDVSTGATAQGETCCDVVG
                     PSIAAKQRALAMAEGVYTDLILNRGKAWSATATAAAAKTELPTGELAYSLRPSYVQSR
                     LRRTAGRRSSSSQNLGTAGIVSDRYSASLDEVMSGTTQHTTAVTSPMMACVSAPHIRG
                     HRGNGVSGPPSERAITRSPGNDSIAGTVPLAATEVALADTITFVRRSGSTAYHSSTTA
                     APPPALSPMELRHDVEDTGKTRSPDGVRGLATSKTSPTAAAAGLRAGHRQGLQPTSSS
                     LPSHGNTQRQSDSNPLLHQLYRTSNSTDSPTYLRTYGDAGGSTIAGGSNYGSGEGGGQ
                     RHRRDGRDARDSPHQSPLRPRGGGDVSNDAQQEHHRYQRPFTAYRLPTESKETRVYAV
                     QLRGLCNADPSLLKRAEPLRRGIPVMLPPDWQPNC"
     gene            <152788..>153657
                     /locus_tag="LMJF_01_0550"
                     /db_xref="GeneID:12983149"
     mRNA            <152788..>153657
                     /locus_tag="LMJF_01_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721529.1"
                     /db_xref="GeneID:12983149"
     CDS             152788..153657
                     /locus_tag="LMJF_01_0550"
                     /note="previous protein_id=AAC24662.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721577.1"
                     /db_xref="GeneID:12983149"
                     /db_xref="UniProtKB/TrEMBL:E9AC46"
                     /translation="MGQTKLSRAPRQPHHSADPTAEAAPTPSFLVYPVPSIADASFLQ
                     IIFCNTVRRSLFLGFGRTRFAVAELTSAAVAAEVEAIIHKAAAAVAGLEDGAAASQEA
                     SGLAADAAARHGALERLANDDAFEHMTLADLFAPPPGGSSSQGSASAPRQEHQPSSNG
                     GGGAAAGGESLDFSHIPYLVWRGRPVHVVVSGVRVADFYGSGGAVPEHRVKRTTDAEE
                     QRSSTNPKRANTGKRTRDDADSTAALSSSPAADQRAVAEERAQGSGLMRRDDGGIHRA
                     QVTLPKGPLPEVR"
     gene            <154977..>156839
                     /locus_tag="LMJF_01_0560"
                     /db_xref="GeneID:12983150"
     mRNA            <154977..>156839
                     /locus_tag="LMJF_01_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721530.1"
                     /db_xref="GeneID:12983150"
     CDS             154977..156839
                     /locus_tag="LMJF_01_0560"
                     /note="previous protein_id=AAC24663.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721578.1"
                     /db_xref="GeneID:12983150"
                     /db_xref="GOA:E9AC47"
                     /db_xref="InterPro:IPR010541"
                     /db_xref="InterPro:IPR013881"
                     /db_xref="InterPro:IPR027104"
                     /db_xref="UniProtKB/TrEMBL:E9AC47"
                     /translation="MPPPPPPLPSSASSSAQSPSSTHKPARKPLSIDDVTIDFSAIAT
                     TSGGATAPTSAASGAIPGLLDIMATQQQQYDGDGGAQYRGGGRRYQGVSDVRAFDPGL
                     QGVMQRYTSRAANAAGSVGGGPARRRKIVFGAQQQQQHASAEDPAPQTPSAAHSVEPA
                     PLSSLEATQAALDFLVEAQQQQTSAAAVQQRRDAYLAQLRCFCQRGRGADGHGAGSAH
                     AEAPATAFPDGSHAQTNSLLRQLFADGVPDIEPWDRWTSTMPRYGSISNSGGGAHLVV
                     SPLTATVAQIRAAQLDLVHHPVIPDTHYTQHYEYRDLEHPVIQKEYKTKEQLRAERRE
                     RLKEKQARAQQKAAAAPDVGALHDITGSSRGPTVLASSAASRLLHDRLSTKNLALNLF
                     GSSVLNPLATDTKVLEQYELRNLEHQRRNHDRHVAALPDQILKRARDQRRHATEAPLL
                     RAYRVFPIFSAAHLGKLRNFANDNLLRGFVLYVGDCDAVIVLAGGEVAARHLDRWIMH
                     KMDWEHPDTRAVRLCSVPLMDAGSFSFHLKKARGQPHKRATTAAGKRDGRLDDVDGDD
                     AAEPVFINMVPTVEEAEAFLRRLPAPSSPWSDLCGVWRAAFLRDGLQLATGGHH"
     gene            <157437..>158417
                     /locus_tag="LMJF_01_0570"
                     /db_xref="GeneID:12983151"
     mRNA            <157437..>158417
                     /locus_tag="LMJF_01_0570"
                     /product="putative tricarboxylate carrier"
                     /transcript_id="XM_003721531.1"
                     /db_xref="GeneID:12983151"
     CDS             157437..158417
                     /locus_tag="LMJF_01_0570"
                     /note="previous protein_id=AAC24664.1"
                     /codon_start=1
                     /product="putative tricarboxylate carrier"
                     /protein_id="XP_003721579.1"
                     /db_xref="GeneID:12983151"
                     /db_xref="GOA:E9AC48"
                     /db_xref="InterPro:IPR004686"
                     /db_xref="UniProtKB/TrEMBL:E9AC48"
                     /translation="MAAATFSMEGSKYEMSTFLGRARYWSEAINPMLLLENERTLQKH
                     QMLLDRWKDGQAGNVPSADLWRARMAVESCIHPTTQEVIPPGFRMSMFLPMNYLVVPF
                     MMLPSTLMSVGRTVAIQWFNQSYNSAVNYANRSSDKQPVSEILKAYTAAVVVACGGSL
                     LATMWLKRIPTGTTTSTLIRATVPFLAVSCAATVNLASMRKNEWLSSGQGIRVVDDDG
                     VTRGTSTAAGWDSLKKCSVARVLWNLPCMMLPTLSAMPLMRISPFARRHSALTECLLQ
                     LLGLTLGVPLALAAYDLHQTIPVSKLEPRFHNLKQRDGSPVQTLRYYKGL"
     gene            <159196..>162105
                     /locus_tag="LMJF_01_0580"
                     /db_xref="GeneID:12983152"
     mRNA            <159196..>162105
                     /locus_tag="LMJF_01_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721532.1"
                     /db_xref="GeneID:12983152"
     CDS             159196..162105
                     /locus_tag="LMJF_01_0580"
                     /note="previous protein_id=AAC24665.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721580.1"
                     /db_xref="GeneID:12983152"
                     /db_xref="UniProtKB/TrEMBL:E9AC49"
                     /translation="MSSASKPRGAALSFSFSSPAPSAAPTAVAVPARTPAEPATAIAA
                     ADKDGAEAERRPRGWTPIEDGRFRIALTHPRASSDADTGAALSSFTNAAPEDLSGADA
                     AAAAASSLCEKVCGTLSDNARCNECRPSEPHIEVRAEASLVNAINSAYTSTGYPFVVT
                     AGSARGAVYGSFIDLSNPTLSSLELPPPQSIIVAPSYVGDADRLPAHGLTEMDTLLAI
                     RWSRGDRIVKTAETAPTVAAAAQAKQTSPTTAAGAAGIPYTSAVTRTIAHHLSQFPEG
                     IHAIHSSPALRQLLVEGTLPTTLASTPSAPVNAAAHAPASASGGVGSGSAAAAAPSTT
                     TTTSTVPRLSDAEANVPPLPTPPQSNAPVQHTLVSASTFNHISVYFVAHQDGKLLYTA
                     PIQSLSASIATRKVTAHQPILVGREEVDALVEDPFTPFPTMPPRRTRIAFAPIPVAGE
                     EAAVFFASKTTSRFVGADARRKTVAAAPVRFSVEPHLLIGNQNGDIFLFSLLQERVVQ
                     HLNYHVGRPSASASLAGGSKGAGNKLVYSPVSCIAEVRNGVETTITRMIESAAMAKRN
                     CRQSFDSDGIPTGFNAVAHAAAPSHYYYDVPPSLYAVGFDDGQMLIVGVTCEGGWMLR
                     HLSNHHFGMRPIHSIAVRVPSFYTRLWTSYLPPITFADRGSKSAVAALPPITTLITAE
                     SALIVHEEEQLVAAISCNGGSIAVVRLPGMEIISSVAPTAYNAVGEILALQWAATSPR
                     YLLTRDILVASGEDDTMTAFQLLTQLLVNTSDRNHHDGNGNVSHMSSTEYVPASARLR
                     ILEKTRFHRSWVSRLNLMPVVVPAATANAKAAGKSSSGGMPQYLGVCLVASSYDHRTS
                     FWPYMFSGQQQGVGEAGGPGSANAAASAWSVSEGAGSMEHADSLMSGLTSNNIPLRTI
                     SVPDRYVLVDGPTTAYPLHPELVVDAAAAGAGTSFFLTTVCCRGKVKFWSVQVKV"
     gene            <163208..>164482
                     /locus_tag="LMJF_01_0590"
