GenomeNet

Database: RefSeq
Entry: NC_002946
LinkDB: NC_002946
Original site: NC_002946 
LOCUS       NC_002946            2153922 bp    DNA     circular CON 10-MAR-2020
DEFINITION  Neisseria gonorrhoeae FA 1090, complete sequence.
ACCESSION   NC_002946
VERSION     NC_002946.2
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02604088
            Assembly: GCF_000006845.1
KEYWORDS    RefSeq.
SOURCE      Neisseria gonorrhoeae FA 1090
  ORGANISM  Neisseria gonorrhoeae FA 1090
            Bacteria; Proteobacteria; Betaproteobacteria; Neisseriales;
            Neisseriaceae; Neisseria.
REFERENCE   1  (bases 1 to 2153922)
  AUTHORS   Lewis,L.A., Gillaspy,A.F., McLaughlin,R.E., Gipson,M., Ducey,T.F.,
            Ownbey,T., Hartman,K., Nydick,C., Carson,M.B., Vaughn,J.,
            Thomson,C., Song,L., Lin,S., Yuan,X., Najar,F., Zhan,M., Ren,Q.,
            Zhu,H., Qi,S., Kenton,S.M., Lai,H., White,J.D., Clifton,S.,
            Roe,B.A. and Dyer,D.W.
  TITLE     The Complete Genome Sequence of Neisseria gonorrhoeae
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2153922)
  AUTHORS   Lewis,L.A., Gillaspy,A.F., McLaughlin,R.E., Gipson,M., Ducey,T.F.,
            Ownbey,T., Hartman,K., Nydick,C., Carson,M.B., Vaughn,J.,
            Thomson,C., Song,L., Lin,S., Yuan,X., Najar,F., Zhan,M., Ren,Q.,
            Zhu,H., Qi,S., Kenton,S.M., Lai,H., White,J.D., Clifton,S.,
            Roe,B.A. and Dyer,D.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-MAR-2003) Microbiology and Immunology, University of
            Oklahoma Health Sciences Center, 975 NE 10th St., Oklahoma City, OK
            73104, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            AE004969.
            On Feb 15, 2005 this sequence version replaced NC_002946.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 03/10/2020 04:45:08
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 2,233
            CDSs (total)                      :: 2,162
            Genes (coding)                    :: 1,973
            CDSs (with protein)               :: 1,973
            Genes (RNA)                       :: 71
            rRNAs                             :: 4, 4, 4 (5S, 16S, 23S)
            complete rRNAs                    :: 4, 4, 4 (5S, 16S, 23S)
            tRNAs                             :: 55
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 189
            CDSs (without protein)            :: 189
            Pseudo Genes (ambiguous residues) :: 0 of 189
            Pseudo Genes (frameshifted)       :: 121 of 189
            Pseudo Genes (incomplete)         :: 73 of 189
            Pseudo Genes (internal stop)      :: 45 of 189
            Pseudo Genes (multiple problems)  :: 47 of 189
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2153922
                     /organism="Neisseria gonorrhoeae FA 1090"
                     /mol_type="genomic DNA"
                     /strain="FA 1090"
                     /db_xref="taxon:242231"
     gene            159..1715
                     /gene="dnaA"
                     /locus_tag="NGO_RS00005"
                     /old_locus_tag="NGO0001"
                     /old_locus_tag="NGO_0001"
     CDS             159..1715
                     /gene="dnaA"
                     /locus_tag="NGO_RS00005"
                     /old_locus_tag="NGO0001"
                     /old_locus_tag="NGO_0001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003758099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_003687194.1"
                     /translation="MTLAEFWPLCLRRLHDMLPHGQFAQWIAPLTVGEEGGVWVVYGK
                     NQFACNMLKSQFAGKIEAVREELAAGRPAFVFKPGEGVRYEMAAVEGAVEPAEPSLHA
                     GSEEMPVQEVLLDELPSEKPVKPAASKTAADILAERMKNLPHEPRQAAGPASRPESAA
                     VAKARTDAQRDAEEARYEQTNLSPDYTFDTLVEGKGNRLAAAAAQAIAENPGQSYNPF
                     FLYGSTGLGKTHLVQAVGNELLKNRPDAKVRYMHSDDYIRSFMKAVRNNTYDVFKQQY
                     KQYDLLIIDDIQFIKGKDRTMEEFFYLYNHFHNEKKQLILTCDVLPAKIEGMDDRLKS
                     RFSWGLTLELEPPELEMRIAILQKKAEAAGISIEDEAALFIANLIRSNVRELEGAFNR
                     VGASSRFMNRPVIDIDLARTALQDIIAEKHKVITADIIIDAVAKYYRIKISDVLGKKR
                     TRNIARPRQVAMSLTKELTTLSLPSIGDSFGGRDHTTVMHGIRAVAKLREEDPELAQD
                     YEKLLILIQN"
     gene            1795..2898
                     /locus_tag="NGO_RS00010"
                     /old_locus_tag="NGO0002"
                     /old_locus_tag="NGO_0002"
     CDS             1795..2898
                     /locus_tag="NGO_RS00010"
                     /old_locus_tag="NGO0002"
                     /old_locus_tag="NGO_0002"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009174415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_010950967.1"
                     /translation="MLILQAERDSLLKPLQAFTGIVERLHTLPILSNVLIEGRGGQTK
                     LLATDLEIQIDTAGPEGGAGDFRITTNAKKFQDILRALPAGALVSLDWDDNRLTLKAG
                     KSRFALQTLPAADFPMMNVGEDISATFSLGQERFKTMLSQVQYSMAVQDIRYYLNGLL
                     MQVEGSQLRLVATDGHRLAYAACAIDADLPRAEVILPRKTVLELFKLLNNPDDPIQIE
                     LLDKQVRFQCNGTTIVSKVIDGKFPDFNRVIPLDNDKIFVLSRAELLGALERVSILAN
                     EKFRGARLFLQPGLLSVVCSNNEQEEAREEIEIAYQGGELEVGFNIGYLMDVLRNIHS
                     DDMQLAFGDANRSTLFTVPNNPNFKYIVMPMRI"
     gene            complement(3047..5104)
                     /gene="ppk1"
                     /locus_tag="NGO_RS00015"
                     /old_locus_tag="NGO0003"
                     /old_locus_tag="NGO_0003"
     CDS             complement(3047..5104)
                     /gene="ppk1"
                     /locus_tag="NGO_RS00015"
                     /old_locus_tag="NGO0003"
                     /old_locus_tag="NGO_0003"
                     /EC_number="2.7.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002244312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase 1"
                     /protein_id="WP_010950968.1"
                     /translation="MTEQNRILCRELSLLAFNRRVLAQAEDKNVPLLERLRFLCIVSS
                     NLDEFFEVRMAWLKRENKLHPRRRPDNGKMPSETIADVTEAARSLIRHQYDLFNNVLQ
                     PELARESIHFYRRRNWTGTQKKWIEDYFDRELLPILTPIGLDPSHPFPRPLNKSLNFA
                     VELDGTDAFGRPSGMAIVQAPRILPRVVPLPSELCGGGHGFVFLSSILHAHVGKLFPG
                     MNVKGCHQFRLTRDSDLTVDEEDVQNLRAAIQNELHDREYGDGVRLEVADTCPAYIRD
                     FLLAQFRLTDAELYQVKGPVNLVRLNAVPDLVNRPDLKFPPHTPGRLKALGKNSPIFD
                     LVRQSPILLHHPYQSFDPVVDMIREAAADPAVLAVKMTIYRTGTRSELVPALMKAALA
                     DKQVTVVVELMARFDEANNVNWAKQLEEAGAHVVYGVFGYKVHAKMALVIRREDGVLK
                     RYAHLGTGNYHQGTSRIYTDFGLITADEQITADVNTLFMEITGLGKPGRLNKLYQSPF
                     TLHKMVIGRIARETEHAKAGKPARITAKMNSLIEPTVIEALYRASAAGVQIDLIVRGM
                     CTLRPGVKGLSENIRVRSIVGRQLEHARVYCFHNNGADDTFISSADWMGRNFFRRIET
                     ATPITAPELKKRVIREGLEMALADNTHAWLMQPDGGYIRAAPAEGESEADLQNDLWDL
                     LRG"
     gene            complement(5273..5716)
                     /locus_tag="NGO_RS00020"
                     /old_locus_tag="NGO_0004"
     CDS             complement(5273..5716)
                     /locus_tag="NGO_RS00020"
                     /old_locus_tag="NGO_0004"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003751571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687201.1"
                     /translation="MPPRLLSGILCCLLTTAPVFAQGQPDAVSAYIQKKKVIVDTSKA
                     ELCFADDRQCHPVLIGTATPKGTFGLTLNSTDKPGYGGEVIGFKQEGDFLFALHRVWN
                     QIPSERRNERIASPSVSDRIMTNGCINVSDAVYEKLRHYFVLEVI"
     gene            complement(5723..6239)
                     /locus_tag="NGO_RS00025"
                     /old_locus_tag="NGO_00025"
                     /pseudo
     CDS             complement(5723..6239)
                     /locus_tag="NGO_RS00025"
                     /old_locus_tag="NGO_00025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002243014.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor BamE"
     gene            6506..9136
                     /locus_tag="NGO_RS00030"
                     /old_locus_tag="NGO0006"
                     /old_locus_tag="NGO_0006"
     CDS             6506..9136
                     /locus_tag="NGO_RS00030"
                     /old_locus_tag="NGO0006"
                     /old_locus_tag="NGO_0006"
                     /EC_number="6.1.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012503319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine--tRNA ligase"
                     /protein_id="WP_025456399.1"
                     /translation="MQEHYQPAAIEPAAQKKWDDARISNVSEDASKPKYYCLSMFPYP
                     SGKLHMGHVRNYTIGDVLSRFKLLNGFNVMQPMGWDAFGMPAENAAMKNNVAPAAWTY
                     DNIEYMKTQLKSLGFAIDWEREVATCKPEYYRWEQWLFTKLFEKGIVYRKNGTVNWDP
                     VDQTVLANEQVIDGRGWRSGALIEKREIPMYYFKITDYAEELLNDLDKLEHWPEQVKT
                     MQRNWIGKSRGMTVRFAVSDDSKQGLEGDYAKFLQVYTTRPDTLMGATYVAVAAEHPL
                     ATAAAADKPELQAFIAECKAGSVAEADMATMEKKGVPTGRYVVNPLNGDKLEVWIANY
                     VLWGYGDGAVMAVPAHDERDFEFAAKYNLPKKQVIAVGDNAFDANRWQEWYGDKENGV
                     LVNSGDLDGLDFQTAFDAVAAKLQSQGAGEPKTQYRLRDWGISRQRYWGCPIPIVHCE
                     KCGDVPVPADQLPVVLPENVVPDGMGSPLAKMPEFYETSCPCCGGAAKRETDTMDTFM
                     ESSWYFFRYMSPKFSDGMVSAESAKYWGAVDQYIGGIEHAILHLLYARFFTKLMRDEG
                     LVNVDEPFERLLTQGMVVCETYYRENDKGGKDWINPADVELTFDDKGRPVSAVLKADG
                     LPVVISGTEKMSKSKNNGVDPQELINAYGADTARLFMMFAAPPEQSLEWSDSGVEGAH
                     RFLRRLWRTVYEYLKQGGAVKAFAGNQDGLSKELKDLRHKLHSTTAKVSDDYGRRQQF
                     NTAIAAVMELLNQYDKTDTGSEQGRAVAQEVLEAAVRLLWPIVPHICETLWSELNGAK
                     LWEAGWPTVDEAALVKSEIEVMVQVNGKLRGKITVAADASKADLEAAALANEGAVKFM
                     EGKPAKKIIVVPGRLVNIVV"
     gene            9365..10294
                     /locus_tag="NGO_RS00035"
                     /old_locus_tag="NGO0007"
                     /old_locus_tag="NGO_0007"
     CDS             9365..10294
                     /locus_tag="NGO_RS00035"
                     /old_locus_tag="NGO0007"
                     /old_locus_tag="NGO_0007"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019270594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_010950969.1"
                     /translation="MNLFFDTQLGKQQNKATHKIRVMSEAWLEKNGYCPCCGSKPMQR
                     FANNKPVADLFCPNCHEQYELKSKNQKTIGNSVPDGAYRTMLERIRSDTNPNFFFLAY
                     KKADYSIRQLVLVPKHFITPDMIIPRNKGIKNRPHHIMCSINLAPLPESGKIFLIDDS
                     RIIEPETVLKKWQSNLFLRNQNAERKDWLLAVMKCIDQLTEEFTLSQMYEFENKLSIQ
                     FPQNNHIKDKIRQQLQILRDQNMIEFIGRGLYKKNRQIAPNSQGVLISNHDTEFTRNI
                     YSSAILKTVEVQRNIAAKGSSRKKVGELLAIYD"
     gene            10287..11094
                     /locus_tag="NGO_RS00040"
                     /old_locus_tag="NGO0008"
                     /old_locus_tag="NGO_00040"
                     /pseudo
     CDS             10287..11094
                     /locus_tag="NGO_RS00040"
                     /old_locus_tag="NGO0008"
                     /old_locus_tag="NGO_00040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009313078.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific DNA-methyltransferase"
     gene            11091..11646
                     /locus_tag="NGO_RS00045"
                     /old_locus_tag="NGO0009"
                     /old_locus_tag="NGO_0009"
                     /pseudo
     CDS             11091..11646
                     /locus_tag="NGO_RS00045"
                     /old_locus_tag="NGO0009"
                     /old_locus_tag="NGO_0009"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009313076.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            11790..12035
                     /locus_tag="NGO_RS11040"
                     /pseudo
     CDS             11790..12035
                     /locus_tag="NGO_RS11040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002244311.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(12107..12307)
                     /locus_tag="NGO_RS00050"
                     /old_locus_tag="NGO0011a"
                     /old_locus_tag="NGO_0010"
     CDS             complement(12107..12307)
                     /locus_tag="NGO_RS00050"
                     /old_locus_tag="NGO0011a"
                     /old_locus_tag="NGO_0010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002221541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010950971.1"
                     /translation="MPDRIKPSRNGGGTDGIARQQGTAQTGAKPETSPTARHGDFLRP
                     LQGGLDLSGTGLKAKRAGRRTV"
     gene            complement(12417..12728)
                     /locus_tag="NGO_RS00055"
                     /old_locus_tag="NGO0011"
                     /old_locus_tag="NGO_0011"
     CDS             complement(12417..12728)
                     /locus_tag="NGO_RS00055"
                     /old_locus_tag="NGO0011"
                     /old_locus_tag="NGO_0011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002241961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator"
                     /protein_id="WP_003700847.1"
                     /translation="MKYKSGIFAAIHETMQGLHDIGAIDKKTMRGFDKSCLTEIKPLS
                     GGDIKAIREKEALSQAAFAIYLNVGKNHVSAWERGVKKPSGAALKLLTIVKNKGIEAI
                     A"
     gene            complement(12725..13092)
                     /locus_tag="NGO_RS00060"
                     /old_locus_tag="NGO00011b"
                     /old_locus_tag="NGO_00060"
                     /pseudo
     CDS             complement(12725..13092)
                     /locus_tag="NGO_RS00060"
                     /old_locus_tag="NGO00011b"
                     /old_locus_tag="NGO_00060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019272218.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RelE/ParE family
                     toxin"
     gene            complement(13982..14067)
                     /locus_tag="NGO_RS00065"
                     /old_locus_tag="NGO_18786"
                     /old_locus_tag="NGO_t01"
     tRNA            complement(13982..14067)
                     /locus_tag="NGO_RS00065"
                     /old_locus_tag="NGO_18786"
                     /old_locus_tag="NGO_t01"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(14031..14033),aa:Leu,seq:gag)
     gene            complement(14081..14431)
                     /gene="secG"
                     /locus_tag="NGO_RS00070"
                     /old_locus_tag="NGO0016"
                     /old_locus_tag="NGO_0016"
     CDS             complement(14081..14431)
                     /gene="secG"
                     /locus_tag="NGO_RS00070"
                     /old_locus_tag="NGO0016"
                     /old_locus_tag="NGO_0016"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019270391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="WP_003687220.1"
                     /translation="MEAFKTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSA
                     QGVFGSAGNANFLSRSTAVAATFFFATCMAMVYIHTHTTKHGLDFSNIRQTQQAPKPV
                     SNTEPSAPVPQQQK"
     gene            complement(14438..15211)
                     /locus_tag="NGO_RS00075"
                     /old_locus_tag="NGO0017"
                     /old_locus_tag="NGO_0017"
     CDS             complement(14438..15211)
                     /locus_tag="NGO_RS00075"
                     /old_locus_tag="NGO0017"
                     /old_locus_tag="NGO_0017"
                     /EC_number="5.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003748082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triose-phosphate isomerase"
                     /protein_id="WP_003687222.1"
                     /translation="MYRQIGMWDQKWVIGNWKMNGRLQNNNALMHRFRILPTAERVLI
                     GLAAPTVYLLQLHNAMQIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVL
                     IGHSERSLYFGEKNEIQRRKMENVLNVGLIPLLCVGESLEERETGKEHEVIAHQLSIL
                     QGLDTKNIAVAYEPVWAIGTGKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSV
                     KADNAADIFAVPYVDGALVGGASLSYDSFTAIISAAQNA"
     gene            15370..15897
                     /locus_tag="NGO_RS00080"
                     /old_locus_tag="NGO0018"
                     /old_locus_tag="NGO_0018"
     CDS             15370..15897
                     /locus_tag="NGO_RS00080"
                     /old_locus_tag="NGO0018"
                     /old_locus_tag="NGO_0018"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010981096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GAF domain-containing protein"
                     /protein_id="WP_003696618.1"
                     /translation="MYANMGDMMHALHFSASDKAALYREVLPQIESVVADEADWVANL
                     ANTAAVLKEAFGWLWVGFYFVDTRSDELVLAPFQGPLACTRIPFGRGVCGQAWAKGET
                     VVVKDVNAHPDHIACSSLSRSEIVVPLFSDGRCIGVLDADSEHLAQFDEADALYLGEL
                     AKILERRFEASSQAA"
     gene            16000..16656
                     /locus_tag="NGO_RS00085"
                     /old_locus_tag="NGO0019"
                     /old_locus_tag="NGO_0019"
     CDS             16000..16656
                     /locus_tag="NGO_RS00085"
                     /old_locus_tag="NGO0019"
                     /old_locus_tag="NGO_0019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="WP_003687226.1"
                     /translation="MDFEKARFNMVEQQIRPWDVLDFDVLDALEEIPRELFADESLQG
                     LAYADMELPLANGHKMLEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGRV
                     VSDDIDAERQKRAKAVLDGLSLENIDYVQNNGLTELSAGAPFDAVYVGGAVTLVPEVL
                     KEQLKDGGRMAVIVGRRPVQRALLITRRGDVFEEKVLFDTLVAHLDDKDAHPFDSFNF
                     "
     gene            16737..17060
                     /locus_tag="NGO_RS00090"
                     /old_locus_tag="NGO0020"
                     /old_locus_tag="NGO_0020"
     CDS             16737..17060
                     /locus_tag="NGO_RS00090"
                     /old_locus_tag="NGO0020"
                     /old_locus_tag="NGO_0020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002247146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_003687228.1"
                     /translation="MDIVQLPSAALKAWMDEGRMFCLLDVRTDEEAAVCSLPNALHIP
                     MNLIPLRQNELPDDVPLVVYCHHGIRSLHTAMYLAEAGFENLYNLQGGIDAWAVEVDA
                     EMARY"
     gene            complement(17323..19500)
                     /locus_tag="NGO_RS00095"
                     /old_locus_tag="NGO0021"
                     /old_locus_tag="NGO_0021"
     CDS             complement(17323..19500)
                     /locus_tag="NGO_RS00095"
                     /old_locus_tag="NGO0021"
                     /old_locus_tag="NGO_0021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003768939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="WP_010950972.1"
                     /translation="MTRFKYSLLFAALLPVYAQADVSVSDDPKPQESTELPTITVTAD
                     RTASSNDGYTVSGTHTPFGLPMTLREIPQSVSVITSQQMRDQNIKTLDRALLQATGTS
                     RQIYGSDRAGYNYLFARGSRIANYQINGIPVADALADTGNANTAAYERVEVVRGVAGL
                     PDGTGEPSATVNLVRKHPTRKPLFEVRAEAGNRKHFGLGADVSGSLNAEGTLRGRLVS
                     TFGRGDSWRQLERSRDAELYGILEYDIAPQTRVHAGMDYQQAKETADAPLSYAVYDSQ
                     GYATAFGPKDNPATNWSNSRNRALNLFAGIEHRFNQDWKLKAEYDYTRSRFRQPYGVA
                     GVLSIDHSTAATDLIPGYWHADPRTHSASMSLTGKYRLFGREHDLIAGINGYKYASNK
                     YGERSIIPNAIPNAYEFSRTGAYPQPSSFAQTIPQYDTRRQIGGYLATRFRAADNLSL
                     ILGGRYSRYRAGSYNSRTQGMTYVSANRFTPYTGIVFDLTGNLSLYGSYSSLFVPQLQ
                     KDEHGSYLKPVTGNNLEADIKGEWLEGRLNASAAVYRARKNNLATAAGRDQSGNTYYR
                     AANQAKTHGWEIEVGGRITPEWQIQAGYSQSKPRDQDGSRLNPDSVPERSFKLFTAYH
                     LAPEAPSGRTIGAGVRRQGETHTDPAALRIPNPAAKARAVANSRQKAYAVADIMARYR
                     FNPRTELSLNVDNLFNKHYRTQPDRHSYGALRTVNAAFTYRFK"
     gene            complement(19763..20086)
                     /locus_tag="NGO_RS00100"
                     /old_locus_tag="NGO0022"
                     /old_locus_tag="NGO_0022"
     CDS             complement(19763..20086)
                     /locus_tag="NGO_RS00100"
                     /old_locus_tag="NGO0022"
                     /old_locus_tag="NGO_0022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003768951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="WP_010950973.1"
                     /translation="MQNETINLKQHLAAIKEYWQPEIINRHGFQFRLVKLLVDYGWHT
                     HGYSDKVLFAVEGDMAVDFADGGNMTIREGEMAVVPKSVSHRPRSENGCSVVLIDLPD
                     PSEAA"
     gene            complement(20119..21090)
                     /locus_tag="NGO_RS00105"
                     /old_locus_tag="NGO0023"
                     /old_locus_tag="NGO_0023"
     CDS             complement(20119..21090)
                     /locus_tag="NGO_RS00105"
                     /old_locus_tag="NGO0023"
                     /old_locus_tag="NGO_0023"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010356564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="siderophore ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_010356564.1"
                     /translation="MKPRFYWAACAVLPAACSPEPAAEKTVSAASQAASTPVATLTVP
                     TARGDAVVPKNPERVAVYDWAALDTLTEPGVNVGATTAPVRVDYLQPAFDKAATVGTL
                     FEPDCESLHRHNPQFVITGGPGAEAYEQLAKNATTIDLTVDNGNIRTSGEKQMETLSR
                     IFGKEARVAELNAQIDALFAQKREAAKGKGRGLVLSVTGNKVSAFGTQSRLASWIHGD
                     IGLPPVDESLRNEGHGQPVSFEYIKEKNPGWIFIIDRTAAIGQEGPAAVEVLDNALVC
                     GTNAWKRKQIIVMPAANYIVAGGARQLIQAAEQLKAAFEKAEPVAAQ"
     gene            21326..22282
                     /locus_tag="NGO_RS00110"
                     /old_locus_tag="NGO0025"
                     /old_locus_tag="NGO_0025"
     CDS             21326..22282
                     /locus_tag="NGO_RS00110"
                     /old_locus_tag="NGO0025"
                     /old_locus_tag="NGO_0025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002227655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_003694694.1"
                     /translation="MNTAAIYRQYQTYVRSDKSGWALDGCSDSALIAQAKQPGLHLKM
                     CINRFDSGITLSRMRGGGTGAFPTEIHNFSHNCALFVMVSGQNRLQMGGREYRPSAGE
                     IWLVRGELADVSETLLPDSGGMCALHLDFSLEKLRRWHDEGLLDERLFSPQTIGRFAL
                     QRLAQNAGTLTAAACPLLQRPFESDGFGLLADEADALELSARLLRFTFRRHDNGYRRR
                     RIDEAADILNSEFARPLTIAEIARRVGLNECYLKRYFKAQTGETVAGRLRRLRLEHAL
                     ALIESGSTIQAAMHFCGYRHAGRFNEAFRRHYGFLPSDVKKC"
     gene            complement(22395..24410)
                     /locus_tag="NGO_RS00115"
                     /old_locus_tag="NGO0026"
                     /old_locus_tag="NGO_0026"
     CDS             complement(22395..24410)
                     /locus_tag="NGO_RS00115"
                     /old_locus_tag="NGO0026"
                     /old_locus_tag="NGO_0026"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002239320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S9 family peptidase"
                     /protein_id="WP_003694697.1"
                     /translation="MKSYPDPYRHFENLDSAETQNFAAEANAETRARFLNNDKARALS
                     DGILNQMQDTRQIPFCQEHRARMYHFHQNAEYPKGVYRMCTAATYRSGYPEWKILFSV
                     ADFDELLGDDVYLGGVSHLVEQPNRALLTLNKSGGDTAYTLEVDLEAGELVEGGFHFP
                     AGKNHVSWRDENSVWVCPAWDERQLTESGYPREVWLVERGKSFEESLPAYQIDKGAMM
                     VNAWRYLDPQGSPIDLIEASDGFYTKTYLQVSSEGGAKPLNLPNDCDVVGYLAGHLLL
                     TLRKDWHRANQSYPSGALVAVKLNRGELGAAQLLFAPDETQALESVETTKRFVVASLL
                     ENVQGRLKAWRFADSKWQEAELPHLPSGALEMTDQPWGGDVVYLAASDFTTPLTLFAL
                     DLNVMELTVMRLQPQQFVSDGIEVRQFWAVSSDGERIPYFHVGKNAAPDTPTLVYAYG
                     GFGIPELPHYLGSVGKYWLEEGNAFVLANIRGGGEFGPRWHQAAQGISKHKSVDDLLA
                     VVRDLSERGMSSPKHIGLQGGSNGGLITAAAFVREPQSIGALVCEVPLTDMIRYPLLS
                     AGSSWTDEYGNPQKYEACKRRLGELSPYHNLSDGIDYPPALITTSLSDDRVHPAHALK
                     FYAKLRETSPQSWLYSPDGGGHTGNGTQRESADKLACVLLFLKEFLG"
     gene            complement(24506..25816)
                     /gene="argA"
                     /locus_tag="NGO_RS00120"
                     /old_locus_tag="NGO0027"
                     /old_locus_tag="NGO_0027"
     CDS             complement(24506..25816)
                     /gene="argA"
                     /locus_tag="NGO_RS00120"
                     /old_locus_tag="NGO0027"
                     /old_locus_tag="NGO_0027"
                     /EC_number="2.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002243854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino-acid N-acetyltransferase"
                     /protein_id="WP_010950974.1"
                     /translation="MNAPDSFVAHFREAAPYIRQMRGTTLVAGIDGRLLEGGTLNKLA
                     ADIGLLSQLGIRLVLIHGAYHFLDRLAAAQGRTPHYCRGLRVTDETSLGQAQQFAGTV
                     RSRFEAALCGSVSGFARAPSVPLVSGNFLTARPIGVIDGTDMEYAGVIRKTDTAALRF
                     QLDAGNIVWMPPLGHSYGGKTFNLDMVQAAASVAVSLQAEKLVYLTLSDGISRPDGTL
                     AETLSAQEAQSLAEHAASETRRLISSAVAALEGGVHRVQILNGAADGSLLQELFTRNG
                     IGTSIAKEAFVSIRQAHSGDIPHIAALIRPLEEQGVLLHRSREYLENHISEFSILEHD
                     GDLYGCAALKTFAEADCGEIACLAVSPQAQDGGYGERLLAHIIDKARGIGISRLFALS
                     TNTGEWFAERGFQTASEDELPETRRKDYRSNGRNPHILVRRLHR"
     gene            complement(25813..26241)
                     /locus_tag="NGO_RS00125"
                     /old_locus_tag="NGO0028"
                     /old_locus_tag="NGO_0028"
     CDS             complement(25813..26241)
                     /locus_tag="NGO_RS00125"
                     /old_locus_tag="NGO0028"
                     /old_locus_tag="NGO_0028"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002236153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003690500.1"
                     /translation="MPACFCPHCKTRLWVKETQLNVAQGFVVCQKCEGLFKAKDHLAS
                     TKEPIFNDLPEAVSDVKLVHRIGTHAISKKQISRDEIADILNGGTTLHDTPPATAAAA
                     PAAAPQVSVPPARQEGLNWTIATLFALIVLIMQLSYLFIL"
     gene            complement(26309..26950)
                     /gene="pyrE"
                     /locus_tag="NGO_RS00130"
                     /old_locus_tag="NGO0029"
                     /old_locus_tag="NGO_0029"
     CDS             complement(26309..26950)
                     /gene="pyrE"
                     /locus_tag="NGO_RS00130"
                     /old_locus_tag="NGO0029"
                     /old_locus_tag="NGO_0029"
                     /EC_number="2.4.2.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012221266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="WP_003690501.1"
                     /translation="MTDFRQDFLKFSLAQNVLKFGEFTTKAGRRSPYFFNAGLFNDGA
                     STLQLAKFYAQSIIESGIRFDMLFGPAYKGIILAAATAMMLAEKGVNVPFAYNRKEAK
                     DRGEGGVLVGAPLKGRVLIIDDVISAGTSVRESIKLIEAEGATPAGVAIALDRMEKGT
                     GKLSAVQEVEKQYGLPVAPIASLNDLFILLQNNPEFGQFLEPVRTYRRQYGVE"
     gene            complement(27012..27749)
                     /locus_tag="NGO_RS00135"
                     /old_locus_tag="NGO0030"
                     /old_locus_tag="NGO_0030"
     CDS             complement(27012..27749)
                     /locus_tag="NGO_RS00135"
                     /old_locus_tag="NGO0030"
                     /old_locus_tag="NGO_0030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010791194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-DNA glycosylase family protein"
                     /protein_id="WP_010950975.1"
                     /translation="MLSARYLHLHEALGLGPMWLKQAAAVLPPKNTPATPAQARPQTV
                     RAATIRPSQPHNVQTRLETMKALETAAVHTRKPAPETETPPPGLSDGIAPVPAASGIT
                     KLAVVSLCPPIEDAVYGQLFHGKAGILLDNILKAAGLDAAYVHKTCWVKTAAVGNPMP
                     SEQAVADALGQIARELDGCRAPAVLFLGQAFVNLERQAMIETLCGSRPFFIIDHPARL
                     LRQPELKARNWQVLKQLKRALRQGGGS"
     gene            complement(27743..28183)
                     /gene="rimI"
                     /locus_tag="NGO_RS00140"
                     /old_locus_tag="NGO0031"
                     /old_locus_tag="NGO_0031"
     CDS             complement(27743..28183)
                     /gene="rimI"
                     /locus_tag="NGO_RS00140"
                     /old_locus_tag="NGO0031"
                     /old_locus_tag="NGO_0031"
                     /EC_number="2.3.1.266"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003702201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S18-alanine
                     N-acetyltransferase"
                     /protein_id="WP_003700855.1"
                     /translation="MNIRPASPSDCAALAALDTVCNPSAWTQRQFESALVSPSEQVFL
                     AEKDGRIAAFIVWQNLPDESELHLIATAPECRRRGVASALLEYWYAHLPEGTQRLLLE
                     VRAGNAAAQALYTKHGFSIAGRRKNYYCAADGQTEDAVLMEKIC"
     gene            complement(28180..28857)
                     /gene="tsaB"
                     /locus_tag="NGO_RS00145"
                     /old_locus_tag="NGO0032"
                     /old_locus_tag="NGO_0032"
     CDS             complement(28180..28857)
                     /gene="tsaB"
                     /locus_tag="NGO_RS00145"
                     /old_locus_tag="NGO0032"
                     /old_locus_tag="NGO_0032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002251540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (adenosine(37)-N6)-threonylcarbamoyltransferase complex
                     dimerization subunit type 1 TsaB"
                     /protein_id="WP_003687250.1"
                     /translation="MQADFNRPVLAVDTGTSYLSLALRADGEIRLFHQEVGIRQSELI
                     LPEIRTLFRNAGITAADLGAIVYAKGPGAFTGLRIGIGVAQGLATPFDTPLIGIPTLD
                     AAASLPPPQSCILAAADARMGEVFYAWFDTLNRRRLSDYQVGRAADIALPEGYVFSDG
                     IGSAFALENRPPFSGKPDMPTAADFLALALGGGYPATGAAHAELLYVRNKIALTAKEQ
                     AERKART"
     gene            complement(28996..29853)
                     /locus_tag="NGO_RS00150"
                     /old_locus_tag="NGO0033"
                     /old_locus_tag="NGO_0033"
     CDS             complement(28996..29853)
                     /locus_tag="NGO_RS00150"
                     /old_locus_tag="NGO0033"
                     /old_locus_tag="NGO_0033"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017146691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_010950976.1"
                     /translation="MTRSKPVNRTTFCCLSLTAGPDSDRLQQRRGGGGGVAADIGTGL
                     ADALTAPLDHKDKGLKSLTLEASIPQNGTLTLSAQGAEKTFKAGGKDNSLNTGKLKND
                     KISRFDFVQKIEVDGQTITLASGEFQIYKQDHSAVVALRIEKINNPDKIDSLINQRSF
                     LVSDLGGEHTAFNQLPDGKAEYHGKAFSSDDADGKLTYTIDFAAKQGHGKIEHLKTPE
                     QNVELASAELKADEKSHAVILGDTRYGGEEKGTYRLALFGDRAQEIAGSATVKIGEKV
                     HEIGIADKQ"
     gene            complement(29992..31056)
                     /locus_tag="NGO_RS00155"
                     /old_locus_tag="NGO0034"
                     /old_locus_tag="NGO_0034"
     CDS             complement(29992..31056)
                     /locus_tag="NGO_RS00155"
                     /old_locus_tag="NGO0034"
                     /old_locus_tag="NGO_0034"
                     /EC_number="4.1.2.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase class II"
                     /protein_id="WP_003687252.1"
                     /translation="MALVSMRQLLDHAAENSYGLPAFNVNNLEQMRAIMEAADQVNAP
                     VIVQASAGARKYAGAPFLRHLILAAVEEFPHIPVVMHQDHGASPDVCQRSIQLGFSSV
                     MMDGSLLEDGKTPSSYEYNVNATRTVVNFSHACGVSVEGEIGVLGNLETGEAGEEDGV
                     GAAGKLSHDQMLTSVEDAVRFVKDTGVDALAIAVGTSHGAYKFTRPPTGDVLRIDRIK
                     EIHQALPNTHIVMHGSSSVPQEWLKVINEYGGNIGETYGVPVEEIVEGIKHGVRKVNI
                     DTDLRLASTGAVRRYLAENPSDFDPRKYLGKTIEAMKQICLDRYLAFGCEGQAGKIKP
                     VSLEKMASRYAKGELNQIVK"
     gene            31250..32167
                     /gene="xerC"
                     /locus_tag="NGO_RS00160"
                     /old_locus_tag="NGO0035"
                     /old_locus_tag="NGO_0035"
     CDS             31250..32167
                     /gene="xerC"
                     /locus_tag="NGO_RS00160"
                     /old_locus_tag="NGO0035"
                     /old_locus_tag="NGO_0035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002243046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase XerC"
                     /protein_id="WP_003687253.1"
                     /translation="MVLDGFAAYFDAYLENIVREGKSEHTVAAYRRDLEELFALLAQM
                     PSEDAGGVPQDLSRRDFTAALRRLSQRGLDGRTLARKLSAWRQYCAWLVKRGLMRADP
                     TADIKPPKQPERVPKALPQEWLNRMLDLPVDGGDPLAVRDHALFELMYGSGLRVSEIH
                     GLNADDVYLDEAWVHVTGKGRKQRQVPLTGKSVEALKNYLPLRQTASDGKALFTGRNG
                     TRLSQRQIQKRLESWAAQYGDGRHVSPHMMRHSYAGHLLQASRDIRAVQELLGHSSLS
                     TTQIYTKLDFDHIARLYDEAHPRAKRQDE"
     gene            32252..34165
                     /gene="dxs"
                     /locus_tag="NGO_RS00165"
                     /old_locus_tag="NGO0036"
                     /old_locus_tag="NGO_0036"
     CDS             32252..34165
                     /gene="dxs"
                     /locus_tag="NGO_RS00165"
                     /old_locus_tag="NGO0036"
                     /old_locus_tag="NGO_0036"
                     /EC_number="2.2.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="WP_003696634.1"
                     /translation="MNPSPLLHLIDSPQDLRRLDKKQLPRLAGELRAFLLESVGQTGG
                     HFASNLGAVELTIALHYVYDTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGLAG
                     FPKRCESEYDAFGVGHSSTSIGAALGMAAADKLLGGDRRSVAIIGDGAMTAGQAFEAL
                     NCAGDMDVDLLVVLNDNEMSISPNVGALPKYLASNVVRDMHGLLSTVKAQTGKVLDKI
                     PGAMEFAQKVEHKIKTLAEEAEHAKQSLSLFENFGFRYTGPVDGHNVENLVDVLKDLR
                     SRKGPQLLHVITKKGNGYKLAENDPVKYHAVANLPKEGGAQMPSEKEPKPAAKPTYTQ
                     VFGKWLCDRAAADSRLVAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLA
                     CEGMKPVVAIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDLSF
                     LRCVPNMIVAAPSDENECRLLLSTCYQADAPAAVRYPRGTGTGAPVSDGMETVEIGKG
                     IIRREGEKTAFIAFGSMVATALAVAEKLNATVADMRFVKPIDEELIVRLARSHDRIVT
                     LEENAEQGGAGGAVLEVLAKHGICKPVLLLGVADTVTEHGDPKKLLDDLGLSAEAVER
                     RVREWLPDRDAAN"
     gene            complement(34230..34394)
                     /locus_tag="NGO_RS00170"
                     /old_locus_tag="NGO_00175"
     CDS             complement(34230..34394)
                     /locus_tag="NGO_RS00170"
                     /old_locus_tag="NGO_00175"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_153707845.1"
                     /translation="MPPEAFQTAFCLVSADGTAAVIRTSGINFQTRNGTPSTARKPPP
                     EPFLPPAGFQ"
     gene            complement(34412..35740)
                     /gene="miaB"
                     /locus_tag="NGO_RS00175"
                     /old_locus_tag="NGO0037"
                     /old_locus_tag="NGO_0037"
     CDS             complement(34412..35740)
                     /gene="miaB"
                     /locus_tag="NGO_RS00175"
                     /old_locus_tag="NGO0037"
                     /old_locus_tag="NGO_0037"
                     /EC_number="2.8.4.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019270969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (N6-isopentenyl
                     adenosine(37)-C2)-methylthiotransferase MiaB"
                     /protein_id="WP_010950977.1"
                     /translation="MKKVFIRTFGCQMNEYDSEKMLSVLAEEHGGIEQVTQADEADII
                     LFNTCSVREKAQEKVFSDLGRVRPLKEKNPGLIIGVAGCVASQEGENIIKRAPYVDVV
                     FGPQTLHRLPKMIVDKETSGLSQVDISFPEIEKFDHLPPARVEGGAAFVSIMEGCSKY
                     CSFCVVPYTRGEEFSRPLNDVLTEIANLAQQGVKEINLLGQNVNAYRGEMDDGEICDF
                     ATLLRIVHEIPGIERMRFTTSHPREFTDSIIECYRDLPKLVSHLHLPIQSGSDRVLSA
                     MKRGYTALEYKSIIRKLRAIRPDLCLSSDFIVGFPGETEREFEQTLKLVKDIAFDLSF
                     VFIYSPRPGTPAANLPDDTPHEEKVRRLEALNEVIEAETARINQTMIGTVQRCLVEGI
                     SKKDPDQLQARTVNNRVVNFTGTPDMINQMIDLEITEAYTFSLRGKIVEA"
     gene            35943..>36023
                     /locus_tag="NGO_RS00180"
                     /pseudo
     CDS             35943..>36023
                     /locus_tag="NGO_RS00180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003712609.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine-fructose-6-phosphate
                     aminotransferase"
     gene            36287..36460
                     /locus_tag="NGO_RS00185"
     CDS             36287..36460
                     /locus_tag="NGO_RS00185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002244690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine-fructose-6-phosphate
                     aminotransferase"
                     /protein_id="WP_139020268.1"
                     /translation="MKSERRHWEWCADYDGEGVVRDYRFTHKVEKDERSVIRDTVGVI
                     RKEAGKSLSQPEK"
     gene            36524..37804
                     /gene="hemL"
                     /locus_tag="NGO_RS00190"
                     /old_locus_tag="NGO0040"
                     /old_locus_tag="NGO_0040"
     CDS             36524..37804
                     /gene="hemL"
                     /locus_tag="NGO_RS00190"
                     /old_locus_tag="NGO0040"
                     /old_locus_tag="NGO_0040"
                     /EC_number="5.4.3.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde 2,1-aminomutase"
                     /protein_id="WP_003687258.1"
                     /translation="MNRNEILFDRAKAIIPGGVNSPVRAFGSVGGVPRFIKKAEGAYV
                     WDENGTRYTDYVGSWGPAIVGHAHPEVVEAVREAALGGLSFGAPTEGEIAIAEQIAEI
                     MPSVERLRLVSSGTEATMTAIRLARGFTGRDKIIKFEGCYHGHSDSLLVKAGSGLLTF
                     GNPSSAGVPADFTKHTLVLEYNNIAQLEEAFAQSGDEIACVIVEPFVGNMNLVRPTEA
                     FVKALRGLTEKHGAVLIYDEVMTGFRVALGGAQSLHGITPDLTTMGKVIGGGMPLAAF
                     GGRKDIMECISPLGGVYQAGTLSGNPIAVAAGLKTLEIIQREGFYENLTALTQRLANG
                     IAAAKAHGIEFAADSVGGMFGLYFAAHVPRNYADMARSNIDAFKRFFHGMLDRGIAFG
                     PSAYEAGFVSAAHTPELIDETVAVAVEVFKAMAA"
     gene            complement(38028..38516)
                     /locus_tag="NGO_RS00195"
                     /old_locus_tag="NGO0040a"
                     /old_locus_tag="NGO_00195"
     CDS             complement(38028..38516)
                     /locus_tag="NGO_RS00195"
                     /old_locus_tag="NGO0040a"
                     /old_locus_tag="NGO_00195"
                     /inference="COORDINATES: protein motif:HMM:NF024751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_025462866.1"
                     /translation="MTRPAGFSDCQRVCPDETGFDRRLFRPYARSLKGQMAKARISGK
                     RYRRLSLVSAQVGNRPIAPMVCQNTVAGVFFEARFQQCLLPALAQKSVIISDNARFRR
                     MGALRGTAEKLGHKVLPPAPCSPEPNPIEKVWANIKRYLRTVLSDYARFDDALLSYFD
                     FN"
     gene            complement(38525..38788)
                     /locus_tag="NGO_RS00200"
                     /old_locus_tag="NGO_00200"
     CDS             complement(38525..38788)
                     /locus_tag="NGO_RS00200"
                     /old_locus_tag="NGO_00200"
                     /inference="COORDINATES: protein motif:HMM:NF013842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_005231956.1"
                     /translation="MSRNTLYLRIRLKKQTGSLKHQVTGLNAAKSDRQKPARYVGRHP
                     DACLHEIAKHFDCTAAAVCHAPKQMRMARKKRPPLTKDKTRPK"
     gene            complement(39110..39673)
                     /gene="orn"
                     /locus_tag="NGO_RS00205"
                     /old_locus_tag="NGO0042"
                     /old_locus_tag="NGO_0042"
     CDS             complement(39110..39673)
                     /gene="orn"
                     /locus_tag="NGO_RS00205"
                     /old_locus_tag="NGO0042"
                     /old_locus_tag="NGO_0042"
                     /EC_number="3.1.-.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoribonuclease"
                     /protein_id="WP_003687260.1"
                     /translation="MQDKNNLCWLDMEMTGLNPETDRIIEVAMIITDSDLNVLAQSEV
                     YAIHQSDDLLDNMDEWNTATHGRTGLTQRVRESSHTEAEVEQKLLDFMSEWIPGRATP
                     MCGNSIHQDRRFMVKYMPKLENYFHYRNLDVSTLKELAKRWNPPIAKSVVKRGSHKAL
                     DDILESIEEMRHYREHFLISAPKAEAQ"
     gene            complement(39691..40578)
                     /gene="prmA"
                     /locus_tag="NGO_RS00210"
                     /old_locus_tag="NGO0043"
                     /old_locus_tag="NGO_0043"
     CDS             complement(39691..40578)
                     /gene="prmA"
                     /locus_tag="NGO_RS00210"
                     /old_locus_tag="NGO0043"
                     /old_locus_tag="NGO_0043"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003684134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11 methyltransferase"
                     /protein_id="WP_010950979.1"
                     /translation="MPYQQITVNVNDAVAERLADALMEHGALSAAIEDACAGTQNEQA
                     IFGEPGMPTEQIWQQSKVIALFGEHDEAAAVIDAAAQECGLKDLAYTGETIENQDWVR
                     LTQSQFDPIRISDRLWITPSWHEAPEGCAVNLRLDPGLAFGTGSHPTTRLCLKWLDTQ
                     LKNGESVLDYGCGSGILTIAALKLGAGSAVGVDIDEQAVRSGRDNAEQNNVDAQFFLP
                     DSLPQGQFDVVVANILANPLRMLGEMLAARTKQGGRIVLSGLLDEQAEELGGIYSQWF
                     DLDPAETDEGWARLSGVKR"
     gene            complement(40682..42043)
                     /gene="accC"
                     /locus_tag="NGO_RS00215"
                     /old_locus_tag="NGO0044"
                     /old_locus_tag="NGO_0044"
     CDS             complement(40682..42043)
                     /gene="accC"
                     /locus_tag="NGO_RS00215"
                     /old_locus_tag="NGO0044"
                     /old_locus_tag="NGO_0044"
                     /EC_number="6.3.4.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxylase
                     subunit"
                     /protein_id="WP_003704972.1"
                     /translation="MLKKVLIANRGEIALRVLRACREMGIATVAVHSETDKGSLHVKL
                     ADESVCIGPAASAQSYLNIPAIIAAAEVTCADAVHPGYGFLAENADFAEQVEQSGFTF
                     IGPKPDTIRLMGDKVSAKHAMIAAGVPCVPGSDGALPDDDAEILKIADKVGYPVIIKA
                     SGGGGGRGMRVVEKKEDLLQSVEMTKAEAGAAFGNPMVYMERYLQRPRHVEIQVLADE
                     HGNAVYLAERDCSLQRRHQKVIEEAPAPFIDEKARKKIGKACTDACKRIGYRGAGTFE
                     FLYEDGEFFFIEMNTRVQVEHPVTELITGVDIVQEQLRIASGLPLQYKQKDIKIEGHA
                     FECRINAEDPYNFIPSPGPIESCHLPGGFGIRVDSHIYQGYRIPPYYDSLIGKICVHG
                     KTREQAMAKMRVALAELAVTGIKTNTPLHRDLFADAGFQEGGVSIHYLEHWLEARKTK
                     QDK"
     gene            complement(42157..42618)
                     /locus_tag="NGO_RS00220"
                     /old_locus_tag="NGO0045"
                     /old_locus_tag="NGO_0045"
     CDS             complement(42157..42618)
                     /locus_tag="NGO_RS00220"
                     /old_locus_tag="NGO0045"
                     /old_locus_tag="NGO_0045"
                     /EC_number="6.4.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003712598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein"
                     /protein_id="WP_003687267.1"
                     /translation="MDLRKLKKLIDLVEESGIAEIEVTEGEEKVRITRTIAAAAAPVY
                     AAPVPAAAPAVTPAAAPVAASAPAAAPAARDLSDAQKSPMVGTFYRAPGPNAAAFVEV
                     GQQVKAGDTLCIIEAMKLMNEIEAEKSGTVKEILVENGTPVEFGEPLFIIG"
     gene            complement(42600..42857)
                     /locus_tag="NGO_RS00225"
                     /old_locus_tag="NGO0046"
                     /old_locus_tag="NGO_0046"
     CDS             complement(42600..42857)
                     /locus_tag="NGO_RS00225"
                     /old_locus_tag="NGO0046"
                     /old_locus_tag="NGO_0046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014575556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687268.1"
                     /translation="MRKIKLPAHFPQKPPFFDILLDIYRQLRENEHNFTVVSHHRKTV
                     SEHHSARFAPLPQAGCFLKNQRNNPPEHRQPLKEQKWICAN"
     gene            42974..44014
                     /gene="queA"
                     /locus_tag="NGO_RS00230"
                     /old_locus_tag="NGO0047"
                     /old_locus_tag="NGO_0047"
     CDS             42974..44014
                     /gene="queA"
                     /locus_tag="NGO_RS00230"
                     /old_locus_tag="NGO0047"
                     /old_locus_tag="NGO_0047"
                     /EC_number="2.4.99.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019271811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA preQ1(34) S-adenosylmethionine
                     ribosyltransferase-isomerase QueA"
                     /protein_id="WP_010950980.1"
                     /translation="MDISDFDFTLPEHLIAQHPPEVRGSSRLLVALSDMPLQDRVFGD
                     LPDYVEAGDVLVFNNTKVMKARLFGQKDSGGRIEALIERVLDNHTALAHIRSSKSPKP
                     GMGLVFEGGIRAVMVGREGELFCLRFEGGQTVYELLEQNGHLPLPPYIERAADADDDS
                     RYQTVYAKYQGAVAAPTAGLHFTEELLRRLKDKGAVTAEVTLHVGAGTFQPVRVDKIE
                     EHKMHSEWFEVPSETVAAVEAAKARGNKAWAVGTTSMRALESAARATGYLKDGQGDTD
                     IFITPGYRFNVVDRLVTNFHLPKSTLLMLVGAFSGMGHIRAVYRHAIEREYRFFSYGD
                     AMVLGRNEGGGL"
     gene            complement(44215..47430)
                     /gene="carB"
                     /locus_tag="NGO_RS00235"
                     /old_locus_tag="NGO0048"
                     /old_locus_tag="NGO_0048"
     CDS             complement(44215..47430)
                     /gene="carB"
                     /locus_tag="NGO_RS00235"
                     /old_locus_tag="NGO0048"
                     /old_locus_tag="NGO_0048"