                     /db_xref="GeneID:12983153"
     mRNA            <163208..>164482
                     /locus_tag="LMJF_01_0590"
                     /product="mitochondrial RNA editing ligase 1"
                     /transcript_id="XM_003721533.1"
                     /db_xref="GeneID:12983153"
     CDS             163208..164482
                     /locus_tag="LMJF_01_0590"
                     /EC_number="6.5.1.3"
                     /note="previous protein_id=AAC24666.2"
                     /codon_start=1
                     /product="mitochondrial RNA editing ligase 1"
                     /protein_id="XP_003721581.1"
                     /db_xref="GeneID:12983153"
                     /db_xref="GOA:E9AC50"
                     /db_xref="InterPro:IPR012647"
                     /db_xref="InterPro:IPR021122"
                     /db_xref="UniProtKB/TrEMBL:E9AC50"
                     /translation="MPLPRNQEDFSAYTEIDLPTETRIDAIRRTGIASQEWVACEKVH
                     GTNFSIYLINESEVRFAKRSGIMDPSENFFGYHLLIDDFTAQVRALCALLKRKYGVTG
                     RMGRVVLHGELFGAKYKHPLVPKSTKWCTLPNKKRIPISGVEIQSEPFPQYSPELHYF
                     AFDVKYSVSGAEEDVVLLPFDDFTEVCSQVPNLLYAKPLVRGTLDECLAFDVENFITP
                     LPALLGLGNYPLEGNLAEGVVIRHVRRGDPAVESSGVSTIIKLRCSSFMELKHPGKQQ
                     ELKATFLDTVRAGALQRVRRGKKVTVLADSMLPKLEAAANALLLNNVSEGRLSNVLSK
                     IGREPLLTGDVKQEDVVLMLAQDALKDFLKETDPVVLNTSLSFRKTLIRSVYFAAEEL
                     LQGEWKRVMDRLKASQAEIDAAAAAQEKAEAQ"
     gene            <165646..>171000
                     /locus_tag="LMJF_01_0600"
                     /db_xref="GeneID:12983154"
     mRNA            <165646..>171000
                     /locus_tag="LMJF_01_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721534.1"
                     /db_xref="GeneID:12983154"
     CDS             165646..171000
                     /locus_tag="LMJF_01_0600"
                     /note="previous protein_id=AAC24667.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721582.1"
                     /db_xref="GeneID:12983154"
                     /db_xref="GOA:E9AC51"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:E9AC51"
                     /translation="MGMDVALPAGPAGARGAGRVLAARRSLADAAPPSSHRVLVDVDG
                     LRCEVRSMRSVPHALYSTPSVSHVLATYVQQLIDDFTHSLLLCRPAQRSSSSISSRVI
                     QAESGDPQRQQQLQSSTTTTLCAADLTVDGALSSDDEEAYLLLRLCHPHKAEQQQQQP
                     SESSGGDASAMPGGRRMAGANTGSVAEQLIALFAAADRACCRHGPSGGAREEDSEQHD
                     AAVLMPPLLSSLLRFKPMLHDMRYLAQHLLLPRHAWQQHQREWVIVYEDVAVTLRDRL
                     SRYRRAAIRSRGRDGEAATNDEDSAENWDAASILTDRQRLFPVSELQHLWHTLWELLG
                     AAWRQRDRLWGAYRYLHGPRRLPPLCLSGQAPCAVPPGVHACPITREHYEAYIARVHA
                     SAASPSHAVPDVPAAPHAEDTCAFGPFTSAEIGISARRLYVLRQPLAAVLRTLRVSAP
                     PAGRDPLVTSVTALAGFQNVDDPGPSGQANTPAPTTDVATPLIVPLFDTTDQDALLAA
                     GAVPYVSPEVYVSLQQEQQRQRRRGASCSAPSMVSWPPVHSFSDDVWNAAVIVLEAAL
                     SGFCATDASMCHLALPSVHGSGADLSDQRTEISRPSSSSSVYSGVLLLLTERHVLPRA
                     AAHNFLYAALYHLQAALSKGGCEDADDHGDVDGAKARRQGSGSGDSSTAAAVPSPTRL
                     AREWVRYLCSAYGPACLKDGGILAEVASKGLRWRRSERWNAFGMAHVTATTASTTAAC
                     ADGWPSASPFTPLETVDGAGGNSRAPAGAAEQRRSTHAGGGPSSPTYLSTPAPPLAER
                     LSGRHHSPAAFAVSALADTSVGVDAPGDADGGRDAAALSRLSQRLDRTFNALETPLLR
                     LLNLGHCRAAPEEKAGSAGVSPAGPKLSRAAAATVDRPTCGAADDAGDLWAVLSRYLR
                     RCTMTAAATGASATSAGKANGAVAEAADADCVDELLRLLFCCLVRTTRSYRVHDGART
                     AFADDAAGKGDAPADVEWCQYAAMNHPFFRGVAERGLLTTCMTAACRNGSGGGGEFSD
                     FAFATATLPALNLYVPAAVLLATVREMEATQKVSGVDVCPERVVKQATSLRALIGDDM
                     RTWEASAAARGGVSGGRMHQQPQQHLLLANPFMDMAAASLLPPPVYRARRALDGVLSP
                     IDFDLAAQLDHTQHLRRLLHSGSDDAAGDNRGRGGEGVAAARIRAYLKSSLMPNTERG
                     TDSVDAHVVYSPFYPLPPTLRGEVWGCLLRVPPSARTREALLAHAVHHTAAKPTPHDR
                     QLSVDIPRCHAYHPLLNSSSGSAQLKRILRAWLYLRPEHAYWQGLDSVCAVLLTVSNR
                     DEALVLAQLNALVNRFIAHDEDRSTVPSGGSSLGLPRAGAVTLPLPPARKPTMAEQLR
                     CLVVMLRYCDPLLAQHLFDVLGCTPELYAISWLLTLFSHSLPARKVYLLWDLLFVEDD
                     VACLVVLCAVVIIYRRELLLSTDFSGCLASFSSGASAINVAAAVGDARWLMRAVPPSV
                     LAPPPVSSVDGKDAQESLYGRGHDGAGAAIDRPLDSSGDDGNGVAAVALLAVEDVAAA
                     LAASATATSDGGDCCREEGRSGPHWFDSGVYLVDVREQPTENALRDSVLGAISVPLYT
                     AALQPREGSDMRPSAVTDEVGDVDSDAAGAGWGIVEQQERMQEQQRAEQDAAARQVED
                     AAAAIVRHVGNPAMAAITPRVWRAAKNHAAPPLPPPQPSLISCPWPVHPIVLKASRAP
                     HVVLLTSGVVDAHELPLAHQLGVKLNACGVHNVSILRGGVASVRRALPELVVRRAPST
                     "
     gene            <172003..>172734
                     /locus_tag="LMJF_01_0610"
                     /db_xref="GeneID:12983071"
     mRNA            <172003..>172734
                     /locus_tag="LMJF_01_0610"
                     /product="DNA-damage inducible protein DDI1-like protein"
                     /transcript_id="XM_003721535.1"
                     /db_xref="GeneID:12983071"
     CDS             172003..172734
                     /locus_tag="LMJF_01_0610"
                     /note="previous protein_id=AAC24668.2"
                     /codon_start=1
                     /product="DNA-damage inducible protein DDI1-like protein"
                     /protein_id="XP_003721583.1"
                     /db_xref="GeneID:12983071"
                     /db_xref="GOA:E9AC52"
                     /db_xref="InterPro:IPR019103"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:E9AC52"
                     /translation="MDERQLELQRRIYAQIQQQQIDENLANALEYTPEAFAKVTMLYV
                     PCTINQVLVKAFVDSGAQNSIMNKRTAERCGLMRLVDVRMRGVAVGVGRQEICGRIHM
                     TPVNLAGMYIPFAFYVIEDQAMDLIIGLDQLKRHQMMIDLKHNCLTIDNINVPFLPEN
                     DLPALAALGDDENAMHAPRHQDPATTATTASNPAAPVLSEGERQARIEGFMTVSGITD
                     PTQAAELLEAADWNPNVAAALLFDT"
     gene            <173484..>175259
                     /locus_tag="LMJF_01_0620"
                     /db_xref="GeneID:12983072"
     mRNA            <173484..>175259
                     /locus_tag="LMJF_01_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721536.1"
                     /db_xref="GeneID:12983072"
     CDS             173484..175259
                     /locus_tag="LMJF_01_0620"
                     /note="previous protein_id=AAC24669.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721584.1"
                     /db_xref="GeneID:12983072"
                     /db_xref="GOA:E9AC53"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:E9AC53"
                     /translation="MANPPAHGIASNCVLNDAAASPTASPCYSTGAMPQEQSKMLAGM