                     /EC_number="6.3.5.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003749610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl-phosphate synthase large subunit"
                     /protein_id="WP_003704965.1"
                     /translation="MPKRTDLKSILIIGAGPIVIGQACEFDYSGAQACKALREEGYKV
                     ILVNSNPATIMTDPEMADVTYIEPIMWQTVEKIIAKERPDAILPTMGGQTALNCALDL
                     ARNGVLAKYNVELIGATEDAIDKAEDRGRFKEAMEKIGLSCPKSFVCHTMNEALAAQE
                     QVGFPTLIRPSFTMGGSGGGIAYNKDEFLAICERGFDASPTHELLIEQSVLGWKEYEM
                     EVVRDKADNCIIICSIENFDPMGVHTGDSITVAPAQTLTDKEYQIMRNASLAVLREIG
                     VDTGGSNVQFAVNPENGEMIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGFTLDE
                     LRNDITGGRTPASFEPSIDYVVTKIPRFAFEKFPAADDRLTTQMKSVGEVMAMGRTIQ
                     ESFQKALRGLETGLCGFNPRSEDKAEIRRELANPGPERMLFVADAFRAGFTPEEIHEI
                     CAIDPWFLAQIEDLMKEEKSVSDGQLQDLDYAALRRLKRKGFSDKRLAQLLNVSEKEV
                     REHRYALKLHPVYKRVDTCAAEFATETAYLYSTYEEECESRPSDRKKVMILGGGPNRI
                     GQGIEFDYCCVHAALALRESGFETIMVNCNPETVSTDFDTSDRLYFEPLTLEDVLEIV
                     RTENPWGVIVHYGGQTPLKLANALVENGVNIIGTSADSIDAAEDRERFQKVLNDLGLR
                     QPPNRIAHNEEEALVKAEEIGYPLVVRPSYVLGGRAMQIIHSAEQLQKYMREAVQVSE
                     DSPVLLDFFLNNAIEVDVDCVSDGKDVVIGGIMQHVEQAGIHSGDSGCSLPPYSLSEE
                     IQDEIRRQTKAMAYALGVVGLMNVQFAVQDGVVFVLEVNPRASRTVPFVSKATGVPLA
                     KVGARCMAGISLKEQGVEKEVVPDFYAVKEAVFPFIKFPGVDTILGPEMRSTGEVMGV
                     GASFGEAYYKAQLGAGERLNPTGKIFLSVREEDKERVIKTAKNFQALGYGICATRGTA
                     QYLTEHGLIVQAINKVPEGRPHIGDALKNGEIALVVNTVSSDPQSVSDSHIIRQSALQ
                     QRVPQYTTTAGGEAMSEGAKSRDYLGVYSVQELHGRLKNRN"
     gene            complement(47441..47974)
                     /locus_tag="NGO_RS00240"
                     /old_locus_tag="NGO0049"
                     /old_locus_tag="NGO_0049"
     CDS             complement(47441..47974)
                     /locus_tag="NGO_RS00240"
                     /old_locus_tag="NGO0049"
                     /old_locus_tag="NGO_0049"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003692498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003692498.1"
                     /translation="MFSDIYLNPKNYFGIEKRLPFKAFWDNGGQCYLDLKVVDGKIIA
                     LCGQLINYTNTSIVNAAEEVYRSIIDYLISNEILIVRTKFSFKNIFSTNEKKYKEIEK
                     EINKFLYKNMDWYLFFNNDITLDPYTGNDLIWHVQIDPNDGGAQFLETYQSWEKLQQK
                     YPNITFSYDKNDLILTK"
     gene            complement(49539..49928)
                     /locus_tag="NGO_RS00245"
                     /old_locus_tag="NGO0050"
                     /old_locus_tag="NGO_0050"
     CDS             complement(49539..49928)
                     /locus_tag="NGO_RS00245"
                     /old_locus_tag="NGO0050"
                     /old_locus_tag="NGO_0050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003686761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF559 domain-containing protein"
                     /protein_id="WP_003687278.1"
                     /translation="MNPPEKLLTAENPALRQRAKAMRQEMSEAEAKLWQHLRAGRLNG
                     YKFRRQQPMGNYIVDFMCVTPKLIVEADGGQHAEQAVYDHARTVYLNSLGFTVLRFWN
                     HEILQQTNDVLAEILRVLQELEKQPAR"
     gene            complement(50091..50470)
                     /locus_tag="NGO_RS00250"
                     /old_locus_tag="NGO0050a"
                     /old_locus_tag="NGO_00260"
                     /pseudo
     CDS             complement(50091..50470)
                     /locus_tag="NGO_RS00250"
                     /old_locus_tag="NGO0050a"
                     /old_locus_tag="NGO_00260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018136153.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
     gene            complement(50524..51657)
                     /gene="carA"
                     /locus_tag="NGO_RS00255"
                     /old_locus_tag="NGO0053"
                     /old_locus_tag="NGO_0053"
     CDS             complement(50524..51657)
                     /gene="carA"
                     /locus_tag="NGO_RS00255"
                     /old_locus_tag="NGO0053"
                     /old_locus_tag="NGO_0053"
                     /EC_number="6.3.5.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002223013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine-hydrolyzing carbamoyl-phosphate
                     synthase small subunit"
                     /protein_id="WP_010950981.1"
                     /translation="MNTPALLVLADGSVFHGTSIGYEGSASGEVVFNTSMTGYQEILT
                     DPSYCKQIVTLTYPHIGNTGTNAEDEESRSVYAAGLIIRDLPLLHSSFRASESLHDYL
                     VRNETVAIADIDTRRLTMLLREKGAQGGAILTGADATVEKAQELIAAFGSMVGKDLAK
                     EVSCTETYEWTEGEWELGKGFVTPDKQPYHVVAYDFGVKTNILRMLASRGCRLTVVPA
                     QTSAEDVLALNPDGVFLSNGPGDPEPCTYAIEAVQKLMESGKPIFGICLGHQLISLAI
                     GAKTLKMRFSHHGANHPVQDLDSGKVVITSQNHGFAVDADTLPANARITHKSLFDNTL
                     QGIELTDKPVFCFQGHPEASPGPQDVGYLFDKFIGNMKAAKQA"
     gene            complement(52527..55670)
                     /locus_tag="NGO_RS00260"
                     /old_locus_tag="NGO0055"
                     /old_locus_tag="NGO_0055"
     CDS             complement(52527..55670)
                     /locus_tag="NGO_RS00260"
                     /old_locus_tag="NGO0055"
                     /old_locus_tag="NGO_0055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003696648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly/adherence protein PilC"
                     /protein_id="WP_010950983.1"
                     /translation="MNKTLKRRVFRHTALYAAILMFSHTGGGGGAQAQTQTRKYAIIM
                     DERNQPEVKWEGSYSTLREKDGERKFIYTNQRNKLNQQNNFISFDNTDTLVSRQSGTA
                     VFGTATYLPPYGKVSGFDTAELNKRGNAVNWIHTTRAGLAGYVYTGVICRDTGQCPQL
                     VYKTRFSFDNTGLAKNTGRLDRHTEPSRENSPIYKLSDYPWLGVSFNLGSEGTAKDGR
                     SSNKLVSSFDENNSNSNQNLVYTTEGHRISLGDWQRESTAMAYYLNAKLHLLDKQRIE
                     NIAPGKTVDLGTLRPRVETKTNNWGNLLSFWATWKIEDKGNITVRLGLPEVKAGRCTN
                     TAHPNPNAKAPSPALTAPALWFGPVQNGKVQMYSASVSTYPGSSSSRIFLQELKTRTD
                     PARPGRHSLAALDTQNIKSREPNFNSRQTVIRLPGGVYKINSGKNGGRVAGINGNDGK
                     NDTFGIYKDRLVTPEADEWSNILLPWTARYYGNDDIFKTFNQPNSKTQNGKKQYSQKY
                     RIRTKEDDNDKPRDLGDIVNSPIVAVGGYLATSANDGMVHLFKRNGTDQRGYELKLSY
                     IPGTMERKDIEGNDSDLAKELRAFAEKGYVGDRYGVDGGFVLRRITDDQDKQKHFFMF
                     GAMGLGGRGAYALDLSKIDGNYPAAAPLFDVKNGDNNGKNRVKVELGYTVGTPQIGKT
                     QNGKYAAFLASGYAAKNIGSGDNKTALYVYDLENGSGSLIKKIEVQGGKGGLSSPTLV
                     DKDLDGTVDIAYAGDRGGNMYRFDLSDSNPDKWSVRTIFEGDKPITSAPAVSRLADKR
                     VVIFGTGSDLTEDDVLNTGEQYIYGIFDDDKGTVKVTVQNGTGGGLLEQVLKEENKTL
                     FLNKGSDGSGSKGWVVKLKEGQRVTVKPTVVLRTAFVTIRSYTGNDKCGAQTAILGIN
                     TADGGALTPRSARPIVPDNQVAQYSGHQKMNGKSIPIGCMWKNGKTVCPNGYVYDKPV
                     NVRYLDEKKTDDFPVTADGDAGGSGTFKEGKKPARNNRCFSGKGVRTLLMNDLDSLDI
                     TGPMCGIKRLSWREVFF"
     gene            complement(57122..58201)
                     /gene="apbC"
                     /locus_tag="NGO_RS00265"
                     /old_locus_tag="NGO0056"
                     /old_locus_tag="NGO_0056"
     CDS             complement(57122..58201)
                     /gene="apbC"
                     /locus_tag="NGO_RS00265"
                     /old_locus_tag="NGO0056"
                     /old_locus_tag="NGO_0056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017146699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster carrier protein ApbC"
                     /protein_id="WP_010950984.1"
                     /translation="MNIQNIRTLLDTVAVPNTARTLGGEKAVRSVGQRSDGIHIALHF
                     GFPVAHIAAALADAVQETLMPETGGAHIHLGIDTEIGTHKVRPGVTTIKGVKNIIAVA
                     SGKGGVGKSTTTANLAAAMARMGARVGVLDADLYGPSQPTMLGVHDRKPDQKNQKLIP
                     VESSDGIQVMSIGFLVDTGQAVVWRGPMVSQALQQLMFQSEWDEVDYLFIDLPPGTGD
                     IQLTLSQRIPVTGSVIVTTPQDIALIDARKAVDMFRKVNIPILGVLENMSVHICSNCG
                     HSEALFGTDGGKDLAARLNVPLLGQLPLSLPVREAMDGGTPARLFDEHPAIARIYTDA
                     AFQIALGIADKGKDFSSRFPKIVVE"
     gene            58420..58495
                     /locus_tag="NGO_RS00270"
                     /old_locus_tag="NGO_18791"
                     /old_locus_tag="NGO_t02"
     tRNA            58420..58495
                     /locus_tag="NGO_RS00270"
                     /old_locus_tag="NGO_18791"
                     /old_locus_tag="NGO_t02"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:58453..58455,aa:Lys,seq:ttt)
     gene            58575..59084
                     /locus_tag="NGO_RS00275"
                     /old_locus_tag="NGO0057"
                     /old_locus_tag="NGO_0057"
     CDS             58575..59084
                     /locus_tag="NGO_RS00275"
                     /old_locus_tag="NGO0057"
                     /old_locus_tag="NGO_0057"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein disulfide oxidoreductase"
                     /protein_id="WP_003687293.1"
                     /translation="MKKKLLSGIKFAVRTALVFLLVSLFLDWVRKPDEPAGAAGRPLT
                     LLSGQRLTLGQFSRDRTVLVYFWGSWCGVCRYQSPIIDDLAADGVPVVGVAVRSGSAS
                     EVAAYMAKRGLGFPTVSDEDGGLARSWRIAATPAVVLVKNGKMVRYTTGISSYWGLRA
                     RIFQADFFG"
     gene            59425..59865
                     /gene="nadR"
                     /locus_tag="NGO_RS00280"
                     /old_locus_tag="NGO0058"
                     /old_locus_tag="NGO_0058"
     CDS             59425..59865
                     /gene="nadR"
                     /locus_tag="NGO_RS00280"
                     /old_locus_tag="NGO0058"
                     /old_locus_tag="NGO_0058"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HpaR family adhesin repressor NadR"
                     /protein_id="WP_003687296.1"
                     /translation="MPTQSKHASINIGLIQAREALMTQFRPILNQANITDQQWRIIRL
                     LAENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVYLKLTSEGEK
                     LYEEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIEDALNS"
     gene            59981..60481
                     /gene="hpaC"
                     /locus_tag="NGO_RS00285"
                     /old_locus_tag="NGO0059"
                     /old_locus_tag="NGO_0059"
     CDS             59981..60481
                     /gene="hpaC"
                     /locus_tag="NGO_RS00285"
                     /old_locus_tag="NGO0059"
                     /old_locus_tag="NGO_0059"
                     /EC_number="1.14.14.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate 3-monooxygenase,
                     reductase component"
                     /protein_id="WP_003687298.1"
                     /translation="MADLQKTFQTSFRDAMASCAAGVHVITTDGAAGRYGITMTAVAP
                     VTDEPPTVMLCINRSARIIPILSENGSLCINMLADEHQDVAEHFAGLTGLSPEERFAY
                     HIWHRGKTGQLEIEGALAHLHGHIVGKHEIGTHFVFYVRLDEIKNCGCKRPALLYFRR
                     QFRPLD"
     gene            60497..61192
                     /locus_tag="NGO_RS00290"
                     /old_locus_tag="NGO0060"
                     /old_locus_tag="NGO_0060"
     CDS             60497..61192
                     /locus_tag="NGO_RS00290"
                     /old_locus_tag="NGO0060"
                     /old_locus_tag="NGO_0060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase family protein"
                     /protein_id="WP_003687300.1"
                     /translation="MKAMILAAGRGERMRPLTDTTPKPLLDVAGKPLIGWHLCRLKQA
                     GFTEIVINHAWLGRQIENALGDGSAYGVNIAYSPEPAGGLETAGGIAQALPLLGGQPF
                     LVANGDVLTDIDFTAAFQTASSLPGHISAHLWLVGNPPHNPDGDFSLLPDGSVRPEVS
                     GGNGLTFSGVGIYRPEMFDGIEAGSVAKLAPVLLNEMRQNRVSGQKHTGLWLDVGTVC
                     RLKEAQALAAAWK"
     gene            complement(61246..61638)
                     /locus_tag="NGO_RS00295"
                     /old_locus_tag="NGO0060a"
                     /old_locus_tag="NGO_00320"
     CDS             complement(61246..61638)
                     /locus_tag="NGO_RS00295"
                     /old_locus_tag="NGO0060a"
                     /old_locus_tag="NGO_00320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003704954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter"
                     /protein_id="WP_157147432.1"
                     /translation="MFWALASAGFASLTAVFAKMGLQGIDSDFATFIRTLVILAALVL
                     FLTYTGKWQGVNGFTGRNRTFLVLSGLATGASWLAYFKALQLGKAPQVAPVDKFSLVL
                     VALMAVIFLDERPNTQEWIDLGLVTAAC"
     gene            61831..63507
                     /locus_tag="NGO_RS00300"
                     /old_locus_tag="NGO0062"
                     /old_locus_tag="NGO_0062"
     CDS             61831..63507
                     /locus_tag="NGO_RS00300"
                     /old_locus_tag="NGO0062"
                     /old_locus_tag="NGO_0062"
                     /EC_number="6.3.4.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019742723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate--tetrahydrofolate ligase"
                     /protein_id="WP_003698015.1"
                     /translation="MSFKTDAETAQSSTMRPIGEIAAKLGLNVDNIEPYGHYKAKINP
                     AEAFKLPQKQGRLILVTAINPTPAGEGKTTVTIGLADALRHIGKDSVIALREPSLGPV
                     FGVKGGAAGGGYAQVLPMEDINLHFTGDFHAIGAANNLLAAMLDNHIYQGNELNIDPK
                     RVLWRRVVDMNDRQLRNIIDGMGKPVDGVMRPDGFDITVASEVMAVFCLAKDISDLKE
                     RFGNILVAYAKDGSPVYAKDLKAHGAMAALLKDAIKPNLVQTIEGTPAFVHGGPFANI
                     AHGCNSVTATRLAKHLADYAVTEAGFGADLGAEKFCDIKCRLAGLKPDAAVVVATVRA
                     LKYNGGVERANLGEENLEALAKGLPNLLKHISNLKNVFGLPVVVALNRFVSDSDAELA
                     MIEKACAEHGVEVSLTEVWGKGGAGGADLARKVVNAIDNQPNNFGFAYDVELGIKDKI
                     RAIAQKVYGAEDVDFSAEASAEIASLEKLGLDKMPICMAKTQYSLSDNAKLLGCPEGF
                     RIAVRGITVSAGAGFIVALCGNMMKMPGLPKVPAAEKIDVDEHGVIHGLF"
     gene            63621..64712
                     /gene="ychF"
                     /locus_tag="NGO_RS00305"
                     /old_locus_tag="NGO0063"
                     /old_locus_tag="NGO_0063"
     CDS             63621..64712
                     /gene="ychF"
                     /locus_tag="NGO_RS00305"
                     /old_locus_tag="NGO0063"
                     /old_locus_tag="NGO_0063"
                     /EC_number="3.6.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002642527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="redox-regulated ATPase YchF"
                     /protein_id="WP_003687306.1"
                     /translation="MSLKCGIVGLPNVGKSTLFNALTQSGIEAANYPFCTIEPNVGIV
                     EVPDPRMAELAKIVNPQKMQPAIVEFVDIAGLVAGASKGEGLGNRFLANIRETDAIVN
                     VVRCFDDDNIVHVSGKVDPIADIETIGTELALADLASVEKAIVREEKRARSGDKDAQK
                     LVDLCKKLLPHLDEGKPVRSFGLDAEERALLKPLFLLTAKPAMYVGNVAEDGFENNPH
                     LDRLKELAAKENAPVVAVCAAMESEIAELEDGEKAEFLAEMGLEEPGLNRLIRAGYDL
                     LGLQTYFTAGVKEVRAWTIHKGDTAPQAAGVIHTDFERGFIRAQVIAYDDFVSLGGEA
                     KAKEAGKMRVEGKEYVVQDGDVMHFLFNV"
     gene            64750..64989
                     /locus_tag="NGO_RS00310"
                     /old_locus_tag="NGO0064"
                     /old_locus_tag="NGO_0064"
     CDS             64750..64989
                     /locus_tag="NGO_RS00310"
                     /old_locus_tag="NGO0064"
                     /old_locus_tag="NGO_0064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010950985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010950985.1"
                     /translation="MPSEAGFGGFRRSHTAGMQPHQNKIPPAFPICPPRFLQNKLPAL
                     PLREAVRYSEYPEPRYKMTFQTAFAQPAAFQVKTL"
     gene            64986..66860
                     /locus_tag="NGO_RS00315"
                     /old_locus_tag="NGO0065"
                     /old_locus_tag="NGO_0065"
     CDS             64986..66860
                     /locus_tag="NGO_RS00315"
                     /old_locus_tag="NGO0065"
                     /old_locus_tag="NGO_0065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002226696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_003687310.1"
                     /translation="MSQALPYRPDIDTLRAAAVLSVIVFHIEKDWLPGGFLGVDIFFV
                     ISGFLMTAILLREMSGGRFFLKTFYIRRIKRILPAFFAVLAATLAGGFFLFTKDDFFL
                     LWKSALTALGFASNLYFARGKDYFDPAQEEKPLLHIWSLSVEEQFYFVFPILLLLVAR
                     KSLRVQFGFLAALCALSLAASFMPSALDKYYLPHLRACEMLVGSLTAVRMRYRQQRNP
                     AVGKRYAAVGALFSACILSACLFAYSEQTAYFPGPAALIPCLAVAALIYFNHYEHPLK
                     KFFQWKITVAAGLISYSLYLWHWPILAFMRYIGPDNLPPYSPAAAIVLTLAFSLISYH
                     CIEKPFKKWKGSFAQSVLWIYALPMLVLGAGSFFAMRLPFMAQYDRLGLTRSNTSCHN
                     NTGKQCLWGDTEKQPELLVLGDSHADHYKTFFDAVGKKEKWSATMVSADACAYVEGYA
                     SRVFQNWAACRAVYRYAEEHLPRYPKVVLAMRWGSQMPENSRSLAYDAGFFQKFDRML
                     HKLSSEKQAVYLMADNLASSYNVQRAYILSSRIPGCRQTLRPDDESTLKANARIRELA
                     AKYPNVYIIDAAAYIPADFQIGGLPVYSDKDHINPYGGTELAKRFSEKQRFLDTRHNH
                     "
     gene            66922..68217
                     /gene="tyrS"
                     /locus_tag="NGO_RS00320"
                     /old_locus_tag="NGO0066"
                     /old_locus_tag="NGO_0066"
     CDS             66922..68217
                     /gene="tyrS"
                     /locus_tag="NGO_RS00320"
                     /old_locus_tag="NGO0066"
                     /old_locus_tag="NGO_0066"
                     /EC_number="6.1.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine--tRNA ligase"
                     /protein_id="WP_003687313.1"
                     /translation="MSVIQDLQSRGLIAQTTDIEALDALLNEQKIALYCGFDPTADSL
                     HIGHLLPVLALRRFQQAGHTPIALVGGATGMIGDPSFKAAERSLNSAETVAGWVGSIR
                     SQLTPFLSFEGGNAAIMANNADWFGSMNCLDFLRDIGKHFSVNAMLNKESVKQRIDRD
                     GAGISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGIDLTRRLNQKQVFG
                     LTLPLVTKSDGTKFGKTEGGAVWLNAKKTSPYQFYQFWLKVADADVYKFLKYFTFLSI
                     EEIGVVEAKDKASGSKPEAQRILAEEMTRLIHGEEALAAAQRISESLFAEDQSRLTES
                     DFEQLALDGLPAFEVSDGINAVEALVKTGLAASNKEARGFVNAKAVLLNGKPAEANNP
                     NHAAERPDDAYLLIGEYKRFGKYTILRRGKRNHALLVWK"
     gene            complement(69021..69844)
                     /locus_tag="NGO_RS00325"
                     /old_locus_tag="NGO0066a"
                     /old_locus_tag="NGO_00350"
                     /pseudo
     CDS             complement(69021..69844)
                     /locus_tag="NGO_RS00325"
                     /old_locus_tag="NGO0066a"
                     /old_locus_tag="NGO_00350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951288.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane beta-barrel protein"
     gene            70253..71173
                     /gene="ribF"
                     /locus_tag="NGO_RS00330"
                     /old_locus_tag="NGO0068"
                     /old_locus_tag="NGO_0068"
     CDS             70253..71173
                     /gene="ribF"
                     /locus_tag="NGO_RS00330"
                     /old_locus_tag="NGO0068"
                     /old_locus_tag="NGO_0068"
                     /EC_number="2.7.1.26"
                     /EC_number="2.7.7.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003749748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional riboflavin kinase/FAD synthetase"
                     /protein_id="WP_157147419.1"
                     /translation="MKIRPGRHNAPDFPHGAAVTIGNFDGVHLGHKHILQKLRLEADA
                     RGLPVVAVVFEPQPKEFFALRTGKTPPCRISPLRTKLELLEGTGCVDAAWVLRFDRNF
                     SEISAQAFIDRLLRQTLNTRYLLVGDDFRFGAGREGCFELLAQQPDMQTERTPSVIVE
                     DIRTSSTAVRQALSDGNLAYAKKLLGHDYVLGGRVVHGRKLGRTLNAPTANIRLPGHR
                     YALGGVFVVEADGAFGTRRGVASFGFNPTVDGGCSQKLEVHLFDFQGDLYGQRLNVRF
                     LHKLRDEEKFDGMEELKRRIEADMEAAKCW"
     gene            71315..74104
                     /gene="ileS"
                     /locus_tag="NGO_RS00335"
                     /old_locus_tag="NGO0069"
                     /old_locus_tag="NGO_0069"
     CDS             71315..74104
                     /gene="ileS"
                     /locus_tag="NGO_RS00335"
                     /old_locus_tag="NGO0069"
                     /old_locus_tag="NGO_0069"
                     /EC_number="6.1.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003747300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucine--tRNA ligase"
                     /protein_id="WP_003699451.1"
                     /translation="MTDYSKTVNLLESPFPMRGNLAKREPAWLKSWYEQKRYQKLREI
                     AKGRPKFILHDGPPYANGDIHIGHAVNKILKDIIIRSKTQAGFDAPYVPGWDCHGLPI
                     EVMVEKLHGKDMPKARFRELCREYAAEQIARQKKDFIRLGVLGDWDNPYLTMDFKTEA
                     DTVRMLGEIYKSGYLYRGAKPVQFCLDCGSSLAEAEVEYKDKVSPAIDVAYPFKNTVA
                     LAAAFGLAGIEGKAFAVIWTTTPWTLPASQAVSAGADVVYQLIDTPKGKLVLAKDLAE
                     GALKRYGFSDGIAILAETTGDKLENLHMNHPFLERDIPMLNGEHVTTDAGTGLVHTAP
                     AHGLEDYAVCNKYGIELYNPVNAEGKYISETPRVAGMSVWEANPVILQWPEETGNLLA
                     SSKIEHSYAHCWRHKTPLIYRATGQWFVGMDKAGSDGKTLRDKAIKAVDDTEFFPPWG
                     RARLESMIEGRPDWVVSRQRYWGTPMTFFVHKETGELHPNSAELLEKVAQRIEEKGIE
                     AWFSLDKSELLSAEDCEHYDKLPDTMDVWFDSGSTHYSVVKQREELEWPADLYLEGSD
                     QHRGWFQSSMLTGCASSMGRAPYKQLLTHGFVVDQNGRKMSKSIGNVVAPQEVYNEFG
                     ADILRLWAASTDYSGELAISKEILKRVTESYRRIRNTLSFLFANLSDFNPIEDAVQQA
                     DMVEIDRYALVLARRLQERLAGGYYPRYAFHFAVKDIVSFCSEDLGAFYLDILKDRLY
                     TTKADSRARRSAQTALYHITRSLVLLIAPILCFTGEEAWDIIGGGEEDSVLFHTWHEF
                     PAINEKAEAELVKKWTAIREAREAVTAAIEPLRADKTVGSSLQAEAEITAPEEMAGYL
                     NALGEELRFALLVSKAEVKVGDELAVAAKASDGEKCERCWHYTRDVGAVAGYETVCKR
                     CAENVGGEGETRHYA"
     gene            complement(74320..74511)
                     /locus_tag="NGO_RS00340"
     CDS             complement(74320..74511)
                     /locus_tag="NGO_RS00340"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_025456395.1"
                     /translation="MPSEPSDGIFDALAVYRRGAGAVKYPNRHPRQHRNLETRHSRAG
                     GNLDLSVQELIGQNGFLRF"
     gene            complement(74599..74769)
                     /locus_tag="NGO_RS00345"
     CDS             complement(74599..74769)
                     /locus_tag="NGO_RS00345"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164920398.1"
                     /translation="MPSEPSDGIFDAPAVYRRGAGAGKYPNRHSRQYRNLETRHSRAG
                     GNPDLSARKLIG"
     gene            complement(74783..75580)
                     /locus_tag="NGO_RS00350"
                     /old_locus_tag="NGO0070"
                     /old_locus_tag="NGO_0070"
     CDS             complement(74783..75580)
                     /locus_tag="NGO_RS00350"
                     /old_locus_tag="NGO0070"
                     /old_locus_tag="NGO_0070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane beta-barrel protein"
                     /protein_id="WP_010950987.1"
                     /translation="MNPARKKPSLLFSSLLFSSLLFSSAAQAASEGNGRGPYVQADLA
                     YAAERITHDYPEPTAPGKNKISTVSDYFRNIRTHSIHPRVSVGYDFGGWRIAADYARY
                     RKWNDNKYSVDIKELENKNQNKRDLKTENQENGSFHAVSSLGLSAVYDFKLNDKFKPY
                     IGARVAYGHVRHSIDSTKKITGTLTAYPSDADAAVTVYPDGHPQKNTYQKSNSSRRLG
                     FGAMAGVGIDVAPGLTLDAGYRYHNWGRLENTRFKTHEASLGMRYRF"
     gene            76565..77059
                     /gene="lspA"
                     /locus_tag="NGO_RS00355"
                     /old_locus_tag="NGO0071"
                     /old_locus_tag="NGO_0071"
     CDS             76565..77059
                     /gene="lspA"
                     /locus_tag="NGO_RS00355"
                     /old_locus_tag="NGO0071"
                     /old_locus_tag="NGO_0071"
                     /EC_number="3.4.23.36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012221292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein signal peptidase"
                     /protein_id="WP_003687321.1"
                     /translation="MSSSVSSKTRYWVLALAAIVLDQWSKWAVLSSFQYRERVNVIPS
                     FFDLTLVYNPGAAFSFLADQGGWQKYFFLVLAVAVSAYLVRAILRDEFAALGKIGAAM
                     IIGGASGNVIDRLIHGHVVDFLLFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKD
                     SKKT"
     gene            77089..78057
                     /gene="ispH"
                     /locus_tag="NGO_RS00360"
                     /old_locus_tag="NGO0072"
                     /old_locus_tag="NGO_0072"
                     /gene_synonym="lytB"
     CDS             77089..78057
                     /gene="ispH"
                     /locus_tag="NGO_RS00360"
                     /old_locus_tag="NGO0072"
                     /old_locus_tag="NGO_0072"
                     /gene_synonym="lytB"
                     /EC_number="1.17.7.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="WP_010356621.1"
                     /translation="MNGKTIILANPRGFCAGVDRAISIVERALEEFGAPVYVRHEVVH
                     NKFVVDNLREKGAVFIEDLAEVPPGATLVYSAHGVSKAVQQEAAERGFRVFDATCPLV
                     TKVHKEVARLDAQDCEIIMIGHKGHAEVEGTMGQLAPGKMLLVETVGDVAKLEVRNPD
                     KLAYVSQTTLSVDETKDIIAALNARFPNIRNPHKEDICYATTNRQTAVKELAEQCDIV
                     IVVGSPNSSNSNRLREVAASRGIDAYMVDNASYLQRTWFEGKSKVGVTAGASAPEVLV
                     REVLATIRGWGHETVREGGGAEESIVFVLPKELRREGETKPDLCKR"
     gene            78158..78607
                     /locus_tag="NGO_RS00365"
                     /old_locus_tag="NGO0072a"
                     /old_locus_tag="NGO_00385"
     CDS             78158..78607
                     /locus_tag="NGO_RS00365"
                     /old_locus_tag="NGO0072a"
                     /old_locus_tag="NGO_00385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_003705389.1"
                     /translation="MSTFFRQTAQAMTAKHIGRFPLSELDQVIDWQPIEQYLIRQKTR
                     YLRDRRGRPAHPLSSMFKAVLPGQWHSLSDPELEHSLITRIGFNLFCRFDEPGIPGCS
                     TLCRYRKFRYARAAYFGLLKVGAQSHLKAMCLNLLKAANRLSAPAAA"
     gene            complement(78813..79472)
                     /locus_tag="NGO_RS00370"
                     /old_locus_tag="NGO0073"
                     /old_locus_tag="NGO_0073"
     CDS             complement(78813..79472)
                     /locus_tag="NGO_RS00370"
                     /old_locus_tag="NGO0073"
                     /old_locus_tag="NGO_0073"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014575545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-IA family hydrolase"
                     /protein_id="WP_003687323.1"
                     /translation="MTPPKLIIFDWDGTLADTTQPIIDTMRRSFAECGFPPPEAERVR
                     SLIGYSLPEIIRALLEMPSEAAVADIARTYSAHYLNPNNRNMTLFPDAPPCLDKLKAQ
                     GFRLAVATGKGRAGLDNAISQTATGGYWLATACAGEYPSKPSPEMVFGLCGELGLDPK
                     EALVVGDTAHDLHMAANAGAAAVGVATGAHSREQLLGAPHLAVLDGLSELPGFLARHY
                     A"
     gene            79620..79847
                     /locus_tag="NGO_RS00375"
                     /old_locus_tag="NGO_00395"
     CDS             79620..79847
                     /locus_tag="NGO_RS00375"
                     /old_locus_tag="NGO_00395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687324.1"
                     /translation="MGQFMSVFRINMTAATVLAALSSPVFAAQTADLETVHIKGQRSY
                     NAIATEKNGDYSSLKAAIWMTASIPASPPAA"
     gene            <79793..80336
                     /locus_tag="NGO_RS00380"
                     /old_locus_tag="NGO_00400"
                     /pseudo
     CDS             <79793..80336
                     /locus_tag="NGO_RS00380"
                     /old_locus_tag="NGO_00400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004467916.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
     gene            80406..80726
                     /locus_tag="NGO_RS00385"
                     /old_locus_tag="NGO_0076"
     CDS             80406..80726
                     /locus_tag="NGO_RS00385"
                     /old_locus_tag="NGO_0076"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010950988.1"
                     /translation="MRSQPEYGIAKENRPNRQADRFAGSVLPLAASLTHKPNIMKPIP
                     TDTFQPAILPQAFETEIKSTCTGRIYRIQTATLGEMQSEGYPVLFVLDGEAFFPRCTT
                     SCSR"
     gene            80714..81337
                     /locus_tag="NGO_RS00390"
                     /old_locus_tag="NGO0076"
                     /old_locus_tag="NGO_0077"
     CDS             80714..81337
                     /locus_tag="NGO_RS00390"
                     /old_locus_tag="NGO0076"
                     /old_locus_tag="NGO_0077"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010950989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_010950989.1"
                     /translation="MQSLMNNPVTRSNAPCLIVGIGYTTGSVRDLAQRAADYTPPLGD
                     NATADERRQFGQADRFADFIDSELTAFLESRYTLNRNETAVFGHSFGALFGLYSLLSH
                     RCFRRHWLVSPSIWWHNRRILDFMPSENRLDGIDACLNIGALERSSGCKRREERDMAG
                     QAEQMAAELDRRGTAVFFREYPNADHGNVPFYSLTDCVEYLREAWQR"
     gene            complement(81989..85423)
                     /gene="dnaE"
                     /locus_tag="NGO_RS00395"
                     /old_locus_tag="NGO0078"
                     /old_locus_tag="NGO_0078"
     CDS             complement(81989..85423)
                     /gene="dnaE"
                     /locus_tag="NGO_RS00395"
                     /old_locus_tag="NGO0078"
                     /old_locus_tag="NGO_0078"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017628914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit alpha"
                     /protein_id="WP_010356628.1"
                     /translation="MTEPTYIPLRLHTEFSITDGMVRIKKLIAKAQEYGLPALGISDL
                     MNEFGLVKFYKACRGAGIKPVGAADVWIGNPNAPDKPFRAMLVIRNDAGYLRLSELLT
                     EAYVGQDRNIHHAELNPEWLENGDNSGLICLSGAHYGEVGVNLLNGNEDAARAAALKY
                     AAWFPDTFYLELQRLPERPEWEACVSGSVKLAEELGLPVVATHPTQFMNRDDFNAHEA
                     RVCIAGGWVLTDKKRPRDFTPSQFFIPPETMLERFADLPEALENTVEIAKRCNLHITL
                     GKNFLPLFPTPDGLSLDDCLIKLSNEGLQERMVQLYPDEAERAAKMPEYQERLDFELN
                     IIIQMKFPGYFLIVQDFINWAKTHGCPVGPGRGSGAGSLVAYSLKITDLDPLKYALLF
                     ERFLNPERVSMPDFDVDFCQANRGRVIEYVREKYGAQAVSQIVTFGTMSSKAVIRDVG
                     RVLELPFMLCDKLSKLIPLEANKPLSLDDAMKAQPQIQELLEAEEADELITLAKKLED
                     LTRGLGMHAGGVLIAPGKISDYSPVYQADESASPVSMYDKGDVEDVGLVKFDFLGLRN
                     LTIIEMAQNNIKNTAGDIVDVGKIPLDDQTAYQIFRDANTTAVFQFESTGMKKMLKTA
                     HTTKFEELIAFVSLYRPGPMDNIPDFVARMKGQEFQYIHPLLEGILAPTYGIMVYQEQ
                     VMQAAQIIGGYSLGGADLLRRAMGKKKPEEMVKHREIFAEGAAKQGISREKSDEIFNY
                     MEKFAGYGFNKSHAAAYALISYQTAWLKAHYPAEFMAATMSSELDNTDQLKHFYDDCR
                     ANGIEFLPPDINESDYRFTPYPDMKIRYALGAIKGTGEAAVESIIAARQSGGKFTGLL
                     DFCERVGKEHMNRRTLEALIRGGAFDSIEPNRAMLLANIDLAMDNADQKAANANQGGL
                     FDMMEDAIEPVRLIDAPMWSESEKLAEEKTVIGFYLSGHPFGPYAQEVRQIAPTKLGR
                     LKPQDSVRLAGFVTAVRTMMGKRGKIAFVSLEDSSGQAEIMVGGQTLENCADCLKADQ
                     VLIIESKVSRDDYGGGDGLRIMANQVMTLQTARERYARSLSLALAPHHDIGGLVRLLA
                     AHQLPDTPRIPLQLSYANEKASGRLQVPPKWTVTPSSALFGELETLLGSRSVRVNW"
     gene            85747..85944
                     /locus_tag="NGO_RS00400"
     CDS             85747..85944
                     /locus_tag="NGO_RS00400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687328.1"
                     /translation="MCISVNADSSGNRICSLPLGRISLDGWRHTGFQTAFLRNRQCGH
                     IAGFAAILGAAAAGATITPSF"
     gene            85953..86189
                     /locus_tag="NGO_RS00405"
                     /old_locus_tag="NGO0079"
                     /old_locus_tag="NGO_0079"
     CDS             85953..86189
                     /locus_tag="NGO_RS00405"
                     /old_locus_tag="NGO0079"
                     /old_locus_tag="NGO_0079"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003681544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding S4 domain-containing protein"
                     /protein_id="WP_162098111.1"
                     /translation="MMEATVYLEDNEYIALCDLLKLAGLAESGGQAKAFIAEGLVLRN
                     GGTEIRKTAKIRGGEVIEFDGARLEIADGYDPEA"
     gene            86167..86370
                     /locus_tag="NGO_RS00410"
                     /old_locus_tag="NGO0080"
                     /old_locus_tag="NGO_0080"
     CDS             86167..86370
                     /locus_tag="NGO_RS00410"
                     /old_locus_tag="NGO0080"
                     /old_locus_tag="NGO_0080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004467907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687334.1"
                     /translation="MDTTLKHKAEALLGEPLLDEPVRPESWECCGSDCGEACIQTIYW
                     ADKARYDAQRKKLKEAGWPDDAV"
     gene            86665..87501
                     /locus_tag="NGO_RS00415"
                     /old_locus_tag="NGO0081"
                     /old_locus_tag="NGO_0081"
     CDS             86665..87501
                     /locus_tag="NGO_RS00415"
                     /old_locus_tag="NGO0081"
                     /old_locus_tag="NGO_0081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PHP domain-containing protein"
                     /protein_id="WP_003687335.1"
                     /translation="MIDLHCHSTVSDGMLPPAEVVRLAHQNGCTLLALTDHDHTGGIS
                     EARAEADRLGLRLINGVEISVTWRGRTIHVVGLDFDEQDENLQNLLADVRKGRLKRLE
                     AIAAKLEKKGIGGAYDGALALAANKEMVSRTHVAEFLIKNGHVKNKQQAFTKYLGDGK
                     SCAVRHEWATLADCVSAVNGAGGMAVIAHPMRYDLSATAKRNLFEEFKNLGGAGIEVH
                     SGNCCKNDRLNYALLADRFGLLASAGSDFHRLDDFSGGILGACPDLPENCKPVRAHFS
                     RH"
     gene            complement(87553..88845)
                     /locus_tag="NGO_RS00420"
                     /old_locus_tag="NGO0082"
                     /old_locus_tag="NGO_0082"
     CDS             complement(87553..88845)
                     /locus_tag="NGO_RS00420"
                     /old_locus_tag="NGO0082"
                     /old_locus_tag="NGO_0082"
                     /EC_number="2.6.1.66"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002241916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valine--pyruvate transaminase"
                     /protein_id="WP_010359743.1"
                     /translation="MQFSAFGEKFTQHSGILQLMDDLGDALKSDKPVNMLGGGNPARI
                     PEIDRAFADIFSKLAAEHAVENIGNYSNPQGDAALIDALTAFPNREYGWNLTVGNIAL
                     TNGSQNAFFYLFNLFGGKFKLSDGTSAEKAILLPLAPEYIGYADVHVEGRHFVSVKPK
                     IENVEHEGEAGFFKYRVDFDALENLPELKAGKIGAICCSRPTNPTGNVLTDGEMARLD
                     ALAREHGIPPIIDNAYGMPFPNIIDSGVTLNWHENIILCFSLSKVGLPGVRTGIIVAA
                     PEAVKAVSSLNAIVNLAPTRFGAAIAAPLLESGEMKRLADQVIRPFYRNQAQTAVSLL
                     KRELGAYPMKIHKPEGAIFLWLWFENLPVSSQTLYEMLKAEGTLIIPGEHFFVGIDTQ
                     DYPHAGECIRMSIAQDAQTLEKGIAAIGKTVRKPYDNV"
     gene            complement(88901..90811)
                     /locus_tag="NGO_RS00425"
                     /old_locus_tag="NGO0083"
                     /old_locus_tag="NGO_0083"
     CDS             complement(88901..90811)
                     /locus_tag="NGO_RS00425"
                     /old_locus_tag="NGO0083"
                     /old_locus_tag="NGO_0083"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="WP_003692533.1"
                     /translation="MNLETLIALPRNIKKICFLIHDFLMIFTAFWFTQSLKADYSDEW
                     FDFANWQSFLLTALLTITLFIRMGLYRAVTRFVSFHVLTTAFAGSLASAVLFFLNTLI
                     FEERLRLALPIVYFLLLFVSVTGSRMVLRGLLSDHQKKTHDPVIIYGAGRSGRQLLEA
                     VKQMREYSAAAFVDDNPKLWHTVIYDLAVYQPDAIAFLIERYGVEKILLAIPSATQEQ
                     RRRIISKLKAYPCEVLTIPGMKDLMDGKISIGTLKKISVSDLLGRDSVAPDDRLMNAD
                     TEGKTVMVTGAGGSIGSELCRQIIRRRPERLLLFELSEFALYTVEKELCEYCARNGIA
                     AEILPFLGSVQNRTLLTHIMTAFSVATVYHAAAYKHVPMVEFNTVEGIRNNIFGTLEC
                     ALAATASGVETFVLISTDKAVRPANTMGAGKRMAELCLQALAAEPGQKTRFSMVRFGN
                     VLGSSGSVVPLFEKQIAEGGPITLTHPDITRYFMTIPEAAQLVIQAGAMGRGGDVFVL
                     DMGESVKITDLARQMITLSGLKPKTPEQPDGDIEILITGLRPGEKLYEELLIGDNVRK
                     TGHPRIMTADETMLPWHELSALLDRIRTACDRYDQQAIRDLLVNAPTGFTPTGGICDL
                     LWVCETHRKNAV"
     gene            complement(90859..92064)
                     /locus_tag="NGO_RS00430"
                     /old_locus_tag="NGO0084"
                     /old_locus_tag="NGO_0084"
     CDS             complement(90859..92064)
                     /locus_tag="NGO_RS00430"
                     /old_locus_tag="NGO0084"
                     /old_locus_tag="NGO_0084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014580497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DegT/DnrJ/EryC1/StrS aminotransferase family
                     protein"
                     /protein_id="WP_003690553.1"
                     /translation="MPSEPDGPNTMLNTALSPWPSFTREEADAVSKVLLSNKVNYWTG
                     SECREFEKEFAAFAGTRYAVALSNGTLALDAALKAIGIGAGDDVIVTSRTFLASASCI
                     VNAGANPVFADVDLNSQNISAETVKAVLTPNTKAVIVVHLAGMPAEMDGIMALAKEHD
                     LWVIEDCAQAHGATYKGKSVGSIGHVGAWSFCQDKIITTGGEGGMVTTNDKTLWEKMW
                     AYKDHGKSYDAVYHREHAPGFRWLHESFGTNWRMMEMQAVIGRIQLKHLPEWTARRQE
                     NAAKLAESLRKFKSIRLIEVAGYIGHAQYKFYAFVKPEHLKDDWTRDRIVSELNARNV
                     PCYQGGCSEVYLEKAFDNTPWRPKERLKNAVELGGTALTFLVHPTLTDDEIAFCKKHI
                     EAVLTEAAR"
     gene            complement(92165..93406)
                     /locus_tag="NGO_RS00435"
                     /old_locus_tag="NGO0085"
                     /old_locus_tag="NGO_0085"
     CDS             complement(92165..93406)
                     /locus_tag="NGO_RS00435"
                     /old_locus_tag="NGO0085"
                     /old_locus_tag="NGO_0085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003704933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NeuD/PglB/VioB family sugar acetyltransferase"
                     /protein_id="WP_003704933.1"
                     /translation="MSKAVKRLFDIIASASGLIVLSPVFLVLIYLIRKNLGSPVFFIR
                     ERPGKDGKPFKMVKFRSMRDALDSDGIPLPDSERLTDFGKKLRATSLDELPELWNVLK
                     GEMSLVGPRPLLMQYLPLYNKFQNRRHEMKPGITGWAQVNGRNALSWDEKFSCDVWYT
                     DNFSFWLDMKILFLTVKKVLIKEGISAQGEATMPPFAGNRKLAVIGAGGHGKVVAELA
                     AALGTYGEIVFLDDRTQGSVNGFPVIGTTLLLENSLSPEQFDITVAVGNNRIRRQITE
                     NAAALGFKLPVLIHPDATVSPSAIIGQGSVVMAKAVVQAGSVLKDGVIVNTAATVDHD
                     CLLDAFVHISPGAHLSGNTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPDG
                     MTVAGNPAKPLTGKNPKTGTA"
     gene            complement(93399..94565)
                     /locus_tag="NGO_RS00440"
                     /old_locus_tag="NGO0086"
                     /old_locus_tag="NGO_0086"
     CDS             complement(93399..94565)
                     /locus_tag="NGO_RS00440"
                     /old_locus_tag="NGO0086"
                     /old_locus_tag="NGO_0086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002221486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_003704930.1"
                     /translation="MNITIAAPYCSLPSEPHFNRFWYLAELLSQSHDVLLITSNFKHY
                     DKSFRRPEDAKAASQGRLKVMLLEESGYSKNVSLGRVTSHHRFVKHFEKWLENCRPGE
                     QDVVYSAYPLIATNLLLGKHKARLGYKLIVDVQDVWPESFSSVVPFLKKIPHNLLPFA
                     SRANRAYRYADALVAVSQTYLDRAKEANPNVPGEVVYIGADFAAIAPPPRFRSKTVRF
                     FYLGTLSYNYDVETVCKGVRKLLDDGENVELHIMGGGPDLDRLKQYACDGIKFYGYIP
                     YAEMMSVAKGCDIAVNAIHSYAMQSITNKLSDYMALQKPILNSQVHDEVAEVLTLLPH
                     ENYRSGDVDGFVQAAKDILKRKNDPVQSDEIVRRFRHDISYRKIVNLIERLANE"
     gene            complement(94579..95643)
                     /locus_tag="NGO_RS00445"
                     /old_locus_tag="NGO0087"
                     /old_locus_tag="NGO_0087"
     CDS             complement(94579..95643)
                     /locus_tag="NGO_RS00445"
                     /old_locus_tag="NGO0087"
                     /old_locus_tag="NGO_0087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002258336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="WP_003704929.1"
                     /translation="MKIILTTSMSGLGGTETATVRLGRLLKRHGHDIILASSDGPFVG
                     EAQASGIRWQPVDFYRGGLAGYLKSTFAYARMLRREQPDIIDCQMARVVPACALAAKI
                     VSPKTKIICHSHGLDAATYPKTAKLFDKLGAYIIGNCKHEREKLIRHGFPAGRIAYAY
                     NTPPEFHFRKTEKECAVLGTLSRLDTVRAVHLMLDILKKMVGRNIPVRLNMAGIGEEM
                     DNLKAQAKRLGIEDKVTFLGGVRDLTGYFKEVDILVNTPHCVGDHGAGVGNNILEAGL
                     YDTPVVTYNMAGISEMVITGQTGYCIPFGDDEAFIEAVDTLIKHPELRSQMGKALHKH
                     VETLCSDDEIYRTTMAAYEM"
     gene            complement(95640..97061)
                     /locus_tag="NGO_RS00450"
                     /old_locus_tag="NGO0088"
                     /old_locus_tag="NGO_0088"
     CDS             complement(95640..97061)
                     /locus_tag="NGO_RS00450"
                     /old_locus_tag="NGO0088"
                     /old_locus_tag="NGO_0088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002258691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
                     /protein_id="WP_003704927.1"
                     /translation="MDTKEILGYAAGSIGSAVLAVIILPLLSWYFPADDIGRIVLMQT
                     AAGLTVSVLCLGLDQAYVREYYAAADKDTLFKTLFLPPLLFSAAIAALLLSRPSLPSE
                     ILFSLDDAAAGIGLVLFELSFLPIRFLLLVLRMEGRALAFSSAQLVPKLAILLLLPLT
                     VGLLHFPANTSVLTAVYALANLAAAAFLLFQNRCRLKAVRRAPFSPAVLHRGLRYGIP
                     LALSSLAYWGLASADRLFLKKYAGLEQLGVYSMGISFGGAALLLQSIFSTVWTPYIFR
                     AIEENATPARLSATAESAAALLASALCLTGIFSPLASLLLPENYAAVRFTVVSCMLPP
                     LFYTLTEISGIGLNVVRKTRPIALATLGALAANLLLLGLAVPSGGTRGAAVACAASFW
                     LFFVFKTESSCRLWQPLKRLPLYMHTLFCLASSAAYTCFGTPANYPLFAGVWAAYLAG
                     CILRHRKNLHKLFHYLKKQGFPL"
     gene            complement(97256..98365)
                     /gene="ribD"
                     /locus_tag="NGO_RS00455"
                     /old_locus_tag="NGO0089"
                     /old_locus_tag="NGO_0089"
     CDS             complement(97256..98365)
                     /gene="ribD"
                     /locus_tag="NGO_RS00455"
                     /old_locus_tag="NGO0089"
                     /old_locus_tag="NGO_0089"
                     /EC_number="1.1.1.193"
                     /EC_number="3.5.4.26"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002226676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     diaminohydroxyphosphoribosylaminopyrimidine
                     deaminase/5-amino-6-(5-phosphoribosylamino)uracil
                     reductase RibD"
                     /protein_id="WP_003704923.1"
                     /translation="MFSDTNISMMENALRLAALGRFSTSPNPRVGCVIAHGSQIVGQG
                     FHVKAGEPHAEVHALRQAGEMAKGATAFVTLEPCSHYGRTPPCAEALLRSGVTRVVAA
                     MRDPNPPVAGKGLVLLKAAGIKTECGLLENKARELNRGFLSRIERRRPFVRLKCAVSL
                     DGKTALSDGSSFWITGEEARADVQVLRAESCAVLTGIGTVLADNPRLNVRAFPTLRQP
                     ARIVLDSRLRLPPNSHLVTDGQSPTYIATLERDEDKLRPYREHAHIRILMPSETADGK
                     IDLHHLMRLLADEGFGEIMVEAGSELTSAFLAENLADEIVLYRSPKILGGGKDLFSLP
                     ENRAALSAPPLWTPVSSEILGHDIKTVFRKNGNAF"
     gene            complement(98397..98849)
                     /gene="nrdR"
                     /locus_tag="NGO_RS00460"
                     /old_locus_tag="NGO0090"
                     /old_locus_tag="NGO_0090"
     CDS             complement(98397..98849)
                     /gene="nrdR"
                     /locus_tag="NGO_RS00460"
                     /old_locus_tag="NGO0090"
                     /old_locus_tag="NGO_0090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003711014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor NrdR"
                     /protein_id="WP_003704920.1"
                     /translation="MKCPFCAHPDTRVVDSRLMEERNAVRRRRQCPGCGKRFGTLETA
                     ELKMPAVIGPDKKRSPFNAQRLRNDLTAAARKSALTPEQIDETVRLTEHRLYTSGQRD
                     ISSSELVEIVLEELFGQNTEAAVRFAALHKRFDSPEHFASWLAQGGKT"
     gene            complement(98878..99720)
                     /locus_tag="NGO_RS00465"
                     /old_locus_tag="NGO0091"
                     /old_locus_tag="NGO_0091"
     CDS             complement(98878..99720)
                     /locus_tag="NGO_RS00465"
                     /old_locus_tag="NGO0091"
                     /old_locus_tag="NGO_0091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017629283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class II glutamine amidotransferase"
                     /protein_id="WP_003687345.1"
                     /translation="MCQLLGMNCNTPTDIMFSFEGFRRRGGITDHHADGFGIGFFEGK
                     GVRLFHDDKPSANSPVADLVRAYQIKSENVVAHIRKASQGQTSLANTHPFMREMWGGY
                     WLFAHNGHLVDFFPEQGEFFHPVGTTDSERAFCHILNRLRTRFAARPDDDTLFDAIAG
                     LTHEIRKFGLFNFMLSDGISLFAHASTLLHYIVRQAPFGKARLLDDDVMVDFAEVTTP
                     DDRVAVISTLPLTRDESWSQLAVNELVMFREGNIVRHDRPENPVYMSAEEGLEIARAA
                     GVSV"
     gene            complement(100459..101538)
                     /gene="aroB"
                     /locus_tag="NGO_RS00470"
                     /old_locus_tag="NGO0092"
                     /old_locus_tag="NGO_0092"
     CDS             complement(100459..101538)
                     /gene="aroB"
                     /locus_tag="NGO_RS00470"
                     /old_locus_tag="NGO0092"
                     /old_locus_tag="NGO_0092"