                     LAKLPELDLGEMSRVKSCFSAVLGEGRENIVNALELRVVLGELGLYPSETELNLILRA
                     YRDRVNLITLTQYLRLYKKEFWVNHAAAVAAAAPAAAGGAGAAHSASLSAAPHSYKVF
                     SGSHSMVAARAGTFGVSGGKDEDTLKAFVALGGEEDGSGEILASTLRDAICGFGLTID
                     IDSMIRTVDVHNSGVLDYVDFCALWSQPTSTSSESGEAGGAGVPMGEALLRGSVDNAG
                     LDAYRRRSSHGSAMSDTHQRLMSLLAATPRLTSPAGGVLRRRSQMMTQVPEQTSTSPR
                     TRRCSPGGTQFSQNTNGRVTTAAYGPLTGGTGNGHGSDGATAFNSILTPPPTSITDEE
                     HMILVEMYLFPEKYKAMGRALRFAAASGSGSLVHGAAGREAALHPSSLYQKRLSHPSV
                     SGSRSRSRRQARGLGNTSGGASAIRAVSHTAGRRGKSGFAGGADGGNAAADFFPPKSS
                     NVYRPPSPMILSMRNSTVYRNRLKRLEEQKRVRKGWKPPAGAAATQQLQHRISYAATA
                     TRGGGDGPGDMEHMSSTPPPKTSTW"
     gene            <177728..>179605
                     /locus_tag="LMJF_01_0630"
                     /db_xref="GeneID:12983073"
     mRNA            <177728..>179605
                     /locus_tag="LMJF_01_0630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721537.1"
                     /db_xref="GeneID:12983073"
     CDS             177728..179605
                     /locus_tag="LMJF_01_0630"
                     /note="previous protein_id=AAC24670.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721585.1"
                     /db_xref="GeneID:12983073"
                     /db_xref="UniProtKB/TrEMBL:E9AC54"
                     /translation="MLASSLHTAAAAAAAAATVTRFVTHSSNLSSRVTGSGACEPCSA
                     PRACPRERAMQHALVHVLQRERVRALIARALHLWHLHCALRQHGRRHGDRETAAGVEG
                     RRETPSASSTAKGHAFYRSRHVGEPYLCSVQTLRSPAAPAAVLSVTAWLTEAARPSAS
                     RLAWTPLGGVGIGVLCDGIATDEGTAYVDANDEEELHDVDDDAEVPRRTELHRCQQQR
                     HHRGRRCTDDNSSLSDADAYVDGTYNRVDNPGTSARPLVPASRSSVAPVIGAASRVTS
                     IVPPLSALSNASQSQSPARDMSFTPVRWSMSCPFQTLLQPQPQDGLCSPSFPHTPVTA
                     SVRETRTADGAGVSLSVGSAAPAGAGAGSPRSAGATGATVTAEVAAERRKRMVQHLLS
                     SGVGGGSTSSFDDSCSRLQSCSQSDREAIAAQGGPPLCLRRPRSGSGGGAGLIASDSE
                     DRSISSLINTPRSHQTDAASSFSSAWGPLKDSDSMHSDSTSPMPTVTATTVPQLLTRE
                     AEDRLAVQATEERRRLRLQHGMTVVMDRLMMAALHHRSGERGLHPSLRTSTAPSPLPF
                     EINDGCGIDFLCACTTETQNESTTWGSAGAIEPAASAPKPRSSSPSPVRQAATSRRTQ
                     R"
     gene            <181458..>184796
                     /locus_tag="LMJF_01_0640"
                     /db_xref="GeneID:12983074"
     mRNA            <181458..>184796
                     /locus_tag="LMJF_01_0640"
                     /product="HSP70-like protein"
                     /transcript_id="XM_003721538.1"
                     /db_xref="GeneID:12983074"
     CDS             181458..184796
                     /locus_tag="LMJF_01_0640"
                     /note="previous protein_id=AAC24671.1"
                     /codon_start=1
                     /product="HSP70-like protein"
                     /protein_id="XP_003721586.1"
                     /db_xref="GeneID:12983074"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="UniProtKB/TrEMBL:E9AC55"
                     /translation="MHRTSHLRLRPCMPSSSSSSAAGAAAARRCGGRCRLPRSAQPWM
                     QLLLLSLALFLLGAIDFALPRRCTSLFFVRAAGDAEVANAAAAPPLLAITETALISVD
                     FGQESMKVSAWRAQQQAPRIGMAEGGDAATATSTGSVTMVLNDQANRKSPPCVAFRYV
                     RDPAATAGRGGVSTDAGPSGRADGEQLPAHHPYTALHPRGYQLERTFAEQAQALAPRF
                     PEQVVCSAAQLLGCAAAPTNAAVVESRACALTSGQLTTTTTYSYHVVPLTAPLSAGTT
                     TGNSMDEAQQRRDNVVGRQALGVYVPFFTTSNAPGQQWRWAAGDHSTGVAAAAAEEEA
                     GVLFSSEELTAMLLGHARRMAEQMDAADNTLSEEDERLLAGMRKSARRVDAAAGATRA
                     SSAIRYAALTVPAHASVAQRQALVDAAALAGLRVVRLVHSTTGAAVQLAYLKAEQVLT
                     ADRVSYVMIYDMGSQHAEVAIYSLAAPPASVASRARLRGDVVMQALVGSRTLGGAAFD
                     ECIANHWDARYFGRRVMNGGLAAAGGRDAARREAARERGSLLRAAQRAKEMLSANNDA
                     HVTIDGVRAEPSQFDAVGRQELQQRHVAVTADGGLLSLRLTRRDFEEWCRPLFDAAVA
                     LRDEAIAATGGGVKSLGALDRFEVIGGGTRVPRLLQRLGEGYRSGVVDRTLNSDEAAV
                     MGTTLLAVSSAPRTLGLRLGQALPRYHVREWLTSAVYASMELHSTGTVAAAAAPSEVQ
                     LLFAARKTTLPATRSVRVRLPDVDVSPADNVVITLYSGAEADSAYAHSTRSDAAVAAD
                     SARAAASPTLMANCTSCYVRTCTVEGVRKAAEQLLAPYTQQKTQHGSARPRRERVRLA
                     GAEVVVEVVATVSGIPHCSIAYLRAEVEEAGVDPNAAEGIQGSNAAAGAATVASLPNS
                     DHDGTAAGVPPATQHDEPSEGVRDEHEMNANEEEVKHTGARVTPKGTADPATVDATAT
                     PPPQWQVRVIALSLRVSSGAATAAAAVHGLGYNMDFAELTFSHRRVRQLQALDDVRLR
                     RSTLRNEIESVLVWIKEHHPTWDAEDVQDDASPSSLALRTWRTTVREVGGWLDDVGDT
                     ASATALEERLRIIAGVKAALREAA"
     gene            <185785..>187269
                     /locus_tag="LMJF_01_0650"
                     /db_xref="GeneID:12983075"
     mRNA            <185785..>187269
                     /locus_tag="LMJF_01_0650"
                     /product="putative mitochondrial processing peptide beta
                     subunit"
                     /transcript_id="XM_003721539.1"
                     /db_xref="GeneID:12983075"
     CDS             185785..187269
                     /locus_tag="LMJF_01_0650"
                     /EC_number="3.4.24.64"
                     /note="previous protein_id=AAC24672.1"
                     /codon_start=1
                     /product="putative mitochondrial processing peptide beta
                     subunit"
                     /protein_id="XP_003721587.1"
                     /db_xref="GeneID:12983075"
                     /db_xref="GOA:E9AC56"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:E9AC56"
                     /translation="MLRRTSAVAATAALPHNMTMKDPLCQQVLSRCTPVVYSALPNGF
                     RVATEYVKDCPFATVGVWIDAGSRFEDIRNSGVAHFLEHMNFKGTDRYSKSDVENLFE
                     HRGAHFNAYTSRDRTAYYVKAFTKDVDKMIDVVSDLLQRGRYRRHDIEAERPTILAEM
                     REVEELVDEVLMDNVHQAAYDPTTSGLPLTILGPVENIAKNINKSMIEDYVRVHYTGP
                     RMCLVSSGGISPDAAHALAEKYFSGLSSMNNRPLLRGVYKGGHTVLWNEGMATANTAV
                     AFPICGASHPDSYPLQLIHNVIGQFREGQYDQFSSQRRNPNLPWERVPNLVQLRPFYT
                     PYEETALLGYHIVTARMATSGVARDDAQTLMLNYVLSSLYDLCATKVEDSLLEAAKAE
                     FKASVMMMRDSTTNSAEDLGRQMIHFGRRVPLQEVFERVDAVTPESLRAAAEKYLGVV
                     QPTVSCIGASSTLPKYDPLSLVSNVVHPQLTPAQFPEDARACPL"
     gene            <188567..>193030
                     /locus_tag="LMJF_01_0660"
                     /db_xref="GeneID:12983076"
     mRNA            <188567..>193030
                     /locus_tag="LMJF_01_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721540.1"
                     /db_xref="GeneID:12983076"
     CDS             188567..193030
                     /locus_tag="LMJF_01_0660"