                     /EC_number="4.2.3.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014582239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="WP_003690567.1"
                     /translation="MKTLTVHTPSHSYPIFIGNGLLPQAGSLLKPHLGKRAAIITNET
                     VAPLYLGTLQTALDAAGVSHFSIILPDGEAHKNWQTLNLIFDGLMQNRAERKTTLIAL
                     GGGVIGDMVGFAAATYQRGAPFIQIPTTLLSQVDSSVGGKTAINHPLGKNMIGAFYQP
                     QAVLADLDTLHTLPARELSAGMAEVIKYGALGDIGFFEWLEQHMPELMALERAPLTQA
                     VYRCCQMKADIVAQDETEQGIRAWLNLGHTFGHAVEAEMGYGVWLHGEAVAAGCVLAA
                     RLSEQLGKTSAADTARLAALLEAAGLPSAPPVFAFEKWLAHMSHDKKVSGGIMRFIGL
                     NRLGEAVITEITDTDILRRTLQPYL"
     gene            complement(101618..102130)
                     /locus_tag="NGO_RS00475"
                     /old_locus_tag="NGO0093"
                     /old_locus_tag="NGO_0093"
     CDS             complement(101618..102130)
                     /locus_tag="NGO_RS00475"
                     /old_locus_tag="NGO0093"
                     /old_locus_tag="NGO_0093"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019272639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="WP_003687349.1"
                     /translation="MKNFNGKLILIGLMGAGKTTLGRQMAQRLDYRFYDSDHEIAAAA
                     GVPIPTIFEMEGEQGFRSRETAILKKLIVLPHIVLSTGGGAVLKEENRALIRKSGTVV
                     YLHAPPETLLERTRCDNSRPLLQVADPLAKLRELYAARDPVYRQTADFTVESANCRET
                     VQTLLKRLSR"
     gene            complement(103398..105569)
                     /locus_tag="NGO_RS00480"
                     /old_locus_tag="NGO0094"
                     /old_locus_tag="NGO_0094"
     CDS             complement(103398..105569)
                     /locus_tag="NGO_RS00480"
                     /old_locus_tag="NGO0094"
                     /old_locus_tag="NGO_0094"
                     /experiment="DESCRIPTION:Gene expression; mutation
                     analysis[PMID:14729699]"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002224059.1"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus secretin PilQ"
                     /protein_id="WP_003698035.1"
                     /translation="MNTKLTKIISGLFVATAAFQTASAGNITDIKVSSLPNKQKIVKV
                     SFDKEIVNPTGFVTSSPARIALDFEQTGISMDQQVLEYADPLLSKISAAQNSSRARLV
                     LNLNKPGQYNTEVRGNKVWIFINESDDTVSAPARPAVKAAPAAPAKQQAAAPFTESVV
                     SVSAPFSPAKQQAAASAKQTNIDFRKDGKNAGIIELAALGFAGQPDISQQHDHIIVTL
                     KNHTLPTALQRSLDVADFKTPVQKVTLKRLNNDTQLIITTTGNWELVNKSAAPGYFTF
                     QVLPKKQNLESGGVNNAPKTFTGRKISLDFQDVEIRTILQILAKESGMNIVASDSVSG
                     KMTLSLKDVPWDQALDLVMQARNLDMRQQGNIVNIAPRDELLAKDKAFLQAEKDIADL
                     GALYSQNFQLKYKNVEEFRSILRLDNADTTGNRNTLVSGRGSVLIDPATNTLIVTDTR
                     SVIEKFRKLIDELDVPAQQVMIEARIVEAADGFSRDLGVKFGATGRKKLKNETSAFGW
                     GVNSGFGGGDKWEAQTKINLPVAAAANSISLVRAISSGALNLELSASESLSKTKTLAN
                     PRVLTQNRKEAKIESGYEIPFTVTTASGGGNSTNTELKKAVLGLTVTPNITPDGQIIM
                     TVKINKDSPAQCASGNNTILCISTKSLNTQAMVENGGTLIVGGIYEENNGNTLTKVPL
                     LGDIPVIGNLFKTRGKKTDRRELLIFITPRIIDTAGNSLRY"
     gene            complement(105588..106133)
                     /locus_tag="NGO_RS00485"
                     /old_locus_tag="NGO0095"
                     /old_locus_tag="NGO_0095"
     CDS             complement(105588..106133)
                     /locus_tag="NGO_RS00485"
                     /old_locus_tag="NGO0095"
                     /old_locus_tag="NGO_0095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003750267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilP"
                     /protein_id="WP_003692554.1"
                     /translation="MKHYALLISFLALSACSQNSEDLNEWMAQTRREAKAEIIPFQAP
                     TLPVAPVYSPPQLTGPNAFDFRRMETAKKGENAPDTKRIKETLEKFSLENMRYVGILK
                     SGQKVSGFIEAEGYVYTVGVGNYLGQNYGRIESITDDSIILNELIEDSTGNWVSRKAE
                     LLLNSSDKNTEQAAAPAAEQN"
     gene            complement(106151..106798)
                     /gene="pilO"
                     /locus_tag="NGO_RS00490"
                     /old_locus_tag="NGO0096"
                     /old_locus_tag="NGO_0096"
     CDS             complement(106151..106798)
                     /gene="pilO"
                     /locus_tag="NGO_RS00490"
                     /old_locus_tag="NGO0096"
                     /old_locus_tag="NGO_0096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003710238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 4a pilus biogenesis protein PilO"
                     /protein_id="WP_010356664.1"
                     /translation="MASKSSKTNLDLNNLHLLNLPARLFIALLVVAAVLGLGYAGLFK
                     SQMESLEEYEAKETELKNTYKQKSIDAASLNNLRDELASIRSTFDIMLKQLPTDAEIP
                     NLVQELHQAGSSNGLRLDSVMPQPPVDDGPIKKLPYSISITGNYEQISQFTRDVGSLS
                     RIITLESLKIAQSPENGGNPDGKSSILNLSAIATTYQAKSVEELAAEAAQNAEQK"
     gene            complement(106799..107398)
                     /locus_tag="NGO_RS00495"
                     /old_locus_tag="NGO0097"
                     /old_locus_tag="NGO_0097"
     CDS             complement(106799..107398)
                     /locus_tag="NGO_RS00495"
                     /old_locus_tag="NGO0097"
                     /old_locus_tag="NGO_0097"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilN domain-containing protein"
                     /protein_id="WP_010356666.1"
                     /translation="MNNLIKINLLPYREEMNKRKQQQFKTLMYGAVLTGVAAVAATYL
                     FIDNMINKQSEKNTLLEISIAHLDTELSEIQKLKQEKDAFLIKKNKIEELQIKRLQAA
                     KILDSLNEAVPGSTYLTSLDAVTADSYRLSGRTSSDNRVAAMMRAMPNTGIFKQPELL
                     SIKKNNSHQEFTLQATLQPIVKAAESKENPASGNAQEAN"
     gene            complement(107401..108516)
                     /locus_tag="NGO_RS00500"
                     /old_locus_tag="NGO0098"
                     /old_locus_tag="NGO_0098"
     CDS             complement(107401..108516)
                     /locus_tag="NGO_RS00500"
                     /old_locus_tag="NGO0098"
                     /old_locus_tag="NGO_0098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015815297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilM"
                     /protein_id="WP_003696683.1"
                     /translation="MRLFKSLKNPKKTDAKLPKKSSGLNNRAAIGIDIDQHSIKMVQL
                     SGRSLNQIQLEKYVIAKLPKNIIQGNKVQNYDQLVTYLQQAYAKLGTSCKNIVASVPQ
                     NLATIEQLTYTAKDAELDLQGFVESSISEASSISLEEANYDYQVLSQSAVGEAVLSVA
                     SRKDEIEPLIDAFNAAGMKLSALDVDIFGQYNAYALWINHFAPELADEKVAIFGVYAA
                     QTYALVIQDGKILYKQETSVSEEQLNQLIQRTYQVTAEKAEEIINSPQKPSDYQESVA
                     NYFNQQITQEIQRVLQFYYTTQTADDMTDIKHILLTGEAVRQKGIAQTVASQTNADVQ
                     CVHPARYFANDLKTDEQQFELDAPTLTKAFGLAVRGL"
     gene            108668..111064
                     /locus_tag="NGO_RS00505"
                     /old_locus_tag="NGO0099"
                     /old_locus_tag="NGO_0099"
     CDS             108668..111064
                     /locus_tag="NGO_RS00505"
                     /old_locus_tag="NGO0099"
                     /old_locus_tag="NGO_0099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002237319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1A"
                     /protein_id="WP_003687357.1"
                     /translation="MIKKILTTCFGLFFGFCVFGVGLVAIAILVTYPKLPSLDSLQHY
                     QPKMPLTIYSADGEVIGMYGEQRREFTKIGDFPEVLRNAVIAAEDKRFYRHWGVDVWG
                     VARAAVGNVVSGSVQSGASTITQQVAKNFYLSSEKTFTRKFNEVLLAYKIEQSLSKDK
                     ILELYFNQIYLGQRAYGFASAAQIYFNKNVRDLTLAEAAMLAGLPKAPSAYNPIVNPE
                     RAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRRELYE
                     KYGEDAYTQGFKVYTTVRTDHQKAATEALRKALRNFDRGSSYRGAENYIDLSKSEDVE
                     ETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVALDRRALGFAARAVDNEK
                     MGEDRIRRGAVIRVKNNGGRWAVVQEPLLQGALVSLDAKTGAVRALVGGYDFHSKTFN
                     RAVQAMRQPGSTFKPFVYSAALSKGMTASTVVNDAPISLPGKGPNGSVWTPKNSDGRY
                     SGYITLRQALTASKNMVSIRILMSIGVGYAQQYIRRFGFRPSELPASLSMALGTGETT
                     PLKVAEAYSVFANGGYRVSSHVIDKIYDRDGRLRAQMQPLVAGQNAPQAIDPRNAYIM
                     YKIMQDVVRVGTARGAAALGRTDIAGKTGTTNDNKDAWFVGFNPDVVTAVYIGFDKPK
                     SMGRAGYGGTIAVPVWVDYMRFALKGKQGKGMKMPEGVVSSNGEYYMKERMVTDPGLM
                     LDNSGIAPQPSRRAKEDDEAAVENEQQGRSDETRQDVQETPVLPSNTDSKQQQLDSLF
                     "
     gene            complement(111184..111813)
                     /locus_tag="NGO_RS00510"
                     /old_locus_tag="NGO0100"
                     /old_locus_tag="NGO_0100"
     CDS             complement(111184..111813)
                     /locus_tag="NGO_RS00510"
                     /old_locus_tag="NGO0100"
                     /old_locus_tag="NGO_0100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002248759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YihA family ribosome biogenesis GTP-binding
                     protein"
                     /protein_id="WP_003687358.1"
                     /translation="MNLFQNAKFFTTVNHLKDLPDTPLEIAFVGRSNAGKSSAINTLT
                     NHVRLAYVSKTPGRTQHINFFELQNGNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLRH
                     RKQLIGLVLIMDARHPLKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVK
                     KLLKPYSDRQNISVQLFSSLKKQGIDEANRTVGSWFDAADAAASSPEEN"
     gene            112020..112643
                     /locus_tag="NGO_RS00515"
                     /old_locus_tag="NGO0101"
                     /old_locus_tag="NGO_0101"
     CDS             112020..112643
                     /locus_tag="NGO_RS00515"
                     /old_locus_tag="NGO0101"
                     /old_locus_tag="NGO_0101"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003750259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c4"
                     /protein_id="WP_003687359.1"
                     /translation="MRRLTLLAFVLAAGAVSASPKADVEKGKQVAATVCAACHAADGN
                     SGIAMYPRLAAQHTAYIYHQTIGIRDGKRTHGSAAVMKPVVMNLSDQDILNVSAFYAK
                     QQPKSGEANPKENPELGAKIYRGGLSDKKVPACMSCHGPSGAGMPGGGSEIQAYPRLG
                     GQHQAYIVEQMNAYKSGQRKNTIMEDIANRMSEEDLKAVANFIQGLR"
     gene            112921..114873
                     /locus_tag="NGO_RS00520"
                     /old_locus_tag="NGO0102"
                     /old_locus_tag="NGO_0102"
     CDS             112921..114873
                     /locus_tag="NGO_RS00520"
                     /old_locus_tag="NGO0102"
                     /old_locus_tag="NGO_0102"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002235152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c biogenesis protein"
                     /protein_id="WP_164920411.1"
                     /translation="MRFAVALLSLLGIASVIGTVLQQNQPQTDYLVKFGPFWTRIFDF
                     LGLYDVYASAWFVVIMMFLVVSTSLCLIRNVPPFWREMKSFREKVKEKSLAAMRHSSL
                     LDVKIAPEVAKRYLEVRGFQGKTVSREDGSVLIAAKKGTMNKWGYIFAHVALIVICLG
                     GLIDSNLLLKLGMLAGRIVPDNQAVYAKDFKPESILGASNLSFRGNVNISEGQSADVV
                     FLNADNGMLVQDLPFEVKLKKFHIDFYNTGMPRDFASDIEVTDKATGEKLERTIRVNH
                     PLTLHGITIYQASFADGGSDLTFKAWNLRDASREPVVLKATSIHQFPLEIGKHKYRLE
                     FDQFTSMNVEDMSEGAEREKSLKSTLNDVRAVTQEGKKYTNIGPSIVYRIRDAAGQAV
                     EYKNYMLPILQDKDYFWLTGTRSGLQQQYRWLRIPLDKQLKADTFMALREFLKDGEGR
                     KRLVADATKDAPAEIREQFMLAAENTLNIFAQKGYLGLDEFITSNIPKGQQDKMQGYF
                     YEMLYGVMNAALDETIRRYGLPEWQQDEARNRFLLHSMDAYTGLTEYPAPMLLQLDGF
                     SEVRSSGLQMTRSPGALLVYLGSVLLVLGTVFMFYVREKRAWVLFSDGKIRFAMSSAR
                     SERDLQKEFPKHVESLQRLGKDLNHD"
     gene            114866..116053
                     /gene="ccsB"
                     /locus_tag="NGO_RS00525"
                     /old_locus_tag="NGO0103"
                     /old_locus_tag="NGO_0103"
     CDS             114866..116053
                     /gene="ccsB"
                     /locus_tag="NGO_RS00525"
                     /old_locus_tag="NGO0103"
                     /old_locus_tag="NGO_0103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003750256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="c-type cytochrome biogenesis protein CcsB"
                     /protein_id="WP_003687361.1"
                     /translation="MTEHYKTLPEHELLIQKSLIRNLNLWDWVFAVLVFAATVFVQTR
                     SGMHMDIYETVMLWASAGIAVFLGWFFKPMRWFVPLSVLLAYAAVGLYGGNIKSAEIF
                     LLRYFLSSQSAIMWQCAFVFFALFAYISGAVLASVKNVPTNTLLGMGTVFAWVSAVAG
                     FTGLLVRWHESYLLRPDAGHIPVSNLYEVFILFLVITALMYLYYEGKFAVQKLGGFVF
                     GFMAVVVGFVLWYSVSREAHTIQPLIPALQSWWMKIHVPANFIGYGAFCISAMLGIAE
                     LVSLRAEEKGGKLWLPPSALIDEVMYKAIAVGFLFFTIATILGALWAADAWGRYWSWD
                     PKETWAFIVWLNYAVWLHLRLVAGWRGKVLAWWAIIGLFVTAFAFIGVNMFLSGLHSY
                     GTL"
     gene            116169..117233
                     /gene="tsaD"
                     /locus_tag="NGO_RS00530"
                     /old_locus_tag="NGO0104"
                     /old_locus_tag="NGO_0104"
     CDS             116169..117233
                     /gene="tsaD"
                     /locus_tag="NGO_RS00530"
                     /old_locus_tag="NGO0104"
                     /old_locus_tag="NGO_0104"
                     /EC_number="2.3.1.234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (adenosine(37)-N6)-threonylcarbamoyltransferase complex
                     transferase subunit TsaD"
                     /protein_id="WP_003687363.1"
                     /translation="MLVLGIESSCDETGVALYDTERGLRSHCLHTQMAMHAEYGGVVP
                     ELASRDHIRRLVPLTEGCLAQAGASYGDIDAVAFTQGPGLGGALLAGSSYANALALAL
                     DKPVIPVHHLEGHLLSPLLAEEKPDFPFVALLVSGGHTQIMAVRGIGDYELLGESVDD
                     AAGEAFDKTAKLLGLPYPGGAKLSELAESGRPEAFVFPRPMIHSDDLQMSFSGLKTAV
                     LTAVEKVREANGSETIPEQTRNNICRAFQDAVVEVLEAKVKKALLQTGFRTVVVAGGV
                     GANRKLRETFGNMTVQIPTPKGKPKHPSEKVSVFFPPMAYCTDNGAMIAFAGAMHLGK
                     GREVGAFNVRPRWSLSEIVK"
     gene            complement(117278..118126)
                     /locus_tag="NGO_RS00535"
                     /old_locus_tag="NGO0105"
                     /old_locus_tag="NGO_0105"
     CDS             complement(117278..118126)
                     /locus_tag="NGO_RS00535"
                     /old_locus_tag="NGO0105"
                     /old_locus_tag="NGO_0105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002245181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipid acyltransferase family protein"
                     /protein_id="WP_020996767.1"
                     /translation="MHILLTALLKCLSLLSLSCLHTLGNRLGHLAFYLLKEDRARIVA
                     NMRQAGLNPDTQTVKAVFAETAKCGLELAPAFFKKPEDIETMFKAVHGWEHVQQALDK
                     GEGLLFITPHIGSYDLGGRYISQQLPFHLTAMYKPPKIKAIDKIMQAGRVRGKGKTAP
                     TGIQGVKQIIKALRAGEATIILPDHVPSPQEGGGVWADFFGKPAYTMTLAAKLAHVKG
                     VKTLFFCCERLPDGQGFVLHIRPVQGELNGNKAHDAAVFNRNTEYWIRRFPTQYLFMY
                     NRYKTP"
     regulatory      118224..118334
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01725"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="SAM riboswitches modulate the expression of
                     downstream genes in response to levels of
                     S-adenosylmethionine; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="S-adenosylmethionine"
                     /db_xref="RFAM:RF01725"
     gene            118517..119686
                     /locus_tag="NGO_RS00540"
                     /old_locus_tag="NGO0106"
                     /old_locus_tag="NGO_0106"
     CDS             118517..119686
                     /locus_tag="NGO_RS00540"
                     /old_locus_tag="NGO0106"
                     /old_locus_tag="NGO_0106"
                     /EC_number="2.5.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002240743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine adenosyltransferase"
                     /protein_id="WP_003704903.1"
                     /translation="MSEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAET
                     LVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPD
                     IAQGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRL
                     PWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPP
                     ELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVD
                     RSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALV
                     CEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL"
     gene            complement(119751..121160)
                     /gene="dacB"
                     /locus_tag="NGO_RS00545"
                     /old_locus_tag="NGO0107"
                     /old_locus_tag="NGO_0107"
     CDS             complement(119751..121160)
                     /gene="dacB"
                     /locus_tag="NGO_RS00545"
                     /old_locus_tag="NGO0107"
                     /old_locus_tag="NGO_0107"
                     /EC_number="3.4.16.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002250348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine
                     carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
                     /protein_id="WP_003700891.1"
                     /translation="MNFPKTAASLLLLLASLAAHALDTGRIPQNEIAVYVQELDSGKV
                     IIDHRAGIPVNPASTMKLVTAFAAFKTFGSNYRWATEFKSNGTVNDGTLDGNLYWAGS
                     GDPVFNQENLLAVQRQLRDKGIRNITGRLMLDHSLWGEVGSPDHFEADSGSPFMTPPN
                     PTMLSAGMVMVRAERNAAGSTDILTDPPLPHIFAQNNLKITASQAACPSVKKLMRASF
                     SGNTLKLRGNIPESCLGKPVGVRMFALDELIRQSFTNRWLLGGGRISDGIGIADTPEG
                     AQTLAVAHSKPMKEILTDMNKRSDNLIARSVFLKLGGDGKLPAVSEQAASAVRRELAV
                     SGIDVADLVLENGSGLSRKERVTARMMAQMLETAYFSPFAQDFIDTLPIAGTDGTLRN
                     RFKQSGGLLRLKTGTLNNVRALAGYWLGDKPMAVVVIINSGRAVSLLPDLDNFVAKNI
                     ISGGDGWLDAKLMCKERRA"
     gene            121325..121890
                     /locus_tag="NGO_RS00550"
                     /old_locus_tag="NGO0108"
                     /old_locus_tag="NGO_0108"
                     /pseudo
     CDS             121325..121890
                     /locus_tag="NGO_RS00550"
                     /old_locus_tag="NGO0108"
                     /old_locus_tag="NGO_0108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009312712.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent oxidoreductase"
     gene            122259..123572
                     /locus_tag="NGO_RS00555"
                     /old_locus_tag="NGO0110"
                     /old_locus_tag="NGO_0110"
     CDS             122259..123572
                     /locus_tag="NGO_RS00555"
                     /old_locus_tag="NGO0110"
                     /old_locus_tag="NGO_0110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003690578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CitMHS family transporter"
                     /protein_id="WP_003687374.1"
                     /translation="MLTFIGLLIIGVIVWLLLTEKVSPIIALILVPLIGALLAGFDVS
                     QLKEFYSGGTKSVTQIVIMFMFSILFFGIMNDVGLFRPMIGGLIKLTRGNIVAVSVGT
                     VLVSVVAQLDGAGATTFLSVVPALLPLYKRLHMNPYLLFLLLTSSAGLINLLPRGGPI
                     GRVASVLGADVGELYKPLLTVQIIGVVFILVLSLFLGVREKRRIVRELGALPAVADLI
                     KPAPLSEEEQKLARPKLFWWNVLLFLAAMSLLFSGIFPPGYVFMLAATAALLLNYRSP
                     QEQMERIYAHAGGAVMMASIILAAGTFLGILKGAGMLDAISKDLVHILPDALLPYLHI
                     AIGVLGIPLELVLSTDAYYFGLFPIVEQITSQAGVAPEAAGYAMLIGSIVGTFVTPLS
                     PALWMGLGLAKLSMGKHIRYSFFWAWGLSLAILVSSIAAGIVPLP"
     gene            123841..124468
                     /locus_tag="NGO_RS00560"
                     /old_locus_tag="NGO0110a"
                     /old_locus_tag="NGO_00605"
                     /pseudo
     CDS             123841..124468
                     /locus_tag="NGO_RS00560"
                     /old_locus_tag="NGO0110a"
                     /old_locus_tag="NGO_00605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687375.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
     gene            124550..125800
                     /locus_tag="NGO_RS00565"
                     /old_locus_tag="NGO0112"
                     /old_locus_tag="NGO_0112"
     CDS             124550..125800
                     /locus_tag="NGO_RS00565"
                     /old_locus_tag="NGO0112"
                     /old_locus_tag="NGO_0112"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014575533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="WP_010950993.1"
                     /translation="MFVPLAMLAGMFSYYETFHETEALQDDLLRQAALYVGPDSKPET
                     LPEGDGDTRILVQMPQQEDPVVSLPAHLADGLHTLQADGDDDYYRVYIRTTEQGRIAV
                     MQENEYREDLAEDAARQSVLPLLAALPLMILLTVWITHKAMRPVRKLSQSLEQRRING
                     LSALSVYNIPSKIRGFVTAINLLLKRVDEDIRRRQRFVADAAHELRTPMTALSLQAER
                     LNNMPLPPDAGRQSAVLQQSIRRNKHLLEQLLALARSQSDETPLTKTTFGLQSRFRQV
                     LQELMPLALEKRQDIGVAVGGDVEVSADETEIYTLVKTFADNAVRYTPNGGRIDLGFT
                     DEGKYLAVWVEDNGNGIPESECPRVLDPFYRILGTEQQGAGLGLSIADTLAKKYGGYL
                     ELTDSRRFGHGLLIRALLDKETLK"
     gene            complement(125835..127328)
                     /gene="rng"
                     /locus_tag="NGO_RS00570"
                     /old_locus_tag="NGO0113"
                     /old_locus_tag="NGO_0113"
     CDS             complement(125835..127328)
                     /gene="rng"
                     /locus_tag="NGO_RS00570"
                     /old_locus_tag="NGO0113"
                     /old_locus_tag="NGO_0113"
                     /EC_number="3.1.26.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003754268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease G"
                     /protein_id="WP_003704899.1"
                     /translation="MLSGLPIPKDIARPPETILVNITPQETRVAVLEENNICELHIER
                     NSGHSLVGNIYLGVVRRVLPGMQSAFIDIGLERAAFLHIVDVLEQRRNPEETQRIEHM
                     LFEGQSVLVQVIKDPINTKGARLSTQISLAGRFLVHLPQEDHIGVSQRIEDDAERSSL
                     RERLDKLLPENACRGYIIRTNAENATDEQLQSDIDYLTKVWEHIQEQAKIRPPETLLY
                     QDLPLSLRVLRDMVGCDTQKILVDSTVNHGRMTRFAEQYVHGALGRIELFKGERPLFE
                     THNIEQEISRALQPRVNLNFGSYLIIESTEAMTTIDVNTGGFVGARNFDETIFRTNLE
                     ACHTIARELRLRNLGGIIIIDFIDMAQESHREAVLQELAKALAFDRTRVTLHDFTSLG
                     LVELTRKRSRENLNQVLCEPCPSCQGRGRLKTPQTVCYEIQREIVREARRYDAESFRI
                     LAAPNVIDLFLDEESQSLAMLIDFIGKPISLAVETAYTQEQYDIVLM"
     gene            127547..127804
                     /gene="grxC"
                     /locus_tag="NGO_RS00575"
                     /old_locus_tag="NGO0114"
                     /old_locus_tag="NGO_0114"
     CDS             127547..127804
                     /gene="grxC"
                     /locus_tag="NGO_RS00575"
                     /old_locus_tag="NGO0114"
                     /old_locus_tag="NGO_0114"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin 3"
                     /protein_id="WP_003687379.1"
                     /translation="MQTVTMYTGPFCPYCAMAKRLLHAAGVGHIDEIRVDASPEAFAE
                     MQRLSGQRSVPQIFIGETHVGGFTDLYRLQQEGGLDGLLNP"
     gene            127825..128268
                     /gene="secB"
                     /locus_tag="NGO_RS00580"
                     /old_locus_tag="NGO0116"
                     /old_locus_tag="NGO_0116"
     CDS             127825..128268
                     /gene="secB"
                     /locus_tag="NGO_RS00580"
                     /old_locus_tag="NGO0116"
                     /old_locus_tag="NGO_0116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019742968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-export chaperone SecB"
                     /protein_id="WP_003687381.1"
                     /translation="MSEELQPVFSIERLYVKDLSLEVPHAPQIFLEQGDPEVDMRVST
                     GSQKLEDGYYDVDVTVTVTAKLDNERTMFLNEVTQSGIFRLENIPEEDVQLLLGVACP
                     NILFPYAREAVSGTVTRAGFPPVLLAPINFEAIYQQQQEAEAAGA"
     gene            128357..130396
                     /gene="recG"
                     /locus_tag="NGO_RS00585"
                     /old_locus_tag="NGO0117"
                     /old_locus_tag="NGO_0117"
     CDS             128357..130396
                     /gene="recG"
                     /locus_tag="NGO_RS00585"
                     /old_locus_tag="NGO0117"
                     /old_locus_tag="NGO_0117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004286145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="WP_033909020.1"
                     /translation="MSPETQKQLKITDVSAKKLDKLNLHTAWDLVLHLPLRYEDETHI
                     MPIKDAPIGVPCQVEGEVIHQEVTFKPRKQLIVQIADGSGSVLFLRFIHFYASHQKQT
                     AVGKRIRAVGEIKHGFYGDEMIHPKIRDAEGGGLAESLTPVYPTVNGLNQPTLRRIIQ
                     TALDVTPLHDTLPDALLGRLKLPRLAESLRLLHSPPPSFTIHQLSDGTLPAWQRLKFD
                     ELLAQQLSMRLARQKRVSGTAAALRGDGTLTQALRQALPFALTDAQEKVVSEICRDMA
                     QTHPMHRLLQGDVGSGKTIVAALSALTAIESGAQVAVMAPTEILAEQHFIKFKQWLEP
                     LGIEVVCLFGSLRKKAKDEAKAKLADGSVKIAVGTHALFSDGVAFHNLGLSIVDEQHR
                     FGVAQRLALKNKGREVHQLMMSATPIPRTLAMSFFADLDVSVIDELPPGRTPIKTRLV
                     NNVRRAEVEGFVLGTCRKGRQAYWVCPLIEESETLQLQTAAETLARLQTALPEPNIGL
                     VHGRMKAAEKAEVMAEFAAGRLNVLVATTVIEVGVDVPNAALMVIEHAERMGLAQLHQ
                     LRGRVGRGAGESVCVLLFAEPLGELAKARLKVIYEHTDGFEIARQDLNIRGPGEFLGA
                     RQSGVPMLRFAKLEEDLHLLEQARETAPMLIEQNPEIVEAHLARWLSGREGYLGV"
     gene            complement(130990..132033)
                     /locus_tag="NGO_RS00590"
                     /old_locus_tag="NGO0118"
                     /old_locus_tag="NGO_0118"
     CDS             complement(130990..132033)
                     /locus_tag="NGO_RS00590"
                     /old_locus_tag="NGO0118"
                     /old_locus_tag="NGO_0118"
                     /EC_number="1.2.1.38"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002242977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="WP_010950995.1"
                     /translation="MSKKIKAGIVGATGYTGVELLRLLAAHPDVEVAAVTSRSEAGTA
                     VADYFPSLRGVYGLAFQTPDEAGLEQCDIVFFATPNGIAMKDAPRLLEQGVRVIDLSA
                     DFRIRDIPTWEHWYGMTHAAPGLVSQAVYGLSELNREAVAQARLVANPGCYPTCVSLP
                     LVPLLRQCRLKPGMPLIADCKSGVSGAGRKGNVGSLLCEAGDNFKAYGTAGHRHLPEI
                     RQTIAGLQDGIAEGFVFTPHLAPMIRGMHATVYLHLSDGSDPETVLRDYYRDSPFMDI
                     LPAGSTPETRSVRGANLCRISIRQAAQSDVWVVLSVIDNLVKGAAGQAVQNMNIMFGL
                     EETHGLDAIPLLP"
     gene            complement(132030..132323)
                     /locus_tag="NGO_RS00595"
                     /old_locus_tag="NGO0119"
                     /old_locus_tag="NGO_0119"
     CDS             complement(132030..132323)
                     /locus_tag="NGO_RS00595"
                     /old_locus_tag="NGO0119"
                     /old_locus_tag="NGO_0119"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002221438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003702280.1"
                     /translation="MKTLVLLLLSFSTTTAFAAYGLGLGQAPKYPVGFRAYGYVYSGR
                     QGWVLKTEADAIKLDTLFKRFVYRPSAANQNPVGQAVGQRSDGIPANHTKEKP"
     gene            132575..133729
                     /locus_tag="NGO_RS00600"
                     /old_locus_tag="NGO0121"
                     /old_locus_tag="NGO_0121"
     CDS             132575..133729
                     /locus_tag="NGO_RS00600"
                     /old_locus_tag="NGO0121"
                     /old_locus_tag="NGO_0121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003704893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="WP_003694771.1"
                     /translation="MGIHLDFGISPKTFRQTYLYQKPKLFKGAVRNLEAASCKYINEI
                     YQRADPTAPLFHLRKKGAIVPKEEYVESFDDLGKTRYRFIKSVIYEHMKNGASLVYNH
                     INNEPFSDHIARQVARFAGAHTIVSGYLAFGSDESYKNHWDTRDVYAIQLFGKKRWQL
                     TAPDFPMPLYMQQTKDTDISIPEHIDMDIILEAGDVLYIPRGWWHRPIPLGCETFHFA
                     VGTFPPNGYNYLEWLMKKFPTIESLRHSFSDWEQDRTRINDTAAQIAAMIADPVNYEA
                     FSEDFLGKERTDTAFHLEQFANPNATPLSDDVRLRLNANNLDTLEKGYLIGNGMKISV
                     DELGKKVLEHIGKNEPLLLKNLLVNFNQAKHEEVRKLIYQLIELDFLEIL"
     gene            133738..133965
                     /locus_tag="NGO_RS00605"
                     /old_locus_tag="NGO_00655"
     CDS             133738..133965
                     /locus_tag="NGO_RS00605"
                     /old_locus_tag="NGO_00655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002232975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_025456393.1"
                     /translation="MKNWKQFIFFVILVIACYQVLYFLSDMFLLDYINKYSWNLNFIQ
                     GTLNFFSIYLPYVFVSRIFRNTNQEKEYKND"
     gene            133958..134311
                     /locus_tag="NGO_RS00610"
                     /old_locus_tag="NGO0122"
                     /old_locus_tag="NGO_0122"
     CDS             133958..134311
                     /locus_tag="NGO_RS00610"
                     /old_locus_tag="NGO0122"
                     /old_locus_tag="NGO_0122"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002234250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003704890.1"
                     /translation="MIELQLHELKLVSGGGPVTDNIAGNVANAATTKGGPTWGDFVAI
                     PAAAATVHFLPKNFFGAIGANGVYNLTRDWVNDAVNAPPYNGRPIFEIEHGLTAPATK
                     ADKSGNGYTDGTDYC"
     gene            134372..135646
                     /locus_tag="NGO_RS00615"
                     /old_locus_tag="NGO0123"
                     /old_locus_tag="NGO_0123"
     CDS             134372..135646
                     /locus_tag="NGO_RS00615"
                     /old_locus_tag="NGO0123"
                     /old_locus_tag="NGO_0123"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family efflux transporter periplasmic
                     adaptor subunit"
                     /protein_id="WP_003696697.1"
                     /translation="MNRPKQPFFRPEVAIARQTSLTGKVILTRPLSFSLWTTFASISA
                     LLIILFLIFGNYTRKTTMEGQILPASGVIRVYAPDTGTITAKFVEDGEKVKAGDKLFA
                     LSTSRFGAGGSVQQQLKTEAVLKKTLAEQELGRLKLIHENETRSLKATVERLENQKLH
                     ISQQIDGQKRRIRLAEEMLRKYRFLSANDAVSKQEMMNVEAELLEQKAKLDAYRREEA
                     GLLQEIRTQNLTLASLPKRHETEQSQLERTIADISQEVLDFEMRSEQIIRAGRSGYIA
                     IPNVEVGRQVDPSKLLLSIVPERTELYAHLYIPSSAAGFIKPKDKVVLRYQAYPYQKF
                     GLASGSVVSVAKTALGRQELSGLGMVSSDLAKSNEPVYLVKIKPDKPTITAYGEEKPL
                     QIGMTLEADILHEKRRLYEWVLEPIYSMSGRL"
     gene            135831..136178
                     /locus_tag="NGO_RS00620"
                     /old_locus_tag="NGO0124"
                     /old_locus_tag="NGO_0124"
     CDS             135831..136178
                     /locus_tag="NGO_RS00620"
                     /old_locus_tag="NGO0124"
                     /old_locus_tag="NGO_0124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687399.1"
                     /translation="MRELTMNEMTAVFGGTEGTWGHRGRVSGEWVGSKVGGALGSFAG
                     AFTGMAGGALVTGGNPAGIAIGGAGGGWVGAEGGSALGGHIGGFAGAKWGKMIDRRNC
                     QCGEDCHCDPCNC"
     gene            136192..136407
                     /locus_tag="NGO_RS00625"
                     /old_locus_tag="NGO0125"
                     /old_locus_tag="NGO_0125"
     CDS             136192..136407
                     /locus_tag="NGO_RS00625"
                     /old_locus_tag="NGO0125"
                     /old_locus_tag="NGO_0125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003692579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687400.1"
                     /translation="MDFAHYLKHWKAAVLIYLAISILTDILCYFLNFDGVFYKGRFFS
                     VTVAGPVGALSFLAYLLYLKREENRSH"
     gene            136509..137276
                     /locus_tag="NGO_RS00630"
                     /old_locus_tag="NGO0125a"
                     /old_locus_tag="NGO_00680"
     CDS             136509..137276
                     /locus_tag="NGO_RS00630"
                     /old_locus_tag="NGO0125a"
                     /old_locus_tag="NGO_00680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003694777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_003694777.1"
                     /translation="MDYLQNLSLGLTKKLPVILQTEVAECGLACLAAVAGFYGFYTDL
                     RALRSKYCLSLKGENLADIVRFADDMGLTGRALRLDLDELGSLRLPCILHWDLNHFVV
                     LESVSSDGAAVMDPASGRRKVKTEEISRKFTGIALELWPNTRFEAGEEKQEIRILPML
                     RGISGLGRTLFQLLALAAAMEVFAFLQNVSFKIGRGESLALIGRSGCGKSTLLDILSG
                     NLPPESGKVMINGHDIYSLPPRFIRNLSAMVRQDDVL"
     gene            137469..137750
                     /locus_tag="NGO_RS00635"
                     /old_locus_tag="NGO_00685"
     CDS             137469..137750
                     /locus_tag="NGO_RS00635"
                     /old_locus_tag="NGO_00685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_003696701.1"
                     /translation="MIREEISAMPMGYETLIGDMGSALSGGQKQRIVLARALYCEPKI
                     LFLDEAASHLDIANEKAVNANLNGLSIIKIMAAHRKETVESADRKMSLG"
     gene            complement(137771..138997)
                     /locus_tag="NGO_RS00640"
                     /old_locus_tag="NGO0127"
                     /old_locus_tag="NGO_0127"
     CDS             complement(137771..138997)
                     /locus_tag="NGO_RS00640"
                     /old_locus_tag="NGO0127"
                     /old_locus_tag="NGO_0127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003699499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YihY family inner membrane protein"
                     /protein_id="WP_003690589.1"
                     /translation="MTFLQRWQGLADNKICAFAWFVIRRFSEERVPQAAASMTFTTLL
                     ALVPVLTVMVAVASIFPVFDRWSDSFVSFVNQTIVPQGADMVFDYIDAFRDQANRLTA
                     IGSVMLVVTSLMLIRTIDNAFNRIWRVNTQRPWMMQFLVYWALLTFGPLSLGVGISFM
                     VGSVQDSVLSSGAQQWADALKTAARLAFMTLLLWGLYRFVPNRFVPARQAFVGALITA
                     FCLETARFLFTWYMGNFDGYRSIYGAFAAVPFFLLWLNLLWTLVLGGAVLTSSLSYWQ
                     GEAFRRGFDSRGRFDDVLKILLLLDAAQKEGRTLSVQEFRRHINMGYDELGELLEKLA
                     RYGYIYSGRQGWVLKTGADSIELSELFKLFVYRPLPVERDHVNQAVDAVMTPCLQTLN
                     MTLAEFDAQAKKQQQS"
     gene            139096..>139300
                     /locus_tag="NGO_RS00645"
                     /pseudo
     CDS             139096..>139300
                     /locus_tag="NGO_RS00645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003779592.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-quinone oxidoreductase"
     gene            139485..140159
                     /gene="queC"
                     /locus_tag="NGO_RS00650"
                     /old_locus_tag="NGO0129"
                     /old_locus_tag="NGO_0129"
     CDS             139485..140159
                     /gene="queC"
                     /locus_tag="NGO_RS00650"
                     /old_locus_tag="NGO0129"
                     /old_locus_tag="NGO_0129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015815312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-cyano-7-deazaguanine synthase QueC"
                     /protein_id="WP_010950996.1"
                     /translation="MSNQKALVIFSGGQDSTTCLIQAIQTYGRENVQAITFRYGQRHA
                     VELERAEWIAQDLGVSQTVLDLSLMRQITHNALMDETAAIETAAIETADNGVPNTFVD
                     GRNALFLLYAAIFAKGQGIRHIIAGVCETDFSGYPDCRGVFVKSMNVTLNLAMDYDFQ
                     IHTPLMYLTKAQTWALADEMGVLDYIREQTHTCYKGIVGGCRECPSCILRERGLAECL
                     ESKKAV"
     gene            140187..140702
                     /locus_tag="NGO_RS00655"
                     /old_locus_tag="NGO0130"
                     /old_locus_tag="NGO_0130"
     CDS             140187..140702
                     /locus_tag="NGO_RS00655"
                     /old_locus_tag="NGO0130"
                     /old_locus_tag="NGO_0130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1543 domain-containing protein"
                     /protein_id="WP_003687408.1"
                     /translation="MPKLHMFYLGGNAGRSNIEVHDIQFAVCDDYREAVPALKAAWFG
                     DTDKIHIDGWQVVEWADGYDIAVSETPKTKMPPENAPRLYFANVGGYRAGQLAEAHAF
                     GLFAAATPAEAKQKALQTLLTDYVRQHKDNLKDVDNLLALEHIGNFHIRLTPNPHGKP
                     AEIGFQGYLPI"
     gene            140790..141212
                     /gene="queD"
                     /locus_tag="NGO_RS00660"
                     /old_locus_tag="NGO0131"
                     /old_locus_tag="NGO_0131"
     CDS             140790..141212
                     /gene="queD"
                     /locus_tag="NGO_RS00660"
                     /old_locus_tag="NGO0131"
                     /old_locus_tag="NGO_0131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-carboxytetrahydropterin synthase QueD"
                     /protein_id="WP_003704886.1"
                     /translation="MKITKIFTFDSSHMLDGHDGKCQNLHGHTYKLEITVSDGIVRGG
                     PKDGMVMDFTDLKAIVKQHITDPFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRT
                     TAENMAVEMYCRLKNAGLNVCRVKLWETPTSCAEYEGE"
     gene            141478..141850
                     /locus_tag="NGO_RS00665"
                     /old_locus_tag="NGO_00715"
                     /pseudo
     CDS             141478..141850
                     /locus_tag="NGO_RS00665"
                     /old_locus_tag="NGO_00715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003702290.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1304 domain-containing protein"
     gene            141847..142485
                     /locus_tag="NGO_RS00670"
                     /old_locus_tag="NGO0132"
                     /old_locus_tag="NGO_00720"
     CDS             141847..142485
                     /locus_tag="NGO_RS00670"
                     /old_locus_tag="NGO0132"
                     /old_locus_tag="NGO_00720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003777273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-carboxy-7-deazaguanine synthase QueE"
                     /protein_id="WP_025456391.1"
                     /translation="MKKISVAPENPQYRIVEIFESLQGEGWNTGMPAVFVRLGKCNLA
                     CGWCDTDYLTFGMMSLSDILGRLKTYAARNIIITGGEPTIQPHLDTLLDALKAEGYFL
                     CLETNGLKPAPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDAVGFCENMERK
                     IRAHHYYLSPCEQDGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGIE"
     gene            complement(142821..142897)
                     /locus_tag="NGO_RS00675"
                     /old_locus_tag="NGO_18796"
                     /old_locus_tag="NGO_t03"
     tRNA            complement(142821..142897)
                     /locus_tag="NGO_RS00675"
                     /old_locus_tag="NGO_18796"
                     /old_locus_tag="NGO_t03"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(142861..142863),aa:Pro,seq:cgg)
     gene            complement(142978..144063)
                     /gene="nagZ"
                     /locus_tag="NGO_RS00680"
                     /old_locus_tag="NGO0135"
                     /old_locus_tag="NGO_0135"
     CDS             complement(142978..144063)
                     /gene="nagZ"
                     /locus_tag="NGO_RS00680"
                     /old_locus_tag="NGO0135"
                     /old_locus_tag="NGO_0135"
                     /EC_number="3.2.1.52"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003704507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-N-acetylhexosaminidase"
                     /protein_id="WP_003704881.1"
                     /translation="MTVPHIPRGPVMADIAAFRLTEEEKQRLLDPAIGGIILFRRNFQ
                     NIEQLKTLTAEIKALRTPELIIAVDHEGGRVQRFIEGFTRLPAMNVLGQIWDKDGASA
                     AETAAGQVGRVLATELSACGIDLSFTPVLDLDWGNCAVIGNRSFHRNPEAVARLALAL
                     QKGLAKGGMKSCGKHFPGHGFVEGDSHLVLPEDGRSLDELEAADLAPFRIMSREGMAA
                     VMPAHVVYPQVDTKPAGFSEIWLKQILRRDIGFKGVIFSDDLTMEGACGAGGIKERAR
                     ISFEAGCDIVLVCNRPDLVDELRDGFTIPDNQDLAGRWQYMENSLGHEAVQAVMQTMG
                     FQAAQAFVAGLASPQDTAGGVKVGEAF"
     gene            complement(144120..145640)
                     /locus_tag="NGO_RS00685"
                     /old_locus_tag="NGO0136"
                     /old_locus_tag="NGO_0136"
     CDS             complement(144120..145640)
                     /locus_tag="NGO_RS00685"
                     /old_locus_tag="NGO0136"
                     /old_locus_tag="NGO_0136"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter NhaC family protein"
                     /protein_id="WP_010950999.1"
                     /translation="MQLIDYSHSFFSVVPPFLALALAVITRRVLLSLGIGILVGVAFL
                     VGGNPVDGLTHLKDMVVGLAWADGDWSLGKPKILVFLILLGIFTSLLTYSGSNQAFAD
                     WAKRHIKNRCGAKMLTACLVFVTFIDDYFHSLAVGAIARPVTDKFKVSRAKLAYILDS
                     TASPMCVLMPVSSWGASIIATLAGLLVTYKITEYTPMGTFVAMSLMNYYALFALIMVF
                     VVAWFSFDIGSMARFEQAALNEAHDETAASDATKGRVYALIIPVLALIASTVSAMIYT
                     GAQASETFSILGAFENTDVNTSLVFGGTCGVLAVVLCTFGTIKTADYPKAVWQGAKSM
                     FGAIAILILAWLISTVVGEMHTGDYLSTLVAGNIHPGFLPVILFLLASVMAFATGTSW
                     GTFGIMLPIAAAMAVKVEPALIIPCMSAVMAGAVCGDHCSPISDTTILSSTGARCNHI
                     DHVTSQLPYALTVAAAAASGYLALGLTKSALLGFGTTGIVLAVLIFLLKDKKRADV"
     gene            complement(145843..147342)
                     /locus_tag="NGO_RS00690"
                     /old_locus_tag="NGO0138"
                     /old_locus_tag="NGO_0138"
     CDS             complement(145843..147342)
                     /locus_tag="NGO_RS00690"
                     /old_locus_tag="NGO0138"
                     /old_locus_tag="NGO_0138"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002221414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DegQ family serine endoprotease"
                     /protein_id="WP_003687423.1"
                     /translation="MFKKYQYFALAALCAALLAGCEKAGSFFGADKKEASFVERIEHT
                     KDDGSVSMLLPDFAQLVQSEGPAVVNIQAAPAPRTQNGSGNAETDSDPLADSDPFYEF
                     FKRLVPNMPEIPQEEADDGGLNFGSGFIISKNGYILTNTHVVAGMGSIKVLLNDKREY
                     TAKLIGSDVQSDVALLKIDATEELPVVKIGNPKNLKPGEWVAAIGAPFGFDNSVTAGI
                     VSAKGRSLPNESYTPFIQTDVAINPGNSGGPLFNLKGQVVGINSQIYSRSGGFMGISF
                     AIPIDVAMNVAEQLKNTGKVQRGQLGVIIQEVSYGLAQSFGLDKASGALIAKILPGSP
                     AERAGLQAGDIVLSLDGGEIRSSGDLPVMVGAITPGKEVSLGVWRKGEEITIKAKLGN
                     AAEHTGASSKTDEAPYTEQQSGTFSVESAGITLQTHTDSSGKHLVVVRVSDAAERAGL
                     RRGDEILAVGQVPVNDEAGFRKAMDKAGKNVPLLVMRRGNTLFIALNLQ"
     gene            complement(147480..148109)
                     /gene="nth"
                     /locus_tag="NGO_RS00695"
                     /old_locus_tag="NGO0139"
                     /old_locus_tag="NGO_0139"
     CDS             complement(147480..148109)
                     /gene="nth"
                     /locus_tag="NGO_RS00695"
                     /old_locus_tag="NGO0139"
                     /old_locus_tag="NGO_0139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease III"
                     /protein_id="WP_010951000.1"
                     /translation="MNRQIRQEIFERFRAANPHPTTELNFNSPFELLIAVLLSAQATD
                     VGVNKATAKLFPVADTPQAMLDLGLDGVMEYTKTIGLYKTKSKHIMQTCRIVLEKYNG
                     QVPEDREALESLPGVGRKTANVVLNTAFGHPVMAVDTHIFRVSNRTKIAPGKDVREVE
                     DKLMRFIPKEFLMDAHHWLILHGRYTCKALKPQCQTCIINDLCEYPAKS"
     gene            complement(148156..148569)
                     /locus_tag="NGO_RS00700"
                     /old_locus_tag="NGO0140"
                     /old_locus_tag="NGO_0140"
     CDS             complement(148156..148569)
                     /locus_tag="NGO_RS00700"
                     /old_locus_tag="NGO0140"
                     /old_locus_tag="NGO_0140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002242365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DedA family protein"
                     /protein_id="WP_003687428.1"
                     /translation="MIPSYTYAALAFSAFTSATLLPGTSEAAFALFVRNFPKHAYGAL
                     LCAGLANGLGSMVSYWMGRLLPSRKMPSEKTLNLIRRFGIWLLAFAWLPVVGDALPLT
                     AGWLRLNPWTSGLMLVIGKTARYAFILWGMQYYAA"
     gene            149005..150228
                     /locus_tag="NGO_RS00705"
                     /old_locus_tag="NGO0142"
                     /old_locus_tag="NGO_0142"
     CDS             149005..150228
                     /locus_tag="NGO_RS00705"
                     /old_locus_tag="NGO0142"
                     /old_locus_tag="NGO_0142"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003685299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar MFS transporter"
                     /protein_id="WP_010356724.1"
                     /translation="MSAQSQNNHTSPLVVLTTLFFMMGFITCMNDILIPHLKEIFDLS
                     YVQAMLIQFCFFTAYAVMSIPMGAFVGKVGYKNGVIGGFLLTAVGCLLFYPAAGSHSY
                     AVFLGALFILASGVTLLQVAGNPYVTLLAKPGKESATLTLVQAFNALGTTIAPQIGAF
                     LILADATQTVSKAEQISSVQIPYLGLAGLLIILAVFVKMIRLPDARKIAAEESAHNHD
                     GKTGVWQYKHLVFGTAGIFCYVGAEVSIGSLMVNVLGYLKGLDHASAAHYLSFYWGGA
                     MVGRFLGSAVMAKFAPNRYLAFNASAAVVLLAVAMATGSGNADVAMWSLLAIGFFNSI
                     MFPTIFSLATKGLGKFTNAASGVLCTAIVGGAVVPVIQGWAADTYTLMSSFVVSVICY
                     LYIVFFAVYGYRADK"
     gene            150518..151897
                     /gene="nhaC"
                     /locus_tag="NGO_RS00710"
                     /old_locus_tag="NGO0143"
                     /old_locus_tag="NGO_0143"
     CDS             150518..151897
                     /gene="nhaC"
                     /locus_tag="NGO_RS00710"