                     /note="previous protein_id=AAC24673.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721588.1"
                     /db_xref="GeneID:12983076"
                     /db_xref="UniProtKB/TrEMBL:E9AC57"
                     /translation="MTPTRPSRISLLAAPAPVPLDAQGHVCHARAAATAPATVVSNAE
                     EVTEARGSCAPLHASREDTRDRDSPVAAPQRQQPALNAEDEWRWRASRPASSASSSSS
                     PSAQDEAHSDRVVYEDGQDGGEEAADRSSEWRHSGADGASDDAEASSSTALHPPSPPQ
                     LHQQEASPLLPSLTPVATACTQQAKPPSTTAPPGLESDTPPPQVVSQGKGTDPAKRLC
                     TAVAPASGRATLTASPPSPSPGMWVSCAHSDLPARYRDIPGYYCTYCSYTVCVDCFPL
                     TNLREQSRVTRTAAPSPAPLPAASASSVTGEMDWLDAVIASPATAVRSGGDVNNEHQG
                     HATAAAYARESAGGGYGHTSRQRHLKEGASLRGAPPTSSSSTVATPLRCHLCRRGDLV
                     REEALLHEWCCEGPAPAARQHSGGSLVYDTANLHKYHFMRAQREKRRSSTEPLLARVL
                     AVFPATLGGAGTRADESAPCVTQSPLQSRRRRPHGDASSGKSAVRGRDPLPSASSVHG
                     RRLTLSRLDARANAAASLRDGAALPHLDRCEEGGSYVFSVWNPRMEVQLVWCAVNREA
                     REGAPALHPHHYQRSSVGHRGHGVLPPSASVTPLFMWRCPPSLPGLPARPFRVTVPYG
                     LYAFANTHALALYEASDIFRKVTTQLAAAASGGDGAHHAQPHPRQLSSVKVSPAATMR
                     ALLIVHVMHHVATTPVPLRLGRALPPPLPDPTSQHHHLKEQRPMPQASSSHVARGTTT
                     PPSASRKRARMSDEDAEGGAEVAAPPPTADLQWPHGLASPELVLCVDHLLHGRSVAVY
                     GIGSKYYFLHHVAQSAELKHFHVVTVDASLGRGDDDVGNGDPHGGGQRGRRSGGGSGS
                     GASGGVAAAPSIVRQLIILGSTLARRVRSTALKTELQLRGHDAMPPRRQARQQDTHQR
                     DQQRPGAAAEADAYPAARAALAGEEVRSPAVARDVTSAMQRVVTASRTAMTPVDVMDV
                     DDALSSSGDEWDGKLGGWGKLCDSLRSAERVAAMPARDTVREVGQSPAARSTLATVTA
                     TTGMITPRKTALTSRPHQRCPPSPTVLTSTPSSQRSTQLGGADASLSATPSLPLMSPV
                     PAFFEVLQRTVTGSLENDGAAGAEKDGEGDVAPTRGACVEVPECASRLHSPKLPPLPV
                     TAASHRGGAASEVTWRAPVMVFASDAVRQLVLASVRRRQTSRRCVQWVSLPSTTALAV
                     LAEQTPFTATPAPTAPPRLHLTEAHQLRPGWSPPVLLVLHNVDLLDTEEAGLLLQLCA
                     EFAHPHPHLQLLLSFDDPRWPLTPLAGALTQMGVCAVQLRNLLLPRVHEMQHVSSLRL
                     LMDSEAMAAGGAGSLGLKTMGHGAPRAAGAGGLASAGSNSGASGGSHLLQDTMRRVLF
                     SLPPAFSGLLRILINLQEEMGEGQKVSVFVAKDRFEQHGIMVSQGRLKALLQELTSNR
                     IAQYDVAEHALTVMQPRKLSKVLEEVTAQRDGAAAAAAAPVSSGPSIFRPS"
     gene            <194045..>194962
                     /locus_tag="LMJF_01_0670"
                     /db_xref="GeneID:12983077"
     mRNA            <194045..>194962
                     /locus_tag="LMJF_01_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721541.1"
                     /db_xref="GeneID:12983077"
     CDS             194045..194962
                     /locus_tag="LMJF_01_0670"
                     /note="previous protein_id=AAC24674.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721589.1"
                     /db_xref="GeneID:12983077"
                     /db_xref="UniProtKB/TrEMBL:E9AC58"
                     /translation="MPGVDLLDAFAELVVRVVFSLPHTEPEKTSSSDEDAPYGANSSA
                     TQIFSRVNSLEDEQQLQLLSDTPLSHIGMGNGNGAGNSAIRTTSCSNSISRGSSAASL
                     DLYPGGFWNALARAPAAAAVNGARTSRPSSVVSLGTADNLSTPRSGAGLWNRLLGGSG
                     RTQTPPHTPSLSPAPHTGLTTTTSSFVQLTDAELGMGAAASGGGGYGSLGAAHSPGGG
                     NGMWGGFSPTPITAHSNASTPLRDACQLLSSSSSNSHQHPPPPPQQQHQQQLMGSHGL
                     RLGWSPTRSGNGNGSRPSQRSSSSEFDIL"
     gene            <198854..>201256
                     /locus_tag="LMJF_01_0680"
                     /db_xref="GeneID:12983078"
     mRNA            <198854..>201256
                     /locus_tag="LMJF_01_0680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721542.1"
                     /db_xref="GeneID:12983078"
     CDS             198854..201256
                     /locus_tag="LMJF_01_0680"
                     /note="previous protein_id=AAC24675.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721590.1"
                     /db_xref="GeneID:12983078"
                     /db_xref="UniProtKB/TrEMBL:E9AC59"
                     /translation="MGSSAMSASPFSAVNGFRGSDDDDDDDGRTALSQVRQALADRRR
                     MRSGVIAGVVDPVAAASASPPLLAKPRKGTSHEPSLCVDRSDNENSADCQRRQAPGSH
                     KQHRERRSPSAPDAFLSCVEDGKLLSVSPLPSPLARAMSASPLISKSSAPVLGALPPS
                     PSPRRISYYGGFLAHTLDAHDLAGAVFPKSSYTDALPLPMSAPQTDNESSVVATDQSS
                     ARSRRERPAASGRSNAVFDKTLAEAMVSTVVRMRENEKRRGSAAQPQQPLRRDSLSTN
                     TTIGSTVFASSHRPGLPTTPITSRAMAAFGHTTADVLNVADYNDSVGFHRATARGSPQ
                     HHNPNAGDTDVYAGDFRSAPMAALTHPASSSATASQHCLCTSGTPESSSAPLRITASR
                     DKERASAARSPDARSRQSSTLPAAPSVLWDITGQPVHRDGVRGLSTTASGRSGSTMMT
                     VSSGTADVAVPEVAAKAAAPQLSYHQLTEAFYGSYKGGEMAQDAYLYFVAQQQQQQQQ
                     LLLLQQPEGSSGGTTSRHGNKHQRSRPSAAMTTTPTRTAARARGGCTVQRVFVSGRSE
                     IQPTMTSQASTTSLTAAAATRAAPAQLEPRSISTDTPLSALRRSSNAAAAAAAAEWQH
                     PHSQPEARPSSTSLVSVHSSNDGSCHSSASRGNGHGASSPSSPLRLSVTVRAVTAGTT
                     AARGAVREAVDDVEVQQQQPRKTSTSKKRSTAVAVAHAAPSQRRSSGRSSFSMDAEPR
                     DTEVDQMSEPPSAVASSSATAATDTATTTDRIRNLLHKSVSIYQEAQQQQSEPHEGPP
                     DA"
     gene            <202894..>203586
                     /locus_tag="LMJF_01_0690"
                     /db_xref="GeneID:12983079"
     mRNA            <202894..>203586
                     /locus_tag="LMJF_01_0690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721543.1"
                     /db_xref="GeneID:12983079"
     CDS             202894..203586
                     /locus_tag="LMJF_01_0690"
                     /note="previous protein_id=AAC24676.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721591.1"
                     /db_xref="GeneID:12983079"
                     /db_xref="InterPro:IPR006461"
                     /db_xref="UniProtKB/TrEMBL:E9AC60"
                     /translation="MSKSDLFNDAQVPMRATVLRFGDDVEGASYPEAALTIDDAAVPA
                     EAKVEVYHDGDNSGSAHESVPHHAQDLRHDFTSGILNCHESCAVCLDACLCMYCTASA
                     HHNFLMNDTEGLYLPVCWGLFCVDVGLSAVSSYLPSSLHFHTYFMRSAIRRRYNLHSA
                     GAPVNSNTHGSSSSGCDCTTESMLDLLTVCFCLPCAIAQHQREIMHQGDWCGGVFSNR
                     YSLQTPATVHTI"
     gene            <206309..>207073
                     /locus_tag="LMJF_01_0700"
                     /db_xref="GeneID:12983080"
     mRNA            <206309..>207073
                     /locus_tag="LMJF_01_0700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721544.1"
                     /db_xref="GeneID:12983080"
     CDS             206309..207073
                     /locus_tag="LMJF_01_0700"
                     /note="previous protein_id=AAC24677.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721592.1"
                     /db_xref="GeneID:12983080"
                     /db_xref="InterPro:IPR006461"
                     /db_xref="UniProtKB/TrEMBL:E9AC61"
                     /translation="MTAPPGSPAFCPPPAQYQYAYVPAASYVAASSCVGRGNNGGPLP
                     YPLQPEAAPGYGEEQTSLLWNTRLFGLSTDVPSAMDSVMCIYCISSTHFNYLYRQQRG
                     MFDPITAALLCFDVFWCMQLWPVVTPLSSITLHTLITRRELRKRYGLVGNDLFVKMDR
                     LNADTAAATEAGETGAQAEEATTAEVESQPHRARDSDVTAEAAAAEPAGTGEAAAEVI
                     SVTPPATAPSEAAAPRTGESDVMAHTPRRVCHGLRS"
     gene            <208464..>210089
                     /locus_tag="LMJF_01_0710"
                     /db_xref="GeneID:12983081"
     mRNA            <208464..>210089
                     /locus_tag="LMJF_01_0710"
                     /product="putative ubiquitin activating enzyme"
                     /transcript_id="XM_003721545.1"
                     /db_xref="GeneID:12983081"
     CDS             208464..210089
                     /locus_tag="LMJF_01_0710"
                     /EC_number="6.3.2.19"
                     /note="previous protein_id=AAC24678.1"
                     /codon_start=1
                     /product="putative ubiquitin activating enzyme"
                     /protein_id="XP_003721593.1"
                     /db_xref="GeneID:12983081"
                     /db_xref="GOA:E9AC62"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023318"
                     /db_xref="UniProtKB/TrEMBL:E9AC62"
                     /translation="MSSRTPSRLAFTQASDALATLVSPSAQFATADFDPALKDWSFVK
                     PLVVGAGGIGCELLHLLALSGFAHLTVIDMDLIELSNLNRQFLFTHSDIGKAKSTTAA
                     AAVQARCPGVSVTAVVGCLEDQPDDFYRSFDAVLLAVDSIPARRWINRKVAEIATRVI
                     VPTPASASPPAARSAAPPEDAVAASAAQAPAAVYRIGNYVIEDAKLIIDTGTEGFEGH
                     CRVIHMAHNRTPCIECEMYLYNNGATRETVPLCTLESVPRAPEHCVLYVQLKEWPEHH
                     RHRSRRRSQGGDGDGAVAGGGCEEDSKDGDRDELLNPDNAEHVRWVTERARARQAAFG
                     IGGAPIDDLFTVGVIKNVVPAVGFTNAYVAGQAVTELMKWLTGCAPELNNYAFYNGAT
                     EAGVHTNVEPCRGSPMHGSGDVAGRCLVCEPCPVVAADASAVSAVAFRDALIELLAPD
                     ATAAALLRRGIVLLVFQSASKLVEVPLPNAVKEAGAVKHESIASMLCAAGHEEFVKQW
                     KDGARMATVECFGAADNARVSALVQWQGPPVWA"
     gene            <210684..>215417
                     /locus_tag="LMJF_01_0720"
                     /db_xref="GeneID:12983082"
     mRNA            <210684..>215417
                     /locus_tag="LMJF_01_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721546.1"
                     /db_xref="GeneID:12983082"
     CDS             210684..215417
                     /locus_tag="LMJF_01_0720"
                     /note="previous protein_id=AAC24679.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721594.1"
                     /db_xref="GeneID:12983082"
                     /db_xref="UniProtKB/TrEMBL:E9AC63"
                     /translation="MMMSASSPYSGHVFDFAEAGASATAWRTSARRTAAFKLRGLGSF
                     GLSPQPRGRRCYATTTATTASTQGRTAAASGSAATQPQTRRRRHVMDLGNNLSVVLPV
                     SGPSPALSSPRHHRGSRRRHGCTESEATARHSRGEHRHGSTDDGNTEASAADRAVHVQ
                     SREALKQPPRSRRHPRQATQTSLLVGQQRATQEELEGAEDALLRIPHTADEAVALLEC
                     ATVLEALELSSSAHLPPCSAAPASKLAAAAPSDVRANFEELRTRALPLLFHFAHVAAT
                     SSAPLAGDAAATVTDAKLAAALQCLAAHLQYMAAATRTDGLRHVSALPPAVVVALWEQ
                     VMPYVHQRVGEAEAPPLPPLQGNLAELEEEGGGVHESAGEAVTSEPGDGAGALASSAT
                     TAVARPVSAASMKNSVYMPLRRALALHTRQIASLLPPPALALVLTRIYQCGALADDVL
                     GPIAADYLEVLRRSGPGQTTGGGDVIAALRQRVLRLPSGDGLDAAPPAAAFTGAAAVT
                     MARLLGRAAVPGHHQLHRFFHLALLPEVTRVLARAAERAAQSVADDATGEAVEALPGA
                     AVLLDVTAALRHYAVSGHAVTHLTTLWMAYFARRPRTDDAAAALADCTALLRALSTVP
                     SASNRTQRRQAHNTGADGSNGGLNAPQQRKQLLEVTDGDYYPLMDVVCAQVCRVCNHL
                     QSPAATSDVATVTPTQLLALLCLLLRVSCPHWAETYEMLASTVLAALASTATSLAALP
                     PSRIEDEELERLLPLAAARRTLRALLHRHSLIPDHPLHRVLLRRLLHSPAAMTDTAVA
                     SQVLLGLELMVPEEEGSSRGNKVVASTATSASAGHTVALVATATSTPAQTLMSTVAIT
                     PDDRQRALQVFRRLGRSVTPTAFVAGLCVVALDMLPRTAQVAVVNHLTSVASAVSPSY
                     LVKGMDAVVRQLPSSAIDDVSVQRWFSRFTARDVVRRVDPVGCAVLLDMLSANPRYQR
                     NCALAKECITHRIGVALRQTGEDGAGNGAASAVSLEALPRVVAALQRANVFLSHYYSR
                     VCRLLLGQVEQAPLGEMLEPFAVVAEAYMSRQRSEAQASVFKDVWELLRGRVMEEAGR
                     LTLHETLTAINGFAALDVTDHVLFGVLVYQLWLCLCAAEAQVAEAAATSRSCGASSAD
                     PAVAAPDVPARRPVRSAQQPSENGEAAEAAAATTDNEDEAAEAQVHRRVQAAQHVLRT
                     LTPSAVAVVTTTLLARSDIRASYAAQARAAAGEVRKGEDGDDNVVRTLLPWMLLGLRD
                     CRAELYPVDVVHLMPSLLEHYAAAATVEDASAPTAYADRYAALLHNAYDACRSTFLLM
                     YTLLPDTVDAAEEPLLPLAEQQRIAEQRSQWTPATKLSVEVVPRPWFATLLVSLSSAA
                     LVDVAVALPCVRRACTRRVCSDLLPIAQLVDVCLSLCWLATSTGLRTVAKGASAAAHR
                     SDDDAPTPATPPVTRQDKPSSPPLPAPGDVLRTAMATVLSALWKRSDELTGAQIGALL
                     RCLRDTYGADKMDADFVERLEAQRALLLSQRQQKGPAAAAAGSASATETANSGGAGAS
                     AASPPQQERPKPLPRMDPEDLFSTT"
     gene            <216579..>223304
                     /locus_tag="LMJF_01_0730"
                     /db_xref="GeneID:12983083"
     mRNA            <216579..>223304
                     /locus_tag="LMJF_01_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721547.1"
                     /db_xref="GeneID:12983083"
     CDS             216579..223304
                     /locus_tag="LMJF_01_0730"
                     /note="previous protein_id=AAC24680.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721595.1"
                     /db_xref="GeneID:12983083"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR028928"
                     /db_xref="UniProtKB/TrEMBL:E9AC64"
                     /translation="MDTLLADLLLAKERTAYHRAVVTEITTTARDGSAACHSEAVTSL
                     PHLSVVPQPSPPLQPDAVDASAAVSTNAAAHASAADVDGGRTEHKKGKETRRGSSDGE
                     EGNAPALSATVFVQPRSGTGDAEGLSGRVTRTRQRRRRGGKDNAADVVPATARAIGDA
                     GGGGVADGAAAAWAGLRRTLPSQAAATDADTHRDYDYLPEGEDAERVIAERMRALQAQ
                     QLSDATDAEGSLRGTAAFVRLSARFSRGPVPAWLKEYSDLLLFDRHHLDRDVAAALQC
                     SGVGTTWRCCCASNDSEGLVQLPVDAVVLRLRSDIARVRRLRDELRRSGGVRVLISPD
                     SHPARCEVYRPAEPDWGAAPAPPTAGEISAAVAREVQELAAGGMEVALGDTDRGERGA
                     RPAAPPSPPAPVSPPPPPPSTPPLSRAVEAKDLQRSLMAQTIPVWRRHGAAAKLLTEL
                     LDHLESRLRAFEAQLGDPAQGALLDLVGAPDSAGVDGTVQNTYPPALERAIRTTITNT
                     MMSDIFATSWSALPNRGPRLSEALRRRQTPLIHADYVTMTDMRPAYDFTALQSVQRVS
                     RAAPSTPGASLVYTAHHQQQWRSGGGGAAAVGGDTRKSYSVHVDYVRFQPSLESIRGA
                     SVLGAHLGVGDSAAAAVGTAGGGGGGERRSSVLCSSEDPLSSLLLGSSSNVFLPRDTH