                     /old_locus_tag="NGO0143"
                     /old_locus_tag="NGO_0143"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002252825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter NhaC"
                     /protein_id="WP_003694793.1"
                     /translation="MFAFKSLLDMPRGEALAVVVALIAAMGYTIISLEWLPHMSIIAA
                     IVVLILYGLARGLKYNDMQAGMIGALNQGMGAVYLFFFIGLMVSALMMSGAIPTLMYY
                     GFGLISPTYFYFSAFALCSVIGVSIGSSLTACATVGVAFMGMAAAFQADMAMTAGAIV
                     SGVFFGDKMSPLSDTTGISASIVGIDLFEHIKNMMYTTIPAWLISAALMLWLLPSVAA
                     QDLNSVESFRSQLEATGLVHGYSLIPFALLVVLALMRVNAVVAMLFTVIAAVAVTYLH
                     STPDLRQLGAWFYGGYKLEGEAFKDIAKLISRGGLESMFFTQTIVILGMSLGGLLFAL
                     GVIPSLLEAVRTFLTNAGRATFSVAMTSVGVNFLIGEQYLSILLSGETFKPVYDKLGL
                     HSCNLSRTLEDAGTVINPLVPWSVCGVFISHALGVPVWEYLPYAFFCYLSLALTLLFG
                     WTGLTLSKK"
     gene            complement(152040..152864)
                     /locus_tag="NGO_RS00715"
                     /old_locus_tag="NGO0144"
                     /old_locus_tag="NGO_0144"
     CDS             complement(152040..152864)
                     /locus_tag="NGO_RS00715"
                     /old_locus_tag="NGO0144"
                     /old_locus_tag="NGO_0144"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CBS domain-containing protein"
                     /protein_id="WP_003687434.1"
                     /translation="MDGAQPKTNFFERLIARLAREPDSAEDVLNLLRQAHEQEVFDAD
                     TLTRLEKVLDFAELEVRDAMITRSRMNVLKENDSIERITAYVIDTAHSRFPVIGEDKD
                     EVLGILHAKDLLKYMFNPEQFHLKSVLRPAVFVPEGKSLTALLKEFREQRNHMAIVID
                     EYGGTSGLVTFEDIIEQIVGDIEDEFDEDESADNIHSVSAERWRIHAATEIEDINAFF
                     GTEYGSEEADTIGGLVIQELGHLPVRGEKVLIGGLQFTVARADNRRLHTLMATRVK"
     gene            complement(152866..153381)
                     /gene="ybeY"
                     /locus_tag="NGO_RS00720"
                     /old_locus_tag="NGO0145"
                     /old_locus_tag="NGO_0145"
     CDS             complement(152866..153381)
                     /gene="ybeY"
                     /locus_tag="NGO_RS00720"
                     /old_locus_tag="NGO0145"
                     /old_locus_tag="NGO_0145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002221387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA maturation RNase YbeY"
                     /protein_id="WP_003694796.1"
                     /translation="MKRAKKYPFLTLQRQRFHLNFENASSAAGIPAERDFYRWAWSAL
                     KNEYLRADIGLILLDEEEARAYNRDYRGKDYATNVLSFALNEGEILPCQVSERLYGDL
                     IICPQVVLKEAAEQGKTPERHFAHLTIHGTLHLMGYDHIKDDEAEIMEAEEIRLMRAA
                     GYPNPYREDGH"
     gene            153500..154435
                     /gene="hemC"
                     /locus_tag="NGO_RS00725"
                     /old_locus_tag="NGO0146"
                     /old_locus_tag="NGO_0146"
     CDS             153500..154435
                     /gene="hemC"
                     /locus_tag="NGO_RS00725"
                     /old_locus_tag="NGO0146"
                     /old_locus_tag="NGO_0146"
                     /EC_number="2.5.1.61"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylbilane synthase"
                     /protein_id="WP_003687436.1"
                     /translation="MNPKKLVIASRESLLAMWQAKHIQGRLKALYPDCEVEILGMTTR
                     GDRILDRTLSKVGGKGLFVKELEQSLQDGRADLAVHSIKDVPMDLPEGFALAAISERA
                     NPFDAFVSNRYARLEEMPEGAVVGTSSLRREAQLRARYPHLVIKPLRGNVQTRLSKLD
                     NGEYDAIILAAAGLQRLELDERIRMILSESDSLPAAGQGALGIEIATHREDLYEVLKP
                     LNHDTTHACVTAERALARALGGSCQVPLAAYCTEENGLLILRGLVGHPDGSIVLQADA
                     QAPAGYADALGRAVAKKLADDGAQELIGAVLNTEN"
     gene            complement(154721..>155086)
                     /locus_tag="NGO_RS00730"
                     /old_locus_tag="NGO_00790"
                     /pseudo
     CDS             complement(154721..>155086)
                     /locus_tag="NGO_RS00730"
                     /old_locus_tag="NGO_00790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002225556.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            155508..155828
                     /locus_tag="NGO_RS00735"
     CDS             155508..155828
                     /locus_tag="NGO_RS00735"
                     /inference="COORDINATES: protein motif:HMM:NF013842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_105211381.1"
                     /translation="MSRNTLYLRIRLKKQTGSLKHQVTGLNAAKSDRQKPARYVGRHP
                     DACLHEIAKHFDCTAAAVCHAPKQMRMARKKDRRLQRTRPGQSNALFDTAGRIFRLPT
                     RLSG"
     gene            155779..156267
                     /locus_tag="NGO_RS00740"
                     /old_locus_tag="NGO0146a"
                     /old_locus_tag="NGO_00795"
     CDS             155779..156267
                     /locus_tag="NGO_RS00740"
                     /old_locus_tag="NGO0146a"
                     /old_locus_tag="NGO_00795"
                     /inference="COORDINATES: protein motif:HMM:NF024751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_157147420.1"
                     /translation="MTRPAGFSDCQRVCPDETGFDRRLFRPYARSLKGQMAKARIRVK
                     RYRRLSLVSAQVGNRPIAPMVCQNTVAGVFFEARFQQCLLPALAQKSVIISDNARFRR
                     MGALRGTAEKLGHKVLPPAPYSPEPNPIEKVWANIKRYLRTVLSDYARFDDALLSYFD
                     FN"
     gene            complement(156345..157430)
                     /locus_tag="NGO_RS00745"
                     /old_locus_tag="NGO0147"
                     /old_locus_tag="NGO_0147"
     CDS             complement(156345..157430)
                     /locus_tag="NGO_RS00745"
                     /old_locus_tag="NGO0147"
                     /old_locus_tag="NGO_0147"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan 7-halogenase"
                     /protein_id="WP_010951001.1"
                     /translation="MEMLEEAGFADAVRTGPGFQLKNGAAFSWGSRYTEFDFTDKFSD
                     GPGTVYQVRRAVFDKILIEEAAKQGVEVRFGHGVTAFDNSGDFARLNIETDTGESYEL
                     TAKFVLDASGYGRVLPRLLNLETPSHLPPRQTHFTHIDDNITHPKFDRNKILITTHPQ
                     HRDVWIWLIPFGDNRCSVGVVGTPDKLAGESETVLKKFVYECPMLSEILDKAVWENDF
                     PFRSIQGYSANVKSLHGRHFALLGNAAEFLDPVFSSGVTIALHSAELAADLLTKQLKG
                     EAADWQTEFAEPLMIGVDAFRTYVDGWYDFRFQNVVYAPDRSPEISRMLSSILAGYAW
                     DTENPFVAKSEQRLTALSEWVGQLESE"
     gene            complement(157367..157582)
                     /locus_tag="NGO_RS00750"
                     /old_locus_tag="NGO_0148"
     CDS             complement(157367..157582)
                     /locus_tag="NGO_RS00750"
                     /old_locus_tag="NGO_0148"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010359774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent monooxygenase"
                     /protein_id="WP_010951002.1"
                     /translation="MPTQFDVAVIGAGPAGSAASALLRKKGYQVCVLENSTFRASSSA
                     KACCRTVWKCWKKPVLPMPFAPGPAFS"
     gene            complement(157762..159135)
                     /locus_tag="NGO_RS00755"
                     /old_locus_tag="NGO0149"
                     /old_locus_tag="NGO_0149"
     CDS             complement(157762..159135)
                     /locus_tag="NGO_RS00755"
                     /old_locus_tag="NGO0149"
                     /old_locus_tag="NGO_0149"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002238938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_003687439.1"
                     /translation="MSNPFSSLGLGTELVSALTAQGYENPTPIQAAAIPKALAGHDLL
                     AAAQTGTGKTAAFMLPSLERLKRYATASTSPAMHPVRMLVLTPTRELADQIDQNVQGY
                     IKNLPLRHTVLFGGVNMDKQTADLRAGCEIVVATVGRLLDHVKQKNISLNKAEIVVLD
                     EADRMLDMGFIDDIRKIMQMLPRQRQTLLFSATFSAPIRKLAQDFMNAPETVEVAAQN
                     TTNANVEQHIIAVDTFQKRNLLERLIVDLHMNQVIVFCKTKQSVDRVTRELVRRNLSA
                     QAIHGDRSQQSRLETLNAFKDGSLRVLVATDIAARGLDIAELPFVINYEMPAQPEDYI
                     HRIGRTGRAGADGVAISLMDESEQKMFEAIKELTGNKLLIERIEGFEPRWWEQEGSKP
                     EKTETSEPRQRNRYESARAQREKNTRPETTANDAGAACGKIAGRSRRSRRGHRTCALL
                     QPRYGVK"
     gene            159349..160353
                     /gene="dusB"
                     /locus_tag="NGO_RS00760"
                     /old_locus_tag="NGO0151"
                     /old_locus_tag="NGO_0151"
     CDS             159349..160353
                     /gene="dusB"
                     /locus_tag="NGO_RS00760"
                     /old_locus_tag="NGO0151"
                     /old_locus_tag="NGO_0151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009311121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA dihydrouridine synthase DusB"
                     /protein_id="WP_010356737.1"
                     /translation="MHIGGYFIDNPIALAPMAGIADKPFRRLCRAFGAGWAVCEMLAS
                     DPTLRNTGKTLHRSDFADEGGIVAVQIAGSDPEQMADAARYNVGLGAQVIDINMGCPA
                     KKVCNVQAGSALMQDEPLVAAILEAVVKAAGVPVTLKTRLGWHDDHQNLPAIAKIAED
                     CGIAALAVHGRARTQMYKGEARYELIAETKSRLNIPAWVNGDITSPQKAAAVLKQTAA
                     DGIMIGRGAQGRPWFFRDLKHYAEHGVLPPALSLAECRAAILNHIRAMHAFYGETVGV
                     RIARKHIGWYIGEMPDGEQARREINRLDNAAAQYDTLAGYLERLAGKTDRWACGYREG
                     "
     gene            160366..160515
                     /locus_tag="NGO_RS11045"
     CDS             160366..160515
                     /locus_tag="NGO_RS11045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003694809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003694809.1"
                     /translation="MPPFGFGRHLSAWFGGRAESRPANVENNKCRLKTSGTGFAKRLS
                     DGIPS"
     gene            160542..160781
                     /locus_tag="NGO_RS00765"
                     /old_locus_tag="NGO0152"
                     /old_locus_tag="NGO_0152"
     CDS             160542..160781
                     /locus_tag="NGO_RS00765"
                     /old_locus_tag="NGO0152"
                     /old_locus_tag="NGO_0152"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003684241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_003687442.1"
                     /translation="MNPATADIAQCIEQNLNQYFKDLNGTEPCGVYDMVLHQVEKPLL
                     VCVMEQCGGNQSKASVMLGLNRNTLRKKLIQHGLL"
     gene            160784..161320
                     /gene="ruvC"
                     /locus_tag="NGO_RS00770"
                     /old_locus_tag="NGO0153"
                     /old_locus_tag="NGO_0153"
     CDS             160784..161320
                     /gene="ruvC"
                     /locus_tag="NGO_RS00770"
                     /old_locus_tag="NGO0153"
                     /old_locus_tag="NGO_0153"
                     /EC_number="3.1.22.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002258268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="crossover junction endodeoxyribonuclease RuvC"
                     /protein_id="WP_003687445.1"
                     /translation="MSATVRILGIDPGSRVTGFGIIDVRGRDHFYVASGCIKTPADEP
                     LADRIAVIVRHIGEVVAVYKPQQAAVEQVFVNVNPASTLMLGQARGAALAALVSHKLP
                     VSEYTALQVKQAVVGKGKAAKEQVQHMVVQMLGLSGTPQADAADGLAVALTHALRNHG
                     LAAKLNPSGMQVKRGRFQ"
     gene            161359..162240
                     /locus_tag="NGO_RS00775"
                     /old_locus_tag="NGO0154"
                     /old_locus_tag="NGO_0154"
     CDS             161359..162240
                     /locus_tag="NGO_RS00775"
                     /old_locus_tag="NGO0154"
                     /old_locus_tag="NGO_0154"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002243640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A biosynthesis lauroyl acyltransferase"
                     /protein_id="WP_003704869.1"
                     /translation="MCTEMKFIFFVLYVLQFLPFALLHKIAGLIGSLAYLLVKPRRRI
                     GEINLAKCFPEWDEEKRKTVLKQHFKHMAKLMLEYGLYWYASAKCLKSLVRYRNKHYL
                     DDALAAGEKVIILYPHFTAFEMAVYALNQDVPLISMYSHQKNKILDEQILKGRNRYHN
                     VFLIGRTEGLRALVKQFRKSSAPFLYLPDQDFGRNNSVFVDFFGIQTATITGLSRIAA
                     LANAKVIPAIPVREADNTVTLQFYPAWKSFPSEDAQADAQRMNRFIEERVREHPEQYF
                     WLHKRFKTRPEGSPDFY"
     gene            162843..163028
                     /locus_tag="NGO_RS00780"
                     /old_locus_tag="NGO_0155"
     CDS             162843..163028
                     /locus_tag="NGO_RS00780"
                     /old_locus_tag="NGO_0155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003696720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003690237.1"
                     /translation="MKKGVHSATQNYRYSGAMPSERIFRSVLRLVGVSSDTVKRKFAG
                     AGLSYAGKAAGESLYCL"
     gene            163144..163938
                     /locus_tag="NGO_RS00785"
                     /old_locus_tag="NGO0156"
                     /old_locus_tag="NGO_0156"
     CDS             163144..163938
                     /locus_tag="NGO_RS00785"
                     /old_locus_tag="NGO0156"
                     /old_locus_tag="NGO_0156"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002252744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5' exonuclease"
                     /protein_id="WP_003686851.1"
                     /translation="MNTILAFDIETVPDVQGIRTLYDLPSSLPDDEVVLFAQQKRRAQ
                     TGGDFMQHHLHQVVAVSCCMRWGQDKVHVGTIGEMDDGEEVVIAKFFELVEKHTPQLV
                     SWNGGGFDLPVLHYRSLIYGINAARYWDTGDGDFGDSRDFKWNNYISRYHQRHCDLMD
                     LLALYQPRANVPLDDMAKLCGFPGKLGMDGSKVWEAFHAGRLKEIRNYCETDAVNTYL
                     MYLRFCLVSGRFDADEYEMEIKRIRNYLSAQTEDKPHWAEFVQAWK"
     gene            164163..166766
                     /gene="pepN"
                     /locus_tag="NGO_RS00790"
                     /old_locus_tag="NGO0158"
                     /old_locus_tag="NGO_0158"
     CDS             164163..166766
                     /gene="pepN"
                     /locus_tag="NGO_RS00790"
                     /old_locus_tag="NGO0158"
                     /old_locus_tag="NGO_0158"
                     /EC_number="3.4.11.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010359779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase N"
                     /protein_id="WP_003694813.1"
                     /translation="MSKTVRYLKDYQTPAYRILETELHFDIAEPQTVVKSRLTVEPQR
                     AGEPLVLDGSAKLLSVKINGAAADYVLEGETLTIADVPSERFTVEVETEILPAENKSL
                     MGLYASGGNLFTQCEPEGFRKITFYIDRPDVMSKFTTTIVADKKRYPVLLSNGNKIDG
                     GEFSDGRHWVKWEDPFAKPSYLFALVAGDLAVTEDRFTTMSGRNVKIEFYTTEADKPK
                     VGFAVESLKNAMKWDETRFGLEYDLDIFMVVAVGDFNMGAMENKGLNIFNTKFVLADS
                     RTATDTDFEGIESVVGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSGDRAGRA
                     VRRIENIRLLRQNQFPEDAGPTAHPVRPVSYEEMNNFYTMTVYEKGAEVVRMYHTLLG
                     EEGFQKGMKLYFQRHDGQAVTCDDFRAAMADANGINLDQFALWYSQAGTPVLEAEGRL
                     KNNVFELTIKQTVPPTPDMADKQPMMIPVKVGLLNRNGEAVAFDYQGKRATEAVLLMT
                     EAEQAFPLEGVTEAVVPSLLRGFSAPVYLNYPYSDDDLLLLLAHDSDAFTCWEAAQTL
                     YRRAVAANLAALSDGIGLPKHEKLLAAVEKVISDDLLDNAFKALLLGVPSEAELWDGT
                     ENIDPLRYHQAREALLDTLAVRFLPKWHELDRQAAKQENQSYEYSPETADWRTLRNVC
                     RAFVLRADPAHIETVAEKYGEMAQNMTHEWGILSAVNGNESDTRNCLLAQFADKFSDD
                     ALVMDKYFALIGSSRRSDTLQQVQTALQHPKFSLENPNKARSLIGSFSRNVPHFHAQD
                     GSGYRFIADKVIEIDRFNPQVAARLVQAFNLCNKLEPHRKNLVKQELQCIRAQEGLSK
                     DVGEIVGKILG"
     gene            166828..167480
                     /locus_tag="NGO_RS00795"
                     /old_locus_tag="NGO0158a"
                     /old_locus_tag="NGO_00855"
                     /pseudo
     CDS             166828..167480
                     /locus_tag="NGO_RS00795"
                     /old_locus_tag="NGO0158a"
                     /old_locus_tag="NGO_00855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611454.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1595 family transposase"
     gene            complement(167614..167805)
                     /locus_tag="NGO_RS00800"
                     /old_locus_tag="NGO0160"
                     /old_locus_tag="NGO_0160"
     CDS             complement(167614..167805)
                     /locus_tag="NGO_RS00800"
                     /old_locus_tag="NGO0160"
                     /old_locus_tag="NGO_0160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003704485.1"
                     /translation="MLPTRSVSSLLLGEYLEFEENGTKITAEIGSAWHFLGAACRISI
                     NGKYYAGNRIVWFAKKAES"
     gene            complement(167838..168305)
                     /locus_tag="NGO_RS00805"
                     /old_locus_tag="NGO0161"
                     /old_locus_tag="NGO_0161"
     CDS             complement(167838..168305)
                     /locus_tag="NGO_RS00805"
                     /old_locus_tag="NGO0161"
                     /old_locus_tag="NGO_0161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012221508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010356746.1"
                     /translation="MQINNISDEQVMIVKMSCYLKKDEIFKNIERYGYQSSDIKKINP
                     PFPLNILPVPKPYYFYLYDTHLNQIYDLAWSCNDFLMFEIFILDRESIKYIDKDKLFK
                     SGETLYSNFKSIKNQCKNYFFCGFDFDAPYFKSGVSQVADYNFVPDAFSLFFI"
     gene            complement(168362..168700)
                     /locus_tag="NGO_RS11050"
     CDS             complement(168362..168700)
                     /locus_tag="NGO_RS11050"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687455.1"
                     /translation="MKTFEKTWSAQYRDMEISVRNFWNLKRTGAEVYINGRRVYHNEA
                     GMASASLRSLMGEYLEFEESGTKITVEIGSAWHFNETIRNINTHLRGTKLPGSNWRVQ
                     DKGHFHLWKR"
     gene            complement(168745..169122)
                     /locus_tag="NGO_RS00815"
                     /old_locus_tag="NGO0163"
                     /old_locus_tag="NGO_0163"
     CDS             complement(168745..169122)
                     /locus_tag="NGO_RS00815"
                     /old_locus_tag="NGO0163"
                     /old_locus_tag="NGO_0163"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003690617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003690617.1"
                     /translation="MSFGYLIATSQPCELLTKSRGETFSLIMDKMDLWIYFRFCEGNI
                     YTIRKNETESCLTERGGEWLKHIYEFNRESFIFSDVLLQKGESEENFSEIVLKSIKNN
                     KILTVEVRSGLHFDLRNIYRIEM"
     gene            complement(169180..169545)
                     /locus_tag="NGO_RS00820"
                     /old_locus_tag="NGO0164"
                     /old_locus_tag="NGO_0164"
     CDS             complement(169180..169545)
                     /locus_tag="NGO_RS00820"
                     /old_locus_tag="NGO0164"
                     /old_locus_tag="NGO_0164"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002227446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687460.1"
                     /translation="MEKPLLTPPFFLFEDVSLDIFQGLSELEKKIEPQDLMDDVYRAF
                     DSVGNILNFRIVEKEQKGFWVSTKIKTVVFDSADMPSDDLFLKCLQSSYKAYSETEPA
                     GLDKRQLMKTLIQKCGFSC"
     gene            complement(169527..170066)
                     /locus_tag="NGO_RS00825"
                     /old_locus_tag="NGO0165"
                     /old_locus_tag="NGO_0165"
     CDS             complement(169527..170066)
                     /locus_tag="NGO_RS00825"
                     /old_locus_tag="NGO0165"
                     /old_locus_tag="NGO_0165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002248269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687462.1"
                     /translation="MKKQITAAVMMLSMIAPAMANGLDNQAFEDQVFHTRADAPMQLA
                     ELSQKEMKETEGAFLPLAILGGAAIGMWTQHGFSYATTGRPASVRDVAGGLGAIPGDV
                     GAAGKVVSFAKYGREIKIGNNMRIAPFGNRTGHPIGKFPHYHRRVTDNTGKTLPGQGI
                     GRHRPWESKSTDRSWKNRF"
     gene            complement(170109..170975)
                     /locus_tag="NGO_RS00830"
                     /old_locus_tag="NGO0166"
                     /old_locus_tag="NGO_0166"
     CDS             complement(170109..170975)
                     /locus_tag="NGO_RS00830"
                     /old_locus_tag="NGO0166"
                     /old_locus_tag="NGO_0166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003696729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003696729.1"
                     /translation="MKNILLVFVSFVPLCVRTDLPLNIEDIMTDKGKWKLETSLTYLN
                     SENSRAALASPVYIQTGSASFIPVPTEIQENGSNTDMLAGTLGLRYGLTGNTDIYGSG
                     SYLWHEERKLDGNGKTRNKRMSDISAGISHTFLKDGKNPALIAFLESTVYEKSRNKAS
                     SGKSWLIGATTYKAIDPIVLSLTAAYRINGSKTLSDDVKYKAGNYWMLNPNISFAAND
                     RISLTGGIQWLGKQPDRIDGKKESARNTSTYAHFGAGFGFTKTAALNASARFNVSGQS
                     SSELKLGVQHTF"
     gene            complement(171195..172121)
                     /locus_tag="NGO_RS00835"
                     /old_locus_tag="NGO0168"
                     /old_locus_tag="NGO_0168"
     CDS             complement(171195..172121)
                     /locus_tag="NGO_RS00835"
                     /old_locus_tag="NGO0168"
                     /old_locus_tag="NGO_0168"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003753922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter substrate-binding protein"
                     /protein_id="WP_010951005.1"
                     /translation="MKHLKLTLIAALLATAATAAPLPVVTSFSILGDVAKQIGGERVA
                     VQSLVGANQDTHAYHMTSGDIKKIRSAKLVLLNGLGLEAADIQRAVEQSKVSYAEATK
                     GIQPLKAEEEGGHHHDHHHDHDHDHEGHHHDHGEYDPHVWNDPVLMSDYAQNVAETLI
                     KADPEGKVYYQQRLGNYQMQLKKLHSDAQAAFNAVPAAKRKVLTGHDAFSYMGNRYNI
                     SFIAPQGVSSEAEPSAKQVAAIIRQIKREGIKAVFTENIKDTRMVDRIAKETGVNVSG
                     KLYSDALGNAPADTYIGMYRHNVKALTNAMKQ"
     gene            complement(172198..173073)
                     /locus_tag="NGO_RS00840"
                     /old_locus_tag="NGO0169"
                     /old_locus_tag="NGO_0169"
     CDS             complement(172198..173073)
                     /locus_tag="NGO_RS00840"
                     /old_locus_tag="NGO0169"
                     /old_locus_tag="NGO_0169"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter permease"
                     /protein_id="WP_003692612.1"
                     /translation="MNLYDLLLAPFAEFDFMHYALASVFCLSLSAAPVGVFLVMRRMS
                     LIGDALSHAVLPGAAVGYMFAGLSLPAMGVGGFAAGMLMALLAGLVSRFTTLKEDANF
                     AAFYLSSLAIGVILISKNGSSVDLLHLLFGSVLAVDIPALQLIAAVSGLTLITLAVIY
                     RPLVLESIDPLFLKSVNGKGGLWHVIFLILVVMNLVSGFQALGILMSVGLMMLPAITA
                     RLWARNMGTLILLSVLIALFCGLIGLLISYHIEIPSGPAIILCCSVLYLFSVILGKEG
                     GILPKWFKNHRHHTT"
     gene            complement(173108..173863)
                     /locus_tag="NGO_RS00845"
                     /old_locus_tag="NGO0170"
                     /old_locus_tag="NGO_0170"
     CDS             complement(173108..173863)
                     /locus_tag="NGO_RS00845"
                     /old_locus_tag="NGO0170"
                     /old_locus_tag="NGO_0170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003692614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter ATP-binding protein"
                     /protein_id="WP_003692614.1"
                     /translation="MGCLPLGGIGMSIIVENLTVSYRRRPAVHHVDITFEEHSMWAVF
                     GPNGAGKSTFLKSLMGLQPIDTGSIRLDGLTRQNIAYLPQQSDIDRSQPMTVFDLAAM
                     GLWYEIGFFKGINTAQKQRVHEALERVGMRQFARRQIAHLSNGQFQRVLFARMLVQNA
                     KFLLLDEPFNAVDARTTYELLDVLQKCHCGGHAIIAVLHDYEQVRAYFPNTLLLAREK
                     IAAGATETILTESYLAQASAKMQQQESPDWCAS"
     gene            complement(174154..174519)
                     /gene="rplS"
                     /locus_tag="NGO_RS00850"
                     /old_locus_tag="NGO0171"
                     /old_locus_tag="NGO_0171"
     CDS             complement(174154..174519)
                     /gene="rplS"
                     /locus_tag="NGO_RS00850"
                     /old_locus_tag="NGO0171"
                     /old_locus_tag="NGO_0171"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003679470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="WP_002217809.1"
                     /translation="MNLIQQLEQEEIARLNKEIPEFAPGDTVVVSVRVVEGTRSRLQA
                     YEGVVIARRNRGLNSNFIVRKISSGEGVERTFQLYSPTVEKIEVKRRGDVRRAKLYYL
                     RGLTGKAARIKEKLPARKG"
     gene            complement(174534..175283)
                     /gene="trmD"
                     /locus_tag="NGO_RS00855"
                     /old_locus_tag="NGO0172"
                     /old_locus_tag="NGO_0172"
     CDS             complement(174534..175283)
                     /gene="trmD"
                     /locus_tag="NGO_RS00855"
                     /old_locus_tag="NGO0172"
                     /old_locus_tag="NGO_0172"
                     /EC_number="2.1.1.228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002222855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanosine(37)-N1)-methyltransferase TrmD"
                     /protein_id="WP_003687474.1"
                     /translation="MLIQAVTIFPEMFDSITRYGVTGRANRQGIWQFEAVNPRKFADN
                     RLGYIDDRPFGGGPGMIMMAPPLHAAIEHAKAQSSQTAKVIYLSPQGKPLTHQKAAEL
                     AELTHLILLCGRYEGIDERLLQSSVDEEISIGDFVVSGGELPAMMLMDAVLRLVPGIL
                     GDIQSAEQDSFSSGILDCPHYTKPLEFQGMAVPEVLRSGNHGLIAEWRLEQSLRRTLE
                     RRPDLLEKRVLIPKESRLLNKILQEQREIQS"
     gene            complement(175283..175792)
                     /gene="rimM"
                     /locus_tag="NGO_RS00860"
                     /old_locus_tag="NGO0173"
                     /old_locus_tag="NGO_0173"
     CDS             complement(175283..175792)
                     /gene="rimM"
                     /locus_tag="NGO_RS00860"
                     /old_locus_tag="NGO0173"
                     /old_locus_tag="NGO_0173"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003748672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome maturation factor RimM"
                     /protein_id="WP_003690619.1"
                     /translation="MTDTQNRVAMGYIKGVFGIKGWLKIAANTEYSDSLLDYPEWHLA
                     KDGKTVSVTLEAGKVVNGELQVKFEGIDDRDSAFSLRGYTIEIPREAFAPTEEDEYYW
                     ADLVGMTVVNKDDTVLGKVSNLMETGANDVLMIDGEHGQILIPFVSQYIETVDTGSKT
                     ITADWGLDY"
     gene            complement(175808..176053)
                     /gene="rpsP"
                     /locus_tag="NGO_RS00865"
                     /old_locus_tag="NGO0174"
                     /old_locus_tag="NGO_0174"
     CDS             complement(175808..176053)
                     /gene="rpsP"
                     /locus_tag="NGO_RS00865"
                     /old_locus_tag="NGO0174"
                     /old_locus_tag="NGO_0174"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S16"
                     /protein_id="WP_003687476.1"
                     /translation="MVVIRLARGGSKHRPFYNVIVTDSRSRRDGRFIERVGFYNPVAN
                     EKQERVRLNADRLNHWIAQGAQVSDSVAKLIKEQKAV"
     gene            complement(176098..178521)
                     /locus_tag="NGO_RS00870"
                     /old_locus_tag="NGO0174a"
                     /old_locus_tag="NGO_00940"
                     /pseudo
     CDS             complement(176098..178521)
                     /locus_tag="NGO_RS00870"
                     /old_locus_tag="NGO0174a"
                     /old_locus_tag="NGO_00940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273083.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional acetate--CoA ligase family
                     protein/GNAT family N-acetyltransferase"
     gene            complement(178639..180045)
                     /locus_tag="NGO_RS00875"
                     /old_locus_tag="NGO0176"
                     /old_locus_tag="NGO_0176"
     CDS             complement(178639..180045)
                     /locus_tag="NGO_RS00875"
                     /old_locus_tag="NGO0176"
                     /old_locus_tag="NGO_0176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAMP domain-containing histidine kinase"
                     /protein_id="WP_003687478.1"
                     /translation="MKLFQRIFATFCAVIVCAIFVASFSFWLVQNTLAENQFNQRRTI
                     ETTLMGSIISAFKTRGDNGAREILTEWKNSPVSSAVYVIQGDEKKDILNRYIDNYTIE
                     RARLFAANNPHSNLVRIEYDRFGEEYLFFIKGWDNHQAQRLPSPLFIPGLPLAPIWHE
                     FIILSFIIIVGLLMAYILAGNIAKPIRILGNGMDRVANGELETRISQQVDDRDDELSH
                     LAIQFDKMAEKLEKLVAKERYLLHHVSHEMRSPLARMQAIVGLIQAQPQKREQYLKRL
                     EGELTRMDTLAGELLTLSRLETSNMALEKESLKLLPFLGNLVEDNQSIAQKNGQTVAL
                     SADGKIPENTTILANESYLYRAFDNVIRNAVNYSPEGSTILINIGQDHKHWIIDVTDN
                     GPGVDEMQLPHIFTAFYRADSSANKPGTGLGLALTQHIIEQHCGKIIAENIKPNGLRM
                     RFILPKKKTGFKTEKSAN"
     gene            complement(180058..180735)
                     /locus_tag="NGO_RS00880"
                     /old_locus_tag="NGO0177"
                     /old_locus_tag="NGO_0177"
     CDS             complement(180058..180735)
                     /locus_tag="NGO_RS00880"
                     /old_locus_tag="NGO0177"
                     /old_locus_tag="NGO_0177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003684348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_002214312.1"
                     /translation="MSRVLLVDDDALLTELLTEYLSAEGLNVRSVPDGEAGVQEILSG
                     QYDVVVLDSMMPKMNGLDVLKNVRARSTVPIIMLTAKGDDIDRIIGLEMGADDYVPKP
                     CTPRELLARINAILRRAQHSGEQNNAPNSISVSDVVLYPAKRQASVKDMPLELTSTEF
                     NLLEVLMRHAGQVVSKETLSVEALDRKLAKFDRSIDVHISSIRHKLGDASLIQTVRGL
                     GYLFVKN"
     gene            complement(180925..182739)
                     /locus_tag="NGO_RS00885"
                     /old_locus_tag="NGO0178"
                     /old_locus_tag="NGO_0178"
     CDS             complement(180925..182739)
                     /locus_tag="NGO_RS00885"
                     /old_locus_tag="NGO0178"
                     /old_locus_tag="NGO_0178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen ligase C-terminal domain-containing
                     protein"
                     /protein_id="WP_003690624.1"
                     /translation="MSAETTVSGARPAAKLPIYILPCFLWIGIIPFTFALRLKPSPDF
                     YHDAAAAAGLIVLLFLTAGKKLFDVKIPAISFLLFAMAAFWWLQARLMNLIYPGMNDI
                     ASWVFILLAVSAWACKSLVAHYGQERIVTLFAWSLLIGSLLQSCIVVIQFAGWENTPL
                     LQNIIVHRGQGVIGHIGQRNNLGHYLMWGILASAYLNGQRKIPAALGAICLIMQTAVL
                     GLVNSRTILTYIAAIALILPFWYFRSDKSNRRTMLGIAAAVFLTALFQFSMNAILETF
                     TGIRYETAVERVANGGFTDLPRQSEWNKALAAFQSAPIFGHGWNSFAQQTFLINAEQH
                     TIHDNFLSTLFTHSHNIILQLLAEMGISGTLLVAATLLTGIAGLLKRSLTPASLFLLC
                     ALAVSMCHSMLEYPLWYVYFLIPFGLMLFLSPAEASDGIAFKKAANLGILTASAAIFA
                     GLLHLDWTYTRLVNSFSPAADDSAKTLNRKINELRYISANSPMLSFYADFSLVNFALP
                     EYPETQTWAEEATLKALKYRPYSATYRIALYLMRQGKVAEAKQWMRATQSYYPYLMPR
                     YADEIRKLPVWAPLLPELLKDCKAFAAAPGHPETKPCK"
     gene            complement(182729..183082)
                     /locus_tag="NGO_RS00890"
                     /old_locus_tag="NGO0179"
                     /old_locus_tag="NGO_0179"
     CDS             complement(182729..183082)
                     /locus_tag="NGO_RS00890"
                     /old_locus_tag="NGO0179"
                     /old_locus_tag="NGO_0179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002226594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2069 domain-containing protein"
                     /protein_id="WP_003687481.1"
                     /translation="MNRQTAYFLASFSLIALIALSLSWELWIAPLRPGGSWLALKALP
                     LCLPLSGILKKKIYTYQYSSMLVLIYFAEAVMRLFNAYPAEKICAALSAVFSIIFFIS
                     CLSFVKQYKETNNVR"
     gene            complement(183091..183699)
                     /locus_tag="NGO_RS00895"
                     /old_locus_tag="NGO0180"
                     /old_locus_tag="NGO_0180"
     CDS             complement(183091..183699)
                     /locus_tag="NGO_RS00895"
                     /old_locus_tag="NGO0180"
                     /old_locus_tag="NGO_0180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017629214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation inhibitor Maf"
                     /protein_id="WP_003690630.1"
                     /translation="MNTLYLGSGSPRRMEILTQLGYRVVKLPAGIDETVKAGETPAPY
                     VQRMAEEKNQAALTLFCETNGAMPDFPLITADTCVFSDGIILGKPRSQAEAIEFLNRL
                     SGKQHTVLTAVCIHYRGKTSSRVQTNRVVFKPLSSEEISAYVQSGEPMEKAGAYAVQG
                     IGGIFIQSIEGSFSGIMGLPVYETVSMLQDLGYRPPLSALKP"
     gene            complement(183743..184513)
                     /gene="tatC"
                     /locus_tag="NGO_RS00900"
                     /old_locus_tag="NGO0181"
                     /old_locus_tag="NGO_0181"
     CDS             complement(183743..184513)
                     /gene="tatC"
                     /locus_tag="NGO_RS00900"
                     /old_locus_tag="NGO0181"
                     /old_locus_tag="NGO_0181"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003769012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase subunit TatC"
                     /protein_id="WP_003690632.1"
                     /translation="MSETQNEQTVQPLVEHLIELRRRLMWMVVGILVCFFGMMPFAQQ
                     LYTFIADPLMANLPKDTSMIATDVIAPFFVPVKVTLMAAFLVSLPHTLYQIWAFVAPA
                     LYQNEKRLITPLVLSSVSLFFIGMAFAYFLVFPVIFKFLAGVTPVGVNMATDIDKYLS
                     FILGMFVAFGTAFEVPIVVILLTKIGAVTTEQLKHARPYVIVGAFVVAAVITPPDIIS
                     QTLLAIPLILLYEAGIWFGRFFTPRSEQDGDIQPPAKT"
     gene            complement(184526..185212)
                     /gene="tatB"
                     /locus_tag="NGO_RS00905"
                     /old_locus_tag="NGO0182"
                     /old_locus_tag="NGO_0182"
     CDS             complement(184526..185212)
                     /gene="tatB"
                     /locus_tag="NGO_RS00905"
                     /old_locus_tag="NGO0182"
                     /old_locus_tag="NGO_0182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002222848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase subunit TatB"
                     /protein_id="WP_003687486.1"
                     /translation="MFDFGLGELIFVGIIALIVLGPERLPEAARTAGRLIGRLQRFVG
                     SVKQELDTQIELEELRKVKQAFEAAAAQVRDSLKETDTDMQNSLHDISDGLKPWEKLP
                     EQRTPADFGVDENGNPLPDTANTVSDGISDVMPSERSDTSAETLGDDRQTGSTAEPAE
                     TDKDRAWREYLTASAAAPVVQAVEVSYIDTAVETPVPHTTSLRKQAINRKRDFRPKHR
                     AKPKLRVRKS"
     gene            complement(185216..185419)
                     /gene="tatA"
                     /locus_tag="NGO_RS00910"
                     /old_locus_tag="NGO0183"
                     /old_locus_tag="NGO_0183"
     CDS             complement(185216..185419)
                     /gene="tatA"
                     /locus_tag="NGO_RS00910"
                     /old_locus_tag="NGO0183"
                     /old_locus_tag="NGO_0183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase subunit
                     TatA"
                     /protein_id="WP_002214303.1"
                     /translation="MGSFSLTHWIIVLIIVVLIFGTKKLRNVGKDLGGAVHDFKQGLN
                     EGTDGKEAQKDDVIEHKKDEDKA"
     gene            complement(185466..185789)
                     /locus_tag="NGO_RS00915"
                     /old_locus_tag="NGO0184"
                     /old_locus_tag="NGO_0184"
     CDS             complement(185466..185789)
                     /locus_tag="NGO_RS00915"
                     /old_locus_tag="NGO0184"
                     /old_locus_tag="NGO_0184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine triad nucleotide-binding protein"
                     /protein_id="WP_003687490.1"
                     /translation="MDNCIFCKIAAKEIPAQTVYEDGEMVCFKDINPAAPLHLLLIPK
                     VHFDSLAHAAPEHQPLLGKMMLKVPEIAKASGLTDGFKTLINTGKGGGQEVFHLHIHI
                     MGTPV"
     gene            complement(185863..186186)
                     /locus_tag="NGO_RS00920"
                     /old_locus_tag="NGO0185"
                     /old_locus_tag="NGO_0185"
     CDS             complement(185863..186186)
                     /locus_tag="NGO_RS00920"
                     /old_locus_tag="NGO0185"
                     /old_locus_tag="NGO_0185"
                     /EC_number="3.6.1.31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP diphosphatase"
                     /protein_id="WP_003687491.1"
                     /translation="MGDSVLSAIQQTIIQRKSADPSESYVAQLLHKGEDKILKKVIEE
                     AGEVLMASKDKDPSHLVYEVADLWFHTMILLTHHDLKAEDVLDELSRRQGLSGLAEKA
                     ARTES"
     gene            complement(186327..187391)
                     /locus_tag="NGO_RS00925"
                     /old_locus_tag="NGO0186"
                     /old_locus_tag="NGO_0186"
     CDS             complement(186327..187391)
                     /locus_tag="NGO_RS00925"
                     /old_locus_tag="NGO0186"
                     /old_locus_tag="NGO_0186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-butanediol dehydrogenase"
                     /protein_id="WP_003694824.1"
                     /translation="MKAARFYNKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEF
                     MEGPIFIPPCGHPHPISGESAPVTMGHEFSGVVYAVGEGVDDIKVGQHVVVEPYIIRD
                     DVPTGEGSNYHLSKDMNFIGLGGCGGGLSEKIAVKRRWVHPISDKIPLDQAALIEPLS
                     VGHHAYVRSGAKAGDVALVGGAGPIGLLLAAVLKAKGIKVIITELSKARKDKARESGV
                     ADYILDPSEVDVVEEVKKLTNGEGVDVAFECTSVNKVLDTLVEACKPAANLVIVSIWS
                     HPATVNVHSVVMKELDVRGTIAYCNDHAETIKLVEEGKINLEPFITQRIKLDKLVSEG
                     FERLIHNNESAVKIIVNPNL"
     gene            complement(187663..188112)
                     /locus_tag="NGO_RS00930"
                     /old_locus_tag="NGO_01000"
     CDS             complement(187663..188112)
                     /locus_tag="NGO_RS00930"
                     /old_locus_tag="NGO_01000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_003705389.1"
                     /translation="MSTFFRQTAQAMTAKHIGRFPLSELDQVIDWQPIEQYLIRQKTR
                     YLRDRRGRPAHPLSSMFKAVLPGQWHSLSDPELEHSLITRIGFNLFCRFDEPGIPGCS
                     TLCRYRKFRYARAAYFGLLKVGAQSHLKAMCLNLLKAANRLSAPAAA"
     gene            complement(188256..189374)
                     /locus_tag="NGO_RS00935"
                     /old_locus_tag="NGO0187"
                     /old_locus_tag="NGO_0187"
     CDS             complement(188256..189374)
                     /locus_tag="NGO_RS00935"
                     /old_locus_tag="NGO0187"
                     /old_locus_tag="NGO_0187"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010356953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histone deacetylase family protein"
                     /protein_id="WP_010951007.1"
                     /translation="MPLTRLFLKLYALLRLFLGKNAQTAWIFHPACTGHDPGANHPDS
                     PDRILCIEQALRRAGIWQHLQTVEAEEISDTRLALVRSSKYLNRLESCLPEDGKICRL
                     DDDTVISKNSLSAARFSAGSAVQAVDMVMKRKAWHAFCAARPPEHHAKSGKAGGFCLL
                     NNVAAGVMHAIAEYRLKRIAVIDFDVHYGDGTAEIFKDDPRILFFNLFETDLFPFPEN
                     NGMPDGGNMVHLPLPSGTGSRTFREAVRRQWLPRLAAFKPELVLLSAGFDAHRLDESG
                     RLNLHEADFAWLTHKIIQTASSCPGKIVSVLEGGYTLEPLAQSAAEHIRVLAGLGKSD
                     AATAYQKTLNPTKKPFAKPKTGQVRQPTQSDRYDINAV"
     gene            189505..189771
                     /gene="yajC"
                     /locus_tag="NGO_RS00940"
                     /old_locus_tag="NGO0188"
                     /old_locus_tag="NGO_0188"
     CDS             189505..189771
                     /gene="yajC"
                     /locus_tag="NGO_RS00940"
                     /old_locus_tag="NGO0188"
                     /old_locus_tag="NGO_0188"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003678762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit YajC"
                     /protein_id="WP_003687494.1"
                     /translation="MNQAVAQFAPLVLIMVVFYFLIMRPQQKKFKAHQAMLAALKAGD
                     KVVLAAGFKGKVTRVGEQFFTVDIGQGTKIEVEVERNAIAAKVD"
     gene            189982..191835
                     /gene="secD"
                     /locus_tag="NGO_RS00945"
                     /old_locus_tag="NGO0189"
                     /old_locus_tag="NGO_0189"
     CDS             189982..191835
                     /gene="secD"
                     /locus_tag="NGO_RS00945"
                     /old_locus_tag="NGO0189"
                     /old_locus_tag="NGO_0189"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit SecD"
                     /protein_id="WP_020996774.1"
                     /translation="MNRYPLWKYLLIVFTIAVAAVYSLPNLFGETPAVQVSTNRQAII
                     INEQTQSKVDAALKNAGIQTDGMFVVDNSLKVRFKDTETQLKARDVIENTLGEGYITA
                     LNLLADSPEWMAKIKANPMFLGLDLRGGVHFTMQVDMKAAMQKTFERYSGDIRRELRR
                     EKIRSGTVRQAENSLTVPLQDAGDVQKALPQLLKLFPEATLNSEGSNIVLTLSEEAVN
                     KVRSDAVKQNITTLHNRVNELGVAEPIIQQSGLDRIVVQLPGVQDTAKAKDIIGRTAT
                     LEVRMVEDDPAKLREALEGNVPSGYELLSSGGEHPETLLISKQVELTGDNINDAQPSF
                     DQMGAPAVSLSLDSAGGSIFGELTAANVGKRMAMVLIDQGKSEVVTAPVIRTAITGGR
                     VEISGSMTTAEANDTSLLLRAGSLAAPMQIVEERTIGPSLGKENIEKGFHSTLWGFAI
                     VAAFMVVYYRLMGFFSTIALSANILFLIGILSAMQATLTLPGMAALALTLGMAIDSNV
                     LINERIREELRAGVPPQQAINLGFQHAWATIVDSNLTSLIAGIALLVFGSGPVRGFAV
                     VHCLGILTSMYSSVVVFRALVNLWYGRRRKLQNISIGAVWKPEAETAAGKE"
     gene            191839..192774
                     /gene="secF"
                     /locus_tag="NGO_RS00950"
                     /old_locus_tag="NGO0190"
                     /old_locus_tag="NGO_0190"
     CDS             191839..192774
                     /gene="secF"
                     /locus_tag="NGO_RS00950"
                     /old_locus_tag="NGO0190"
                     /old_locus_tag="NGO_0190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit SecF"
                     /protein_id="WP_003687497.1"
                     /translation="MELFKIKRDIPFMSYGKLTTFISLVTFIAAVFFLVARGLNFSVE
                     FTGGTVMEVQYQQGADVNKMRERLDTLKMGDVQVQALGTNKHIMIRLPNKEGVTSAQL
                     SNQVMDLLKKDSPDVTLRQVEFIGPQVGEELVNNGLMALGFVVIGIIIYLSMRFEWRF
                     AVSAIIANMHDIVIILGCFAFFQWEFSLTVLAGILAVLGYSVNESVVVFDRIRENFRK
                     PAMRGHTVPEVIDNAITATMSRTIITHGSTEAMVVSMLVFGGAALHGFSMALTIGIVF
                     GIYSSVLVASPLLLMFGLSRDNIAKEAKQKEEIVV"
     gene            192979..193248
                     /gene="rpsO"
                     /locus_tag="NGO_RS00955"
                     /old_locus_tag="NGO0191"
                     /old_locus_tag="NGO_0191"
     CDS             192979..193248
                     /gene="rpsO"
                     /locus_tag="NGO_RS00955"
                     /old_locus_tag="NGO0191"
                     /old_locus_tag="NGO_0191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019958878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_002217790.1"
                     /translation="MALTVEQKAQIVKDFQRKEGDTGSSEVQVALLTFRINDLTPHFK
                     ANPKDHHSRRGLLKMVSQRRRLLAYLRRTQPDTYRALITRLGLRK"
     gene            193526..194650
                     /gene="potA"
                     /locus_tag="NGO_RS00960"
                     /old_locus_tag="NGO0192"
                     /old_locus_tag="NGO_0192"
     CDS             193526..194650
                     /gene="potA"
                     /locus_tag="NGO_RS00960"
                     /old_locus_tag="NGO0192"
                     /old_locus_tag="NGO_0192"
                     /EC_number="7.6.2.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002256447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter ATP-binding protein"
                     /protein_id="WP_010356995.1"
                     /translation="MTATTASSAKPYLQIQGLVKKFGDNYAVDNIDLDIYQNEIFALL
                     GSSGSGKSTLLRMLAGMESPNQGKIILDGQDITKLAPYDRPINMMFQSYALFPHMTVE
                     QNIAFGLKQDKMPKGEIDARVEEMLRLVQMTKFAKRKPHQLSGGQQQRIALARSLAKR
                     PKILLLDEPLGALDKKLRQQTQLELVNTLEQVGVTCIMVTHDQEEAMTMATRIAIMSD
                     GQLQQVGTPSDVYDYPNSRFTAEFIGETNIFDGVVIENHADYAVIECEGLENHVRIDH
                     GLGGPSEQDLWVSIRPEDIDLYKEKPEYLGDYNWAKGTVKEIAYLGSFAIYHIKLANG
                     RVVKSQVPAPYWYVRNITPPTWDETVYISWPENQPTPLFR"
     gene            194666..194809
                     /locus_tag="NGO_RS00965"
                     /old_locus_tag="NGO_01035"
     CDS             194666..194809
                     /locus_tag="NGO_RS00965"
                     /old_locus_tag="NGO_01035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003690690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003690690.1"
                     /translation="MNLNKLKNKLFRRPGQRAVIAVPYMPPTWDETVYISWPENQPTP
                     LFR"
     gene            194825..194968
                     /locus_tag="NGO_RS00970"
                     /old_locus_tag="NGO_01040"
     CDS             194825..194968
                     /locus_tag="NGO_RS00970"
                     /old_locus_tag="NGO_01040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003690690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003690690.1"
                     /translation="MNLNKLKNKLFRRPGQRAVIAVPYMPPTWDETVYISWPENQPTP
                     LFR"
     gene            194984..195949
                     /locus_tag="NGO_RS00975"
                     /old_locus_tag="NGO0195"
                     /old_locus_tag="NGO_0195"
     CDS             194984..195949
                     /locus_tag="NGO_RS00975"
                     /old_locus_tag="NGO0195"
                     /old_locus_tag="NGO_0195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003713503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease subunit"
                     /protein_id="WP_003690691.1"
                     /translation="MNLNKLKNKLFRRPGQRAVIAVPYIWLLVLFLIPFAIVLKISFA
                     EQEIAIPPFTPLTTIDEDLGRLNIAVSYQNYADIFQNFWHTLNPFGDSENSNIYLMTY
                     WSSIKTALTTTVICLLVGYPTAYAISRANPSVRNGLLLAIMLPFWTSFLLRVYAWMGL
                     LGHNGIINNLLIKMGIIREPLDLFYNAFSLNLVMVYAYLPFMILPLYTQLVKLDSRLL
                     EAASDLGAGPVKSFLTITLPLSKTGIIAGSMLVFVPAVGEFVIPELVGGSENLMIGKV
                     LWQAFFDQNNWPLASAVAVVMVALLVVPIALFQHYENRELEEGAK"
     gene            195949..196836
                     /locus_tag="NGO_RS00980"
                     /old_locus_tag="NGO0196"
                     /old_locus_tag="NGO_0196"
     CDS             195949..196836
                     /locus_tag="NGO_RS00980"
                     /old_locus_tag="NGO0196"
                     /old_locus_tag="NGO_0196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003675707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease subunit"
                     /protein_id="WP_003687503.1"
                     /translation="MQKSKLSWFLKLMLALSLAFLYIPLVVLVIYSFNESKLVTVWGG
                     FSTKWYGALLENDTILEAAWLSLRIAVVSSLAAVVLGTLAGYAMARIKRFRGSTLFAG
                     MISAPMVMPDVITGLSMLLLIIQVQIFLQGSEWLQHLYFDRGFFTIFLGHTTLCMAYI
                     TVVIRSRLVELDQSLEEAAMDLGARPLKIFFVITLPLIAPAIASGFLLGITLSLDDLV
                     ITSFLSGPGSSTLPQVIFSKIKLGLDPQMNVLATILIGIIGTLVIIVNYWMMRQATKR
                     NREAAEAYRQEKLAAEKAN"
     gene            196963..198258
                     /locus_tag="NGO_RS00985"
                     /old_locus_tag="NGO0197"
                     /old_locus_tag="NGO_0197"
     CDS             196963..198258
                     /locus_tag="NGO_RS00985"
                     /old_locus_tag="NGO0197"
                     /old_locus_tag="NGO_0197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002251145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding oxidoreductase"
                     /protein_id="WP_003687505.1"
                     /translation="MIRPDFQEYLPSYYFSSVNPHTVYPKLQCRLKAETCIIGGGLSG
                     LCTALPLAEHGHEAVVLEAARIGFGASGRSGGQVISDYACGMGEIEKQVGLEQAQWFW
                     QQSLQAVELVDERVRKHAIDCDWQRGYATVAVRPQHWEELQQWHEHAQRHYGASHYQL
                     WDKAELKQQLDSDMYQGAQFDPLSGHLHPLNYTLGVASAAAEAGAQIFEQSPMTRIEP
                     YQNGWLVYTPEGSVECKNVVYAVNTYVGLNPIFRPLERKAIAVSTFIIATEPLGARTK
                     GLIRNNMAVCDNRHILDYYRLSADGRLLFGGKDNEFIDNPARMTELVRQDMLKVFPQL
                     ADVRIEYSWGGECDITANLVPHFGRLTSNVFYTQGYSGHGMAITGIAGLAVAEAILGD
                     ECRLKPFEQLCQPNIILQPFLRKLGSFLGSKYYQWKDSR"
     gene            complement(198352..199656)
                     /locus_tag="NGO_RS00990"
                     /old_locus_tag="NGO0198"
                     /old_locus_tag="NGO_0198"
     CDS             complement(198352..199656)
                     /locus_tag="NGO_RS00990"
                     /old_locus_tag="NGO0198"
                     /old_locus_tag="NGO_0198"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="WP_003687507.1"
                     /translation="MKKHIWAASLLPASLSAEPLNWWKPYSAVNSGDTAWVMTAAALV
                     LLMTLPGLALFYGGMVRKKNLLSTMMHSFSIATLVGILWVAVGYSLAFTPGNAFIGGL
                     GRVFLSGMQIDAAARMLTVSPNAPTVPEPVFMFFQMTFAIISTAIITGAFAERMKYSA
                     MMLFSGIWFLLVYVPGAHWVWGGGFMSKGGVLDYAGGTVVHINAGIAGLVAALVLGRR
                     IGYGREAMPPHNMAMTLIGAAMLWFGWFGFNAGSALAADAAAGMAMAVTQVSAVFGAA
                     GWLACEKIAGHKPSALGLASGAVSGLVGITPAAGFTGPSGAAAIGILTAAACFVSVTV
                     VKHKLRYDDSLDAFGIHGFGGLVGGILTGIFFDNRIFGGDAAVWQQLWIQVKDGFIMA
                     AYSGLMSWAILKAVGKICGGLRVGKDVEREGLDLNIHGEHVE"
     gene            complement(200272..201531)
                     /gene="rho"
                     /locus_tag="NGO_RS00995"
                     /old_locus_tag="NGO0199"
                     /old_locus_tag="NGO_0199"
     CDS             complement(200272..201531)
                     /gene="rho"
                     /locus_tag="NGO_RS00995"
                     /old_locus_tag="NGO0199"
                     /old_locus_tag="NGO_0199"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003823056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="WP_003687508.1"
                     /translation="MHVSELQTLHISKLLELAEEHGIENANRFRKQDLVFAIVRQMMK
                     KGEGFTCSGTLEILPDGFGFLRSADTSYLAGPDDIYVSPTQIRRFNLHTGDTIEGSVR
                     VPKDNERYFALVRLDSINGDHPEVCRHKILFENLTPLFPTEQLKLERDLKSEENLTGR
                     AIDLISPIGKGQRALLVAPPKIGKTVMLQNIAHAVTANYPEVELIVLLIDERPEEVTE
                     MSRSVRGEVVSSTFDEPAQRHVQVAEMVLEKAKRMVEHKKDVVILLDSITRLARAYNT
                     VVPASGKILTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVETGSRMDDVIYEE
                     FKGTGNMELHLDRRMAEKRLFPAININKSGTRREELLVPNDQLQRMWLLRKFLHPMDE
                     IEATEFLNGKIKASKNNDDFFELMRGK"
     gene            complement(201752..204136)
                     /gene="ppsA"
                     /locus_tag="NGO_RS01000"
                     /old_locus_tag="NGO0200"
                     /old_locus_tag="NGO_0200"
     CDS             complement(201752..204136)
                     /gene="ppsA"
                     /locus_tag="NGO_RS01000"
                     /old_locus_tag="NGO0200"
                     /old_locus_tag="NGO_0200"
                     /EC_number="2.7.9.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003753989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate synthase"
                     /protein_id="WP_010951009.1"
                     /translation="MADNYVIWFENLRMTDVERVGGKNASLGEMISQLTEKGVRVPGG
                     FATTADAYRAFLAHNGLNERISAALAKLDVEDVSELARVGKEIRQWILDTPFPEQLDA
                     EIEAAWNKMITDADGADISVAVRSSATAEDLPDASFAGQQETFLNINGLDNVKKAMRH
                     VFASLYNDRAISYRVHKGFEHDIVALSAGVQRMVRSDSGASGVMFTLDTESGYNQVVF
                     VTSSYGLGENVVQGAVNPDEFYVFKPTLKAGKPAILRKTMGSKHIKMIFTDKAEAGKS
                     VTNVEVPEEDRNRFSITDEEITELAHYALTIEKHYGRPMDIEWGRDGLDGKLYILQAR
                     PETVKSQEEGSRNLRRYAINGEKTVLCEGRAIGQKVGQGKVRLIKDASEMDSVEAGDV
                     LVTDMTDPDWEPVMKRASAIVTNRGGRTCHAAIIARELGIPAVVGCGNATELLENGQE
                     VTVSCAEGDTGFIYAGLLDVQITDVALDNMPKAPVKVMMNVGNPELAFSFANLPSEGI
                     GLARMEFIINRQIGIHPKALLEFDKQDDELKAEIIRRIAGYASPVDFYVDKIAEGVAT
                     LAASVYPRKTIVRMSDFKSNEYANLVGGSVYEPHEENPMLGFRGAARYVAESFKDCFA
                     LECKALKRVRDEMGLTNVEIMIPFVRTLGEAEAVVKALKENGLERGKNGLRLIMMCEL
                     PSNAVLAEQFLQYFDGFSIGSNDMTQLTLGLDRDSGLVSESFDERNPAVKVMLHLAIS
                     ACRKQNKYVGICGQGPSDHPDFAKWLVGEGIESVSLNPDTVIETWLYLANELNK"
     gene            204491..205144
                     /locus_tag="NGO_RS01005"
                     /old_locus_tag="NGO0201"
                     /old_locus_tag="NGO_0201"
     CDS             204491..205144
                     /locus_tag="NGO_RS01005"
                     /old_locus_tag="NGO0201"
                     /old_locus_tag="NGO_0201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1595 family transposase"
                     /protein_id="WP_010951010.1"
                     /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFY
                     RKIRTVANHRLALAADEVFEGPAGPGASCFGVRRKGRRGRGAAGKAVVFGIPKRNGRA
                     YTVAADDAEPETLPPAVKKKIMPDGIVYADSPGSRGKSDAGGFTRCRINRSKEFADRR
                     NHINGIGNFWNQAKRALRKYNGIDRKPFPPFLRECEFRLNFGTPSRQLKILRDRCGI"
     gene            205270..206091
                     /locus_tag="NGO_RS01010"
                     /old_locus_tag="NGO0202"
                     /old_locus_tag="NGO_0202"
     CDS             205270..206091
                     /locus_tag="NGO_RS01010"
                     /old_locus_tag="NGO0202"
                     /old_locus_tag="NGO_0202"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="kinase/pyrophosphorylase"
                     /protein_id="WP_003687512.1"
                     /translation="MSSPRQVFYISDRTGLTAENIGEALLNQFGNLSFKRHTHPFVDT
                     PEKARAVVEKVNRSRQENGQRPIAFVSVVDDEIRRIIKGADAFQINFFETFLGLLEKE
                     LNTEATVSGQGHHSIGNTKRYDARMEAVNFSLNHDDGVSDKNLQEADVILMGVSRSGK
                     TPTCLYLALQYGIRAANYPLIPDDLESADLPRMVKPYKDKLFGLTIQPERLQAIRQER
                     RPNSAYARIDTCRSEVADAQSMFRRHGIPFANTTDKSVEELAVHILQACKLKRRF"
     gene            complement(206177..206839)
                     /locus_tag="NGO_RS01015"
                     /old_locus_tag="NGO0203"
                     /old_locus_tag="NGO_0203"
     CDS             complement(206177..206839)
                     /locus_tag="NGO_RS01015"
                     /old_locus_tag="NGO0203"
                     /old_locus_tag="NGO_0203"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002238862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_003687514.1"
                     /translation="MIQAVLFDLDGTLADTALDLGGALNTQLARHGLPEKSMDEIRTQ
                     ASHGAAGLLKLGANITPEHPDYTAWRTEYLEEYDSRYAQDTTLFDGVNELIAELDRRG
                     IKWGIITNKPMRFTDKLVPKLGFAVPPATVVSGDTCGEPKPSIKPMLHACGKIHADPQ
                     HTLYVGDAERDIQAGRNAGMKTVLAEWGYISDEDDTGSWQADFHIRTPLDLLECLDKI
                     QP"
     gene            complement(206877..207704)
                     /locus_tag="NGO_RS01020"
                     /old_locus_tag="NGO0204"
                     /old_locus_tag="NGO_0204"
     CDS             complement(206877..207704)
                     /locus_tag="NGO_RS01020"
                     /old_locus_tag="NGO0204"
                     /old_locus_tag="NGO_0204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003713490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin-like domain-containing protein"
                     /protein_id="WP_010951011.1"
                     /translation="MNPDIYALPERALLSGDPDEKGRLTDEAFAAVQNADGAEANAPP
                     ADFPRAGRPDTPVLVAPSQLTPRKMNTAEGYAAMLHAITHIEFNAVNLALDAAYRFRT
                     LPFQFVRDWVKVAKEEVYHFRLVRDRLRAFGFDYGSFEAHNHLWDMAYKTAYDPLLRM
                     ALVPRVLEARGLDVMPGIRAKVEQRGDSATCGVLDIIYRDEVGHVAIGNRWYQHLCRE
                     RGLEPVALFRSLIARYDMFIFRGYVNIEAREKAGFSRFELDMLEDFEQGLKQNKHAV"
     gene            208087..208710
                     /gene="lolA"
                     /locus_tag="NGO_RS01025"
                     /old_locus_tag="NGO0205"
                     /old_locus_tag="NGO_0205"
     CDS             208087..208710
                     /gene="lolA"
                     /locus_tag="NGO_RS01025"
                     /old_locus_tag="NGO0205"
                     /old_locus_tag="NGO_0205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016686633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein chaperone LolA"
                     /protein_id="WP_003702312.1"
                     /translation="MMKPHNLFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGS
                     FTQTVQSKKKTQTAHGTFKILRPGLFKWEYTLPYRQTIVGDGQTVWLYDVDLAQVTKS
                     SQDQAIGGSPAAILSNKTALESSYTLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKG
                     GNLAAMQLKDSFGNQTSISFGGLNTNPQLSRGAFKFTPPKGVDVLSN"
     gene            208983..210119
                     /locus_tag="NGO_RS01030"
                     /old_locus_tag="NGO0206"
                     /old_locus_tag="NGO_0206"
     CDS             208983..210119
                     /locus_tag="NGO_RS01030"
                     /old_locus_tag="NGO0206"
                     /old_locus_tag="NGO_0206"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003709746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_010951012.1"
                     /translation="MKKTLVAAILSLALTACGGGSDTAAQTPSAKPEAEQSGKLNIYN
                     WSDYVDPETVAAFEKETGIKMRSDYYDSNETLEAKVLTGKSGYDLTAPSIANVGRQIK
                     AGAYQKIDKAQIPHYGNIDKDLLKMMEAVDPGNEYAVPYFWGINTLAINTRQVQKALG
                     TDKLPENEWDLVFKPEYTAKLKSCGISYFDSAIEQIPLALHYLGKDPNSENPEDIKAA
                     VDMMKAVRGDVKRFSSSGYIDDMAAGNLCAAIGYGGDLNIAKTRAEEAANGVEIKVLT
                     PKTGVGVWVDSFMIPRDAQNVANAHRYIDYTLRPEVAAKNGSFVTYAPASRPARELMD
                     EKYTSDASIFPTKELMEKSFIVSPKSAESVKLGVKLWQGLKAGK"
     gene            210214..211197
                     /gene="pglE"
                     /locus_tag="NGO_RS01035"
                     /old_locus_tag="NGO0207"
                     /old_locus_tag="NGO_0207"
     CDS             210214..211197
                     /gene="pglE"
                     /locus_tag="NGO_RS01035"
                     /old_locus_tag="NGO0207"
                     /old_locus_tag="NGO_0207"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003704837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(galactosaminyl)2-N,
                     N'-diacetylbacillosaminyl-alpha1-diphospho-di-trans,
                     octa-cis-undecaprenol synthase PglE"
                     /protein_id="WP_003704837.1"
                     /translation="MNLSIVVPIYNVESYLEACLNSIEPILSNENVELILVNDGSKDG
                     SEDICYKYIDKISNTKHQTPNTKYIYQDNQGLSEARNTGIKNSNGKYIAFIDSDDFIN
                     CQVLLDFLGKDDSDMPDVVFLNAVKYDKGRVSYFGEDYQPEKILNQSKVEVLKGLCRF
                     RKFPGSAWNKIIKRELIIREKLFFEKGIYSEDIEWSMRLFNAATTFSYLDGCYYYYRQ
                     GRKDSITGTVSEKGIKSLLYILEKNAKMEFNRDISSYLYSFLSYEYLVLLFIMTSKNI
                     ACDSDIKRRAYHLRFMLLKSNKLIYKLIFPIITLFGVDITGRILKAIRGNI"
     gene            211238..211768
                     /locus_tag="NGO_RS01040"
                     /old_locus_tag="NGO0208"
                     /old_locus_tag="NGO_0208"
     CDS             211238..211768
                     /locus_tag="NGO_RS01040"
                     /old_locus_tag="NGO0208"
                     /old_locus_tag="NGO_0208"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma carbonic anhydrase family protein"
                     /protein_id="WP_003687524.1"
                     /translation="MNAIRTFQNRTPEIHETCMIDEACVVIGEVSLAEDVSVWPCAVL
                     RGDVNSITVGARSNIQDGSVLHVSHKTAAKPEGSPLVIGEDVTVGHKVMLHGCRIGNR
                     VLVGMGSTVLDDAVIEDDVMIGAGSLVPPRKRLEGGYLYIGSPVRQVRLLTDEEKAFL
                     KYSAAHYVKLSKQYGM"
     gene            complement(211936..213531)
                     /locus_tag="NGO_RS01045"
                     /old_locus_tag="NGO0209"
                     /old_locus_tag="NGO_0209"
     CDS             complement(211936..213531)
                     /locus_tag="NGO_RS01045"
                     /old_locus_tag="NGO0209"
                     /old_locus_tag="NGO_0209"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007342770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="WP_003704835.1"
                     /translation="MSQEILDQVRRRRTFAIISHPDAGKTTLTEKLLLFSGAIQSAGT
                     VKGKKTGKFATSDWMDIEKQRGISVASSVMQFDYKDHTVNLLDTPGHQDFSEDTYRVL
                     TAVDSALMVIDAAKGVEAQTIKLLNVCRLRDTPIVTFMNKYDREVRDSLELLDEVEDI
                     LQIRCAPVTWPIGMGKNFKGVYHILNDEIYLFEAGGERLPHEFDIIKGINNPELEQRF
                     PLEIQQLRDEIELVQAASNEFNLDEFLAGELTPVFFGSAINNFGIQEILNSLIDWAPA
                     PKPRDATMRMVGPDEPKFSGFIFKIQANMDPKHRDRIAFLRVCSGKFERGMKMKHLRI
                     NREIAASSVVTFMSHDRELAEEAYAGDIIGIPNHGNIQIGDSFSEGEQLAFTGIPFFA
                     PELFRSVRIKNPLKIKQLQKGLQQLGEEGAVQVFKPMSGADLILGAVGVLQFEVVTSR
                     LANEYGVEAVFDSASIWSARWVSCDDKKKLAEFEKANAGNLAIDAGGNLAYLAPNRVN
                     LGLTQERWPDIVFHETREHSVKL"
     gene            complement(213638..214033)
                     /gene="hisI"
                     /locus_tag="NGO_RS01050"
                     /old_locus_tag="NGO0210"
                     /old_locus_tag="NGO_0210"
     CDS             complement(213638..214033)
                     /gene="hisI"
                     /locus_tag="NGO_RS01050"
                     /old_locus_tag="NGO0210"
                     /old_locus_tag="NGO_0210"
                     /EC_number="3.5.4.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002225530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-AMP cyclohydrolase"
                     /protein_id="WP_003687532.1"
                     /translation="MDKNLLEAVKFDEKGLVCAIAQDAETKRVLMVAWMNAEALQKTV
                     ETGFAHYYSRSRQKQWMKGEESGHTQKVRELRLDCDGDTIVMLIAQNGGIACHTGRES
                     CFYKKWNGGAWETADAVLKDEKEIYGSTH"
     gene            complement(214064..214831)
                     /gene="hisF"
                     /locus_tag="NGO_RS01055"
                     /old_locus_tag="NGO0211"
                     /old_locus_tag="NGO_0211"
     CDS             complement(214064..214831)
                     /gene="hisF"
                     /locus_tag="NGO_RS01055"
                     /old_locus_tag="NGO0211"
                     /old_locus_tag="NGO_0211"
                     /EC_number="4.1.3.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002251159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     HisF"
                     /protein_id="WP_003690707.1"
                     /translation="MALAKRIIPCLDVKDGRVVKGVNFIGLRDAGDPVEAAKRYNGEG
                     ADELTFLDITASSDNRDTILHIIEEVAGQVFIPLTVGGGVRTVADIRRLLNAGADKVS
                     INTAAVTRPDLINEAAGFFGSQAIVAAVDAKAVNPENTRWEIFTHGGRNPTGLDAVEW
                     AVEMQKRGAGEILLTGMDRDGTKQGFNLPLTRAVAEAVDIPVIASGGVGNVRHLIEGI
                     TEGKADAVLAAGIFHFGEIAIREAKRTMREAGIEVRL"
     gene            complement(214844..215581)
                     /gene="hisA"
                     /locus_tag="NGO_RS01060"
                     /old_locus_tag="NGO0212"
                     /old_locus_tag="NGO_0212"
     CDS             complement(214844..215581)
                     /gene="hisA"
                     /locus_tag="NGO_RS01060"
                     /old_locus_tag="NGO0212"
                     /old_locus_tag="NGO_0212"
                     /EC_number="5.3.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003754010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]imidazole-4-
                     carboxamide isomerase"
                     /protein_id="WP_003687535.1"
                     /translation="MLLIPAIDLKEGRCVRLKQGLMEEATVFSDSPADTALHWFEQGA
                     RRLHLVDLNGAFAGVPQNLPAIKDILAAVAKDIPVQLGGGMRDLKTIGQYLDLGLNDV
                     IIGTAAVKNPDLVREACKAFPGRIIVGLDAKDGMAAIDGWATVTGHHVIDLAKRFEDD
                     GVNSIIYTDIGRDGMMSGVNIDATVKLAQSVRIPVIASGGLTGLDDIRALCAAEKHGV
                     AGAITGRAIYEGSIDFAQAQQLADSLD"
     gene            complement(215614..216252)
                     /gene="hisH"
                     /locus_tag="NGO_RS01065"
                     /old_locus_tag="NGO0213"
                     /old_locus_tag="NGO_0213"
     CDS             complement(215614..216252)
                     /gene="hisH"
                     /locus_tag="NGO_RS01065"
                     /old_locus_tag="NGO0213"
                     /old_locus_tag="NGO_0213"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003754012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH"
                     /protein_id="WP_003687537.1"
                     /translation="MQTAIIDYGMGNLHSVLKSVRTAGQLAGKNTKIFLSGDPDRVSR
                     ADKVIFPGQGAMPDCMAALTRGGLDEAVKDALKNKPFFGICVGAQLLFDHSEEGNTDG
                     LGWFGGKVRRFARDLRDPQGCRLKVPHMGWNTVRQTQNHPLFQGIPQNTRFYFVHSYY
                     FAPENPETILGESDYPSPFACIVGKDNVFATQFHTEKSHDAGLTMLKNFLNW"
     gene            complement(216382..217884)
                     /gene="pta"
                     /locus_tag="NGO_RS01070"
                     /old_locus_tag="NGO0214"
                     /old_locus_tag="NGO_0214"
     CDS             complement(216382..217884)
                     /gene="pta"
                     /locus_tag="NGO_RS01070"
                     /old_locus_tag="NGO0214"
                     /old_locus_tag="NGO_0214"
                     /EC_number="2.3.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003709725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate acetyltransferase"
                     /protein_id="WP_010357022.1"
                     /translation="MAKVLVVPVSAGLNTSAAAQAFAKALDAQVFQAVDATAETLLAQ
                     GKSDDWFDALVGKVAALDAANLVIEGIAPDADKIYLAGKNVELALSLDAAAVFAVRSD
                     NTDADALAHQLNLAKQFFAAAPGVLEGFVVDGAAASVAEAAAEKTGLTFFGSSDALKD
                     VSVLAGREAKRLSPAQFRYNLIDFARQAGKRIVLPEGAEPRTVQAAAICHEKGIARCV
                     LLAKREEVEAVAKERGISLPDSLEIIDPASLVEQYVEPMCELRKSKGLTPEDARKQLQ
                     DTVVLGTMMMAQNDVDGLVSGAVHTTANTIRPALQLIKTAPGASLVSSVFFMLLPNQV
                     LVFGDCAVNPNPTAQQLADIAIQSADSAKAFGIDPKVAMISYSTVNSGSGPDVDTVIE
                     ATKLAREKRPDLAIDGPLQYDAATVPGVGKSKAPGSPVAGQATVLVFPDLNTGNCTYK
                     AVQRSANVLSVGPLLQGLRKPVNDLSRGALVEDIVFTIALTAVQAKQMEG"
     gene            complement(218069..219127)
                     /locus_tag="NGO_RS01075"
                     /old_locus_tag="NGO0215"
                     /old_locus_tag="NGO_0215"
     CDS             complement(218069..219127)
                     /locus_tag="NGO_RS01075"
                     /old_locus_tag="NGO0215"
                     /old_locus_tag="NGO_0215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_003687540.1"
                     /translation="MTAALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKT
                     TLLRCLAGFEQPDSGEISLSGKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIA
                     YGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGQQQRVALARALAPDPELI
                     LLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRIL
                     QTASPHELYRQPADLDAALFIGEGIVFPAALNADGTADCRLGRLPVQSGAPAGTRGTL
                     LIRPEQFSLHPHSAPAASIHAVVLKTTPKARHTEISLRAGQTVLTLNLPSAPTLSDGI
                     SAVLHLDGPALFFPGNTL"
     gene            complement(219148..220665)
                     /locus_tag="NGO_RS01080"
                     /old_locus_tag="NGO0216"
                     /old_locus_tag="NGO_0216"
     CDS             complement(219148..220665)
                     /locus_tag="NGO_RS01080"
                     /old_locus_tag="NGO0216"
                     /old_locus_tag="NGO_0216"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_025456388.1"
                     /translation="MSPKKIPIWLTGLILLIALPLTLPFLYVAMRSWQVGINRAVELL
                     FRPRMWDLLSNTLTMMAGVTLISIVLGIACALLFQRYRFFGKTFFQTAITLPLCIPAF
                     VSCFTWISLTFRVEGFWGTVMIMSLSSFPLAYLPVEAALKRISLSYEEVSLSLGKSRL
                     QTFFSAILPQLKPAIGSSVLLIALHMLVEFGAVSILNYPTFTTAIFQEYEMSYNNNTA
                     ALLSAVLTAVCGIVVFGESIFRGKAKIYHSGKGVARPYPVKTLKLPGQIGAIVFLSSL
                     LILGIIIPFGVLIHWMMVGTSGTFALVSVFDAFIRSLSVSALGAILTILCALPLVWAS
                     VRYRNFLTVWIDRLPFLLHAVPGLVIALSLVYFSINYTPAVYQTFIVVILAYFMLYLP
                     MAQTTLRTSLEQLPKGMEQVGATLGRGHFFIFRTLVLPSILPGITAAFALVFLKLMKE
                     LTATLLLTADDVHTLSTAVWEYTSDAQYAAATPYALMLVLFSGIPVFLLKKYAFK"
     gene            complement(220733..221728)
                     /locus_tag="NGO_RS01085"
                     /old_locus_tag="NGO0217"
                     /old_locus_tag="NGO_0217"
     CDS             complement(220733..221728)
                     /locus_tag="NGO_RS01085"
                     /old_locus_tag="NGO0217"
                     /old_locus_tag="NGO_0217"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019271780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_003687545.1"
                     /translation="MKTSIRYALLAAALTAATPALADITVYNGQHKEAAQAVADAFTR
                     ATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPALATLSAANLLEPLPASTIN
                     ETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSVLNYATPKWKNRIGYVPT
                     SGAFLEQIVAIVKLKGEAAALKWLKGLKEYGKPYAKNSVALQAVENGEIDAALINNYY
                     WHAFAREKGVQNVHTRLNFVRHRDPGALVTYSGAAVLKSSQNKDEAKKFVAFLAGKEG
                     QRALTAVRAEYPLNPHVVSTFNLEPIAKLEAPQVSATTVSEKEHATRLLEQAGMK"
     gene            complement(222119..222460)
                     /locus_tag="NGO_RS01090"
                     /old_locus_tag="NGO0218"
                     /old_locus_tag="NGO_0218"
     CDS             complement(222119..222460)
                     /locus_tag="NGO_RS01090"
                     /old_locus_tag="NGO0218"
                     /old_locus_tag="NGO_0218"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010357028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4375 domain-containing protein"
                     /protein_id="WP_003690711.1"
                     /translation="MTDTDTQADRFEQMMRQAVDKLFEQHDGKLESMDGREQELVLIW
                     RAEADIGNGGILQFVCNWGFPAAEKTCSVLKKIGAVHSAMLIHRAADALGKEIRHLQS
                     EGKNLKEMWDI"
     gene            complement(222518..223894)
                     /gene="argH"
                     /locus_tag="NGO_RS01095"
                     /old_locus_tag="NGO0219"
                     /old_locus_tag="NGO_0219"
     CDS             complement(222518..223894)
                     /gene="argH"
                     /locus_tag="NGO_RS01095"
                     /old_locus_tag="NGO0219"
                     /old_locus_tag="NGO_0219"
                     /EC_number="4.3.2.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002241261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate lyase"
                     /protein_id="WP_003704829.1"
                     /translation="MHDKTWSGRFNEPVSELVKQYTASIGFDQRLAEWDIQGSLAHAQ
                     MLTRSGVLSENDLTDIRRGMSEILEEIRSGKIEWPLDLEDVHMNIERRLTDKIGDAGK
                     RLHTGRSRNDQVATDIRLWLRDQITVIQNLIQNLQTALLDLAEQNAEAVMPGFTHLQV
                     AQPVSFGHHMLAYVEMLGRDFERMTDCRKRVNRMPLGAAALAGTTYPIQREITAELLG
                     FEQICQNSLDAVSDRDFAIEFTAAASLVMVHLSRLSEELILWMSPRFGFIDIADRFCT
                     GSSIMPQKKNPDVPELVRGKSGRVIGHLIGLITLMKSQPLAYNKDNQEDKEPLFDTAD
                     TLIDTLRIYADMMRGVTVKPGNMRAAVMQGFATATDLADYLVKKGMPFRDAHEVVAQA
                     VRHADEAGVDLSELPLEALQGFSKLISDDVYGVLTPEGSLNARNHLGGTAPEQVRLQV
                     KRWREMSA"
     gene            complement(223913..224782)
                     /gene="galU"
                     /locus_tag="NGO_RS01100"
                     /old_locus_tag="NGO0220"
                     /old_locus_tag="NGO_0220"
     CDS             complement(223913..224782)
                     /gene="galU"
                     /locus_tag="NGO_RS01100"
                     /old_locus_tag="NGO0220"
                     /old_locus_tag="NGO_0220"
                     /EC_number="2.7.7.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003713464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase
                     GalU"
                     /protein_id="WP_003687550.1"
                     /translation="MKPIKKAVFPVAGMGTRFLPATKANPKEMLPIVDKPLIQYAVEE
                     AVEAGCTEMVFVTGRNKRSIEDHFDKAYELETKLEMRHKDKLLEHVRNILPPNITCLY
                     IRQAEALGLGHAVLCARAAIGDEPFAVILADDLIDAPKGALKQMVEVYGRSGNSILGV
                     ETVEPSQTGSYGIVETEQLKQFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLT
                     GLPRGAGNEIQLTDGIAKLLDHEFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETG
                     EPFRRLLEKYRTE"
     gene            complement(224810..225409)
                     /gene="rdgB"
                     /locus_tag="NGO_RS01105"
                     /old_locus_tag="NGO0221"
                     /old_locus_tag="NGO_0221"
     CDS             complement(224810..225409)
                     /gene="rdgB"
                     /locus_tag="NGO_RS01105"
                     /old_locus_tag="NGO0221"
                     /old_locus_tag="NGO_0221"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RdgB/HAM1 family non-canonical purine NTP
                     pyrophosphatase"
                     /protein_id="WP_003687551.1"
                     /translation="MSEKPEKIVLASGNAGKLKEFGNLFKPYGITVLPQSAFGIPECP
                     EPYPTFVENALAKARHAAGHSGLPALADDSGICAAALNGAPGIHSARYAGSNPKSDTA
                     NNLKLAAELAGKADKSCSYVCVLVFVRHKDDPRPIIAEGIWHGQWHDTPLGQNGFGYD
                     PYFYLPEHGKTAAELDSEVKNRESHRAQALADLIRKLAL"
     gene            complement(225402..225635)
                     /locus_tag="NGO_RS01110"
                     /old_locus_tag="NGO0222"
                     /old_locus_tag="NGO_0222"
     CDS             complement(225402..225635)
                     /locus_tag="NGO_RS01110"
                     /old_locus_tag="NGO0222"
                     /old_locus_tag="NGO_0222"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003704827.1"
                     /translation="MNRRKIYLLSVALFTLAFMLPVLLGAYLLTAGSKTFAVASFLFA
                     FGALFGQIGALALYLRHKSLRAAPSSSQGNRYV"
     gene            complement(225743..226276)
                     /locus_tag="NGO_RS01115"
                     /old_locus_tag="NGO0223"
                     /old_locus_tag="NGO_0223"
     CDS             complement(225743..226276)
                     /locus_tag="NGO_RS01115"
                     /old_locus_tag="NGO0223"
                     /old_locus_tag="NGO_0223"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002246850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic diphosphatase"
                     /protein_id="WP_003687553.1"
                     /translation="MADFNQILTPGDVDGGIINVVNEIPAGSNHKIEWNRKLAAFQLD
                     RIEPAIFAKPTNYGFIPQTLDEDGDELDVLLVTEQPLATGVFLEARVIGVMKFVDDGE
                     VDDKIVCVPADDRNNGNAYKTLSDLPQQLIKQIEFHFNHYKDLKKAGTTKVESWGGAE
                     EAKKVIKESIERWNKQA"
     gene            complement(226378..226830)
                     /gene="nudB"
                     /locus_tag="NGO_RS01120"
                     /old_locus_tag="NGO0224"
                     /old_locus_tag="NGO_0224"
     CDS             complement(226378..226830)
                     /gene="nudB"
                     /locus_tag="NGO_RS01120"
                     /old_locus_tag="NGO0224"
                     /old_locus_tag="NGO_0224"
                     /EC_number="3.6.1.67"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin triphosphate diphosphatase"
                     /protein_id="WP_010357032.1"
                     /translation="MAKPLKYPVSALVVLYSGDGGILLIERTHPKGFWQSVTGSLEPG
                     ETVAQTARREVWEETGILLEDGQLQDRHDSTVYEIYHHWRHRYPKGVFENREHVFRAE
                     IPRDTPVVLQPEEHVSYGWFGLEEAAEKVFSPSNRRAILELGRFLGKR"
     gene            227047..227123
                     /locus_tag="NGO_RS01125"
                     /old_locus_tag="NGO_18801"
                     /old_locus_tag="NGO_t04"
     tRNA            227047..227123
                     /locus_tag="NGO_RS01125"
                     /old_locus_tag="NGO_18801"
                     /old_locus_tag="NGO_t04"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:227081..227083,aa:Pro,seq:ggg)
     gene            227386..229272
                     /gene="mafB"
                     /locus_tag="NGO_RS01130"
                     /old_locus_tag="NGO0225"
                     /old_locus_tag="NGO_0225"
     CDS             227386..229272
                     /gene="mafB"
                     /locus_tag="NGO_RS01130"
                     /old_locus_tag="NGO0225"
                     /old_locus_tag="NGO_0225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003704451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polymorphic toxin MafB class 2"
                     /protein_id="WP_003704451.1"
                     /translation="MGISRKISLILSILAVCLPMHAHASDLANDPFIRQVLDRQHFEP
                     DGKYHLFGSRGELAERSGHIGLGNIQSHQLGNLMIQQAAIKGNIGYIVRFSDHGHEVH
                     SPFDNHASHSDSDEAGSPVDGFSLYRIHWDGYEHHPADGYDGPQGGGYPAPKGARDIY
                     SYDIKGVAQNIRLNLTDNRSTGQRLADRFHNAGAMLTQGVGDGFKRATRYSPELDRSG
                     NAAEAFNGTADIVKNIIGAAGEIVGAGDAVQGISEGSNIAVMHGLGLLSTENKMARIN
                     DLADMAQLKDYAAAAIRDWAVQNPNAAQGIEAVSNIFMAAIPIKGIGAVRGKYGLGGI
                     TAHPVKRSQMGAIALPKGKSAVSDNFADAAYAKYPSPYHSRNIRSNLEQRYGKENITS
                     STVPPSNGKNVKLADQRHPKTGVPFDGKGFPNFEKHVKYDTKLDIQELSGGGIPKAKP
                     VFDAKPRWEVDRKLNKLTTREQVEKNVQETRRRSQSSQFKAHAQREWENKTGLDFNHF
                     IGGDINKKGTVTGGHSLTRGDVRVIQQTSAPDKHGVYQATVEIKKPDGSWEVKTKKGG
                     KVMTKHTMFPKDWDEARIRAEVTSAWESRIMLKDNKWQGTSKSGIKIEGFTEPNRTAY
                     PIYE"
     gene            229300..229722
                     /locus_tag="NGO_RS01135"
                     /old_locus_tag="NGO0226"
                     /old_locus_tag="NGO_0226"
     CDS             229300..229722
                     /locus_tag="NGO_RS01135"
                     /old_locus_tag="NGO0226"
                     /old_locus_tag="NGO_0226"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002261379.1"
                     /translation="MMKRIKCFCDKFPSGDTFRMCIILDDYDNRVDYYVGIYDYITST
                     LMSDIYYRSTIDEHFKIIELIENNPNEIYDDGGGQQFCLEFHHDKVIFYHNEFDEEDG
                     YPVLSCSLHTFKTALIAWNAFLQLPKSIHSVVETVIEE"
     gene            <229800..229883
                     /locus_tag="NGO_RS01140"
                     /pseudo
     CDS             <229800..229883
                     /locus_tag="NGO_RS01140"
                     /inference="COORDINATES: protein motif:HMM:NF026862.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            229880..230122
                     /locus_tag="NGO_RS01145"
     CDS             229880..230122
                     /locus_tag="NGO_RS01145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002254310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="immunity protein 31"
                     /protein_id="WP_002232149.1"
                     /translation="MTNLKLDFYSEVIIKDSCPNDLLENGETIKGKKGVVLGISEEDG
                     IIYGYTILLFDIKYCIYIDKKYIIPTGKKFSRDDFY"
     gene            230200..230445
                     /locus_tag="NGO_RS01150"
                     /old_locus_tag="NGO0227"
                     /old_locus_tag="NGO_0227"
     CDS             230200..230445
                     /locus_tag="NGO_RS01150"
                     /old_locus_tag="NGO0227"
                     /old_locus_tag="NGO_0227"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003706679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="WP_002237787.1"
                     /translation="MKDSTGQMRLATKDLAEAIKRGEVRSSAFTTKQLKAIEKGKDKI
                     PSYTWHHHQDTGRMQLVPEWEHSKTGHIGGTAMGKGK"
     gene            230448..230834
                     /locus_tag="NGO_RS01155"
                     /old_locus_tag="NGO0228"
                     /old_locus_tag="NGO_0228"
     CDS             230448..230834
                     /locus_tag="NGO_RS01155"
                     /old_locus_tag="NGO0228"
                     /old_locus_tag="NGO_0228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002253928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010357075.1"
                     /translation="MWKIYKENSTDLNFAIGSIYCQAINLTEFKMWVEKIIREVDLHE
                     IPNYFFDLIDFQSLYDLIDIIGFVPENNLSKNQDNALTGIAFLRGIDVYDPPISKEKA
                     LKALEKHPEIYQKFQHFFPFVELPPL"
     gene            230909..231052
                     /locus_tag="NGO_RS01160"
                     /old_locus_tag="NGO_01225"
     CDS             230909..231052
                     /locus_tag="NGO_RS01160"
                     /old_locus_tag="NGO_01225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002222817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="WP_003690717.1"
                     /translation="MFDGKGTSEIPNYTWHHHQDTGRMQLIREDSHHDTDHIGWRAMS
                     KGK"
     gene            231055..231444
                     /locus_tag="NGO_RS01165"
                     /old_locus_tag="NGO0229"
                     /old_locus_tag="NGO_0229"
     CDS             231055..231444
                     /locus_tag="NGO_RS01165"
                     /old_locus_tag="NGO0229"
                     /old_locus_tag="NGO_0229"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002253928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003692667.1"
                     /translation="MWKIIKEDSDDLGFAIKCLFSQSIDLNEFKLWIEQVIRDMPIED
                     IPFYIFDLADFNGGIGDIDNIVGFVSSYSLSKSKKNALTGIAFLRGIDVYDPPISKEK
                     ALKALKKHPEIYHKFKRFFPFVELPLL"
     gene            complement(231484..232941)
                     /locus_tag="NGO_RS01170"
                     /old_locus_tag="NGO0230"
                     /old_locus_tag="NGO_0230"
     CDS             complement(231484..232941)
                     /locus_tag="NGO_RS01170"
                     /old_locus_tag="NGO0230"
                     /old_locus_tag="NGO_0230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019272823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter Trk"
                     /protein_id="WP_003706675.1"
                     /translation="MHKILPIAHVLSRLGMLFSFILLIPAALSYAFSDGAYTAFATTA
                     TVTLSGSCIVRLATLRFRRELRPRDGFTLVLMLWLAFAAMAAMPMYLYFPNMGFTDAF
                     FESMSGLTTTGATVIPHVDGLAPSVNFWRHMLNWLGGMGIIVLAVAILPMLGVGGTQL
                     FKAEIPGIDKESKMSPRISQVAKKLWFGYTLITILAAACLHFAGMGWFDAVCHALATL
                     SLGGFSTHDASIGYYNSPLIEAVIIVFTIFGGINFASHFAALNSRSLKTYWKDEECRT
                     MLLLLSGSILASALYLWHTGHYAGFGESLRYTAFNFVSIGLANGLSNTDFAQWPLLIS
                     LWMFFLANILASSGSTGGGIKTIRALVLFKFSLREMMVLLHPKAVRTVKISGKAIPDR
                     LALTVMSFIFIYFMTVVLFSFLLMASGMEFTTAFTAVIACITNAGPGLGEVGPAGNYA
                     GLDVMQKWICVTAMLLGRLEIFTVFILFTPAYWKK"
     gene            complement(232956..233786)
                     /locus_tag="NGO_RS01175"
                     /old_locus_tag="NGO0231"
                     /old_locus_tag="NGO_0231"
     CDS             complement(232956..233786)
                     /locus_tag="NGO_RS01175"
                     /old_locus_tag="NGO0231"
                     /old_locus_tag="NGO_0231"
                     /EC_number="3.6.1.41"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="symmetrical bis(5'-nucleosyl)-tetraphosphatase"
                     /protein_id="WP_003687564.1"
                     /translation="MAHYAIGDIQGCFDELTALLGKIGFNHGTDTLWLTGDIVNRGPK
                     SLETLQFCIRHENSVQIVLGNHDLYLLAVGCGEGALKRSDTIEPILKHPDGGKMLDWL
                     RAQPLLIREGGRVMIHAGILPQWRIAKAESLAGEAEAELRGKKYVKFFSKMYGNKPAA
                     WDEGLEGYARLRFIVNAFTRMRALTFKNELDFDYKSTVKKMPPYLRPWFKAPDRQNLD
                     HTIIFGHWSSLGYTNADNVISLDTGALWGGQLTAVNLETEEITQVQAAGGIDWKSFAK
                     "
     gene            complement(233863..234252)
                     /locus_tag="NGO_RS01180"
                     /old_locus_tag="NGO0232"
                     /old_locus_tag="NGO_0232"
     CDS             complement(233863..234252)
                     /locus_tag="NGO_RS01180"
                     /old_locus_tag="NGO0232"
                     /old_locus_tag="NGO_0232"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003754044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RidA family protein"
                     /protein_id="WP_003687566.1"
                     /translation="MSKTVIHTDKAPAAIGAYSQAVRAGGTVYMSGQIPLDPATMTVV
                     GNGDFHTEARQVFQNLQAVAEAAGGSLDDIVKLNAYLTDLGNFAVFNEVMAEFITEPF
                     PARAAVGVASLPKGVQVEAEAVLVLNA"
     gene            complement(234399..234926)
                     /gene="nspA"
                     /locus_tag="NGO_RS01185"
                     /old_locus_tag="NGO0233"
                     /old_locus_tag="NGO_0233"
     CDS             complement(234399..234926)
                     /gene="nspA"
                     /locus_tag="NGO_RS01185"
                     /old_locus_tag="NGO0233"
                     /old_locus_tag="NGO_0233"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002225511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane beta-barrel protein NspA"
                     /protein_id="WP_003696762.1"
                     /translation="MKKALAALIALALPAAALAEGASGFYVQADAAHAKASSSLGSAK
                     GFSPRISAGYRINDLRFAVDYTRYKNYKQAPSTDFKLYSIGASVIYDFDTQSPVKPYF
                     GARLSLNRASAHLGGSDSFSKTSAGLGVLAGVSYAVTPNVDLDAGYRYNYVGKVNNVK
                     NVRSGELSAGVRVKF"
     gene            complement(235369..236544)
                     /locus_tag="NGO_RS01190"
                     /old_locus_tag="NGO0234"
                     /old_locus_tag="NGO_0234"
     CDS             complement(235369..236544)
                     /locus_tag="NGO_RS01190"
                     /old_locus_tag="NGO0234"
                     /old_locus_tag="NGO_0234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003754052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-independent coproporphyrinogen III
                     oxidase-like protein"
                     /protein_id="WP_003706670.1"
                     /translation="MHTISFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNG
                     LPEAAYIDALLTDLQLELPNIWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQ
                     PEAEITLEANPGTVEIEKFQGFKDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAI
                     ATALKLFDKVNIDLMYALPNQTVQTALDDVQTAIATDATHISAYHLTMEPNTPFGHTP
                     PKGLPQDEAALDIEDAVHGTLEGAGFIHYETSAFAKPTMQCRHNLNYWQFGDYLGIGA
                     GAHGKISYPDRIERTVRRRHPNDYLALMQSQPGEAVERKTVAAEDLPFEFMMNALRLT
                     DGVPAAMLQERTGVPAAKIMVQIETARQKGLLETDPTVFRPTEKGRLFLNDLLQCFL"
     gene            complement(236601..239072)
                     /gene="ligA"
                     /locus_tag="NGO_RS01195"
                     /old_locus_tag="NGO0235"
                     /old_locus_tag="NGO_0235"
     CDS             complement(236601..239072)
                     /gene="ligA"
                     /locus_tag="NGO_RS01195"
                     /old_locus_tag="NGO0235"
                     /old_locus_tag="NGO_0235"
                     /EC_number="6.5.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase LigA"
                     /protein_id="WP_010951014.1"
                     /translation="MNPTAQRIHELTDLLNRYAYEYYTLDAPSIPDAEYDRLFRELEA
                     LERNHPELKLPDSPTQRVGGEPLAGFAEVRHEVPMLSLTNAFSPQDENGVFDHAEMYA
                     FDQRVRDGLDGGNPEYVIEPKFDGLAISLLYRDGVLVQAATRGDGTTGEDVTRNVKTV
                     SNIPLRLHGENVPELIEVRGEVLMLKADFAALNQRQTENGQKPFANPRNAAAGSLRQL
                     DSRITAQRKLHFFPYSVARQQGGLIAEEHIQELAYFQALGFSLPNGNFGCFKNIGEVL
                     AFYEHMQQKRPELPYEIDGTVVKVNSLAQQHELGFISRAPRWAVAHKFPAEEALTIVE
                     AIDVQIGRTGAVTPVARLQPVFVGGVTVTNATLHNQDEVSRKDVRVGDTVVVRRAGDV
                     IPEVVRVIFERRPMQETAVAVSDGIGHQQDDLFAETPSAKQTESVPLHKPYRLPARCP
                     ICRSEIEREEGEAVARCSGGMLCQAQRAQGLIHFASRKAMDIDGLGEKQIEQLVAQDL
                     VRHFADLYRIDIPTLQKMKETADKGSSENENGDAETVSGDLSKYNTQNGKKQPTKWAQ
                     NILAGIESGKTPELARFLFALGIRHVGERTAKTLAQAFGTLERVRRAPEPVLACLPDI
                     GTVVARSIAHFFAQAEQQAMIDELLAAGVAPQAQAVSLPAAQYAGPQRWITRLPGFKI
                     SENKAQALWELAGQSIEGLQNDKALPADWQAWRSKAQNTALLENLKTFFAQMPSEDEA
                     AQGSDGINKAVAGKTFVLTGTLPTFKRDQAQALIEAAGGKVSGSVSKKTDYVVAGETA
                     GSKLEKANALGVSVLSEAELLTLLC"
     gene            complement(239206..240492)
                     /locus_tag="NGO_RS01200"
                     /old_locus_tag="NGO0236"
                     /old_locus_tag="NGO_0236"
     CDS             complement(239206..240492)
                     /locus_tag="NGO_RS01200"
                     /old_locus_tag="NGO0236"
                     /old_locus_tag="NGO_0236"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010359823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZipA"
                     /protein_id="WP_003687577.1"
                     /translation="MIYIVLFLAAVLAVVAYNMYQENQYRKKVRDQFGHSDKDALLNS
                     KTSHVRDGKPSGGPVMMPKPQPAVKKPAKPQDSAMRNLQEQDAVYIAKQKQAKASPFK
                     TEIETALEEIGIIGNSAHTVSEPQTGHSAPKPADAPAKPVPVPQTPAKPLITLKELSK
                     VELPWFDVRFDFISYIALTEAKELHALPRLSNRCRYQIVGCTMDDHFQIAEPIPGIRY
                     QAFIVGIQAVSRNGLASQEELSAFNRQADAFAQSMGGQTLHTDLAAFIEVASALDAFC
                     ARVDQTIAIHLVSPTSISGVELRSAVTGVGFVLEDDGAFHYTDTSGSTMFSICSLNNE
                     PFTNALLDNQSYKGFSMLLDIPHSPAGEKTFDDLFMDLAVRLSGQLNLNLVNDKMEEV
                     STQWLKDVRTYVLARQSEMLKVGIEPGGKTALRLFS"
     gene            complement(240686..241258)
                     /gene="ampD"
                     /locus_tag="NGO_RS01205"
                     /old_locus_tag="NGO0237"
                     /old_locus_tag="NGO_0237"
     CDS             complement(240686..241258)
                     /gene="ampD"
                     /locus_tag="NGO_RS01205"
                     /old_locus_tag="NGO0237"
                     /old_locus_tag="NGO_0237"
                     /EC_number="3.5.1.28"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003675628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,6-anhydro-N-acetylmuramyl-L-alanine amidase
                     AmpD"
                     /protein_id="WP_003687579.1"
                     /translation="MDNHAGAHWQNGWLQSIRHTPSPNFSPRETGETVSLIVLHNISL
                     PPFEYGTDAVEKLFANRLDPDGHPFFSLIHTLHVSSHFLIARDGETVQFVSCGDMAYH
                     AGASSFRGREKCNAFSIGIELEGCDFEPFAEAQYRSLETLLAALCRRYPITAVTGHQD
                     IAPGRKTDPGHFFDWRRIREKGFPVDRNAV"
     gene            241342..242338
                     /gene="mltG"
                     /locus_tag="NGO_RS01210"
                     /old_locus_tag="NGO0238"
                     /old_locus_tag="NGO_0238"
                     /pseudo
     CDS             241342..242338
                     /gene="mltG"
                     /locus_tag="NGO_RS01210"
                     /old_locus_tag="NGO0238"
                     /old_locus_tag="NGO_0238"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581169.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="endolytic transglycosylase MltG"