                     ASGNGTAADAHDALLLQQQRRNGNLHSTAAALLFALSAATAQHSLVAFSPEEYLTSLL
                     LQYYEQYRLLQLNLLPSLKNRFFYQEQVLQLQRQSQRTSDMEQLQLRLESLAKTSADV
                     ERGCLQVMIVLWNSVLMLRRQKQAQGQRAAEKLDVATTDTPIIVENQHRSSRSNSRNR
                     GAQPPVTAMAQEMPSHPPVFGAEVSAAASEDEIAVQVNDELIANIPVVHRVDSSVTYD
                     GQVDRHGASLGSQPQQQGNPRVSSPRSFVLPPGSPPAQPSTSASASPLLGPATSVSSG
                     EAGVGDSSTDSSGRGVVSPPWPQPQRFRFFLRRHGTAEETPYVTGDDLLHYAAEVEGA
                     DVLQTDRQPGERGGGAAAVPPVAQDALRYFQLVVFTRSHAAMVPQYVGCTTPRPMTAA
                     KVVFFNETFEVRALHEPAELLLHLIPVTAGPSKHTVVSTVRLRPTLARTYSLLPLQPP
                     TAFVFHGRLFAHHQRAAAGTNGAASSTTTATSVHGVLAASTTWTGSQGMTVAQIEHLF
                     LGGGSSGPAADPLDPQYLPLLCTLRAHYEEQGMGRASAASGGGAGTAPLSSHRRHSAD
                     GSARLQRQVSTPNPTNALAGMPAGRAGKAHQTALGGSRRSFKHIAFSGQLLQRVGSAV
                     GAAATALPAPDGTRRTMHVLTAAAEAAGGGCGSRDCYAADDSLQPLPSARLEHLRRRW
                     LAHTNKVKAVDEVEARLFARAMPLDDADVYRLQKALKRSVRTEEAERVKGYGAAAGVL
                     FNVQHYYSAPSAISGLPLSPLPRETKLKLWQERQRRMLLTRKARHHLTDAEKLEAVVR
                     VPKLVLKLVFYFAPRSQLNPHRKVRPKTEDIDRALLARRRDSRIVIHIMKAHNLPRRA
                     DGTPLEPFVQASFVSEVAYTRSEVGSNPSWFQSLELPFQPLNFEEDTLGMIDDDVIIS
                     LYDKVEVKMAPSAAATAAVAHETHYRTERRFIGTLRIPFYSLHQASQARMEGVYPLRM
                     PRWLLGYHTLLPHRDSTEDEAAKQHFIPGCGTTSGGTATLAPNPFGSFDRLPAHRAEG
                     ASGAATAAASPQQLATSASAVLALTVDNTSSDRQSTEPTLQLYMSLWPPLQREPPPGL
                     SRAELTRQVSELNVSPQLRYLHQVALKWQQAAMKKVKAIGAMNAQASTRQIEPFVKCS
                     TGDLMLVCRYILPRGGPPPPCVRTVYEAIRYVSLIPLVADMLSWGEKDVWNTNAELLA
                     MRSGDCGELALLLTHFLRCLAPDRPTYAVLGSGTTTCQQTIMVLHAFDDAEWMLIDPH
                     SGWTVSAGKPYGTALRDVYMVVSHDQLWANVQLSGFPHRMTWDLANPAHWLPCFDSAK
                     DARIAVCTPHLFPIQRDVLTFPAADPVKSREIELELRACLKKALLTWRNGCPPSYHRG
                     VEAILRELLESAEAERCTCASARRSDITLSAAVRLSEYFGENITGEPESDMSAPQRRQ
                     HQKRRQHRHRHHSRDNGSIGHEEDAAAAQPATTTPVSSSVSPLRLLGSPVMGSYNPCD
                     PQFQELLQQVFECAVHEVGTSEASFAVGTYVKSYTGDVYAMSVFLVAICRG"
     gene            <223998..>226253
                     /locus_tag="LMJF_01_0740"
                     /db_xref="GeneID:12983084"
     mRNA            <223998..>226253
                     /locus_tag="LMJF_01_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721548.1"
                     /db_xref="GeneID:12983084"
     CDS             223998..226253
                     /locus_tag="LMJF_01_0740"
                     /note="previous protein_id=AAC24681.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721596.1"
                     /db_xref="GeneID:12983084"
                     /db_xref="UniProtKB/TrEMBL:E9AC65"
                     /translation="MMSKAAFMMQDHVRRNYVMITDVCNPNTFFVRGRLPFPQGLTAM
                     AVLFKNQRPADVYAHPYFIEKQSNPSQPSPQLHLTEESQGIMKVMSGLRYMRDDNTKL
                     DNTMVVVTDYRVEVEGRMPSVPQAASTAPGGPKTAPAHDGGSRGAQGHHPVPGSPTGT
                     SPGLTLEQRALLRRTVHHVTQIPGGGGDAGLGLGGIRSPFSAASRPAATPSAASASSS
                     RSLQASAGEAARTAGDSDPSAACSGDAASTAMHNAMPGYSTFPTPEDCATDAWMSYRY
                     LKAAIFGRRALEETKGRASSTDPIDVPALFEKRVGGYTVLYNPIEVNERTFVELLLKL
                     QEEERVVKAIVVPTRPAWRHLQVWADIFPDAELITSGEVPLLPAAAAPTWSSSGCGGN
                     KESADSAADPQHRSTRRSRGGAAALRAPPSTTAASATEWRGGCQDMGNGMSGLSFPEV
                     DLVAEAALERQRADEAAAKARATAEAAQRERERSAAPGESGREVDEENDDDAVGTNGG
                     GTATERERRAMLRRQQHKLKLREEMRAEDARPEAAAAKRAAAASPSAPSNDSGDPVDV
                     LWHDVSFFTEKLVQAVGLRESDAWRLRILSPRATSSPQEPPVDVLRLTPTIELLRIPG
                     DSAVEEYVLLDTNSNSLACTDLYHGEYADLDPVNSWMCRVWFKFMKRGDYKRTDLVPR
                     YKWLQVLQQRSLSVVQSAIDDLTRRRPIKCVLSAHGTPPLRGVDAVDTLRRQWNLPPL
                     HPAERPRDGRR"
     gene            <227560..>231813
                     /locus_tag="LMJF_01_0750"
                     /db_xref="GeneID:12983085"
     mRNA            <227560..>231813
                     /locus_tag="LMJF_01_0750"
                     /product="putative protein kinase"
                     /transcript_id="XM_003721549.1"
                     /db_xref="GeneID:12983085"
     CDS             227560..231813
                     /locus_tag="LMJF_01_0750"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAC24682.2"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003721597.1"
                     /db_xref="GeneID:12983085"
                     /db_xref="GOA:E9AC66"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9AC66"
                     /translation="MSLPSMSMHWSEGDNGGGSLGGSRRSFSKGSIYRHHFLSLDHSS
                     TAGSAIGFSRAATHDRRATGTSAGFEWLQPWRTPQDCGEGGVALLYSMQEVLENVRRA
                     RKTSLSELYHVRAAGSPAASTTSLCRPQHLCPPRAATSGSSDDAEGRCGSVNQKNSCS
                     AAGSRTSSVDRRRQRDRGERNLSFGKGARSASGDSVQGIEPATEVEEGAFSPPLQTTT
                     AAARTAAAPLATPPRSFASAAPVPPIVPVIPYFAEVTTEQELIYRLQQLQPQPHPRSE
                     HARRRRRALANSDDDDDDDDDPARSPHHPDASCPSGGCDQTARPGDSRHRPGRSVEWS
                     GSDSNGDEPEARAQRCNASGVSADDDDADTSDVHHGKDEERDEEEHRLSETDFGEGGH
                     LACVPGDTLHQRYTLLKALGVGRSSRVWLAVDLEQCSLARCQLIRELGEREVRRLFRT
                     SERPMFVAIKVFRCDPVYADCAMYELKLSALIHENVMTRQQQEQEQQRWPPARASHSA
                     SLPSSLIAVPAACDDPGGDLQESSDGGENSTSRGRDGAAGRTRADSASSTPGSGSVSA
                     EVASPASTSAMAFSRRLTTVRDAFTIEGAFGTHQCLVMDVLGAGVDRAINEAHLNGFP
                     SAVARSIMQSSLQGLVLLAACHLVHTDMKPENLFFTNLEADVAEEMLTFQSAQLRASQ
                     RQTLCSSFTHRSTATSVMTERQEVAAHEQQHHGDGGTAEHTGVGQRSPFSAPPLPDYT
                     HVKGAAADLHTVHAANAADVGASGDRVASSVTNLSAVAVGHETLHSSQDSSAQVSCQP
                     SFARTPTRRRSAYDVRLSGLGLSLVVPPCLRLGVRVLTNYAAHAADGGGMTADELVRQ
                     DPLAQLHWLCAQQQARLLRLPGNDDDDDLGSVAERWRLAGTCAPAASPPPPTLDIGMS
                     EDFIDEAELRALGLQELPKSDADGGRCAAGMAADEYVEADVTDFVCVPAVGEPAAHHR
                     ATVTTAGVGIEDGTTLPPATLRTASAATRAGGGRRTPLAAAKRRLFPPCFHEGLATPR
                     DPATVPTRCEGVAAASPTDSSSSGAAPPAGAAAAATVLRRLECEVVRHQNYRRGVVVQ
                     SREYRAPEVLLGNFVLPACDIWSMGCIAYELVSGRFLIDCIVDRERFATALSWQQQQR
                     HGRKGCHAPDDDSGGAHDAKDHSRDDDEDTQQRLNKWDGQPVYLEDTEQDLDVFHLKA
                     IMRLIGPPPVSFLRQQPIGLFVDDFFDEHGDFCFWERGEAEEAGMRLADPYRQLELTY
                     WAAASRVSGTSVAVGSAAGQQQNPPLPETVSGVTASLDTDPPGAPSAASVGQHAASAQ
                     ARRDPQDTMNYPIRTPDWQDVQAILREKLGSAEEAADFEVFLLRCLQWDPARRATAAE
                     LLADKWLVKYSGVVADASESDVVAEKEGGGDSDGEVRRL"
     gene            <232419..>233438
                     /locus_tag="LMJF_01_0760"
                     /db_xref="GeneID:12983086"