     gene            242398..243018
                     /locus_tag="NGO_RS01215"
                     /old_locus_tag="NGO0239"
                     /old_locus_tag="NGO_0239"
     CDS             242398..243018
                     /locus_tag="NGO_RS01215"
                     /old_locus_tag="NGO0239"
                     /old_locus_tag="NGO_0239"
                     /EC_number="2.7.4.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003754064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTMP kinase"
                     /protein_id="WP_003687582.1"
                     /translation="MKPQFITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTP
                     VGEALREILLNPETKAGLRAETLMMFAARMQHIEEVILPALSDGIHVVSDRFTDATFA
                     YQGGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPLEVSMARIGQAREKDRFEQEQAD
                     FFMRVRGVYLDRAAACPERYAVIDSNRSLDEVRNSIEKVLDGHFGC"
     gene            243240..244520
                     /locus_tag="NGO_RS01220"
                     /old_locus_tag="NGO0240"
                     /old_locus_tag="NGO_0240"
     CDS             243240..244520
                     /locus_tag="NGO_RS01220"
                     /old_locus_tag="NGO0240"
                     /old_locus_tag="NGO_0240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019272811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malic enzyme"
                     /protein_id="WP_003687585.1"
                     /translation="MENSLKEAALKFHELPVPGKISVTPTKSLATDKDLALAYSPGVA
                     APCMEIHADPQNAYKYTGKGNLVAVISNGTAVLGLGDIGALAGKPVMEGKGVLFKKFA
                     GVDVFDIEIDEKDPQKLVDIIAALEPTFGGINLEDIKAPECFYIERELRKRCKIPVFH
                     DDQHGTAIITAAAVLNALRYTGRKIEEATLVCSGAGAAAIACLNQLLDLGLKRENVTV
                     CDSKGVIYQTREDKDRMDESKKFYAVEDNGRRVLADAVKGKDIFLGLSGANLLTPEML
                     NTMNEKPIVFAMANPNPEILPPLAKETRPDVVIGTGRSDFPNQVNNVLCFPFIFRGAL
                     DVGATTINEEMKRACVYALADLAMEEVTEEVVAAYGKKFEFGAEYLIPTPFDSRLLPR
                     VATAAAKAAMESGVATRPIADLEAYAAKLGEWKL"
     gene            244675..244883
                     /locus_tag="NGO_RS01225"
                     /old_locus_tag="NGO_0241"
                     /pseudo
     CDS             244675..244883
                     /locus_tag="NGO_RS01225"
                     /old_locus_tag="NGO_0241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002600387.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            244922..245953
                     /locus_tag="NGO_RS01230"
                     /old_locus_tag="NGO0242"
                     /old_locus_tag="NGO_0242"
     CDS             244922..245953
                     /locus_tag="NGO_RS01230"
                     /old_locus_tag="NGO0242"
                     /old_locus_tag="NGO_0242"
                     /EC_number="2.7.1.130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_025462052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetraacyldisaccharide 4'-kinase"
                     /protein_id="WP_003687587.1"
                     /translation="MPNFFKFHTVIERHWQKPYPVLSFLLKPLSGLFAKIAAKWRADF
                     LSGKRQSEKLSVPVVVVGNIHAGGTGKTPIAAALVSGLQEKGVKVGIISRGYGRKSKA
                     VYVLNAASRAEDAGDEPLLLFRKTGAPTAVGSSRVEAGRALLAAHPELELIVADDGLQ
                     HYALQRDVEIAVFPAADTGRTDLDLLPNGNLREPLSRLESVDAVVVGGRAADGFMPSE
                     HLFGSRIEAGAVYRLNRPSEKLDISTLSGKRVAAVAGIARPQRFFDTLTHMGIRLDQT
                     VALPDHADIFNRDLPPADVVLVTEKDAVKFSDGICTDNVWVLPVCAIIEPDLAEFVLE
                     RLEGVPKAV"
     gene            246159..246692
                     /locus_tag="NGO_RS01235"
                     /old_locus_tag="NGO0243"
                     /old_locus_tag="NGO_0243"
     CDS             246159..246692
                     /locus_tag="NGO_RS01235"
                     /old_locus_tag="NGO0243"
                     /old_locus_tag="NGO_0243"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010357100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2059 domain-containing protein"
                     /protein_id="WP_010357100.1"
                     /translation="MKLKTLLLPFAALALCANAFAAPPGDASLARWLDTQNFDRDIEK
                     NMIEGFNAGFKPYADKALAEMPEAKKDQAAEAFNRYRENVLKDLITPEVKQAVRNTLL
                     KNAREIYTQEEIDGMIAFYGSPVGQSVVAKNPRLIKKSMSEIAVSWTALSGKIARHHL
                     PEFTEELRRIICGGIVD"
     gene            246914..247096
                     /locus_tag="NGO_RS01240"
                     /old_locus_tag="NGO0244"
                     /old_locus_tag="NGO_0244"
     CDS             246914..247096
                     /locus_tag="NGO_RS01240"
                     /old_locus_tag="NGO0244"
                     /old_locus_tag="NGO_0244"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003679524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Trm112 family protein"
                     /protein_id="WP_002221286.1"
                     /translation="MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPY
                     MLENEARALSEEELKA"
     gene            247093..247854
                     /gene="kdsB"
                     /locus_tag="NGO_RS01245"
                     /old_locus_tag="NGO0245"
                     /old_locus_tag="NGO_0245"
     CDS             247093..247854
                     /gene="kdsB"
                     /locus_tag="NGO_RS01245"
                     /old_locus_tag="NGO0245"
                     /old_locus_tag="NGO_0245"
                     /EC_number="2.7.7.38"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010359827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-manno-octulosonate cytidylyltransferase"
                     /protein_id="WP_003690726.1"
                     /translation="MTEFVVLIPARLDSSRLPGKALADIHGKPMVVRVAEQAAKSKAA
                     RVVVATDHPDIQTACQAHGIEVVMTSNRHESGTTRLAEAAAALKLPPHLIVVNVQGDE
                     PLIAPELIDRTAEVLVENNVQMATAGHELHDFDELMNPNAVKVVLDKNGNAIYFSRAP
                     IPYPRDAMRAGKREMPSETAVLRHIGIYAYRVGFLQRYAEMSVSPLETIESLEQLRVL
                     WHGYPIAVETAKEAPAAGVDTQEDLDRVRAVFQTV"
     gene            247877..248173
                     /locus_tag="NGO_RS01250"
                     /old_locus_tag="NGO_0246"
     CDS             247877..248173
                     /locus_tag="NGO_RS01250"
                     /old_locus_tag="NGO_0246"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017146733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003706665.1"
                     /translation="MQQHIEKWQHLSREEQKILAEVWGLVQNDDQEVHYEMLKLNAPD
                     EVSGEFWFRMAETLSTLPPNRSLDLRMNGGRLSTAVSILSVMIEDNPDIPQLWA"
     gene            248195..248392
                     /locus_tag="NGO_RS01255"
                     /old_locus_tag="NGO_0247"
     CDS             248195..248392
                     /locus_tag="NGO_RS01255"
                     /old_locus_tag="NGO_0247"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003690727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003690727.1"
                     /translation="MVHGHKARADGLVQQPDKAAEANEEEYLTKALSQNLLSTLDAAL
                     ARFPEDAWFQEIKQDAQKHFA"
     gene            248549..248641
                     /locus_tag="NGO_RS01260"
                     /old_locus_tag="NGO_18806"
                     /old_locus_tag="NGO_t05"
     tRNA            248549..248641
                     /locus_tag="NGO_RS01260"
                     /old_locus_tag="NGO_18806"
                     /old_locus_tag="NGO_t05"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:248583..248585,aa:Ser,seq:gct)
     gene            248915..249700
                     /locus_tag="NGO_RS01265"
                     /old_locus_tag="NGO0248"
                     /old_locus_tag="NGO_0248"
     CDS             248915..249700
                     /locus_tag="NGO_RS01265"
                     /old_locus_tag="NGO0248"
                     /old_locus_tag="NGO_0248"
                     /EC_number="4.2.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002227527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit alpha"
                     /protein_id="WP_003694852.1"
                     /translation="MSRIRQAFAALDGGKALIPYIAVGDPDIRTTLALMHGMVASGAD
                     ILELGVPFSDPMADGPVIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLN
                     PIHKMGYREFAQEAAKAGVDGVLTVDSPIETIDSLYRELKDNEVDCIFLIAPTTTEDR
                     IKTIAELAGGFVYYVSLKGVTGAASLDTDEVSRKIEYLRQYIDIPIGVGFGISNAESA
                     RKIGRVAAAIIVGSRIVKEIENNAGNEAAAVGALVKELKDAVR"
     gene            249737..250609
                     /locus_tag="NGO_RS01270"
                     /old_locus_tag="NGO0249"
                     /old_locus_tag="NGO_0249"
     CDS             249737..250609
                     /locus_tag="NGO_RS01270"
                     /old_locus_tag="NGO0249"
                     /old_locus_tag="NGO_0249"
                     /EC_number="6.4.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase carboxyltransferase
                     subunit beta"
                     /protein_id="WP_003706663.1"
                     /translation="MSWLDKILPPKIKNRGKDGASNVPEGLWRKCPSCSATVYSTELQ
                     QNNQVCPKCNHHNPLSARQRLNLLLDEEGREEVAGNVKPTDPLKFKDSKKYPDRLSAA
                     RKLTGEDDALVVMKGMMNGLPVVVAAFEFRFIGGSMGSVVGERFVQGVRRAVADNCPF
                     VCVAASGGARMQEGVNSLMQMTKTSAALHLLTEKRLPFISVLTDPTMGGVSASFAFLG
                     DVVLAEPNALIGFAGPRVIEQTVRETLPEGFQRAEFLLEKGAIDQIVDRRDMKRRISD
                     LITLLCRQDKVSAT"
     gene            complement(250669..251280)
                     /locus_tag="NGO_RS01275"
                     /old_locus_tag="NGO0250"
                     /old_locus_tag="NGO_0250"
     CDS             complement(250669..251280)
                     /locus_tag="NGO_RS01275"
                     /old_locus_tag="NGO0250"
                     /old_locus_tag="NGO_0250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002227524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CNP1-like family protein"
                     /protein_id="WP_003692687.1"
                     /translation="MRRAILLILTLTVGTSLAAGFSQKDTPINTRYRETPEEAAAREF
                     KEHTAELPPLPDAHSDGWFDIYVDENYGKQPKILLDSLQIMPAPDGSIRYILNIRSDK
                     GYDNLTAEGIFCARSSIGFGNGKLSSYKVFGYGDTVNSRWIQPRNAEWKPIGGTLGRN
                     DALRAVLYQAFCEGGVPADTQGLVQRLKERAGRYAPSMKPHDK"
     gene            251388..251612
                     /locus_tag="NGO_RS01280"
                     /old_locus_tag="NGO0250a"
                     /old_locus_tag="NGO_01355"
     CDS             251388..251612
                     /locus_tag="NGO_RS01280"
                     /old_locus_tag="NGO0250a"
                     /old_locus_tag="NGO_01355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase TusA family protein"
                     /protein_id="WP_003690730.1"
                     /translation="MNSETLDVTGLKCPLPILRAKKALAQMRQGEVLTVLATDGGAPG
                     DFEAFCRQTGHVLLDSSEQDGVFTLVVKHK"
     gene            251643..>252026
                     /locus_tag="NGO_RS01285"
                     /old_locus_tag="NGO0252"
                     /old_locus_tag="NGO_0252"
                     /pseudo
     CDS             251643..>252026
                     /locus_tag="NGO_RS01285"
                     /old_locus_tag="NGO0252"
                     /old_locus_tag="NGO_0252"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002237656.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(252030..252518)
                     /locus_tag="NGO_RS01290"
                     /old_locus_tag="NGO0253"
                     /old_locus_tag="NGO_0253"
     CDS             complement(252030..252518)
                     /locus_tag="NGO_RS01290"
                     /old_locus_tag="NGO0253"
                     /old_locus_tag="NGO_0253"
                     /inference="COORDINATES: protein motif:HMM:NF024751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_025462866.1"
                     /translation="MTRPAGFSDCQRVCPDETGFDRRLFRPYARSLKGQMAKARISGK
                     RYRRLSLVSAQVGNRPIAPMVCQNTVAGVFFEARFQQCLLPALAQKSVIISDNARFRR
                     MGALRGTAEKLGHKVLPPAPCSPEPNPIEKVWANIKRYLRTVLSDYARFDDALLSYFD
                     FN"
     gene            complement(252527..252790)
                     /locus_tag="NGO_RS01295"
     CDS             complement(252527..252790)
                     /locus_tag="NGO_RS01295"
                     /inference="COORDINATES: protein motif:HMM:NF013842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_005231956.1"
                     /translation="MSRNTLYLRIRLKKQTGSLKHQVTGLNAAKSDRQKPARYVGRHP
                     DACLHEIAKHFDCTAAAVCHAPKQMRMARKKRPPLTKDKTRPK"
     gene            <253076..253273
                     /locus_tag="NGO_RS01300"
                     /pseudo
     CDS             <253076..253273
                     /locus_tag="NGO_RS01300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003754093.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            253334..254368
                     /gene="pyrC"
                     /locus_tag="NGO_RS01305"
                     /old_locus_tag="NGO0255"
                     /old_locus_tag="NGO_0255"
     CDS             253334..254368
                     /gene="pyrC"
                     /locus_tag="NGO_RS01305"
                     /old_locus_tag="NGO0255"
                     /old_locus_tag="NGO_0255"
                     /EC_number="3.5.2.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="WP_003706656.1"
                     /translation="MQTLTIIRPDDMHLHLRDGDALKAVAPYTARQMGRAVIMPNLKP
                     PVVSVADALAYKARIMAALPEGSAFEPLMTLYLTDQATPELVREAKAAGIVAFKLYPA
                     GATTNSDSGVTDLFKLIPVLEEMAKQGILFLVHGEVTDPEIDIFDREAAFIGRVMKPV
                     LAQVPNLKVVFEHITTAEAARLVLEAGDNVAATVTPQHLLLNRNDLLVGGVRPHHFCL
                     PVLKRETHRQALVAAVTGEKAHKFFLGTDSAPHAKSAKENACGCAGMFSAMTAIELYA
                     EVFEKAGALDKLEAFASKNGARFYGIPENADTITLVKQSQTVPASVPYGDGELVPMRA
                     GGEIGWTVQY"
     gene            complement(254447..254872)
                     /gene="nusB"
                     /locus_tag="NGO_RS01310"
                     /old_locus_tag="NGO0256"
                     /old_locus_tag="NGO_0256"
     CDS             complement(254447..254872)
                     /gene="nusB"
                     /locus_tag="NGO_RS01310"
                     /old_locus_tag="NGO0256"
                     /old_locus_tag="NGO_0256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003714720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination factor NusB"
                     /protein_id="WP_002241285.1"
                     /translation="MKTARRRSRELAVQAVYQSLINRTAAPEIAKNIREMSDFAKADE
                     ELFNKLFFGTQTNAADYIQKIRPLLDRDEKDLNPIERAVLLTACHELSAMPETPYPVI
                     INEAIEVTKTFGGTDGHKFVNGILDKLAAQIRPDEPKRR"
     gene            complement(254950..255426)
                     /locus_tag="NGO_RS01315"
                     /old_locus_tag="NGO0257"
                     /old_locus_tag="NGO_0257"
     CDS             complement(254950..255426)
                     /locus_tag="NGO_RS01315"
                     /old_locus_tag="NGO0257"
                     /old_locus_tag="NGO_0257"
                     /EC_number="2.5.1.78"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="WP_003687601.1"
                     /translation="MNTIAPNLDGKHLRIGIVQARFTNEIGSQMLKVCCRTLQELGVA
                     DENITVATVPGALEIPIALMNFASSEKFDALIAIGVVIRGETYHFELVANESGAGIGR
                     VALDYNIPIANAVLTTENDAQAIERIGEKASDAAKVAVECANLVNLLLEEQFEDEE"
     gene            complement(255473..255796)
                     /locus_tag="NGO_RS01320"
                     /old_locus_tag="NGO0258"
                     /old_locus_tag="NGO_0258"
     CDS             complement(255473..255796)
                     /locus_tag="NGO_RS01320"
                     /old_locus_tag="NGO0258"
                     /old_locus_tag="NGO_0258"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002231998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2185 domain-containing protein"
                     /protein_id="WP_002238889.1"
                     /translation="MNAFAQALSSALDRCIATNTVAKQNRPVGFLYREAPVFENDSGW
                     RFFSGDETDEYTDDPDNFSIVSLADITKTNPETAALLSQPEGSAWELAEDGTFQTVAD
                     WQPQD"
     gene            255967..256686
                     /gene="rnc"
                     /locus_tag="NGO_RS01325"
                     /old_locus_tag="NGO0259"
                     /old_locus_tag="NGO_0259"
     CDS             255967..256686
                     /gene="rnc"
                     /locus_tag="NGO_RS01325"
                     /old_locus_tag="NGO0259"
                     /old_locus_tag="NGO_0259"
                     /EC_number="3.1.26.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002221273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease III"
                     /protein_id="WP_010951018.1"
                     /translation="MKDDVLKRQAHTAIQKKLGYAFRDMSLLRRALTHRSHHAKHNER
                     FEFVGDSILNYTVARMLFDAFPKLTEGELSRLRASLVNEGVLAEMAAEMNVGDGLYLG
                     AGELKSSGFRRPSILADAMEAMFAAVSFDADFNTAEKVVRHLFAERVRRADFQNQAKD
                     GKTALQEALQARRFALPKYRIEEQIGHADDSMFVISCDLGELGFVCRAKGTSRKAAEQ
                     EAAKEALKWLEEKLPLKKKKK"
     gene            256721..257656
                     /locus_tag="NGO_RS01330"
                     /old_locus_tag="NGO0260"
                     /old_locus_tag="NGO_0260"
     CDS             256721..257656
                     /locus_tag="NGO_RS01330"
                     /old_locus_tag="NGO0260"
                     /old_locus_tag="NGO_0260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010357134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase Era"
                     /protein_id="WP_010357134.1"
                     /translation="MKANMDIETFLAGERAAGGYRCGFVAIVGRPNVGKSTLMNHLIG
                     QKISITSKKAQTTRNRVTGIYTDDTAQFVFVDTPGFQTDHRNALNDRLNQNVTEALGG
                     VDVVVFVVEAMRLTDADRVVLKQLPKHTPVILVINKIDKDKAKDRYALEAFVAQVRAE
                     FEFAAAEAVSAKHGLRIANLLELLKPYLPESVPMYPEDMVTDKSARFLAMEIVREKLF
                     RYLGEELPYAMNVEVEQFEEGDGLNRIYIAVLVDKESQKAILIGKGGERLKKISTEAR
                     LDMEKLFDNKVFLKVWVKVKSGWADDIRFLRELGL"
     gene            <257811..260114
                     /locus_tag="NGO_RS01335"
                     /old_locus_tag="NGO0260a"
                     /old_locus_tag="NGO_01405"
                     /pseudo
     CDS             <257811..260114
                     /locus_tag="NGO_RS01335"
                     /old_locus_tag="NGO0260a"
                     /old_locus_tag="NGO_01405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002226199.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="lactoferrin/transferrin family TonB-dependent
                     receptor"
     gene            complement(260589..261215)
                     /locus_tag="NGO_RS01340"
                     /old_locus_tag="NGO0261"
                     /old_locus_tag="NGO_0261"
     CDS             complement(260589..261215)
                     /locus_tag="NGO_RS01340"
                     /old_locus_tag="NGO0261"
                     /old_locus_tag="NGO_0261"
                     /EC_number="5.3.1.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylanthranilate isomerase"
                     /protein_id="WP_003687611.1"
                     /translation="MRKIRTKICGITTPEDALYAAHAGADALGLVFYPQSPRAIDIIK
                     AQKIAAALPPFVSVVALFVNESAQNIRRILAEVPIHIIQFHGDEDDAFCRQFDRPYIK
                     AIRVQTASDIRNAATRFPNAQALLFDAYHPSEYGGTGHRFDWTLLAEYSGKPWVLAGG
                     LTPENVGEAVRITGAEAVDVSGGVEASKGKKDPAKVAAFIATANRLSR"
     gene            complement(261274..261765)
                     /gene="greB"
                     /locus_tag="NGO_RS01345"
                     /old_locus_tag="NGO0262"
                     /old_locus_tag="NGO_0262"
     CDS             complement(261274..261765)
                     /gene="greB"
                     /locus_tag="NGO_RS01345"
                     /old_locus_tag="NGO0262"
                     /old_locus_tag="NGO_0262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002232005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreB"
                     /protein_id="WP_003687613.1"
                     /translation="MSTETKNYITPAGWQALKDELYQLVNKERPEIVQIVNWAAGNGD
                     RSENGDYLYGKRRMREIDRRIRFLTKRLEAAVVVDPELREATDQVFFGATVGLLRGDG
                     REQTVKIVGVDEIDTAQNKISWISPLARCLIKAREGDEVVLNTPEGREEIEILSVEYI
                     KID"
     gene            complement(261865..263409)
                     /gene="purF"
                     /locus_tag="NGO_RS01350"
                     /old_locus_tag="NGO0263"
                     /old_locus_tag="NGO_0263"
     CDS             complement(261865..263409)
                     /gene="purF"
                     /locus_tag="NGO_RS01350"
                     /old_locus_tag="NGO0263"
                     /old_locus_tag="NGO_0263"
                     /EC_number="2.4.2.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002251190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="WP_003690741.1"
                     /translation="MCGVLGLVSHEPVNQLLYDGLQMLQHRGQDAAGIATAEGGTFHM
                     HKGKGMVSEVFRTRNMRDLTGNAGIAHVRYPTAGNAGSSAEAQPFYVSSPFGIVLAHN
                     GNLTNTAELYENVCNKHLRHINTGSDSEVLLNVFAHELRREVSKNADPHRLNADNIFN
                     AVAEVHRLVRGAYGVVAMIAGYGMLAFRDPYGIRPLALGSQTDSEGRKSYAVASESVA
                     FNALAYDLERDIRPGEAVFVGFNGTIIARQCSDRAKLSPCLFEYVYFARPDSVIDGVS
                     VYQSRLDMGVSLAEKIKRELPVDGIDVVMPIPDTSRPSAMELAVHLNKPYREGLIKNR
                     YIGRTFIMPGQSTRKKSVRQKLSPMETEFAGKSVLLVDDSIVRGTTSREIVEMVRAAG
                     ARKVYIASAAPEVRYPNVYGIDMPTREELIANGRSAAEIAAEIGADGIVFQDLGDLEA
                     VVKALNPKIESFDSSCFNGIYRTGDIDDAYLDRLSAEKSGCAGLKIHPSRMEHSISIS
                     DAGDEE"
     gene            complement(263603..264100)
                     /locus_tag="NGO_RS01355"
                     /old_locus_tag="NGO0264"
                     /old_locus_tag="NGO_0264"
     CDS             complement(263603..264100)
                     /locus_tag="NGO_RS01355"
                     /old_locus_tag="NGO0264"
                     /old_locus_tag="NGO_0264"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002235595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CvpA family protein"
                     /protein_id="WP_003687616.1"
                     /translation="MNSLPIADLLASAVIAACIVISTMRGVIAEAGSMVAWVVSFFFA
                     KLFAAPFADLAFASFQPRLFALALSFISLFVIACLIQKMLRSLLTGAVSAVGLGFANR
                     ILGGVFGALKGVLIVTLLIMLASKTDLPDTEEWQQSYTVPFFVSLSEAVLNHTDNAPE
                     SLDDD"
     gene            complement(264093..265133)
                     /gene="ftsN"
                     /locus_tag="NGO_RS01360"
                     /old_locus_tag="NGO0265"
                     /old_locus_tag="NGO_0265"
     CDS             complement(264093..265133)
                     /gene="ftsN"
                     /locus_tag="NGO_RS01360"
                     /old_locus_tag="NGO0265"
                     /old_locus_tag="NGO_0265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsN"
                     /protein_id="WP_003690743.1"
                     /translation="MSENKQNEVLTGYEQLKRRNRRRLVTASSLVAASCILLAAALSS
                     DPADSNPAPQAGETGATESQTANTAQTPALKSAAENGETAADKPQDLAGEDKPSAADS
                     EISEPENVGAPLVLINDRLEDSNIKGLEESEKLQQAETAKTEPKQAKQRAAEKVSATA
                     DSTDTVAVEKPKRTAEPKPQKAERTAEAKPKAKETKTAEKVADKPKTAAEKTKPDTAK
                     SDSAVKEAKKADKAEGKKTAEKDRSDGKKHETAQKTDKADKTKTAEKEKSGKAGKKAA
                     IQAGYAEKERALSLQRKMKAAGIDSTITEIMTDNGKVYRVKSSNYKNARDAERDLNKL
                     RVHGIAGQVTNE"
     gene            complement(265147..266421)
                     /gene="folC"
                     /locus_tag="NGO_RS01365"
                     /old_locus_tag="NGO0266"
                     /old_locus_tag="NGO_0266"
     CDS             complement(265147..266421)
                     /gene="folC"
                     /locus_tag="NGO_RS01365"
                     /old_locus_tag="NGO0266"
                     /old_locus_tag="NGO_0266"
                     /EC_number="6.3.2.12"
                     /EC_number="6.3.2.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003753247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional tetrahydrofolate
                     synthase/dihydrofolate synthase"
                     /protein_id="WP_003687619.1"
                     /translation="MKTLQDWLSHLETAHSGGLIDMGLERVSEVKKRMNLTPQCPVVV
                     VAGTNGKGSVCAYLTQIYKQAGFKTGTLTSPHLLHYNERIAINAEPVSDDTIIASFER
                     IEAARGEISLTYFEFNALAAVDIFIREQVDVMILEVGLGGRLDAVNAFDGDCAVVTSV
                     DLDHQAFLGDTVEQVGFEKAGVFRSGKPAICGQNPAPASLVAHAEAIGAKLLMVQRDF
                     EFHAMENIQWNYRFRPQHSDGPARNRNALPFPALRGAYQLSNAACALTVLECLDDRLP
                     VDIGAIKRGLLLVENPGRFQVLPGRPLTVLDVGHNPHAARALRRNLINLAYAQKRTAV
                     FSMLSDKDIDGVSETVKDQFDEWYIAPLDVPRGMTADALKAKLEQHHIENIQTFAAVR
                     DAYRAAASKAGEDDRIVVFGSFHTVADVMSVL"
     gene            complement(266452..266892)
                     /locus_tag="NGO_RS01370"
                     /old_locus_tag="NGO0267"
                     /old_locus_tag="NGO_0267"
     CDS             complement(266452..266892)
                     /locus_tag="NGO_RS01370"
                     /old_locus_tag="NGO0267"
                     /old_locus_tag="NGO_0267"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019272920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_003687622.1"
                     /translation="MRAFQTALRPSRILNILTVSLHSASIAVCLTWFYGRMMWFGLAA
                     LAASYAYSLRITNLKHRHAITAITIDRDGRAEIVSGKDKTAATLAGSSMVTPYALFLQ
                     WDTGGKTVRQCIMPDMTDKESYRRLKVWVLWRQPKKTAETDTSD"
     gene            complement(266897..267256)
                     /locus_tag="NGO_RS01375"
                     /old_locus_tag="NGO0268"
                     /old_locus_tag="NGO_0268"
     CDS             complement(266897..267256)
                     /locus_tag="NGO_RS01375"
                     /old_locus_tag="NGO0268"
                     /old_locus_tag="NGO_0268"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002251194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687624.1"
                     /translation="MYFVDRTAAVLKPTARFLEWLKSTDENMPDLTIEQLRADCSVFL
                     VPQFDEPEAVVSYFDERYRQIFEAELAGWDIDKDKWPQDMGLKAFWEFFDIEIHDMVL
                     DMEEADLNITPVFDNMM"
     gene            complement(267329..268057)
                     /locus_tag="NGO_RS01380"
                     /old_locus_tag="NGO0269"
                     /old_locus_tag="NGO_0269"
     CDS             complement(267329..268057)
                     /locus_tag="NGO_RS01380"
                     /old_locus_tag="NGO0269"
                     /old_locus_tag="NGO_0269"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009173913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_010357138.1"
                     /translation="MIKFKNVHKHFKDLHVINGVNLEIKKGEVVVVCGPSGSGKSTLI
                     RTVNQLESIESGEIWVDGVNVADPKTDLNKIREEVGFVFQSFNLYPHLTVLDNITLAP
                     MKVKGQNAEQAEKKAMELLERVGLAHKKDAFPSQLSGGQQQRVAIARGLAMEPRVMLF
                     DEPTSALDPEMVGEVLKVMKDLAESGMTMMCVTHEMGFAREVADRVIFVDKGQILEDE
                     TPEAFFTNPKHERAKQFLQQVMTH"
     gene            complement(268099..268554)
                     /locus_tag="NGO_RS01385"
                     /old_locus_tag="NGO0270"
                     /old_locus_tag="NGO_0270"
     CDS             complement(268099..268554)
                     /locus_tag="NGO_RS01385"
                     /old_locus_tag="NGO0270"
                     /old_locus_tag="NGO_0270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019272917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003690747.1"
                     /translation="MKYTAALLTFLLTACMNPNDAFFQNRRYQMPEAQLNGSNAVFHY
                     GYSQNPDHDLLVDQVRVPDAYRASFARDWIAKEQGYRKNDCVLEKAESGGVTYYTCDA
                     EKGFNGTRFVIYVVNMKNDKGYVKVYRGMNKPNQEELTKLVADLNKFYP"
     gene            complement(268665..269234)
                     /locus_tag="NGO_RS01390"
                     /old_locus_tag="NGO0271"
                     /old_locus_tag="NGO_0271"
     CDS             complement(268665..269234)
                     /locus_tag="NGO_RS01390"
                     /old_locus_tag="NGO0271"
                     /old_locus_tag="NGO_0271"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP pyrophosphokinase"
                     /protein_id="WP_003687630.1"
                     /translation="MESNLQKTERLIREINRLHAQYSQDYFETGKVRKINLSHTLKNV
                     PTEHILSYRLNLHEAVNDYLAFADTRGIDFFYRVKTAESIHDKINRYLARGTQYPTNN
                     ILNDIFGARLIWPSETVAGILEKLDGWKTEYGLKNWYLRDAGGYIGIHIYFKNSSNFY
                     YPWELQVWDEKDAKANIENHMAYKRNFVR"
     gene            complement(269249..270028)
                     /gene="rsmA"
                     /locus_tag="NGO_RS01395"
                     /old_locus_tag="NGO0272"
                     /old_locus_tag="NGO_0272"
     CDS             complement(269249..270028)
                     /gene="rsmA"
                     /locus_tag="NGO_RS01395"
                     /old_locus_tag="NGO0272"
                     /old_locus_tag="NGO_0272"
                     /EC_number="2.1.1.182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019271458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA
                     (adenine(1518)-N(6)/adenine(1519)-N(6))-
                     dimethyltransferase RsmA"
                     /protein_id="WP_003706653.1"
                     /translation="MKEHKARKRFGQNFLQDTRIIGDIVNAVRPQADDVVIEIGPGLA
                     AITEPLAKKLNRLHVVEIDRDIVCRLKTLPFADKLVIHEGDVLQFDFNGISGKKKIVG
                     NLPYNISTPLLFKLAEVADDVADMHFMLQKEVVERMVAAPKSNDYGRLGVMLQYFFDM
                     ELLIDVPPESFDPAPKIDSAVVRMIPVKHRIGKADDFDHFAKLVKLAFRQRRKTIRNN
                     LKELADDDDLQAVGISPQDRAEHIAPEKYVALSNYLADKAV"
     gene            270271..270933
                     /locus_tag="NGO_RS01400"
                     /old_locus_tag="NGO272a"
                     /old_locus_tag="NGO_01470"
     CDS             270271..270933
                     /locus_tag="NGO_RS01400"
                     /old_locus_tag="NGO272a"
                     /old_locus_tag="NGO_01470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019272913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA glycosylase"
                     /protein_id="WP_162098112.1"
                     /translation="MSAALPVGGLNVSENLLEIETHPFDPVLPPKAAVMMMGTFPPKE
                     DKRAMQFHYPNFQNDMWRVYGLVFFNDAAHFRMPSHGEAAHSEKAFDAEKIKAFLHER
                     GIASCPTVLKAAREHGNASDKFLKVVETVDLAAVLAKIPDCRHICTTGGKATEILLDI
                     QGGGIKMPKTGETVPFPFAGRDLTLTRLPSTSRAYPLSLAKKAAAYRAFFEMAGLCEK
                     QL"
     gene            271016..272218
                     /gene="trpB"
                     /locus_tag="NGO_RS01405"
                     /old_locus_tag="NGO0274"
                     /old_locus_tag="NGO_0274"
     CDS             271016..272218
                     /gene="trpB"
                     /locus_tag="NGO_RS01405"
                     /old_locus_tag="NGO0274"
                     /old_locus_tag="NGO_0274"
                     /EC_number="4.2.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019270865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="WP_003687637.1"
                     /translation="MKNYHAPDEKGFFGEHGGLYVSETLIPALKELEQAYNEAKNDPE
                     FWAEFRRDLKHYVGRPSPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALL
                     ARRMGKKRVIAETGAGQHGVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGAN
                     VIGVDSGSRTLKDAMNEAMREWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAK
                     AQMQEATGRQPDVAVACVGGGSNAIGLFYPYIEEENVRLVGVEAGGLGVDTPDHAAPI
                     TSGAPIGVLHGFRSYLMQDENGQVLGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAK
                     DDEALEAFDLLCRFEGIIPALESSHAVAWAVKNAPKMGKDQVILVNLSGRGDKDINTV
                     AKLKGIEL"
     gene            complement(272294..277075)
                     /locus_tag="NGO_RS01410"
                     /old_locus_tag="NGO0275"
                     /old_locus_tag="NGO_0275"
     CDS             complement(272294..277075)
                     /locus_tag="NGO_RS01410"
                     /old_locus_tag="NGO0275"
                     /old_locus_tag="NGO_0275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002225480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter domain-containing protein"
                     /protein_id="WP_010951019.1"
                     /translation="MKAKRFKINAISLSIFLAYALTPYSEAALVRDDVDYQIFRDFAE
                     NKGKFFVGATDLSVKNKRGQNIGNALSNVPMIDFSVADVNKRIATVVDPQYAVSVKHA
                     KAEVHTFYYGQYNGHNDVADKENEYRVVEQNNYEPHKAWSASNLGRLEDYNMARFNKF
                     VTEVAPIAPTDAGGGLDTYKDKNRFSSFVRIGAGRQLVYEKGVYHQEGNEKGYDLRDL
                     SQAYRYAIAGTPYKDINIDQTMNTEGLIGFGNHNKQYSAEELKQALSQDALTNYGVLG
                     DSGSPLFAFDKQKNQWVFLGTYDYWAGYGKKSWQEWNIYKKEFADKIKQHDNAGTVKG
                     NGEHHWKTTGTNSHIGSTAVRLANNEGDANNGQNVTFEDNGTLVLDQNINQGAGGLFF
                     KGDYTVKGANNDITWLGAGIDVADGKKVVWQVKNPNGDRLAKIGKGTLEINGTGVNQG
                     QLKVGDGTVILNQKADSNQKVQAFSQVGIVSGRGTLVLNSPDQINPNNLYFGFRGGRL
                     DANGNDLTFEHIRNVDEGARIVNHNTDHASTITLTGKSLITNPNSLSVHSIQNDYDED
                     NYSYYYRPRRPIPQGKDLYYKNYRYYALKSGGSVNAPMPENGQTENNDWILMGSTQEE
                     AKKNAMNHKNNQRISGFSGFFGEENGKGHNGALNLNFNGKSAQNRFLLTGGANLNGKI
                     SVTQGNVLLSGRPTPHARDFVNKSSARKDAHFSKNNEVVFEDDWINRTFKAAEIAVNQ
                     SASFSSGRNVSDITANITATDNAKVNLGYKNGDEVCVRSDYTGYVTCNTGNLSDKALN
                     SFDATRINGNVNLNQNAALVLGKAALWGQIQGQGNSRVSLNQHSKWHLTGDSQVHNLS
                     LADSHIHLNNASDAQSANKYHTIKINHLSGNGHFHYLTDLAKNLGDKVLVKESASGHY
                     QLHVQNKTGEPNQEGLDLFDASSVQDRSRLFVSLANHYVDLGALRYTIKTENGITRLY
                     NPYAGNRRPVKPAPSPAANTASQAQKATQTDGAQIAKPQDIVVAPPSPQANQAEEAKR
                     QQAKAEQVKRQQAEAGRKSAELSAKQRAGEEERRQTAQSQPQRRKRRAAPQDYMAVSQ
                     DRPKRRGHRSVQQNNVEIAQAQAELARRQQEERKAAELLAKQRAEAEREAQALAARRK
                     AEAEEAKHQAAELAHRQEAKRKAAESAKRKAEEEEHRQTAQSQPQRRKRRAAPQDYMA
                     VSQDRPKRRGRRSTLPAPPSPSFDSSAYAAPRALHNPDWYENDYEEIPLDALEDEDVS
                     ESVDTSDKQPQDNTELHEKVEAVSLQPRAAQPRTQAAAQADAVSTNTNSALSDAMAST
                     QSILLDTGASLTRHIAQKSRADAEKNSVWMSNTGYGRDYASAQYRRFSSKRTQTQIGI
                     DRSLSENMQIGGVLTYSDSQHTFDQAGGKNTFVQANLYGKYYLNDAWYVAGDIGAGSL
                     RSRLQTQQKANFNRTSIQTGLTLGNTLKINQFEIVPSAGIRYSRLSSADYKLGDDSVK
                     VSSMAVKTLTAGLDFAYRFKVGNLTVKPLLSAAYFANYGKGGVNVGGKSFAYKADNQQ
                     QYSAGAALLYRNVTLNVNGSITKGKQLEKQKSGQIKIQIRF"
     gene            complement(277154..277429)
                     /locus_tag="NGO_RS01415"
     CDS             complement(277154..277429)
                     /locus_tag="NGO_RS01415"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_153707850.1"
                     /translation="MIKQSHKTVITRFENDKNANEKPQYYPRQRQTFHRHSRKSGNPK
                     TKSRRNLSERTEPQKPASHLRLNNRTKKAEIKTSGFFFKLAIKHQNE"
     gene            277461..279680
                     /locus_tag="NGO_RS01420"
                     /old_locus_tag="NGO0276"
                     /old_locus_tag="NGO_0276"
     CDS             277461..279680
                     /locus_tag="NGO_RS01420"
                     /old_locus_tag="NGO0276"
                     /old_locus_tag="NGO_0276"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009311926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA internalization-related competence protein
                     ComEC/Rec2"
                     /protein_id="WP_154017517.1"
                     /translation="MFRRWFLPCWVVGVAVSFALSVVPHWPFWLAAFAVLAVLARRFA
                     FAGLMLCVLAGAAYGVFRTEAALSSQWRAEAVSGVPLTVEVTDMPRSDGRRVQFAAKA
                     VDSGGRTFDLLLSDYKRREWAVGSRWRITARVHPVVGELNLRGLNREAWALSNGVGGV
                     GTVGADRVLLHGGSGWGIAVWRSRISRNWRQADADGGLSDGIGLMRALSVGEQSALRP
                     ELWQAFRPLGLTHLVSISGLHVTMVAVLFAWLAKRLLACSPRLPARPRAWVLAAGCAG
                     ALFYALLAGFSVPTQRSVLMLAAFAWAWRRGRLSAWATWWQALAAVLLFDPLAVLGVG
                     TWLSFGLVAALIWACAGCLYEGKRQTAVRGQWAASVLSLVLLGYLFASLPLVSPLVNA
                     VSIPWFSWVLTPLALLGSVVPFAPLQQAGAFLAEYTLRFLVWLADVSPEFAVAAAPLP
                     LLVLAVCAALLLLLPRGLGLRPWAVLLLAGFVSYRPEAVPENEAAVTVWDAGQGLSVL
                     VRTANRHLLFDTGTVAAAQTGIVPSLNAAGVRRLDKLVLSHHDSDHDGGFQAVGKIPN
                     GGIYAGQPEFYEGARHCAEQRWQWDGVDFEFLRPSERKNIDDNGKSCVLRVVAGGAAL
                     LVTGDLDTKGEESLVGKYGGNLYSQVLVLGHHGSNTSSSGVFLNAVSPEYAVASSGYA
                     NAYKHPTEAVQNRVRAHGIKLLRTDLSGALQFGLGRGGVKAQRLRVYKFYWQKKPFE"
     gene            complement(279750..280553)
                     /locus_tag="NGO_RS01425"
                     /old_locus_tag="NGO0277"
                     /old_locus_tag="NGO_0277"
     CDS             complement(279750..280553)
                     /locus_tag="NGO_RS01425"
                     /old_locus_tag="NGO0277"
                     /old_locus_tag="NGO_0277"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002244053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor BamD"
                     /protein_id="WP_003687645.1"
                     /translation="MKKILLTVSLGLALSACATQGTADKDAQITQDWSVEKLYAEAQD
                     ELNSSNYTRAVKLYEILESRFPTSRHARQSQLDTAYAYYKDDEKDKALAAIERFRRLH
                     PQHPNMDYALYLRGLVLFNEDQSFLNKLASQDWSDRDPKANREAYQAFAELVQRFPNS
                     KYAADATARMVKLVDALGGNEMSVARYYMKRGAYIAAANRAKKIIGSYQNTRYVEESL
                     AILELAYKKLDKPQLAADTRRVLETNFPKSPFLTHAWQPDDMPWWRYWH"
     gene            280552..281676
                     /gene="rluD"
                     /locus_tag="NGO_RS01430"
                     /old_locus_tag="NGO0278"
                     /old_locus_tag="NGO_0278"
     CDS             280552..281676
                     /gene="rluD"
                     /locus_tag="NGO_RS01430"
                     /old_locus_tag="NGO0278"
                     /old_locus_tag="NGO_0278"
                     /EC_number="5.4.99.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002258136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA pseudouridine(1911/1915/1917) synthase
                     RluD"
                     /protein_id="WP_003692709.1"
                     /translation="MQNTSFDNESDYSDDSDFASASGTENRIGLTVPLELAGGRLDAV
                     LAKLLPDYSRSRLTSWIKEGAVIVNDKPSQPKDKMIGGEQICVTVRPSEENLAFVPEP
                     MDLDIVYEDDTVIVVNKPAGLVVHPAAGNWTGTLLNGLLAHCPELSQIPRAGIVHRLD
                     KETSGLMVVAKTLPAQNSLVRQLQERTVKRIYRAVANGIVPFDGKIETQIGRDPHNRL
                     KMAAVKFGGKPAVTHVKVLERYLAHSYIECSLGTGRTHQIRVHMREANHPLAGDPVYG
                     NPRHPCGDTVKEAVKSLGARQALHAYRLSFTHPESGETVSFEAPIPDDIYHLLSVLRL
                     EAGLDSSLSNEEEWQDKFGADDDDDWNEDDYDVEVVYVRE"
     gene            complement(281803..282636)
                     /locus_tag="NGO_RS01435"
                     /old_locus_tag="NGO0278a"
                     /old_locus_tag="NGO_01500"
     CDS             complement(281803..282636)
                     /locus_tag="NGO_RS01435"
                     /old_locus_tag="NGO0278a"
                     /old_locus_tag="NGO_01500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014580117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bile acid:sodium symporter family protein"
                     /protein_id="WP_010357152.1"
                     /translation="MFGMGLTLKPSDFDILFKHPKAVIIGVIAQFAIMPATAWLPSKL
                     LNLPAEIAVGVILVGCCPGGTASNVMTYLARGNVALSVAVTSVSTLISPLLTPAIFLM
                     LAGEMLEIQAAGMLMSIVKMVLLPIVLGLIVHKVLGSKTEKPTDALPLVSVAAIVLII
                     GAVVGASKGKIMESGLLIFAVVVLRNGIGYLLGFFAAKWTGLPYDAQKTLAIEVGMQN
                     SGLAAALAAAHFAAAPVVAVPGALFSVWHNISGSLLATYWAAKAGKHKKTLNAFHHNA
                     V"
     gene            complement(282855..283046)
                     /locus_tag="NGO_RS01440"
                     /old_locus_tag="NGO_01505"
     CDS             complement(282855..283046)
                     /locus_tag="NGO_RS01440"
                     /old_locus_tag="NGO_01505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003694884.1"
                     /translation="MLQQGTAHQAPHCVLPERGCPPIRFYRYKQTGFNRKGMGIKSIS
                     DTSRAMPSENQSPLSDGIV"
     gene            283231..284010
                     /gene="pgeF"
                     /locus_tag="NGO_RS01445"
                     /old_locus_tag="NGO0281"
                     /old_locus_tag="NGO_0281"
     CDS             283231..284010
                     /gene="pgeF"
                     /locus_tag="NGO_RS01445"
                     /old_locus_tag="NGO0281"
                     /old_locus_tag="NGO_0281"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002242497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan editing factor PgeF"
                     /protein_id="WP_003690756.1"
                     /translation="MKTITETLNLAPKGKNFLTADWPAPANVKTLITTRNGGVSQGAY
                     QSLNLGTHVGDDPETVRRNREIVQQQVGLPVAYLNQIHSTIVVNAAEALDGTPDADAS
                     VDDTGKAVCAVMTADCLPVLFCDRAGTAVAAAHAGWSGLAGGVLQNTIAAMKVPPVEI
                     MAYLGPAISADAFEVGQDVFDAFCTSMPEAAAAFEPIGGGKFLADLYALARLILKREG
                     VGGVYGGTHCTVLERDIFFSYRRDGATGRMASLIWLDGNAV"
     gene            284062..284541
                     /locus_tag="NGO_RS01450"
                     /old_locus_tag="NGO0282"
                     /old_locus_tag="NGO_0282"
     CDS             284062..284541
                     /locus_tag="NGO_RS01450"
                     /old_locus_tag="NGO0282"
                     /old_locus_tag="NGO_0282"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003704424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_003687653.1"
                     /translation="MNKIFLTAAALVLGACGFHLKGADGISPPLTYRSWHIEGGQALQ
                     FPLETALYQASGRVDDAAGAQMTLRIDSVSQNKETYTVTRAAVINEYLLILTVEAQVL
                     KRGEPVGKPMTVSVRRILDYADNEILGKQEEEETLWAEMRQDVAEQIVRRLTFLKAE"
     gene            284543..285541
                     /locus_tag="NGO_RS01455"
                     /old_locus_tag="NGO0283"
                     /old_locus_tag="NGO_0283"
     CDS             284543..285541
                     /locus_tag="NGO_RS01455"
                     /old_locus_tag="NGO0283"
                     /old_locus_tag="NGO_0283"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002230375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta"
                     /protein_id="WP_003687654.1"
                     /translation="MAAHIGRIDTDAPLKPLYVIHGEEELLRIEAVDALRAAAKKQGY
                     LNREAYTADASFDWNELLQTAGNAGLFADLKLLELHIPNGKPGKNGGEALQDFAARLP
                     EDTVTLVLLPKLEKTRLQSKWFAALAAKGEVWEAKPVGAAALPQWIRGRLDKIGLGIE
                     ADALALFAERVEGNLLAARQEIDKLALLYPKGHAVNIDEAQTAVANVARFDAFQLAGA
                     WMKGDVPRVCRLLDGLEEEGEEPVLLLWAVAEDVRTLIRLAAALKQGQSIQSVRNSLR
                     LWGDKQTLAPLAVKRISVVRLLDALKTCAQIDRIIKGAEDGDAWTVFKQLVVSLAE"
     gene            285662..286081
                     /locus_tag="NGO_RS01460"
                     /old_locus_tag="NGO0284"
                     /old_locus_tag="NGO_0284"
     CDS             285662..286081
                     /locus_tag="NGO_RS01460"
                     /old_locus_tag="NGO0284"
                     /old_locus_tag="NGO_0284"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002238945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002217668.1"
                     /translation="MDNKTKLRLGGLILLTTAVLSLIIVLIVDSWPLAILLAAVIVAA
                     AAGGFVWTSRRQQRQFIERLKKFDIDPEKGRINEANLRRMYHSGGQHQKDAITLICLS
                     QKCSVDEAHAMFKKRPTRQEINQMAAKQSRGQKRPHR"
     gene            286157..286672
                     /locus_tag="NGO_RS01465"
                     /old_locus_tag="NGO0285"
                     /old_locus_tag="NGO_0285"
     CDS             286157..286672
                     /locus_tag="NGO_RS01465"
                     /old_locus_tag="NGO0285"
                     /old_locus_tag="NGO_0285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004519927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RDD family protein"
                     /protein_id="WP_033908763.1"
                     /translation="MMILKTAPLKRRFAAILYEMLLVGAATCLAALLAGIAAIFLNPV
                     SIAVSALVTSILIMGAWWLYFRANWHGQGQTLAMRTWKIGLCDLNGIQPSLHLLRLRF
                     IWACIFIVFIPMLAYAGLRHFLGIPPKGAAGAALVWLILPWGFALLNPDRQFLYDFLA
                     GTRLVDVKEQS"
     gene            complement(286763..287647)
                     /locus_tag="NGO_RS01470"
                     /old_locus_tag="NGO0286"
                     /old_locus_tag="NGO_0286"
     CDS             complement(286763..287647)
                     /locus_tag="NGO_RS01470"
                     /old_locus_tag="NGO0286"
                     /old_locus_tag="NGO_0286"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YicC family protein"
                     /protein_id="WP_003687657.1"
                     /translation="MSSGNIRIHSMTGFANAAAECGSKRINLDIRAVNHRFLDIQIRM
                     PDDLRHLENGIREQISSHLARGKVECKIQIQDAENGNQSLELNRVLVGQLAEINKNLR
                     KHYDLAKLGVADILRFPGVLASQKENTEALAKTIVELADKALKDFTAARRREGKKLGE
                     HLLQRIKNMEEIIDALSEIFPALVEAHKEKIRTRLAEAVGSIDNDRLQQEFALFIQKS
                     DIDEEFSRLRTHIAEVRRIVTEHKGSSGKRLDFLMQELNREANTLGSKSIATECTQAS
                     VELKVLIEQMREQVQNIE"