     mRNA            <232419..>233438
                     /locus_tag="LMJF_01_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721550.1"
                     /db_xref="GeneID:12983086"
     CDS             232419..233438
                     /locus_tag="LMJF_01_0760"
                     /note="previous protein_id=AAC24683.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721598.1"
                     /db_xref="GeneID:12983086"
                     /db_xref="UniProtKB/TrEMBL:E9AC67"
                     /translation="MMSARATASAGAAPRGSRRREPAYYYQSLSAVVDGDVRFGVGCV
                     VLPHARIHVPRGYRLHVDPFCLFEDFAELICDGAADAADQRHVDEAPASPTATAAVAL
                     HIGSHNHFHSYARVRCAVATATLASLSSSAAAPPPTWRLMGSGNIFHAFASVQMMLSQ
                     PLSSPRGPPAPRLRHFFGDYNVVTTYSSVSLQQGASAAAPLADEGASSSIPSSPAAPR
                     PAASGTFQHVIVFSGEAHTKGADASVARATGALCVPRFGARSVAELPVVIQRITDEAK
                     AGPPPTAEMVGTAAMLERYISDVHPDLRSHEETRIVTEVEHACRCYIHQLLDDGGLQP
                     VEVPC"
     gene            <234392..>235603
                     /locus_tag="LMJF_01_0770"
                     /db_xref="GeneID:12983087"
     mRNA            <234392..>235603
                     /locus_tag="LMJF_01_0770"
                     /product="putative eukaryotic initiation factor 4a"
                     /transcript_id="XM_003721551.1"
                     /db_xref="GeneID:12983087"
     CDS             234392..235603
                     /locus_tag="LMJF_01_0770"
                     /note="previous protein_id=AAC24685.1"
                     /codon_start=1
                     /product="putative eukaryotic initiation factor 4a"
                     /protein_id="XP_003721599.1"
                     /db_xref="GeneID:12983087"
                     /db_xref="GOA:O62591"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MAQNDKIAPQDQDSFLDDQPGVRPIPSFDDMPLHQNLLRGIYSY
                     GFEKPSSIQQRAIAPFTRGGDIIAQAQSGTGKTGAFSIGLLQRLDFRHNLIQGLVLSP
                     TRELALQTAEVISRIGEFLSNSSKFCETFVGGTRVQDDLRKLQAGVIVAVGTPGRVSD
                     VIKRGALRTESLRVLVLDEADEMLSQGFADQIYEIFRFLPKDIQVALFSATMPEEVLE
                     LTKKFMRDPVRILVKRESLTLEGIKQFFIAVEEEHKLDTLMDLYETVSIAQSVIFANT
                     RRKVDWIAEKLNQSNHTVSSMHAEMPKSDRERVMNTFRSGSSRVLVTTDLVARGIDVH
                     HVNIVINFDLPTNKENYLHRIGRGGRYGRKGVAINFVTEKDVELLHEIEAHYHTQIDE
                     LPVDFAAYLGE"
     gene            <237389..>238600
                     /locus_tag="LMJF_01_0780"
                     /db_xref="GeneID:12983088"
     mRNA            <237389..>238600
                     /locus_tag="LMJF_01_0780"
                     /product="putative eukaryotic initiation factor 4a"
                     /transcript_id="XM_003721552.1"
                     /db_xref="GeneID:12983088"
     CDS             237389..238600
                     /locus_tag="LMJF_01_0780"
                     /note="previous protein_id=AAC24684.1"
                     /codon_start=1
                     /product="putative eukaryotic initiation factor 4a"
                     /protein_id="XP_003721600.1"
                     /db_xref="GeneID:12983088"
                     /db_xref="GOA:O62591"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MAQNDKIAPQDQDSFLDDQPGVRPIPSFDDMPLHQNLLRGIYSY
                     GFEKPSSIQQRAIAPFTRGGDIIAQAQSGTGKTGAFSIGLLQRLDFRHNLIQGLVLSP
                     TRELALQTAEVISRIGEFLSNSSKFCETFVGGTRVQDDLRKLQAGVIVAVGTPGRVSD
                     VIKRGALRTESLRVLVLDEADEMLSQGFADQIYEIFRFLPKDIQVALFSATMPEEVLE
                     LTKKFMRDPVRILVKRESLTLEGIKQFFIAVEEEHKLDTLMDLYETVSIAQSVIFANT
                     RRKVDWIAEKLNQSNHTVSSMHAEMPKSDRERVMNTFRSGSSRVLVTTDLVARGIDVH
                     HVNIVINFDLPTNKENYLHRIGRGGRYGRKGVAINFVTEKDVELLHEIEAHYHTQIDE
                     LPVDFAAYLGE"
     gene            <240769..>242355
                     /locus_tag="LMJF_01_0790"
                     /db_xref="GeneID:12983089"
     mRNA            <240769..>242355
                     /locus_tag="LMJF_01_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721553.1"
                     /db_xref="GeneID:12983089"
     CDS             240769..242355
                     /locus_tag="LMJF_01_0790"
                     /note="previous protein_id=AAC24686.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721601.1"
                     /db_xref="GeneID:12983089"
                     /db_xref="UniProtKB/TrEMBL:E9AC70"
                     /translation="MFTHTVPSRHTAAAGAASAGSTSSSSTHSVRMHGPLQASTRGAS
                     GVPAAPATAATNSSNSADSVVDARRGGMKGTAVARATAPASSHHRSEHDSRVDTEGSD
                     SAVRHTTPAAAASSFSDQGLRQLPQQRRGTTASTATPPGSARAPHHSDADVARVRAAL
                     AEAGYPNPSWYDIERVFAQLAVNQDDEDGNVAARHRDTTPTPSAAYPSRRVVQEDTLE
                     EGHGAVYYHNTHGAAITPPPVSPPQQQQQQEDYPTESSGLLQRLEPSLRLQRYIQLRE
                     RELEKLCLRPSSSAPHAQQQRQPPVSPAAHASGTLPGHSRDTPHASQVKASSLRGAPG
                     ERAGKQPQRRRSSAAAVPHAERIRSDGDAVGTGAAASGDAQVTVMAAHHRRAANIVFD
                     ATGDQRFRFFPTTRTPPGTGTLVAMARVPRTSSSSASTTVLTGAAPAASLGSYHNYYQ
                     CPRPSSCSTVGGQVSYLDPEGRTLRRKADPVKRGEQMRLLWAKDSFLSQRDRPREAWR
                     TRQITMAYGQGADSGEIHHG"
     gene            <244534..>246063
                     /locus_tag="LMJF_01_0800"
                     /db_xref="GeneID:12983090"
     mRNA            <244534..>246063
                     /locus_tag="LMJF_01_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721554.1"
                     /db_xref="GeneID:12983090"
     CDS             244534..246063
                     /locus_tag="LMJF_01_0800"
                     /note="previous protein_id=AAC24687.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721602.1"
                     /db_xref="GeneID:12983090"
                     /db_xref="GOA:E9AC71"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:E9AC71"
                     /translation="MHPPPPFFLRASYILQNIHLSRHPDLLMSRAASIPSAAVRWCLA
                     LAPPLPTASSVSLRSAAAVVESHRHDRPRLAPVAVLSAIALTNSRRLSAAPHSLPFLY
                     RRPSGLRACCTSGNGCRSIRLAAPSPASAGAAAASASVTTPTPSAPAPAQRERHVCPE
                     CGKRFLCEPNLVRHRATRHGVQVASATEVARAQIAARNARLQQELARVQARVRQLRDG
                     GGTAATAVLAVDAASAYPSAVLTGRLMQVDEAVERAWRHSGRGLGTGISFVSCVGTVR
                     GPVEVGTLRGATPASASDSPAAGPRVLQFVLEAHGYRERRPGQLKMYRSHLLVRYVAW
                     QPYHCYGDDDGAGSAAAPCPPATAPLLFKVQEGDLLRVQGHYALHSSYDMISKQSVEN
                     VVLEADAVGMLRPAPAKETSAAQRERDGSPTRQPFLSTSPPSRHATTPTAKDAISSAH
                     DRCPGQDSAMSAAPCATAAAVASADDASPPKQRQSILSTRKKTASTKLSTTAPLQHQP
                     R"
     gene            <247550..>250603
                     /locus_tag="LMJF_01_0810"
                     /db_xref="GeneID:12983091"