     gene            287747..288223
                     /locus_tag="NGO_RS01475"
                     /old_locus_tag="NGO_01540"
     CDS             287747..288223
                     /locus_tag="NGO_RS01475"
                     /old_locus_tag="NGO_01540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR00645 family protein"
                     /protein_id="WP_003687659.1"
                     /translation="MESRAFVAARKGNVSSKISKTRTGYGFFAKMIFASRWLQVPIYA
                     GLTVVRAICAYKFLKSLKHLVMNLDVSDENAIMLAVLNLIDVVMIANLLTMVQIGGYE
                     SFVSRLRIDDHPDRPEWLSHVNAPVLKVRLSMSIIGIHPSICSKHLSIPPICRKSS"
     gene            complement(288380..289243)
                     /gene="rpoH"
                     /locus_tag="NGO_RS01480"
                     /old_locus_tag="NGO0288"
                     /old_locus_tag="NGO_0288"
     CDS             complement(288380..289243)
                     /gene="rpoH"
                     /locus_tag="NGO_RS01480"
                     /old_locus_tag="NGO0288"
                     /old_locus_tag="NGO_0288"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoH"
                     /protein_id="WP_014580118.1"
                     /translation="MNNAFALPAIQSGNGSLEQYIHTVNSIPMLSQEEETRLAERRIK
                     GDLNAAKQLILSHLRVVVSIARGYDGYGLNQADLIQEGNIGLMKAVKRYEPGRGARLF
                     SFAVHWIKAEIHEFILRNWRLVRVATTKPQRKLFFNLRSMRKNLNVLSPKEAQDIADD
                     LGVKLSEVLEMEQRMTGHDIAIMADNSDDEDSFAPIDWLADHDSEPSRQLSKQAHYAL
                     QTEGLQNALAQLDDRSRRIVESRWLQDDGGLTLHQLAAEYGVSAERIRQIEAKAMQKL
                     RGFLTEEAEAV"
     gene            complement(289507..291045)
                     /gene="lnt"
                     /locus_tag="NGO_RS01485"
                     /old_locus_tag="NGO0289"
                     /old_locus_tag="NGO_0289"
     CDS             complement(289507..291045)
                     /gene="lnt"
                     /locus_tag="NGO_RS01485"
                     /old_locus_tag="NGO0289"
                     /old_locus_tag="NGO_0289"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="WP_003687663.1"
                     /translation="MFSKLDKYWQHPALYWPLLILFAAATPFAFAPYYHFWLMPLIFG
                     AFVRLIELRPRFAASSAYLFGLTAYTAQFYWIHTALHDVSGLPDLYAVPLTFLLPAYL
                     ALYPALCFWLWKKFTLPQGIKTGLVLPILWTLTEFARERFLTGFGWGAIGYSQITPDS
                     PLAGFAPLGGIHMVTLATAFLGVWLVLAIDNTARSGKRLLPAILIAALLAAGYTAQQT
                     DFTRPDGSRSTVALLQGNIAQTLKWREDQVIPTIQKYYEQVGKTTADIVILPETAIPI
                     MRQNLPENILAQFAEQAQNNGSALAVGISQYTSDGNGYENAVINLTGYQENNQDGIPY
                     YAKNHLVPFGEYKPLPLLTTPLYKMMDMPLSDFRKGGGKQSAMMMKNQKIAFNICYED
                     GFGDELIAAAKDATLLANVSNMAWYGKSNAMYQHLQQSQARAMELGRYMVRATNTGAT
                     AIISPKGNIIAQAQPDTETVLEGHIKGYIGETPYMKTGSSWWLMGILTLAALILFIFR
                     NKEH"
     gene            complement(291138..291855)
                     /locus_tag="NGO_RS01490"
                     /old_locus_tag="NGO0290"
                     /old_locus_tag="NGO_0290"
                     /pseudo
     CDS             complement(291138..291855)
                     /locus_tag="NGO_RS01490"
                     /old_locus_tag="NGO0290"
                     /old_locus_tag="NGO_0290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004519693.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF808 domain-containing protein"
     gene            292050..293780
                     /locus_tag="NGO_RS01495"
                     /old_locus_tag="NGO0291"
                     /old_locus_tag="NGO_0291"
     CDS             292050..293780
                     /locus_tag="NGO_RS01495"
                     /old_locus_tag="NGO0291"
                     /old_locus_tag="NGO_0291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium/proton antiporter"
                     /protein_id="WP_003692721.1"
                     /translation="MDWMNSLFLLGGALLFLSVVSTTLSARLGMPLLLVFLAVGMLAG
                     EEGVGGIAFNNVVMANFISQLALAVILLDGGLRTQLSSFRIALKPASVLASWGVFATV
                     LPLGLFATFYLGLDWKFGVLMAAIVGSTDAGAVFSLLRNSGVRLNERVQATLEIESGA
                     NDPMAVFLVTALITMIMQPAESGAAAFVRMLALQIGFGLLTGWAGGKILAKLVRRLNL
                     AEGLYALMIVSGGLLVFAFTNTIGGSGFLAVYLAGIIVGNQRNRATEHVLRVMDGLAW
                     LAQATLFVMLGLLVSPAGVLDRAAEALAIAAFLMLVARPLAVFGGLWKFNYSLREKAY
                     ISWLGLRGAVPISLAMMPLVMGVPNSHLLFDVAFAVVVLSLLIQGTTIPVMARLLKVA
                     MPNKPEPKDTHDIWLAEKEIVRMSAFKVVAESEAEGHHPDTVEPISDSFDARCFALIR
                     NGSRIEMQSDTVLQAEDLAWYILADGKVDKMAKYFTETGIGVRENFDFFGEFVVSPAA
                     RSGDLALAYGLKLEAGEEGLSLAELFDKRSDSQEPVEGDRIDIGGFMLTAKEVDGGGN
                     IGSMGLKVPR"
     gene            complement(293777..294244)
                     /locus_tag="NGO_RS01500"
                     /old_locus_tag="NGO0292"
                     /old_locus_tag="NGO_0292"
     CDS             complement(293777..294244)
                     /locus_tag="NGO_RS01500"
                     /old_locus_tag="NGO0292"
                     /old_locus_tag="NGO_0292"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003692723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c2"
                     /protein_id="WP_003692723.1"
                     /translation="MNTTRLPTAFILCCLCAAASAADNSIMTKGQKVYESNCIACHGK
                     KGEGRGTAFPPLFRSDYIMNKPHVLLHSMVKGINGTIKVNGKTYNGFMPATAISDADI
                     AAVATYIMNAFDNGGGSVTEKDVKQAKGKKNQTDKMPSETGNPASDGIQIKPF"
     gene            complement(294435..295445)
                     /locus_tag="NGO_RS01505"
                     /old_locus_tag="NGO0293"
                     /old_locus_tag="NGO_0293"
     CDS             complement(294435..295445)
                     /locus_tag="NGO_RS01505"
                     /old_locus_tag="NGO0293"
                     /old_locus_tag="NGO_0293"
                     /EC_number="4.99.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002261728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="WP_010359848.1"
                     /translation="MLPFLPEPSLSYTQQNRTAVLLLNLGTPDAPTAQAVRPYLKSFL
                     TDRRIVELPKWLWYPILHGLVLTFRPKKSAHAYEKIWFKEGSPLEVYTARQAAALAER
                     MPDLIVRHAMTYGNPSIADVLAELKSQGVGRLLAIPLYPQYAASSSGAAVDKVCEQLL
                     LQRNQMSVRTISRFYDDAGYIDAMKNHILRYWAEHGRGKKLMLSFHGVPQKHYDLGDP
                     YPDECRHTAKLLAEALELTEDEYTVSFQSQFGRAKWVTPSTQDLFGKLPKQGVTELDV
                     FCPGFLADCLETMEEIALMGREQFYEAGGKNYRYIPCLNDNPDWIDALVALAEENLGG
                     WR"
     gene            complement(295527..296642)
                     /gene="tgt"
                     /locus_tag="NGO_RS01510"
                     /old_locus_tag="NGO0294"
                     /old_locus_tag="NGO_0294"
     CDS             complement(295527..296642)
                     /gene="tgt"
                     /locus_tag="NGO_RS01510"
                     /old_locus_tag="NGO0294"
                     /old_locus_tag="NGO_0294"
                     /EC_number="2.4.2.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010357167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA guanosine(34) transglycosylase Tgt"
                     /protein_id="WP_010951022.1"
                     /translation="MLKFTLHKKDGLARRGTLELNHGKIETPVFMPVGTYGSVKAMNP
                     QNLHDIKAQIILGNTYHLWLRPGLEVVEQFGGLHGFIGWDKPILTDSGGFQVFSLSDM
                     RKLTEEGCTFKSPINGDKLFLSPEISMKIQTVLNSDIAMQLDECTPGETTREQARKSL
                     QMSLRWAERSKKAFEDLKNPNALFGIVQGAMYEDLREESLRGLEEFDFPGLAVGGLSV
                     GEPKPEMYRMLHAVGPMLPERKPHYLMGVGTPEDLVYGVAHGIDMFDCVMPTRNARNG
                     WLFTRFGDLKIKNAKHKPDKRPIDESCTCYACQNFSRAYLHHLHRAGEILGAQLNTIH
                     NLHFYQVIMAEMRDAVEQGKFADWQAQFHENRARGVD"
     gene            296821..296897
                     /locus_tag="NGO_RS01515"
                     /old_locus_tag="NGO_18811"
                     /old_locus_tag="NGO_t06"
     tRNA            296821..296897
                     /locus_tag="NGO_RS01515"
                     /old_locus_tag="NGO_18811"
                     /old_locus_tag="NGO_t06"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:296855..296857,aa:Val,seq:gac)
     gene            296950..298863
                     /gene="thrS"
                     /locus_tag="NGO_RS01520"
                     /old_locus_tag="NGO0295"
                     /old_locus_tag="NGO_0295"
     CDS             296950..298863
                     /gene="thrS"
                     /locus_tag="NGO_RS01520"
                     /old_locus_tag="NGO0295"
                     /old_locus_tag="NGO_0295"
                     /EC_number="6.1.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009312109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine--tRNA ligase"
                     /protein_id="WP_010951023.1"
                     /translation="MLNITLPDCSVRQYESPVTVAQIAASIGAGLAKAAVAGKVNGKL
                     VDACDPIVEDSAVQIITPKDQEGIEIIRHSCAHLVGHAVKQLYPNAKMVIGPVIEEGF
                     YYDIATEKPFTPEDVAAIEARMKELIAQDYDVVKIMTPRAEAIKIFQERGEEYKLRLI
                     DDMPEVEAMGIYHHQEYVDMCRGPHVPNTRFLKNFKLTKLAGAYWRGDSNNEMLQRIY
                     GTAWATKDELKDYIQRIEEAEKRDHRKLGKQLDLFHLQDEAPGMVFWHPKGWALWQTI
                     EQHMRKELNAAGYKEVKTPQIMDKTFWEKSGHWDNYKDNMFVTSSEKREYAVKPMNCP
                     GHVQIFNNGLRSYRDLPMRLAEFGSCHRNEPSGALHGLMRVRGFVQDDAHIFCTEDQI
                     VSEARAFNELLVRIYKQFGFHDVSVRLSLRPEKRAGSDDVWDKAEQGLREALTACGVE
                     WGELPGEGAFYGPKIEYHVKDALGRSWQCGTLQLDFVLPERLDAEYVTENNDRARPVM
                     LHRAILGSLERFIGILIENHAGSFPLWLAPVQMVIMNITENQADYCREVAAKLQAAGF
                     RAELDLRNEKIGYKIRDNSQYRFPYQIVIGDKEKQENKVAVRRKAEDLGSLDLDDFIA
                     QLQQEITDALVNH"
     gene            298869..299402
                     /gene="infC"
                     /locus_tag="NGO_RS01525"
                     /old_locus_tag="NGO0296"
                     /old_locus_tag="NGO_0296"
     CDS             298869..299402
                     /gene="infC"
                     /locus_tag="NGO_RS01525"
                     /old_locus_tag="NGO0296"
                     /old_locus_tag="NGO_0296"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013212341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="WP_162849214.1"
                     /translation="MGVFIIAQEREARINGEITAKEVRLISESGEQLGVVSVREALAM
                     AEGQDVDLVEISPTAKPPVCKLMDYGKYKYQQAKKRDEAKKNQKQVQIKEIKFRPGTD
                     EGDYQIKMRNINRFLADGDKVKVTLRFRGREMAHQQLGAQLLERVKEDLAEVAQIESF
                     PKMEGRQMVMMIAPKKK"
     gene            299549..299746
                     /gene="rpmI"
                     /locus_tag="NGO_RS01530"
                     /old_locus_tag="NGO0297"
                     /old_locus_tag="NGO_0297"
     CDS             299549..299746
                     /gene="rpmI"
                     /locus_tag="NGO_RS01530"
                     /old_locus_tag="NGO0297"
                     /old_locus_tag="NGO_0297"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002641005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="WP_002232040.1"
                     /translation="MPKMKTKSSAKKRFKVLGNGGVKRAHAFKRHILTKKTTKNKRQL
                     RGTSMVNDRDLASVAKMLPYA"
     gene            299759..300118
                     /gene="rplT"
                     /locus_tag="NGO_RS01535"
                     /old_locus_tag="NGO0298"
                     /old_locus_tag="NGO_0298"
     CDS             299759..300118
                     /gene="rplT"
                     /locus_tag="NGO_RS01535"
                     /old_locus_tag="NGO0298"
                     /old_locus_tag="NGO_0298"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002225461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="WP_002214103.1"
                     /translation="MPRVKRGVTARARHQKIFALAKGYRGRRKNVYRVAKQAVMKAGQ
                     YAYRDRRQRKRQFRQLWIVRINAGARENGLSYSKFMNGLKRASIEIDRKVLADLAVFD
                     KAAFAQLVEKAKAALAA"
     gene            300359..301348
                     /gene="pheS"
                     /locus_tag="NGO_RS01540"
                     /old_locus_tag="NGO0299"
                     /old_locus_tag="NGO_0299"
     CDS             300359..301348
                     /gene="pheS"
                     /locus_tag="NGO_RS01540"
                     /old_locus_tag="NGO0299"
                     /old_locus_tag="NGO_0299"
                     /EC_number="6.1.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003675497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanine--tRNA ligase subunit alpha"
                     /protein_id="WP_010951025.1"
                     /translation="MENVNRIVAEGIAAVEAAQDFNALEQIKARYLGKTGELTGLLKT
                     LGQMSPEERKTIGAHINECKNRFQTAFNAKRDALNEAKLQARLAAEALDITLPGRAQE
                     GGSLHPVTLTLQRVVELFHGMGFEVADGPEIEDDFHNFQALNIPANHPARAMQDTFYV
                     ENGDVLRTHTSPIQIRYMLDKKEPPIRIIAPGRVYRVDSDATHSPMFHQAEGLWVEEG
                     VTFADLKAVFTDFIRRFFERDDLQVRFRPSFFPFTEPSAEIDIMGENGKWLEVGGCGM
                     VHPNVLKNVNIDPEKYTGFAFGIGLDRFAMLRYNVNDLRLFFDNDLNFLKQFE"
     gene            301365..301778
                     /locus_tag="NGO_RS01545"
                     /old_locus_tag="NGO0300"
                     /old_locus_tag="NGO_0300"
     CDS             301365..301778
                     /locus_tag="NGO_RS01545"
                     /old_locus_tag="NGO0300"
                     /old_locus_tag="NGO_0300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="very short patch repair endonuclease"
                     /protein_id="WP_003690774.1"
                     /translation="MDKLTPEQRKKCMQSNKSTGTKPELVLAKAMWALGLRYRKNSGS
                     IFGKPDFSFKKYKVAVFVDGEFWHGKDWEQKKAVIKGNREFWIAKIERNIQRDIEVTG
                     RLKAEGWTVLRFWSNDVVKNTTCCAEKVKEIIQTR"
     gene            301780..302118
                     /locus_tag="NGO_RS01550"
                     /old_locus_tag="NGO_01615"
     CDS             301780..302118
                     /locus_tag="NGO_RS01550"
                     /old_locus_tag="NGO_01615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA cytosine methyltransferase"
                     /protein_id="WP_003687679.1"
                     /translation="MIYKNKIKEDGQDERLKEKAAQYRLFENNDTFQTALKPKFTFID
                     LFAGIGGFRIAMQNLGGEYVFSSEWDEKAKLTYEANFGEVPFGDITLEEIKQYIPKQF
                     DVLCGFTLSK"
     gene            302132..302377
                     /locus_tag="NGO_RS01555"
                     /old_locus_tag="NGO0302"
                     /old_locus_tag="NGO_0302"
     CDS             302132..302377
                     /locus_tag="NGO_RS01555"
                     /old_locus_tag="NGO0302"
                     /old_locus_tag="NGO_0302"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687680.1"
                     /translation="MRLSDYILNNKININNLSDKQVQEIIDYFSSEIDDWLLASEKEL
                     KDYDVYLYKLVLDGQQYVQGIRKSVLYDFLMENQKDS"
     gene            302383..303132
                     /locus_tag="NGO_RS01560"
                     /old_locus_tag="NGO0303"
                     /old_locus_tag="NGO_0303"
     CDS             302383..303132
                     /locus_tag="NGO_RS01560"
                     /old_locus_tag="NGO0303"
                     /old_locus_tag="NGO_0303"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003704414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_003706646.1"
                     /translation="MKKWTRDETLVALYLYYIIPFQKVSKDNPVIQEYAEILGRTPSA
                     LGMKIGNLGRLDPTLKVKNISGLSNGSKMDVVVWNEFSGDWEQLNKEFEGVISQYQSN
                     DENSNIEIESPEIPKGRERFARISVRVNQGFFRSSVLAAYNNQCCITGLKQPELLVAS
                     HIKPWGEDKDNRLNPRNGLCLNALHDKAFDRGLLGIDENFKIIFSPLLAKTEGFDDLF
                     KPYENRMIRLPERLNPSLEFLKFHRENIFQS"
     gene            303223..305586
                     /locus_tag="NGO_RS01565"
                     /old_locus_tag="NGO0304"
                     /old_locus_tag="NGO_0304"
     CDS             303223..305586
                     /locus_tag="NGO_RS01565"
                     /old_locus_tag="NGO0304"
                     /old_locus_tag="NGO_0304"
                     /EC_number="6.1.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanine--tRNA ligase subunit beta"
                     /protein_id="WP_003687684.1"
                     /translation="MQFSYSWLKTQANPDLSADKLEHLLTMAGLEVEEIDTAAPAFSG
                     VVVAEVKSVEKHPDADRLNVTQVDAGTGELVQIVCGAPNVKPGIKVPCSLPVAVLPGN
                     FKIKPTKMRGVPSNGMLCSTNELGLPDDGVDGLHILPEDAPVGTNIREYLDLDDMLFT
                     LKITPNRADCLSVKGIAREVSALTQCAFTPVEIQTAPIGSEKKQAVRIDAPADCGRFI
                     SRVIENVNAKAATPDWMKQRLERSGIRSISALVDIGNYVMLEIGQPMHVFDADKLSGS
                     LIVRRAQNGETLACLNEKTVTLADNTLVVADEKGALSLAGLMGGAASAVSDGTQNIVL
                     EAAWFEPEIIVGKSRQYGFGSDSSFRFERGVDYRLQADAIERATELVLQICGGAAGEM
                     VEAQGKLPEAKQVGLRLGRLKTVLGVDIPAEQVETILQHLGLQPEKTAEGFRITAPSF
                     RFDIEIEADLIEEIGRVYGYENIPDDYTSGRLKMSELPETRRPRFAVYNEMAARGYRE
                     VISYAFVDEQWELDFAANAAPIRLQNPLAAQYAVMRSTLIGGLVEILQNNLNRKQNRV
                     RVFEIACVFGKGSDGRFVQNERIGGLWYGAAMPEQWGEKTRNADFYDIKADVENLLKN
                     KAVEFVKTGHPALHPGRAANIVSDGKVIGFVGELHPKWLQKYDLPQAPLVFEIDMAAV
                     LECGKTRYRAVSKFQPVRRDLAFVMPEVMNHDDLLLVLKGAANKLVQEISVFDVYRGT
                     GLPEGMKSVAVKVILQDMENTLTDEAVEPLIGKLIGVATEAGARLRS"
     gene            305660..305962
                     /locus_tag="NGO_RS01570"
                     /old_locus_tag="NGO0305"
                     /old_locus_tag="NGO_0305"
     CDS             305660..305962
                     /locus_tag="NGO_RS01570"
                     /old_locus_tag="NGO0305"
                     /old_locus_tag="NGO_0305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002641098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integration host factor subunit alpha"
                     /protein_id="WP_003687686.1"
                     /translation="MTLTKAELADILVDKVSNVTKNDAKEIVELFFEEIRSTLASGEE
                     IKISGFGNFQLRDKPQRPGRNPKTGEEVPITARRVVTFHASQKLKGMVEHYYDKQR"
     gene            305946..306254
                     /locus_tag="NGO_RS01575"
                     /old_locus_tag="NGO0306"
                     /old_locus_tag="NGO_0306"
     CDS             305946..306254
                     /locus_tag="NGO_RS01575"
                     /old_locus_tag="NGO0306"
                     /old_locus_tag="NGO_0306"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003690777.1"
                     /translation="MTNNVDLTIPAKRYFTLDELCGLLQISPYGFAQWQHDHGVVVGY
                     GGERYTRLDVVKLLKLKSTFAPYAEGAESGSDGNRPVTLQEIGDGLKDLLEDLDKELC
                     "
     gene            306430..306915
                     /gene="fxsA"
                     /locus_tag="NGO_RS01580"
                     /old_locus_tag="NGO0307"
                     /old_locus_tag="NGO_0307"
     CDS             306430..306915
                     /gene="fxsA"
                     /locus_tag="NGO_RS01580"
                     /old_locus_tag="NGO0307"
                     /old_locus_tag="NGO_0307"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009349087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein FxsA"
                     /protein_id="WP_003687689.1"
                     /translation="MRFFGIGFLVLLFLEIMSIVWVADWLGGGWTLFLMAATFAAGVL
                     MLRHTGLSGLLLAGAAVKSSGKVSVYQMLWPIRYTVAAVCLMSPGFVSSVLAVLLLLP
                     FKGGAVLQAGGAENFFNMNQSGRKEGFFHDDDIIEGEYTVEEPYGGNRSRNAIEHKKD
                     E"
     gene            307107..307331
                     /locus_tag="NGO_RS01585"
                     /old_locus_tag="NGO_01650"
     CDS             307107..307331
                     /locus_tag="NGO_RS01585"
                     /old_locus_tag="NGO_01650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687691.1"
                     /translation="MSVWDIWDRMVEIYHKYKKPCLVLAVDFVMGMVFIEPNEEPCIG
                     RCYAPMPESPDFANAVAMAVAMICIVFIYD"
     gene            307549..308850
                     /gene="bioA"
                     /locus_tag="NGO_RS01590"
                     /old_locus_tag="NGO0308"
                     /old_locus_tag="NGO_0308"
     CDS             307549..308850
                     /gene="bioA"
                     /locus_tag="NGO_RS01590"
                     /old_locus_tag="NGO0308"
                     /old_locus_tag="NGO_0308"
                     /EC_number="2.6.1.62"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002235617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine--8-amino-7-oxononanoate
                     transaminase"
                     /protein_id="WP_003687694.1"
                     /translation="MPSEHQHTSSLLNFDRTHLLHPYTSMTDPLPVYPVKRAEGVFIE
                     LADGTRLIDGMSSWWCAIHGYNHPVLNQAVENQMKQMAHVMFGGLTHEPAVELGKLLV
                     GILPQGLDRIFYADSGSVSVEVALKMAVQYQQARGLTAKQNIATVRRGYHGDTWNAMS
                     VCDPETGMHHIFGSALPQRYFVDNPKNRFDDEWDGADLQPVRALFEAHHVDIAAFILE
                     PVVQGAGGMYFYHPQYLRGLRDLCDEFDIVLIFDEIATGFGRTGKMFACEHAEVVPDI
                     MCIGKGLSGGYMTLAAAITSQKVTETISRGEAGVFMHGPTFMANPLACAVACASVKLL
                     LSQDWQANIRRIESILKGRLKAAWDIRGVKDVRVLGAIGVIELEKGVDMARFQADCVA
                     QGIWVRPFGRLVYLMPPYIISDGILTKLADKTVQILKEHSK"
     gene            308847..309494
                     /gene="bioD"
                     /locus_tag="NGO_RS01595"
                     /old_locus_tag="NGO0309"
                     /old_locus_tag="NGO_0309"
     CDS             308847..309494
                     /gene="bioD"
                     /locus_tag="NGO_RS01595"
                     /old_locus_tag="NGO0309"
                     /old_locus_tag="NGO_0309"
                     /EC_number="6.3.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003675485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent dethiobiotin synthetase BioD"
                     /protein_id="WP_003690778.1"
                     /translation="MKGVYFVSGIDTDIGKTVATGMLAKQLLQQGKSVITQKPVQTGC
                     QDIAEDIAVHRKIMGIPMQEADEQRLTMPEIFSHPASPHLAARLDGRGLDLDKIRTAT
                     QELAAQYEVVLVEGAGGLMVPLTEKLLTIDHIQQQAYPVILVTSGRLGSINHTLLSFV
                     VLKQYGIRLHSLVFNHIHDSRDAHVAQDSLNYLQCRLKADFPEAEWMELAKTGAV"
     gene            309509..309985
                     /locus_tag="NGO_RS01600"
                     /old_locus_tag="NGO0310"
                     /old_locus_tag="NGO_0310"
     CDS             309509..309985
                     /locus_tag="NGO_RS01600"
                     /old_locus_tag="NGO0310"
                     /old_locus_tag="NGO_0310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate lyase"
                     /protein_id="WP_010357240.1"
                     /translation="MEHLFGKWLPDLPAPVSDGIDLPMSRLLKARSLTAALCALPHTF
                     SVELLKLGEAETEYGRRRVRDVLLKLDGTAVVQARSACSVGSAFWQNILDCGTRPLGE
                     RLFQADLEGARSAFEFAVSSEGCGRYFAARRSRFSHQGEEMLLTEYFLPELKRFIG"
     gene            310005..310100
                     /locus_tag="NGO_RS01605"
     CDS             310005..310100
                     /locus_tag="NGO_RS01605"
                     /inference="COORDINATES: protein motif:HMM:NF026993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_157147422.1"
                     /translation="MRQPASKPHFNIRDSNLDTGHVDGTHGHYNF"
     gene            310109..310516
                     /locus_tag="NGO_RS01610"
                     /old_locus_tag="NGO0311"
                     /old_locus_tag="NGO_0311"
     CDS             310109..310516
                     /locus_tag="NGO_RS01610"
                     /old_locus_tag="NGO0311"
                     /old_locus_tag="NGO_0311"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687699.1"
                     /translation="MNIIEIISRNRFLKQIYPSGIMDISLVSFSTDLSNCILTIRTST
                     KPSVEIEKWGLWLKDYDTVEIELRNSFIKGMKCQNWSHNNRNICQVEIKNQEDGLKII
                     RFYDNNSNWLLELEVYGLVFQGCKTYMKEGYES"
     gene            310506..311396
                     /gene="ubiA"
                     /locus_tag="NGO_RS01615"
                     /old_locus_tag="NGO0312"
                     /old_locus_tag="NGO_0312"
     CDS             310506..311396
                     /gene="ubiA"
                     /locus_tag="NGO_RS01615"
                     /old_locus_tag="NGO0312"
                     /old_locus_tag="NGO_0312"
                     /EC_number="2.5.1.39"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002234757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="WP_010951027.1"
                     /translation="MNLKSPLFLRLSDRLDVYIRLMRADKPIGTLLLLWPTYWALWLA
                     SDGIPDLAVLAAFTIGTFLMRSAGCVINDFADRDFDGAVERTKNRPFAQGRVKKKEAL
                     LLTAFLCLLAALCLIPLNHLTWLMSLPALFLALTYPFTKRFFPIPQFYLGFAFSFGIP
                     MAFAAVGNSVPVEAWILFAANVLWTLAYDTVYAMADKEDDLKIGIKTSAVTFGRYDIA
                     AVMLCHGGFTLLMAVLGAVIGAAWAYWTAIPIVLLLQYRQYAAIKSRVRQICFETFLA
                     NNRIGWVWFAAIFAHTFFAK"
     gene            311581..312030
                     /gene="ptsN"
                     /locus_tag="NGO_RS01620"
                     /old_locus_tag="NGO0313"
                     /old_locus_tag="NGO_0313"
     CDS             311581..312030
                     /gene="ptsN"
                     /locus_tag="NGO_RS01620"
                     /old_locus_tag="NGO0313"
                     /old_locus_tag="NGO_0313"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS IIA-like nitrogen regulatory protein PtsN"
                     /protein_id="WP_003687701.1"
                     /translation="MSLIGEILPLSHIVLDMEVGSKKRLFEEAGLLLERESSLSHADV
                     FECLFAREKLGSTGLGQGVAIPHGRHASVKQATGAFIRTREPVGFDAPDGKPVSLVFI
                     LLVPENATGEHLEVLSKLAGKFSQKSIRESLMTVASAEEARAILTEE"
     gene            312034..312996
                     /locus_tag="NGO_RS01625"
                     /old_locus_tag="NGO0314"
                     /old_locus_tag="NGO_0314"
     CDS             312034..312996
                     /locus_tag="NGO_RS01625"
                     /old_locus_tag="NGO0314"
                     /old_locus_tag="NGO_0314"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HPr kinase/phosphorylase"
                     /protein_id="WP_003687702.1"
                     /translation="MPSISVRRLFDDNQYKLQLAWAAGNSGADNRIGVEADKPVLALV
                     GHLNFIHPNQIQVVGLAESEYLNRLESGETGYQFGDLFDISMSLVIVANDLPVSPGLR
                     DYCHKNDIPLLTSKLESPYLMDVLRIYLQRTLAASSVKHGVFLDVFEIGVLITGHSGL
                     GKSELALELISRGHSLIADDAVELFRIGPETLEGRCSPMLRDFLEVRGLGILNIRHIF
                     GETSIRPKKILQLIINLVEADDEYMKQLDRLSIRTETESILNVNVRSVTLPVAVGRNL
                     AVLVEAAVRNYILQLRGKDSTREFLERHQTQLKENEQNHENRPD"
     gene            312977..313831
                     /gene="rapZ"
                     /locus_tag="NGO_RS01630"
                     /old_locus_tag="NGO0315"
                     /old_locus_tag="NGO_0315"
     CDS             312977..313831
                     /gene="rapZ"
                     /locus_tag="NGO_RS01630"
                     /old_locus_tag="NGO0315"
                     /old_locus_tag="NGO_0315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002247444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNase adapter RapZ"
                     /protein_id="WP_003687703.1"
                     /translation="MKIVLISGLSGSGKSVALRQMEDLGYFCVDNLPLEMLPSLVSYH
                     IERADETELAVSVDVRSGIDIAQAREQIAYLRGLGHRVEVLFVEAEEAVLVRRFSETR
                     RGHPLSNQDMTLLESLKKEREWLFPLKEIAYCIDTSKMNAQQLRHAVRQWLKVERTGL
                     LVVLESFGFKYGVPNNADFMFDMRSLPNPYYDPELRPYTGMDKPVWDYLDGQPLAQEM
                     VDGIERFVTRWLPRLEDESRSYVTVAIGCTGGQHRSVYIVEKLARRLKGRYELLIRHR
                     QAQNLSGR"
     gene            313912..314853
                     /gene="ylqF"
                     /locus_tag="NGO_RS01635"
                     /old_locus_tag="NGO0316"
                     /old_locus_tag="NGO_0316"
     CDS             313912..314853
                     /gene="ylqF"
                     /locus_tag="NGO_RS01635"
                     /old_locus_tag="NGO0316"
                     /old_locus_tag="NGO_0316"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome biogenesis GTPase YlqF"
                     /protein_id="WP_003687704.1"
                     /translation="MAIQWFPGHMNKARKAIAERAKSVDMVIEMLDARMPASSENPLL
                     AQLSKGKPKLKILNKQDLADPERTKVWLDHYNSRPDTRAIALDSSETGAHGKITQACR
                     AMIPHRQGIDKPLRVLICGIPNVGKSTLINGMIGKKSAKTGNEPGITKAEQRLFLADD
                     FWLYDTPGMLWPKIIVEESGYNLAAGGAVGRNALDEEEVALELLDYLRRHYLPMLQER
                     YQADKDPSSHWDDNSWLEWIAKKRGAVLSGGRVNYQKAAENILTDFREGKIGRITLET
                     PNQWETWLKKARQKEAELKAIREARKAERKGQKPSEA"
     gene            314954..315556
                     /locus_tag="NGO_RS01640"
                     /old_locus_tag="NGO0317"
                     /old_locus_tag="NGO_0317"
     CDS             314954..315556
                     /locus_tag="NGO_RS01640"
                     /old_locus_tag="NGO0317"
                     /old_locus_tag="NGO_0317"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003707991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SMC-Scp complex subunit ScpB"
                     /protein_id="WP_002235622.1"
                     /translation="MTDKISPDALIEAALLTQTEPLTEKSMRELCVPPLSQDKLIDVL
                     AQLKTRWQDRALQLVHTQEGWRFQIVQTAFERLGSLQEQRAPRYSRAVMETLAIIAYQ
                     QPVTRGDIEGIRGVAVSQNVMQTLQDRGWIEVIGHRDTLGKPALWATTATFLSDLRLD
                     GLEELPPLTELGELVLPDLIEMPPTDEEEPETVPSDTLPN"
     gene            315740..317413
                     /gene="recN"
                     /locus_tag="NGO_RS01645"
                     /old_locus_tag="NGO0318"
                     /old_locus_tag="NGO_0318"
     CDS             315740..317413
                     /gene="recN"
                     /locus_tag="NGO_RS01645"
                     /old_locus_tag="NGO0318"
                     /old_locus_tag="NGO_0318"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002221225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecN"
                     /protein_id="WP_010951028.1"
                     /translation="MLLTLSLRDFVIVENLNLDFQSGFTVLTGETGAGKSITLDAIGL
                     LLGDKADYSQVRSGAKEAQLSALFDISHLPALKAELREQGLLDEGGEELSIRRIIDAK
                     GKSRSFINNQAATLAQLKAVGGQLIDIHGQNDHHSLNQEAAQRELLDAFVGGRVQAET
                     VRQLYQNWANAKKALQEAQEHADAVIIERERLEWQFNELNQLDIKQGEWEAFSQSHDS
                     LAHSAELLQAAEEVGSKIDGDNGIQRHIYQCQKLLANLQNIEPRFAESLNMLASIEAE
                     LGEISANMRDVAGHSDINPNELAAQEQRMGELMGMARKYRIEPEELPAKLAEIEERLQ
                     SLQAAADLDALEHNVAHNFAEYQEAAHILSAMRHQAAGRLSSDTTEHMQHLAMKGARF
                     DIVLLPSSPTAHGLEQVQFQVAANKGNPPRPLNKVASGGELARISLALQVVASQYTQV
                     PTLIFDEVDTGIGGGVAEMVGKALRALGRKHQVLAVTHLPQVASCGENHWRVRKHSEG
                     EQTVSEISILDEIQRIEEVARMLGGEVITDTTRQHAAELLQLASKNSLF"
     gene            317524..317600
                     /locus_tag="NGO_RS01650"
                     /old_locus_tag="NGO_18816"
                     /old_locus_tag="NGO_t07"
     tRNA            317524..317600
                     /locus_tag="NGO_RS01650"
                     /old_locus_tag="NGO_18816"
                     /old_locus_tag="NGO_t07"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:317558..317560,aa:Arg,seq:acg)
     gene            317618..317692
                     /locus_tag="NGO_RS01655"
                     /old_locus_tag="NGO_18821"
                     /old_locus_tag="NGO_t08"
     tRNA            317618..317692
                     /locus_tag="NGO_RS01655"
                     /old_locus_tag="NGO_18821"
                     /old_locus_tag="NGO_t08"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:317651..317653,aa:Glu,seq:ttc)
     gene            complement(318158..319777)
                     /gene="mnmC"
                     /locus_tag="NGO_RS01660"
                     /old_locus_tag="NGO0319"
                     /old_locus_tag="NGO_0319"
     CDS             complement(318158..319777)
                     /gene="mnmC"
                     /locus_tag="NGO_RS01660"
                     /old_locus_tag="NGO0319"
                     /old_locus_tag="NGO_0319"
                     /EC_number="2.1.1.61"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003707997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent
                     5-carboxymethylaminomethyl-2-thiouridine(34)
                     oxidoreductase MnmC"
                     /protein_id="WP_003687708.1"
                     /translation="MDNLVWDGIPDIRTLDQTIRKHAHPLNLIVCLPDNQIPDFQTAQ
                     DASDSECRLKHRLDQATQCLQFDSINLIEHILPDVRFWLVPPSRTRRLHEHFHHISWQ
                     TEAIPQTESKSDKPWFALPQTSERKKPEHVLVIGAGIAGASTAHALASHGISVTVLEA
                     RKAAQAASGNRQGLLYAKISPHDTGQTELLLAGYGYTKRLLGHILPDSDTWGGNGIIH
                     LNYSRTEQQRNHELGLQKHHNHLYRSITSAEAEKIAGIPLNTPYAEPLCGLYWQHGVW
                     LNPPAFVRTLLSHPLIELYENTTLTGISHDGEKWIASTPNGTFTATHIIYCTGAHSPC
                     LPETNLAALPLRQIRGQTGLTPSTPFSEQLRCAVSGESYISPSWHGLHCYGASFIPNS
                     SNTGWNEAEEASNRQALAHLNPALAESLFAANPNPQKHQGHAAIRCDSPDHLPVVGAL
                     GDIAAMRQTYAKLALDKNYRIDTTCPYLPNAYTNTAHGTRGLATAPICAAAVAAEILG
                     LPHLFSQRLRHALHPNRTVIRAIVRRQNLIP"
     gene            319897..320265
                     /locus_tag="NGO_RS01665"
                     /old_locus_tag="NGO0320"
                     /old_locus_tag="NGO_0320"
     CDS             319897..320265
                     /locus_tag="NGO_RS01665"
                     /old_locus_tag="NGO0320"
                     /old_locus_tag="NGO_0320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003707999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF971 domain-containing protein"
                     /protein_id="WP_003687709.1"
                     /translation="MNNIPVEIRLLKNRAVLVLTYGDEPKNLPAEFLRVYSPSAEVRG
                     HGVGQDVLQTGKADVQITDLQPVGQYALKISFSDGHDSGLYDWAYLHRLAYGYDAMWQ
                     EYLDKLAAAGASRFEKQSDC"
     gene            320308..321045
                     /gene="ubiE"
                     /locus_tag="NGO_RS01670"
                     /old_locus_tag="NGO0321"
                     /old_locus_tag="NGO_0321"
     CDS             320308..321045
                     /gene="ubiE"
                     /locus_tag="NGO_RS01670"
                     /old_locus_tag="NGO0321"
                     /old_locus_tag="NGO_0321"
                     /EC_number="2.1.1.163"
                     /EC_number="2.1.1.201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009173436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional demethylmenaquinone
                     methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol
                     methylase UbiE"
                     /protein_id="WP_003687710.1"
                     /translation="MGGQKTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGL
                     HRVWKHFTIHTAHLKKGDKVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGR
                     DRLLNEGMILPVSLADAEKLPFPDNYFNLVSVAFGLRNMTYKDAALKEMYRVLKPGGT
                     LLVLEFSKIYKPLEGAYDFYSFKLLPVMGRLIAKDADSYQYLAESIRMHPDQETLKQM
                     MLDAGFDSVDYHNMSAGIVALHKGVKF"
     gene            321265..321744
                     /locus_tag="NGO_RS01675"
                     /old_locus_tag="NGO0322"
                     /old_locus_tag="NGO_0322"
     CDS             321265..321744
                     /locus_tag="NGO_RS01675"
                     /old_locus_tag="NGO0322"
                     /old_locus_tag="NGO_0322"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687711.1"
                     /translation="MPESIFKQISSDILRLHRDSVYSLLATSGCNCQVHEAAYVNIDG
                     KYYIALSCEPEVGEVETGILLIEDESRNLRLSWVGSARELDRKDNAYKRALSALSRKL
                     GRCKDKLHTAVQPFLLELVPEKGRFSVGDEEVWISRNDLVRALYPVGYSMRQAVLQI"
     gene            complement(321872..322366)
                     /gene="folK"
                     /locus_tag="NGO_RS01680"
                     /old_locus_tag="NGO0323"
                     /old_locus_tag="NGO_0323"
     CDS             complement(321872..322366)
                     /gene="folK"
                     /locus_tag="NGO_RS01680"
                     /old_locus_tag="NGO0323"
                     /old_locus_tag="NGO_0323"
                     /EC_number="2.7.6.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002221222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine diphosphokinase"
                     /protein_id="WP_003687713.1"
                     /translation="MNNRHFAVIALGSNLDNPAQQIRGALDALSSHPDIRLEQASSLY
                     MTAPVGYDNQPDFINAVCTVSTTLDGIALLAELNRIEADFGRERSFRNAPRTLDLDII
                     DFDGISSDDPRLTLPHPRAHERSFVIRPLAEILPDFILGKYGKVVELSKRLGNQGIRL
                     LPDR"
     gene            complement(322376..322750)
                     /locus_tag="NGO_RS01685"
                     /old_locus_tag="NGO0324"
                     /old_locus_tag="NGO_0324"
     CDS             complement(322376..322750)
                     /locus_tag="NGO_RS01685"
                     /old_locus_tag="NGO0324"
                     /old_locus_tag="NGO_0324"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003762962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SirB2 family protein"
                     /protein_id="WP_003687714.1"
                     /translation="MQYLIVKYSHQIFVTITILVFNIRFFLLWKNPEKPLVGFWKALP
                     HLNDTMLLFTGLWLMKITHFSPFNAPWLGTKILLLFAYIALGMVMMRARPRSTKFYTV
                     YLLAMCCIACIVYLAKTKVLPF"
     gene            complement(322804..323370)
                     /locus_tag="NGO_RS01690"
                     /old_locus_tag="NGO_01750"
                     /pseudo
     CDS             complement(322804..323370)
                     /locus_tag="NGO_RS01690"
                     /old_locus_tag="NGO_01750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002237812.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase domain-containing protein"
     gene            complement(323455..323748)
                     /gene="hfq"
                     /locus_tag="NGO_RS01695"
                     /old_locus_tag="NGO0326"
                     /old_locus_tag="NGO_0326"
     CDS             complement(323455..323748)
                     /gene="hfq"
                     /locus_tag="NGO_RS01695"
                     /old_locus_tag="NGO0326"
                     /old_locus_tag="NGO_0326"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA chaperone Hfq"
                     /protein_id="WP_003687717.1"
                     /translation="MTAKGQMLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYV
                     VLLRNTSVTQMVYKHAISTIVPARSVNLQHENKPQAAPASTLVQVETVQQPAE"
     gene            complement(323877..324815)
                     /locus_tag="NGO_RS01700"
                     /old_locus_tag="NGO0327"
                     /old_locus_tag="NGO_0327"
     CDS             complement(323877..324815)
                     /locus_tag="NGO_RS01700"
                     /old_locus_tag="NGO0327"
                     /old_locus_tag="NGO_0327"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003714842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydrolase"
                     /protein_id="WP_003687718.1"
                     /translation="MSIRTLKRLPSSLLLGLCLSLPSAHLFADNDILGQFLEQNMLTS
                     SDPIEIFAESTIYPADTQAITGGLILSSQSALVVNNKTGQILYQKNADRIMPIASISK
                     LMSAMVVLDANLDMNETVTITPDEIDRLKGTGSRLAIGTALTRKELLHLSLMSSENRA
                     THALGRTYPGGMGAFVAAMNRKAQSLGMYGSRFYEPTGLNFQNVSTAKDLSLMVNAAA
                     QYPQIRTNSTSNYASVQTKNGQQNYKNSNALVREGMWNIELQKTGYIREAGRSMVVKA
                     NIQNQPVTIVLLNSPTSATRVNDARKIESWMLQQRS"
     gene            325136..325576
                     /locus_tag="NGO_RS01705"
                     /old_locus_tag="NGO0328"
                     /old_locus_tag="NGO_0328"
     CDS             325136..325576
                     /locus_tag="NGO_RS01705"
                     /old_locus_tag="NGO0328"
                     /old_locus_tag="NGO_0328"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003714839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_010357251.1"
                     /translation="MDMKYEFTLPSSSGADFHSAEHLPLVVYFYPKDSTPGCTTEGLD
                     FNARLEQFEALGYTVVGISRDGVKAHQNFCAKQGFRFELLSDKDETVCRLFDVIKLKK
                     LYGKESLGIERSTFVLNKDGEIVREWRKVKVAGHAQEVLETLSR"
     gene            325628..326503
                     /gene="xerD"
                     /locus_tag="NGO_RS01710"
                     /old_locus_tag="NGO0329"
                     /old_locus_tag="NGO_0329"
     CDS             325628..326503
                     /gene="xerD"
                     /locus_tag="NGO_RS01710"
                     /old_locus_tag="NGO0329"
                     /old_locus_tag="NGO_0329"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019271881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific tyrosine recombinase XerD"
                     /protein_id="WP_003690783.1"
                     /translation="MENGLIDRLLETLWLDRRLSRNTLDSYRRDLEKIARRLSLCGRT
                     LKDADEADLAAAVYVDGEQRSSQARALSACKRLYVWMEREGMRADNPTRLLKPPKIDR
                     NIPTLITEQQISRLLAAPDTDTPHGLRDKALLELMYATGLRVSEAVGLNFGNVDLDRG
                     CITTLGKGDKQRMVPMGQESAYWVERYYTEARPLLLKGRSCDALFVSQKKTGISRQLA
                     WMIVKEYAGRAGIGHISPHSLRHAFATHLVRHGLDLRVVQDMLGHADLNTTQIYTHVA
                     NVRLHSVVKEHHSRN"
     gene            326675..326875
                     /locus_tag="NGO_RS01715"
                     /old_locus_tag="NGO0329a"
                     /old_locus_tag="NGO_01775"
     CDS             326675..326875
                     /locus_tag="NGO_RS01715"
                     /old_locus_tag="NGO0329a"
                     /old_locus_tag="NGO_01775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003677538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin-associated ferredoxin"
                     /protein_id="WP_002214037.1"
                     /translation="MFVCICNAVTDHQIKETIAAGATTMGDLQSQLGVASCCGCCGEL
                     AASFLTAHNAQPTVTAGINVQA"
     gene            327041..327274
                     /locus_tag="NGO_RS01720"
                     /old_locus_tag="NGO0331"
                     /old_locus_tag="NGO_0331"
     CDS             327041..327274
                     /locus_tag="NGO_RS01720"
                     /old_locus_tag="NGO0331"
                     /old_locus_tag="NGO_0331"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin family protein"
                     /protein_id="WP_003687723.1"
                     /translation="MKLTLMFREYCSLCHKMRDALKPFQDEYGFGLEVVDVDENPVLE
                     EKYNELIPVLLAGDEEICHWFLDEDRLKQFLER"
     gene            complement(327646..328509)
                     /gene="rfbD"
                     /locus_tag="NGO_RS01725"
                     /old_locus_tag="NGO0332"
                     /old_locus_tag="NGO_0332"
     CDS             complement(327646..328509)
                     /gene="rfbD"
                     /locus_tag="NGO_RS01725"
                     /old_locus_tag="NGO0332"
                     /old_locus_tag="NGO_0332"
                     /EC_number="1.1.1.133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003708034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose reductase"
                     /protein_id="WP_003692740.1"
                     /translation="MRILLTGSKSQLAHCLRDRLPEDWETIATDSASLDITDADAVCN
                     MVKSFQPDAIVNTAAYTAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDY
                     VFDGKGKIPYQESDFTNPSNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVR
                     TMLNLARERSPLSAVHNQIGCPTYAGDLSAAIIRLLQQSNPVRGIYHYAGGKSVSWYE
                     FARHIFQTALQQDASFPVPELKAVSDEGSAAAAPRPAYSILDCRKIENDFGIKPSDWQ
                     KALAQVVSKLL"
     gene            328702..329565
                     /locus_tag="NGO_RS01730"
                     /old_locus_tag="NGO0333"
                     /old_locus_tag="NGO_0333"
     CDS             328702..329565
                     /locus_tag="NGO_RS01730"
                     /old_locus_tag="NGO0333"
                     /old_locus_tag="NGO_0333"
                     /EC_number="6.3.2.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazolesuccinocarboxamide
                     synthase"
                     /protein_id="WP_020996787.1"
                     /translation="MSEIGLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPI
                     PGKGEILTQISNFWFKKLAHIMPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKV
                     EAIVRGYLAGSGWKDYQKTGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVGDHDENIS
                     FEECGRIIGKELAEEVRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDE
                     VLTPDSSRFWPADQYEVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEK
                     YQEALTLLTQD"
     gene            329802..331922
                     /gene="pnp"
                     /locus_tag="NGO_RS01735"
                     /old_locus_tag="NGO0335"
                     /old_locus_tag="NGO_0335"
     CDS             329802..331922
                     /gene="pnp"
                     /locus_tag="NGO_RS01735"
                     /old_locus_tag="NGO0335"
                     /old_locus_tag="NGO_0335"
                     /EC_number="2.7.7.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009312233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="WP_010357282.1"
                     /translation="MFNKYVKTFQYGNQTVTLETGEIARQAAAAVKVSMGDTVVFVAV
                     TTNKEVKEGQDFFPLAVDYLERTYAAGKIPGGFFKREGKQSEKEILTSRLIDRPIRPL
                     FPEGFYHDIQIVAMVVSVDPEIDSDIPAMLGASAALVLSGVPFAGPIGAARVGYINGV