     mRNA            <247550..>250603
                     /locus_tag="LMJF_01_0810"
                     /product="putative calcium/potassium channel (CAKC)"
                     /transcript_id="XM_003721555.1"
                     /db_xref="GeneID:12983091"
     CDS             247550..250603
                     /locus_tag="LMJF_01_0810"
                     /note="previous protein_id=AAC24688.1"
                     /codon_start=1
                     /product="putative calcium/potassium channel (CAKC)"
                     /protein_id="XP_003721603.1"
                     /db_xref="GeneID:12983091"
                     /db_xref="GOA:E9AC72"
                     /db_xref="InterPro:IPR003929"
                     /db_xref="InterPro:IPR013099"
                     /db_xref="UniProtKB/TrEMBL:E9AC72"
                     /translation="MDKRMSLWPVRMRLGRRSDRPQVFMDKHYAHPEQRFHSLRNFVE
                     FLDQRHTNVSIFGLLTHTTMEVVSVAFYVWTSQVTAATSVTEFAWGLPVFIVELVLSI
                     IFFLAWVGLFFFEPDKKAYLISWLSLVNAMTSIPMIVIGIGALKDSSWRSVWVPMYLR
                     VWWLCDCLSVLIDYPQIARHTPEMWREMVRYFIRLFAVMCTCVGTHQIVESCSGVYVD
                     LYDSLYLIIVAFATIGFGDVTAFTTPARIFMIAFIVIGICFFLPLFQRLSVIAERSQL
                     HNTFSGGGSASWLRRGWKHPHVIICGQFSDLSVELLLRNFYAGWRKYLDTCIVLMAPE
                     EHSPEVRLAANLPWLKGRVTLMVGDPAKPKDLDRAKARDADAIFLFGDSRSTAYYQDY
                     TIIAQSVAVSLYDRNLPQHLLLHRNCTVKQISPYAASVLEVERILHHLLGLSMAHPGV
                     VPLIVNLLRTYESLPSDITLSRHWVEQYEYSLRNDMYGLEIPDALRGREFRVLARSFF
                     EKDVTLIGILNARSVVQLNPRELVPNAKKLILIAKTMKVAQDATDAIARDHEQTFGEE
                     MLAAPDPDEHDRAKRRRARSRFLVHLRSSSSSSSSGVDGDVEDRNGAPKQRGDRWPRQ
                     TAHVSASRPATPTATTTDSQRTQPVRPHAAAAALENGNGLARAFPSVVSLHPSGSSIA
                     AEGSSGDEFDARSSIVAASPSPPSSMRAPPVRSEALVRIDDAFDLENHFVVVDLSSAK
                     AKDESSRYAQEAVNTAVAHDIFHVTMPVRQAYPANDIVLLTNDVSFGPYLDYYWSVHR
                     QDSANPVKYISGCGLNTADLRRCNLERCAGCCVFYAGDVSRSGSTSAMSMLTVLSINE
                     ILHGIPAFPVVVELEGLANLPLFPPHAEDLRLRTKAEIDFVYEPNFIIGNAVSRLMLF
                     PALQRTYFMEEFIDVMDVLISGHAPDTPALARLPLSLFQAELQTYEDVVVYCLKFGYL
                     PIALQRRIVDVRNPSINGQRFVLTNPPRALPVNQQTDLLFYITPG"
     gene            <252411..>255890
                     /locus_tag="LMJF_01_0820"
                     /db_xref="GeneID:12983092"
     mRNA            <252411..>255890
                     /locus_tag="LMJF_01_0820"
                     /product="potassium channel subunit-like protein"
                     /transcript_id="XM_003721556.1"
                     /db_xref="GeneID:12983092"
     CDS             252411..255890
                     /locus_tag="LMJF_01_0820"
                     /note="previous protein_id=AAC24689.1"
                     /codon_start=1
                     /product="potassium channel subunit-like protein"
                     /protein_id="XP_003721604.1"
                     /db_xref="GeneID:12983092"
                     /db_xref="InterPro:IPR013099"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9AC73"
                     /translation="MTGASPVMPAPDDAATSPTAAARFTAEDPTASTTTIPAAEASAA
                     ATHAHVHVNTKVFMVNLDQDVQTTVLGRFRNLQGTIHSQLRNLQNNVVDLRPSTGIPP
                     EALHSPWVYHYNHSTLGIHSLRKLFDVIEQRYSHVSILLLLCNVGLEAAAFGIYLHVQ
                     NAHVTADWREFDWGLGYFIAEVLLSVVFMASWTSLLAVEAKKWNYVLNARSLMNYLSS
                     GWMLLLALGALLTLDRAWTHVYAPMFLRVWWLHESLLSLLNYPQISVYFTENRLEMVR
                     SMTQCIAVVGISVGVLQAVESFCGDPVEYFDMVYMMLLSFSSIGYGDVTPLTVQGRLL
                     MIIFIGVGFSYFVPILQYVADLGVYHLSYAYYTTCFKRTDHVVICGHLGYNELRMQLK
                     NIFAEDRHYLNMSVVLLLREQPSAQVLLLLNSPKYRSAVHLLVGDPGVPTDLDRCNAR
                     GAAAMFLLGAGTNSSYYSDYDLAAQTMTVNALVPDLPLYILLHRSRYTKSLMPSRAIV
                     LEFERLNHNLLGLGCVLPGMIPLVANLMRMFDPMTTEALWELRDFKDLLGLSGSAASL
                     RAMRKMWAPKRPMLTYGAATIELGLGAEPDWMSTYEASLAQHVDTVAAPPPVQRGHYT
                     VVRLARLLYRTNITLIGVVRSSGNGDSVVELAPRGSLVGVKKLIVICDVRRAAQDIVD
                     EIVNDATRGSTSSAAAGAPAIRSPPPAGVQATAVTVVPIPAKEDAGAVWNSSTTTTTI
                     APTARASQMPLKPAAAPAPATAATVIGASAVELPRRLHRVACERAAEARMPHNDSSLV
                     LSAAIAAEDDDNDDDEDALIGALASPVLLDAVGRGRPACVDARVGVPATVSPSSLVFA
                     AAAAHSVLRVEPDVRHLANHYVFIDLSSAHERTNWSREAAVESRTAKAADYYDIMRPV
                     RQHDPDSNIVLLANDTNYDSLNNMWEEEDVTGSLIVVQGCGLFTSDLRRCNVTKAAAI
                     VIFSAGDRCDEHGDSLSVLVMQLVRQLIGEDRHGSAADIPIVVEVDHAELVPLFAPAM
                     TLGKDVKAAEWVLEPSFMSGCVVCRHMLDTGLQEMYFTPELHDVLEQLLSSKSESLLV
                     TVMAPDAAWTVYEDATSFGIDSGLLPLAIHRFHEMIRDDTSVSFRYIITNPPPSFPLH
                     PDDFIYCLKLCDP"
     gene            <258831..>260867
                     /locus_tag="LMJF_01_0830"
                     /db_xref="GeneID:12983093"
     mRNA            <258831..>260867
                     /locus_tag="LMJF_01_0830"
                     /product="metallo-peptidase, Clan MA(E), Family M3"
                     /transcript_id="XM_003721557.1"
                     /db_xref="GeneID:12983093"
     CDS             258831..260867
                     /locus_tag="LMJF_01_0830"
                     /EC_number="3.4.15.-"
                     /note="previous protein_id=AAC24690.1"
                     /codon_start=1
                     /product="metallo-peptidase, Clan MA(E), Family M3"
                     /protein_id="XP_003721605.1"
                     /db_xref="GeneID:12983093"
                     /db_xref="GOA:E9AC74"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR024080"
                     /db_xref="UniProtKB/TrEMBL:E9AC74"
                     /translation="MSANPLLQQSPLQYQHPPFDQITMEHYAPAFEQGMAEQMAEIEA
                     IKSNPDAPTLENTVVALERSGAQLERARLVFQNLCSAHTNPEMQNPEQACAPKFSVHT
                     DKIYLDGALYNRIKAVWDERASLAGEDLRLVEHYEREFRKAGAGLHDADKEKLKQVNE
                     RLATLESDFAKKVMGTRKTASLAVDNVAELEGLSEDEIATAQMEAESLGHPGKYALII
                     VNTTQQPLLASLRSRETRRRLFEASVQRAARGDENDTSAIIAEIAQLRLKKAKLLGRK
                     CFAECQLQNQMADPASAEALLHDMGNAAASKAKKEAADIKQMIREEGGDFELAPWDWR
                     YYAERVRKQRHDLDENEAKPYFELNNVLERGVFYTAAKLYGVTMRRRTDLPVYHPDVL
                     SFEMFDCTGGSLAIFRLDPYARASKRGGAWMTFYVCQSPLLGQKPVVYNVLNIVKPAE
                     GKPTLLSRSDVTTLFHEFGHGLHGMLSNLKCSTLSGTSVARDFLEFPSQINEHWAMYD
                     AVLKNYAPHYETKEPIPQALVDRMKAAETNGAGFHTIEVVKAAYLDLCWHLVAEETAF
                     LPPAQMEEAAMRSFGVGMTEAPPRYHSGCFMHTFSGGYASNYYVYQWARVLDCDGFEW
                     FLENGGLTRENGDHLRACVLSVGNSVDANVAYEKFAGRKANMKAFLRINGLLDE"
CONTIG      join(FR796397.1:1..268986)
//
DBGET integrated database retrieval system