                     YVLNPTKAELAKSQLDLVVAGTSKAVLMVESEAKILPEDVMLGAVVYGHDQMQVAINA
                     INEFADEVNPEVWDWKAPETNEELVAKVRGIAGETIKEAFKIRQKQARSAKLDEAWNA
                     VKEALITEETDTLAANEIKGIFKRLEADVVRSQILDGQPRIDGRDTRTVRPLNIQTGV
                     LPRTHGSALFTRGETQALAVATLGTSRDEQIIDALSGEYTDRFMLHYNFPPYSTGEVG
                     RMGAPKRREIGHGRLAKRALLAVLPKPEDFSYTMRVVSEITESNGSSSMASVCGGCLS
                     LLSAGVPLKAHVAGIAMGLILEGNKFAVLTDILGDEDHLGDMDFKVAGTTEGVTALQM
                     DIKIQGITKEIMQIALAQAKEARLHILDQMKAAVAGPQELSAHAPRLFTMKISQDKIR
                     DVIGKGGETIRSITAETGTEINIAEDGTITIAATTQEAGDAAKKRIEEITAEVEVGKV
                     YEGTVVKILDNNVGAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVD
                     DRGRVRLSIKALLDAPVREENAAE"
     gene            complement(331995..332663)
                     /locus_tag="NGO_RS01740"
                     /old_locus_tag="NGO0336"
                     /old_locus_tag="NGO_0336"
     CDS             complement(331995..332663)
                     /locus_tag="NGO_RS01740"
                     /old_locus_tag="NGO0336"
                     /old_locus_tag="NGO_0336"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite exporter TauE/SafE family protein"
                     /protein_id="WP_003687733.1"
                     /translation="MNHDITFLTLFLLGFFGGTHCIGMCGGLSSAFALQLPPHINRFW
                     LILLLNTGRISSYTAIGLMLGLIGQLGISLDQTRVLQNILYTASNLLLLFLGLYLSGI
                     SSLAAKIEKIGKPIWRNLNPILNRLLPIKSIPACLAVGILWGWLPCGLVYSASLYALG
                     SGSATTGGLYMLAFALGTLPNLLAIGIFSLQLKKIMQNRYIRLCTGLSVSLWALWKLA
                     VLWL"
     gene            complement(332660..332974)
                     /locus_tag="NGO_RS01745"
                     /old_locus_tag="NGO0337"
                     /old_locus_tag="NGO_0337"
     CDS             complement(332660..332974)
                     /locus_tag="NGO_RS01745"
                     /old_locus_tag="NGO0337"
                     /old_locus_tag="NGO_0337"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004467974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687735.1"
                     /translation="MSRLFLLLFPWATLAACTRNIPASPAVSNCAHLHNRTVLYFDAH
                     GKPADSTAKGGFYRTVEIHDTNRILIQDFNSTGNALVKPYWSDCRKLSVFPDKHLTMS
                     HP"
     gene            333111..333962
                     /gene="dapF"
                     /locus_tag="NGO_RS01750"
                     /old_locus_tag="NGO0338"
                     /old_locus_tag="NGO_0338"
     CDS             333111..333962
                     /gene="dapF"
                     /locus_tag="NGO_RS01750"
                     /old_locus_tag="NGO0338"
                     /old_locus_tag="NGO_0338"
                     /EC_number="5.1.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002234768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="WP_003687738.1"
                     /translation="MKTLKFTKMHGLGNDFMVIDAVSQDFTPEDVPIAAWADRFRGVG
                     FDQLLVVGCSETEGVDFRYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVET
                     AKGIIFPKLSDNGMVTVNMGKPKFMPSEIPFVPESGEGDDACIYGVHLESGIQPVSCV
                     NMGNPHAVIVVDDVECAPVRETGSRIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGV
                     GETQACGTGACAAVVAGIRLGLLDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAETVF
                     EGELAYS"
     gene            333959..334564
                     /locus_tag="NGO_RS01755"
                     /old_locus_tag="NGO0339"
                     /old_locus_tag="NGO_0339"
     CDS             333959..334564
                     /locus_tag="NGO_RS01755"
                     /old_locus_tag="NGO0339"
                     /old_locus_tag="NGO_0339"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019271888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687740.1"
                     /translation="MILLHLDFLSALLYAAVFLFLIFRAGMLQWFWASIALWLGISVL
                     GVKLMPGMWGMTRAAPLFIPHFYLTLGSIFFFIGYWNRKTDGNGWQADPEHPLLGLFA
                     VSNVSMTLAFVGICALVHYCFSGTVQVFVFAALLKLYALKPVYWFVLQFVLMAVAYVH
                     RCGIDRQPPSTFGGSQLRLGVLAAMLMQVAVTAMLLAEIGR"
     gene            334760..335692
                     /gene="cysK"
                     /locus_tag="NGO_RS01760"
                     /old_locus_tag="NGO0340"
                     /old_locus_tag="NGO_0340"
     CDS             334760..335692
                     /gene="cysK"
                     /locus_tag="NGO_RS01760"
                     /old_locus_tag="NGO0340"
                     /old_locus_tag="NGO_0340"
                     /EC_number="2.5.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase A"
                     /protein_id="WP_010951030.1"
                     /translation="MKIANSITELIGNTPLVKLNRLTKGLKAEVAVKLEFFNPGSSVK
                     DRIAEAMIEAAEKAGKINKNTVIVEATSGNTGIGLAMVCAARGYKLAITMPESMSKER
                     KMLLRTFGAELILTPAAEGMAGAIAKAQSLVDAHPDTYFMPRQFDNEANPEVHRKTTA
                     EEIWNDTDGKVDVFVAGVGTGGTITGVGEVLKKYKPEIEVCAVEAGASPVLSGGEKGP
                     HPIQGIGAGFIPTVLNTKIYDSIAKVPNEAAFETARAMAEKEGILAGISSGAAVWSAL
                     QLAKQPENEGKLIVVLLPSYGERYLSTPLFADLA"
     gene            336001..336908
                     /locus_tag="NGO_RS01765"
                     /old_locus_tag="NGO0340a"
                     /old_locus_tag="NGO_01825"
                     /pseudo
     CDS             336001..336908
                     /locus_tag="NGO_RS01765"
                     /old_locus_tag="NGO0340a"
                     /old_locus_tag="NGO_01825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273746.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
     gene            336954..337103
                     /locus_tag="NGO_RS01770"
     CDS             336954..337103
                     /locus_tag="NGO_RS01770"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687747.1"
                     /translation="MDWQAVKTGKTKHADNGAERKMPSEALSDGIGAGRIKKAASAGM
                     AMQLK"
     gene            complement(337539..338558)
                     /gene="lepB"
                     /locus_tag="NGO_RS01775"
                     /old_locus_tag="NGO0343"
                     /old_locus_tag="NGO_0343"
     CDS             complement(337539..338558)
                     /gene="lepB"
                     /locus_tag="NGO_RS01775"
                     /old_locus_tag="NGO0343"
                     /old_locus_tag="NGO_0343"
                     /EC_number="3.4.21.89"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002232071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="WP_003706641.1"
                     /translation="MNTMLMSGAAAALLAGIILYFKSDKKRQENGEWSSGLEYAYILT
                     AVGVFAALSLFMSFTAVFLIFVVLCGTAWGVYKYRLKTHPEISESSHFGDYFGSFFPT
                     VLVLFLIRSFIAEPFQIPSSSMRPGLIKGDFILVGKFSYGLRVPVLNNVFIPTGKIER
                     GDVVVFNYPLQPEMTYIKRIVGIPGDIVEYRDKVLTVNGKPASDIPDGTYRYPDDTDP
                     SEIHNTDMFRSGLDGKSFNILKKEGQPAVSLPVLGKYTSDIMSENGYSIDQSGLNHCQ
                     YADDGSGFVCKVPEGRYFAMGDNRDNSADSRYWGFVDDKLVVGKAMFILMNFGDFGRA
                     GTAIR"
     gene            complement(338704..340497)
                     /gene="lepA"
                     /locus_tag="NGO_RS01780"
                     /old_locus_tag="NGO0344"
                     /old_locus_tag="NGO_0344"
     CDS             complement(338704..340497)
                     /gene="lepA"
                     /locus_tag="NGO_RS01780"
                     /old_locus_tag="NGO0344"
                     /old_locus_tag="NGO_0344"
                     /EC_number="3.6.5.n1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014575259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor 4"
                     /protein_id="WP_003687751.1"
                     /translation="MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSM
                     DIEKERGITIKAQTAALNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVV
                     DASQGVEAQTVANCYTAIDLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQ
                     CSAKSGIGVEDVLEEIVAKIPAPTGDENAPLQAVIVDSWFDNYVGVVMLIRVKNGTIK
                     LKDKVRFMSTKAETQVEQLGVFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTL
                     VANPATEPLPGFQEVQSQVFAGLYPVESHDYEALRDALEKLQLNDASLKFEPEVSQAL
                     GFGFRCGFLGLLHLEIVQERLEREFDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPD
                     IGSIETILEPIITATILVPQEYVGNVMTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEV
                     VMDFFDKLKSTSRGYASLDYHFKEFQPSDLIKLDIMVNGEKVDALSLIVHRQSAVHKG
                     RELASKMRELIPRQMFDIAVQAAIGSRIIARENVKALRKNVLAKCYGGDITRKKKLLE
                     KQKAGKRRMKQVGNVEIPQSAFLAILQVSDK"
     gene            complement(340639..341340)
                     /locus_tag="NGO_RS01785"
                     /old_locus_tag="NGO0345"
                     /old_locus_tag="NGO_0345"
     CDS             complement(340639..341340)
                     /locus_tag="NGO_RS01785"
                     /old_locus_tag="NGO0345"
                     /old_locus_tag="NGO_0345"
                     /EC_number="3.2.2.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010357299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-methylthioadenosine/adenosylhomocysteine
                     nucleosidase"
                     /protein_id="WP_003687752.1"
                     /translation="MSLKTVAVIGAMEQEIELLREMMENVKAVSFGRFSAYEGELAGK
                     RIVLALSGIGKVNAAVATAWLIRQFAPDCVINTGSAGGLGKGLKVGDVVIGTETEHHD
                     VDVTAFGYARGQVPQLPARFASDGILIETAKRAARTFEGAEVEQGLIVSGDRFVHSSE
                     GVAEIRKHFPEVKAVEMEAAAIAQTCHQLETPFVIIRAVSDSADEKADISFEEFLKTA
                     AASSAKMVAEIVKSL"
     gene            341526..342638
                     /locus_tag="NGO_RS01790"
                     /old_locus_tag="NGO0346"
                     /old_locus_tag="NGO_0346"
     CDS             341526..342638
                     /locus_tag="NGO_RS01790"
                     /old_locus_tag="NGO0346"
                     /old_locus_tag="NGO_0346"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010981144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilT/PilU family type 4a pilus ATPase"
                     /protein_id="WP_003687753.1"
                     /translation="MTAKEELFAWLRHMNKNKGSDLFVTTHFPPAMKLDGKITRITDE
                     PLTAEKCMEIAFSIMSAKQAEEFSSTNECNFAISLPDTSRFRVNAMIQRGATALVFRA
                     ITSKIPKFESLNLPPALKDVALKKRGLVIFVGGTGSGKSTSLASLIDYRNENSFGHII
                     TIEDPIEFVHEHKNCIITQREVGVDTENWMAALKNTLRQAPDVILIGEIRDRETMDYA
                     IAFAETGHLCMATLHANSTNQALDRIINFFPEERREQLLTDLSLNLQAFISQRLVPRD
                     GGKGRVAAVEVLLNSPLISELIHNGNIHEIKEVMKKSTTLGMQTFDQHLYQLYEKGEI
                     SLQDALKNADSAHDLRLAVQLRSRRAQSSDPDLELL"
     gene            342672..343649
                     /locus_tag="NGO_RS01795"
                     /old_locus_tag="NGO0347"
                     /old_locus_tag="NGO_0347"
     CDS             342672..343649
                     /locus_tag="NGO_RS01795"
                     /old_locus_tag="NGO0347"
                     /old_locus_tag="NGO_0347"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003702370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta'"
                     /protein_id="WP_003696824.1"
                     /translation="MIYPWHQEQWRQIAEHWTSRPNAWLFVGKKGTGKTAFARFAAKA
                     LLCETPAPGCKPCGECMSCHLFGRGSHPDFYEITPLADEPENGRKLLRIKIDAVREII
                     DNVYLTSVRGGLRVILIHPAESMNVQAANSLLKVLEEPPPQVVFLLVSHAADKVLPTI
                     KSRCRKMVLPAPSHGEALAYLRDRGVAEPEERLAFHSGAPLFQEEGELRELRAKLLEI
                     LAEPRLLKILDYAALFDKEKLPLAVFVGWMQKWLVDLGLCLQHMKPVYYPAYEDRLLQ
                     TASGFRPRNVFAAEDMLKQLAPYGFHTLNVKMQIEHLLINYLELKKENR"
     gene            343653..344003
                     /locus_tag="NGO_RS01800"
                     /old_locus_tag="NGO0348"
                     /old_locus_tag="NGO_0348"
     CDS             343653..344003
                     /locus_tag="NGO_RS01800"
                     /old_locus_tag="NGO0348"
                     /old_locus_tag="NGO_0348"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003708068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilZ"
                     /protein_id="WP_003687757.1"
                     /translation="MSDGQNIPAKMMSLQLKDMNLLYSSYMPFLEHGGLFVQTDDVFS
                     IGDDILLAVEILNFPKLFLPTKVAWINPASTSSKPKGVGLAFTKHENCLKVKDQIEVE
                     LGSTISGSRPTFTM"
     gene            344008..344787
                     /locus_tag="NGO_RS01805"
                     /old_locus_tag="NGO0349"
                     /old_locus_tag="NGO_0349"
     CDS             344008..344787
                     /locus_tag="NGO_RS01805"
                     /old_locus_tag="NGO0349"
                     /old_locus_tag="NGO_0349"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003750782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TatD family hydrolase"
                     /protein_id="WP_003694907.1"
                     /translation="MHIIDSHCHLNFEGLKERLPEVLSNMEANGVGQALAISVSRESF
                     SEVFAVAEAHEHIYCTIGVHPDSKEAEEFSIAEMVEAAAHPKVVGIGETGLDYYWCKG
                     DLSWQHKRFADHIEAANQTGLPVIVHTRDAAADTLAILKECKTNSGVIHCFSEDVGFA
                     RAAMDLGLYISFSGIVTFKNAPLVQEAAKYVPDDRILVETDAPFLAPVPKRGRQNEPA
                     FVRHTAEHIAKLRNQTLEQVAAYTTENFYRLFKKVPDMRVV"
     gene            344813..345028
                     /locus_tag="NGO_RS01810"
                     /old_locus_tag="NGO0350"
                     /old_locus_tag="NGO_0350"
     CDS             344813..345028
                     /locus_tag="NGO_RS01810"
                     /old_locus_tag="NGO0350"
                     /old_locus_tag="NGO_0350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF333 domain-containing protein"
                     /protein_id="WP_003690799.1"
                     /translation="MKAIHPYACPRCCRLPANTFRTGMANSASKFCIAKGGRREVKKD
                     ESGGGYALCHLPDSRIVEEWEYCRSQH"
     gene            345129..345440
                     /gene="grxD"
                     /locus_tag="NGO_RS01815"
                     /old_locus_tag="NGO0351"
                     /old_locus_tag="NGO_0351"
     CDS             345129..345440
                     /gene="grxD"
                     /locus_tag="NGO_RS01815"
                     /old_locus_tag="NGO0351"
                     /old_locus_tag="NGO_0351"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002214004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Grx4 family monothiol glutaredoxin"
                     /protein_id="WP_003687762.1"
                     /translation="MASIHDQIKEVVTTHRVVLFMKGTKQFPQCGFSSRAVQILNAAG
                     CTDYVAVNVLENPEVRQGIKEYSDWPTIPQLYVNGEFVGGSDILMEMYEAGELQELLK
                     A"
     gene            345546..346172
                     /gene="upp"
                     /locus_tag="NGO_RS01820"
                     /old_locus_tag="NGO0353"
                     /old_locus_tag="NGO_0353"
     CDS             345546..346172
                     /gene="upp"
                     /locus_tag="NGO_RS01820"
                     /old_locus_tag="NGO0353"
                     /old_locus_tag="NGO_0353"
                     /EC_number="2.4.2.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002225428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="WP_003690802.1"
                     /translation="MNVNVINHPLVRHKLTLMREADCSTYKFRTLTTELARLMAYEAS
                     RDFEIEKYLIDGWCGQIEGDRIKGKTLTVVPILRAGLGMLDGVLDLIPTAKISVVGLQ
                     RDEETLKPISYFEKFVDSMDERPALIIDPMLATGGSMVATIDLLKEKGCRNIKALVLV
                     AAPEGVKAVNDAHPDVTIYTAALDSRLNENGYIIPGLGDAGDKIFGTR"
     gene            346195..346515
                     /locus_tag="NGO_RS01825"
                     /old_locus_tag="NGO0354"
                     /old_locus_tag="NGO_0354"
     CDS             346195..346515
                     /locus_tag="NGO_RS01825"
                     /old_locus_tag="NGO0354"
                     /old_locus_tag="NGO_0354"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003690805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2322 family protein"
                     /protein_id="WP_003690805.1"
                     /translation="MNFQDYLATFPSIDHLGGLDVQDAEGKTVHHIPAVQGKLGSLKL
                     YNALAERFDGKLGKEAAEQGLIWFAEHVADARAHPGKHPNIDLLENVVQSGETLLLKP
                     LAAQ"
     gene            346684..>347325
                     /locus_tag="NGO_RS01830"
                     /old_locus_tag="NGO0355"
                     /old_locus_tag="NGO_0355"
                     /pseudo
     CDS             346684..>347325
                     /locus_tag="NGO_RS01830"
                     /old_locus_tag="NGO0355"
                     /old_locus_tag="NGO_0355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003711434.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1595 family transposase"
     gene            347355..348179
                     /locus_tag="NGO_RS01835"
                     /old_locus_tag="NGO0356"
                     /old_locus_tag="NGO_0356"
     CDS             347355..348179
                     /locus_tag="NGO_RS01835"
                     /old_locus_tag="NGO0356"
                     /old_locus_tag="NGO_0356"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003690807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent DNA methyltransferase"
                     /protein_id="WP_003690807.1"
                     /translation="MFALAASNMILRGDGKANLHQSSCFMTDFQDLIKNPKPETGLKR
                     PNVGFLNPPYAQSKSDAELHELYFVKEMLDMLAEGGTGIAIIPVSCVIAPSKAKSEIV
                     KYHRLKAVMSMPSELFYPVGTVTCIVVFEAHKPHFQTVVIDPDTQEEISTKKACRKTW
                     FGYWRDDGFEKTKHLGRIDLYDRWQGIKARWLEHYLNNEVHTGESVTAFVTDNDEWVA
                     EAYLETDYSKITRADFEQVVREFALFQLLGAEVGPTENLDNESYEDDDNNDFGDDE"
     gene            348179..349147
                     /locus_tag="NGO_RS01840"
                     /old_locus_tag="NGO0357"
                     /old_locus_tag="NGO_0357"
     CDS             348179..349147
                     /locus_tag="NGO_RS01840"
                     /old_locus_tag="NGO0357"
                     /old_locus_tag="NGO_0357"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit S"
                     /protein_id="WP_003687768.1"
                     /translation="MVELQEIFDVSYGSKLDLNKMSSFNPTINFVGRSGKNNGVTASV
                     DLLKNTKPYPAGLLTVALGGSVLSTFLQNKPFYTAQNVAVLNPKTEMTEQQKLFYCAA
                     IFANAYRFSACGREANRTLRQLFVPSLDEIPSWVESVNLNPSAGVTEPKLKESLDLPV
                     VRQSKRLDEIFTIQNGIAATKLKEFEQRQKDTVVYIRPASTQARTLRSYIARDSVDEK
                     HIFPCHTLFTSTNGEGSHTYSYVSTCEFVANSDVAVLTPIQSDMPIEVKLYYAKCITA
                     NRYLFSYGRKPKGEKLKSIMLPYFDQQEDFDYICRFIHTLLFSNNL"
     gene            349429..349851
                     /locus_tag="NGO_RS01845"
                     /old_locus_tag="NGO0358"
                     /old_locus_tag="NGO_0358"
     CDS             349429..349851
                     /locus_tag="NGO_RS01845"
                     /old_locus_tag="NGO0358"
                     /old_locus_tag="NGO_0358"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002232080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687769.1"
                     /translation="MKKMFLSAALLLSAAAQTVWADTVFSCKTDNNKYIEVQKINRNL
                     YEYSFGSAAKKEIAIRNSKADLLGRSDRWQGMGSGRRATMKFQNGEFMYTVWTGFDSV
                     THTESSGVVVERRGKEVARVGCTPKTAQANFNDDDFSR"
     gene            349869..350633
                     /locus_tag="NGO_RS01850"
                     /old_locus_tag="NGO0359"
                     /old_locus_tag="NGO_0359"
     CDS             349869..350633
                     /locus_tag="NGO_RS01850"
                     /old_locus_tag="NGO0359"
                     /old_locus_tag="NGO_0359"
                     /EC_number="4.2.1.75"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003699580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="WP_003687770.1"
                     /translation="METAKPVMLIVRPSGRAKDDVEVCRRAGWQAEVLSPIEIETDEA
                     SLKRLPEMYARADAVFWVSPAAVETAVPYLNLSDGIKAHIAVGQGSRRALARYAGAGV
                     FAPEDGNDSEAVLRLPVWNSLPEGARVLSVRGHGGRDFLMNALQEKGFRTEVAEVYFR
                     RHKPLNFQNFQTENIAAAYITSTELVQSLFAQLPPQFSRFFKSLLYFTHHPRIAEALK
                     REGVCSVETVPTLEAALSYSSISVSDGMVFPGTSNQ"
     gene            350645..351979
                     /locus_tag="NGO_RS01855"
                     /old_locus_tag="NGO0360"
                     /old_locus_tag="NGO_0360"
     CDS             350645..351979
                     /locus_tag="NGO_RS01855"
                     /old_locus_tag="NGO0360"
                     /old_locus_tag="NGO_0360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002245525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III C-methyltransferase"
                     /protein_id="WP_003687772.1"
                     /translation="MGEPENKSSEPVREIQASKEMPSETSSPRKENETEVHIPAAPFI
                     VKQSGSNALAACALVLAALGLGASGFLFVQGQNVLKNQELAFNQKIDKAALGESENAA
                     LLKDNLNRQSAIQSELDRLDSGVKANGEQILMTQKAYRELTKGRADWLVDETETILNL
                     AAQQLVLTGNIQTAVGVLEHIDSRLSRFDQAELLPIKQAVSSDLAELKNRPYVDISGT
                     ALRLDRLETAVSGLPLILDGVLKPGVQARNEAVSASWWQNVWEKSLGTLKGLVEIRRL
                     ENNDAMLISPEQAYFVRENLRLRLLDARTALMQRNGEVYQGDLNNAEAAVRQYFDAKS
                     PATQSWLKELAELKTLDVRMTADDGLKTSLNAVRAYRDGTRMTAAENQEAEQAASEPA
                     NENTASEPAAASDVKAIEAPSLPSERKPEQPAKKQPAPEKAGRSPSAKGERA"
     gene            351976..353193
                     /locus_tag="NGO_RS01860"
                     /old_locus_tag="NGO0361"
                     /old_locus_tag="NGO_0361"
     CDS             351976..353193
                     /locus_tag="NGO_RS01860"
                     /old_locus_tag="NGO0361"
                     /old_locus_tag="NGO_0361"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003702373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme biosynthesis protein HemY"
                     /protein_id="WP_003698136.1"
                     /translation="MKTVVWIVVLFAAAVGLALASGIYTGDVYIVLGQTMLRINLHAF
                     VLGSLIAVVVWYFLFKFIIGVLNIPENMRRSGSARKGRKAALALNKAGLAYFEGRFEK
                     AELEASRVLGNKEAGDNRTLALMLGAHAAGQMENIELRDRYLAEIAKLPEKQQLSRYL
                     LLAESALNRRDYEAAEANLHAAAKMNANLTRLVRLQLRYAFDRGDALQVLAKTEKLSK
                     AGALGKSEMERYQNWAYRRQMADAADAAALKTCLKRIPDSLKNGELSVSVAEKYERLG
                     LYADAVKWVKQHYPHNRRPELLEAFVESVRFLGEREQQKAIDFADSWLKEQPDNALLL
                     MYLGRLAYGRKLWGKAKGYLEASIALKPSIPARLVLAKVFDETAQSQKAEAQRNLVLA
                     SVAGENRPSAETR"
     gene            353268..354332
                     /locus_tag="NGO_RS01865"
                     /old_locus_tag="NGO0362"
                     /old_locus_tag="NGO_0362"
     CDS             353268..354332
                     /locus_tag="NGO_RS01865"
                     /old_locus_tag="NGO0362"
                     /old_locus_tag="NGO_0362"
                     /EC_number="4.1.1.37"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="WP_003706638.1"
                     /translation="MTLLKNDTFLRALLKQPVEYTPIWMMRQAGRYLPEYKATRTKAG
                     SFLDLCKNTGLATEVTIQPLERFDLDAAILFSDILTVPDAMGLGLYFAEGEGPKFKRA
                     LQHESDIAKLHVPDMEKLQYVFDAVTSIRKALDGRVPLIGFSGSPFTLACYMVEGGGS
                     KEFRTIKTMMYSRPDLLYKILDTNAQAVTAYLNAQIDAGAQAVQIFDTWGGVLSDAAF
                     KEFSLKYIRQIVAGLKRESEGRRVPVIVFAKGGGLWLESMAQIGADALGLDWTCNIGE
                     ARRRVGNQVALQGNFDPSALFGTPESIRTEVARILTGYGHGSGHVFNLGHGINQHADP
                     EHAKILVDTVHELSRQYHGG"
     gene            complement(354395..356284)
                     /locus_tag="NGO_RS01870"
                     /old_locus_tag="NGO0363"
                     /old_locus_tag="NGO_0363"
     CDS             complement(354395..356284)
                     /locus_tag="NGO_RS01870"
                     /old_locus_tag="NGO0363"
                     /old_locus_tag="NGO_0363"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003680474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_003687775.1"
                     /translation="MLRTYLNQLTPPELADSVKNTVDGFMEKLSQTEPKIAQNVLLLG
                     NVQSGKTAQVLGVLSALADDGDHKVFLYLTTDSVDLQDQTVKRAKANLKNFIVLSEAD
                     DRSFMEVMKAENPILVVIKKNARVLKRWRNLFASQSSLKGYPLVIVDDEADAASLNTN
                     SDKPAKDASTINKLLNDIKNSCCQSLFIQLTATPQSLLLQHEESDWQPEFIHFFEAGE
                     KYIGGNFVFSDPPSYIVRFIDSELDDMKDESGEIAEGAKQALLSFLITCAEFALCDKA
                     NCNFALHPSYKIQDHQAFSKKIQAFLNDLVQAVNNGEDLAGSFKESYLDLQKTKPDIH
                     HFDEIYEKLTALLENKQISTLVVNSQTETDFDLEKGFNIIIGGNVIGRGLTIPKLQTV
                     YYSRTAKKPNADTFWQHSRIFGYDRDKSLLRLYIPFDVYYFFVQLNQANNLIIGQAKN
                     SGGNIQVIYPKNINPTRKNVLKFDSINQIVGGVNYFPLHPNEDNLSEINKILPSILKD
                     EIQSDLYQIDIEDLFLVLDKLGRYVPDDWNKEKFIAGVEALKAQRPSFKTYVLIKTGR
                     KLSRATGTMLSEDDRKLGEKYPNDLFLTLYQVVGNKDKGWQGKDFWLPNIKLPHNGLV
                     YQSAK"
     gene            complement(356285..357322)
                     /locus_tag="NGO_RS01875"
                     /old_locus_tag="NGO0364"
                     /old_locus_tag="NGO_0364"
     CDS             complement(356285..357322)
                     /locus_tag="NGO_RS01875"
                     /old_locus_tag="NGO0364"
                     /old_locus_tag="NGO_0364"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003680475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NgoFVII family restriction endonuclease"
                     /protein_id="WP_003687776.1"
                     /translation="MNTVFSNIANAKITEKSLNAVWMDLFKSADEVLMATGYVSNDAV
                     VELHKILELNDHIQKIDLLVGMHYLEGFSHLQYDSLCKLNDFLRHEKRGAVYVSPFVK
                     FHGKMYSFKNYQKINGLIGSANLTCFWDSTERTYETMLHLNGKPAQILQADIQSTIHK
                     LGKNIQEVERPSKFIEHNSHLENCLGVQKIAPEQIRQLFAQTSEYHFSIPAKTEEKSN
                     LNVFFGEGRRDKRGFVKPRPWYEVELIVSKDITSQEGYPVLKSFTVITDDGWQFQCKT
                     SGDYSKNFRSENDLKTLGKWIKGRLESHGCLQNNEKITHETLREYGNDHFELRSTDNP
                     DVWLLSFKGKN"
     gene            complement(357319..358443)
                     /locus_tag="NGO_RS01880"
                     /old_locus_tag="NGO0365"
                     /old_locus_tag="NGO_0365"
     CDS             complement(357319..358443)
                     /locus_tag="NGO_RS01880"
                     /old_locus_tag="NGO0365"
                     /old_locus_tag="NGO_0365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012221464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA cytosine methyltransferase"
                     /protein_id="WP_003687777.1"
                     /translation="MLSKQISNLNSSSNKPKILSLFSGCGGLDLGFHQAGCETVWAND
                     FSHWACESFRKNIGDVIVEGDIEQINPNDPTIPDCDIILGGFPCQDFSMIWKQPGLEG
                     ERGNLYKSFLRFVNAKKPKVFVAENVKGLLTANKKKAIQQIITDFENCGYYVQAKLYN
                     FAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNETGENGLKPYVTAGQAISNIPQNA
                     SNNELLKISDKTRRMLELIPEGGNFTDIPKDHPLYVKGMISHVYRRMHRNEPSKTIIA
                     AGGGGTWGYHFPEPRAFTNRERARLQSFPDDFEFVGSTTEVRRQIGNAVPPQGVVELA
                     KSILPIFSDNYEKVDLHEKLVEEKEILFHDRLSKIRGGKQ"
     gene            358830..360209
                     /gene="radA"
                     /locus_tag="NGO_RS01885"
                     /old_locus_tag="NGO0367"
                     /old_locus_tag="NGO_0367"
     CDS             358830..360209
                     /gene="radA"
                     /locus_tag="NGO_RS01885"
                     /old_locus_tag="NGO0367"
                     /old_locus_tag="NGO_0367"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012221465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="WP_003690821.1"
                     /translation="MAKTLKTLYQCTECGGTSPKWQGKCPHCGEWNTLQESFAAPEPK
                     NARFQSWAADASTVQSLSAVTAAEVPRNPTGMGELDRVLGGGLVDGAVILLGGDPGIG
                     KSTLLLQTIAKMAQSRKVLYVSGEESAQQVALRSQRLELHAEGVNLLAEIRMEAIQAA
                     LKQHQPEVVVIDSIQTMYSDQITSAPGSVSQVRECAAQLTRMAKQMGIAMILVGHVTK
                     DGAIAGPRVLEHMVDTVLYFEGDQHSNYRMIRAIKNRFGAANELGVFAMTENGLKGVS
                     NPSAIFLASYRDDTPGSCVLVTQEGSRPLLVEIQALVDDAHGFTPKRLSVGLEQNRLA
                     MLLAVLNRHGGIACFDQDVFLNAVGGVKIGEPAADLAVILAMLSSFRNRPMPEKTVVF
                     GEIGLSGEVRPVARGQERLKEAEKLGFKRAIVPKANMPRNAKEFPNLKIHGVSSLQEA
                     IDICRDSRE"
     gene            complement(360484..360963)
                     /locus_tag="NGO_RS01890"
                     /old_locus_tag="NGO0368"
                     /old_locus_tag="NGO_0368"
     CDS             complement(360484..360963)
                     /locus_tag="NGO_RS01890"
                     /old_locus_tag="NGO0368"
                     /old_locus_tag="NGO_0368"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002256519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF302 domain-containing protein"
                     /protein_id="WP_003692767.1"
                     /translation="MKHILPLIAASALCISTASAHPAGKPPTQNETAMTTHTLTSKYS
                     FDETVSRLETAIKSKGMDIFAVIDHQEAARRNGLTMQPAKVIVFGTPKAGTPLMVKDP
                     AFALQLPLRVLVTETDGKVRTAYTDTRALIVGSRISFDEVANTLANAEKLIQKTVGE"
     gene            complement(361088..361447)
                     /locus_tag="NGO_RS01895"
                     /old_locus_tag="NGO0369"
                     /old_locus_tag="NGO_0369"
     CDS             complement(361088..361447)
                     /locus_tag="NGO_RS01895"
                     /old_locus_tag="NGO0369"
                     /old_locus_tag="NGO_0369"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-like domain-containing protein"
                     /protein_id="WP_003687781.1"
                     /translation="MNIKQLITAALIASAAFATQAAPQKPVSAAQTAQHSAVWIDVRS
                     EQEFSEGHLHNAVNIPVDQIVRRIYEAAPDKDTPVNLYCRSGRRAEAALQELKKAGYT
                     NVANHGGYEDLLKKGMK"
     gene            complement(361486..365088)
                     /gene="recB"
                     /locus_tag="NGO_RS01900"
                     /old_locus_tag="NGO0370"
                     /old_locus_tag="NGO_0370"
     CDS             complement(361486..365088)
                     /gene="recB"
                     /locus_tag="NGO_RS01900"
                     /old_locus_tag="NGO0370"
                     /old_locus_tag="NGO_0370"
                     /EC_number="3.1.11.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002261402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit beta"
                     /protein_id="WP_010951035.1"
                     /translation="MSAPIRAFDPLTAPISGTNLIEASAGTGKTYGIAALFTRLIVLE
                     QKSVERVLVVTFTKAATAELKTRLRARLDDVLQVLESKEIAELGDDTLSDGIAAYCAE
                     HHEGDTFLPALLEQALQKESRTRLIVRLKAAIGQFDNAAIYTIHGFCQRILRDYAFLC
                     QAPFDVELTEEDGDRLLVPAQDFWRERVSGDPVLAALAFKRKAVPQTVLAQIRAYLSR
                     PYLNFRRPQADLKQAQRDAETSWQTVCRLLPELEAGFWRIHPDLNGNSYRKNSFGNLF
                     KELAQKSAAGQLPCLDKDTHERLLKLSSDKLEAGLKKGKTPDAAVFAELQKLADFGRD
                     LNALEEAEETTMIRLQLDLIEYLNSSLAEMKKSRRERGFDDLLLDVHTALTDNPHAET
                     PARAVAENWEIALIDEFQDTDPLQYEIFQKIFIARNRPLFLVGDPKQAIYSFRGADIY
                     AYLQAAEDARHRYTLATNYRSHAALIGSIGALFRLKERPFVLENIGYSEVGAARAESR
                     LSPKRPAVQLRWLHENDNEKANKDVLRRRAADYCADEIARALNEASGGRLNFKDRPLQ
                     SGDIAVLVRTHNEAVMISAALKKRQVQSVLLSRESVFASPEAAALSALIGFWLEPRRA
                     GTLRFVLTSGIFGYDAQQLHDFNQNESEILHWAESARTALDIWQKYGIFAAMQQFSQT
                     HGIETRLLSRNNGRSLTNYFQLLELLAAEDAQNRNPAALHKWLRDQISLAGNNGGDNR
                     AIRLESDEDLVKIVTMHASKGLQYPLVYCPFAWDAQDTGPSDWQILHQGANRAELLAK
                     AQLSESEQKQYADEEMAERLRLLYVALTRAEEQLNIYAAYSSDTADNPLAYLIEGLPQ
                     DSRETVRRTYACEKDGITMLKRNWRRVADNAPAGTDFTFTEDAPPPAAYRGNADQAAE
                     FAANSIPERGFRFVRHTSFTALSRHTQTPDGGEEDACPSLDAAETSVPAMPSETPTAS
                     DGISIHDFPKGTQAGLCLHEILEDFKFGQAAAEQETLIADKLKKYGFEEIWLPAVAEM
                     AEACRKTPLTGAYGLSDIPPGCRRPEMGFTLHTEDFGLKRLRDWLARDDIRLPEVCRA
                     AAETLDFHTVNGFLNGFIDMVCQDPDGNICIIDYKSNHLSAYTRQAMDEAVAHQHYYL
                     QALIYAVAAARYFKLRGQPPAAVSVRYLFLRGLDGKGGGVWRWDIDAAALEQIK"
     gene            complement(365165..366073)
                     /locus_tag="NGO_RS01905"
                     /old_locus_tag="NGO0371"
                     /old_locus_tag="NGO_0371"
     CDS             complement(365165..366073)
                     /locus_tag="NGO_RS01905"
                     /old_locus_tag="NGO0371"
                     /old_locus_tag="NGO_0371"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Dyp-type peroxidase"
                     /protein_id="WP_010357322.1"
                     /translation="MNTPQSAIIPDHAQAGIFIEADFAANRLNDIKAACRASLDALSA
                     LKARFPDDILGLTIAFGSKAWATFGHTDEGSEIKPFPEMGNGLAPSTQHDMSIHIQSF
                     RQNAAYALAQSVLGAFGDSICVASEEHGLRLYQDRGLDGFVDGTENPQGDETIREVAI
                     IPEGLPDAGGSYVLLQKYLHDLKKWDAVPVAEQEASVGRSKETDDEFSRDVRLPDSHL
                     GRVNLKENGVGLKIVRRSLPFGKISGEHGLMFTAYCRTLHNIEAQLLSMFGDTDGKTD
                     LLLRHLSAAVSGGYYYAPSVERLQNL"
     gene            366361..367185
                     /locus_tag="NGO_RS01910"
                     /old_locus_tag="NGO0372"
                     /old_locus_tag="NGO_0372"
     CDS             366361..367185
                     /locus_tag="NGO_RS01910"
                     /old_locus_tag="NGO0372"
                     /old_locus_tag="NGO_0372"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009173727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_025456494.1"
                     /translation="MLKKFVLGGIAALVLAACGGSEGGSGASSAPAQSAISGSLIERI
                     NNKGTVTVGTEGTYAPFTYHDKDGKLTGYDVEVTRAVAEKLGVKVEFKETQWDSMMAG
                     LKAGRFDVVANQVGLTSPERQATFDKSEPYSWSGAVLVAHNDSNIKSIADIKGVKTAQ
                     SLTSNYGEKAKAAGAQLVPVDGLAQSLTLIEQKRADATLNDELAVLDYLKKNPNAGVK
                     IVWSAPADEKVGSGLIVNKGNDEAVAKFSTAINELKADGTLKKLGEQFFGKDISVQ"
     gene            367175..367891
                     /locus_tag="NGO_RS01915"
                     /old_locus_tag="NGO0373"
                     /old_locus_tag="NGO_0373"
     CDS             367175..367891
                     /locus_tag="NGO_RS01915"
                     /old_locus_tag="NGO0373"
                     /old_locus_tag="NGO_0373"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002223904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_003687787.1"
                     /translation="MFNNFLASLPFMTETRADMLISAFWPMVKAGFTVSLPLAIASFV
                     IGMIIAVAVALVRIMPSGGIFQKCLLKLVEFYISVVRGTPLLVQLVIVFYGLPSVGIY
                     INPIPAAIIGFSLNVGAYASETIRAAILSVPKGQWEAGFSIGMTYMQTFRRIVAPQAF
                     RVAVPPLSNEFIGLFKNTSLAAVVTVTELFRVAQETANRTYDFLPVYIEAALVYWCFC
                     KVLFLIQARLEKRFDRYVAK"
     gene            367901..368656
                     /locus_tag="NGO_RS01920"
                     /old_locus_tag="NGO0374"
                     /old_locus_tag="NGO_0374"
     CDS             367901..368656
                     /locus_tag="NGO_RS01920"
                     /old_locus_tag="NGO0374"
                     /old_locus_tag="NGO_0374"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019271912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_003687790.1"
                     /translation="MIKIRNIHKTFGENTILRGIDLDVGKGQVVVILGPSGSGKTTFL
                     RCLNALEMPEDGQIEFDNARPLRIDFSKKTSKHDILALRRKSGMVFQQYNLFPHKTVL
                     ENVMEGPVAVQGKPAAQAREEALKLLEKVGLGDKVDLYPYQLSGGQQQRVGIARALAI
                     QPELMLFDEPTSALDPELVQDVLDAMKELAREGWTMVVVTHEIKFTLEVATNVVVMDG
                     GVIVEQGSPKELFDHLKHERTRRFLSQIQSAKI"
     gene            complement(368712..370094)
                     /locus_tag="NGO_RS01925"
                     /old_locus_tag="NGO0375"
                     /old_locus_tag="NGO_0375"
     CDS             complement(368712..370094)
                     /locus_tag="NGO_RS01925"
                     /old_locus_tag="NGO0375"
                     /old_locus_tag="NGO_0375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase/phosphoglucomutase"
                     /protein_id="WP_003690828.1"
                     /translation="MASITRDIFKAYDIRGIVGKTLTDDAAYFIGRAIAAKAAEKGIA
                     RIAIGRDGRLSGPELMEHIQRGLTDSGIGVLNVGMVTTPMLYFAAVNECGGSGVMITG
                     SHNPPDYNGFKMMLGGDTLAGEAIQELLAIVEKDGFVAADKQGSVTEKDISGAYHDHI
                     VGHVKLKRPINIAIDAGNGVGGAFAGKLYKGLGNEVTELFCEVDGNFPNHHPDPSKPE
                     NLQDLIAALKNGDAEIGLAFDGDADRLGVVTKDGNIIYPDRQLMLFAQDVLNRNPGAK
                     VIFDVKSTRLLAPWIKEHGGEAIMEKTGHSFIKSAMKKTGALVAGEMSGHVFFKERWF
                     GFDDGLYAGARLLEILSASDNPSEVLDNLPQSISTPELNISLPEGSNGHQVIEELAAK
                     AEFEGATEIITIDGLRVEFPDGFGLMRASNTTPILVLRFEADTQAAIERIQNRFKAVI
                     ESNPHLIWPL"
     gene            complement(370262..370771)
                     /locus_tag="NGO_RS01930"
                     /old_locus_tag="NGO0376"
                     /old_locus_tag="NGO_0376"
     CDS             complement(370262..370771)
                     /locus_tag="NGO_RS01930"
                     /old_locus_tag="NGO0376"
                     /old_locus_tag="NGO_0376"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003712743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_003687796.1"
                     /translation="MIILHTNKGDIKIELDFDKAPVTAKNFEQYVKDGFYDGVIFHRV
                     IKGFMIQGGGMDENMNEKETRDPIQNEASNGLPNDKYTIAMARTSDPHSAGAQFFINT
                     ADNAFLNFRSKELYGKTVVQDWGYAVFGKVVDGFDVVDAIESVSTKRHGYHDDVPTEP
                     VIIIKAEAV"
     gene            complement(370891..372306)
                     /locus_tag="NGO_RS01935"
                     /old_locus_tag="NGO0377"
                     /old_locus_tag="NGO_0377"
     CDS             complement(370891..372306)
                     /locus_tag="NGO_RS01935"
                     /old_locus_tag="NGO0377"
                     /old_locus_tag="NGO_0377"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SLC13/DASS family transporter"
                     /protein_id="WP_010359883.1"
                     /translation="MNLHAKDKTQHPENVELLSAQKPITDFKGLLTTIISAVVCFGIY
                     HILPYSPDANKGIALLIFVAALWFTEAVHITVTALMVPILAVVLGFPDMDIKKAMADF
                     SNPIIYIFFGGFALATALHMQRLDRKIAVSLLRLSRGNMKVAVLMLFLVTAFLSMWIS
                     NTATAAMMLPLAMGMLSHLDREKEHKTYVFLLLGIAYCASIGGLGTLVGSPPNLIAAK
                     ALNLDFVGWMKLGLPMMLLILPLMLLSLYVILKPNLNERVEIKAESIPWTLHRVIALL
                     IFLATAAAWIFGSKIKTAFGISNPDTVIALSAAVAVVVFGVAQWKEVARNTDWGVLML
                     FGGGISLSTLLKTSGASEALGQQVAATFSGAPAFLVILIVAAFIIFLTEFTSNTASAA
                     LLVPIFSGIAMQMGLPEQVLVFVIGIAASCAFMLPVATPPNAIVFGTGLIKQREMMNV
                     GILLNILCVVLVALWAYAVLM"
     gene            complement(372535..372897)
                     /locus_tag="NGO_RS01940"
                     /old_locus_tag="NGO0378"
                     /old_locus_tag="NGO_0378"
     CDS             complement(372535..372897)
                     /locus_tag="NGO_RS01940"
                     /old_locus_tag="NGO0378"
                     /old_locus_tag="NGO_0378"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VanZ family protein"
                     /protein_id="WP_003690830.1"
                     /translation="MKLPRNRFSLLSALWFAGGIYSLLFKAADTAPPPFPHFDKAAHL
                     ALFFAQILLLAKAFKTGKLPIPYRSLIAFAFCFAVGSECAQAWFTATRTGSLGDVLAD
                     LTGAALALFAARSACRPD"
     gene            complement(372894..373100)
                     /locus_tag="NGO_RS01945"
                     /old_locus_tag="NGO_02015"
     CDS             complement(372894..373100)
                     /locus_tag="NGO_RS01945"
                     /old_locus_tag="NGO_02015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002243416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002213975.1"
                     /translation="MTELKQLIQTESIPVIEETLDFLLYECSIDDAPSAEEVAQWRDI
                     LAARGGKFLRLSKICQTWLDEEAA"
     gene            complement(373161..373739)
                     /gene="pth"
                     /locus_tag="NGO_RS01950"
                     /old_locus_tag="NGO0379"
                     /old_locus_tag="NGO_0379"
     CDS             complement(373161..373739)
                     /gene="pth"
                     /locus_tag="NGO_RS01950"
                     /old_locus_tag="NGO0379"
                     /old_locus_tag="NGO_0379"
                     /EC_number="3.1.1.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoacyl-tRNA hydrolase"
                     /protein_id="WP_003687802.1"
                     /translation="MSNTIKMVVGLGNPGKEYEQTRHNAGFWFLDELAWKWKASFKEE
                     KKFFGEVARAALPDGDVWLLKPATFMNRSGQAVAALAQFYKIKPEEILVVHDELDIPC
                     GRIKFKLGGGNGGHNGLKDIQAKLGTADYYRLRLGIGHPGDRNLVVGYVLNKPSAEHR
                     RQIDDAVAKSLQAVPDIISGKWEEATRFLHSK"
     gene            complement(373792..374070)
                     /locus_tag="NGO_RS01955"
                     /old_locus_tag="NGO0380"
                     /old_locus_tag="NGO_0380"
     CDS             complement(373792..374070)
                     /locus_tag="NGO_RS01955"
                     /old_locus_tag="NGO0380"
                     /old_locus_tag="NGO_0380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003712748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RnfH family protein"
                     /protein_id="WP_003687804.1"
                     /translation="MLEIEIVYGLPDRQVLKTMQLAEGTTVRTAALQSGLDGIFENLN
                     LHSAPLGIFGKAVKDDTPLRDGDRIEVYRPLLIDPKEARRKRVQNQEE"
     gene            complement(374063..374494)
                     /locus_tag="NGO_RS01960"
                     /old_locus_tag="NGO0381"
                     /old_locus_tag="NGO_0381"
     CDS             complement(374063..374494)
                     /locus_tag="NGO_RS01960"
                     /old_locus_tag="NGO0381"
                     /old_locus_tag="NGO_0381"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009173302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RatA family
                     toxin"
                     /protein_id="WP_025455777.1"
                     /translation="MKKVEKNILVLHGADKMFELVDKVEDYPHFLPWYSKTEVIGRSG
                     NELKARLFMDYMRVRQSFATHNRNIPGREIRMELLEGPFKTLRGTWKFIDLGDDMCKI
                     EFNLEYDFSNAVLSALISPVFNHLSATLVEAFVKEADRRYA"
     gene            complement(374716..376683)
                     /locus_tag="NGO_RS01965"
                     /old_locus_tag="NGO0382"
                     /old_locus_tag="NGO_0382"
     CDS             complement(374716..376683)
                     /locus_tag="NGO_RS01965"
                     /old_locus_tag="NGO0382"
                     /old_locus_tag="NGO_0382"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent metallopeptidase FtsH/Yme1/Tma
                     family protein"
                     /protein_id="WP_003687806.1"
                     /translation="MGNTFKSILVWVALGIGLMAAFNALDGKKEDNGQIEYSQFIRQV
                     NNGEVSGVNIEGSVVSGYLIKGERTDKSTFFTNAPLDDNLIQTLLNKNVRVKVTPEEK
                     PSALTALFYSLLPVLLLIGAWFYFMRMQAGGGGKGGAFSFGKSRARLLDKDANKVTFA
                     DVAGCDEAKEEVQEIVDYLKAPNRYQSLGGRVPRGILLAGSPGTGKTLLAKAIAGEAG
                     VPFFSISGSDFVEMFVGVGASRVRDMFEQAKKNAPCIIFIDEIDAVGRQRGAGLGGGN
                     DEREQTLNQLLVEMDGFESNQTVIVIAATNRPDVLDPALQRPGRFDRQVVVPLPDIRG
                     REQILNVHSKKVPLDESVDLLSLARGTPGFSGADLANLVNEAALFAGRRNKVKVDQSD
                     FEDAKDKIYMGPERRSMVMHEDEKRATAYHESGHAIVAESLPFTDPVHKVTIMPRGRA
                     LGLTWQLPERDRISMYKDQMLSQLSILFGGRIAEDIFVGRISTGASNDFERATQMARE
                     MVTRYGMSDKMGVMVYAENEGEVFLGRSVTRSQNISEKTQQDIDAEIRRILDEQYQVA
                     YKILDENRDKMETMCKALMEWETIDRDQVLEIMAGKQPSPPKDYSHNLRENADAAEDN
                     APHAPTREKTEAPAPADTASTESGQQPENKA"
     gene            complement(376747..377367)
                     /locus_tag="NGO_RS01970"
                     /old_locus_tag="NGO0383"
                     /old_locus_tag="NGO_0383"
     CDS             complement(376747..377367)
                     /locus_tag="NGO_RS01970"
                     /old_locus_tag="NGO0383"
                     /old_locus_tag="NGO_0383"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016688282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RlmE family RNA methyltransferase"
                     /protein_id="WP_003698155.1"
                     /translation="MAVRSKSSKAWLHEHINDQYVHMAQKDGYRARAAYKLLEINEKD
                     KIIKPGTVLADLGSAPGSWSQVAAKLTGTSGAVFALDILPMEAIGGVSFIQGDFREND
                     VLAQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFYLCELALDFASQHLKTGGSFL
                     VKVFQGAGYQEYMAAMREIFGTVQTRKPEASRNRSSEIYLLGKNKR"
     gene            377477..377761
                     /gene="yhbY"
                     /locus_tag="NGO_RS01975"
                     /old_locus_tag="NGO0384"
                     /old_locus_tag="NGO_0384"
     CDS             377477..377761
                     /gene="yhbY"
                     /locus_tag="NGO_RS01975"
                     /old_locus_tag="NGO0384"
                     /old_locus_tag="NGO_0384"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003750834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome assembly RNA-binding protein YhbY"
                     /protein_id="WP_003690833.1"
                     /translation="MADTKLNTKEILELKARAHHLHPVVMVGQQGLTDAVIKETDAAL
                     TAHELIKVRVFGDDRAERIEICNTLCEAVDAQPVRHIGKLLVLWRKNIEA"
     gene            377945..378946
                     /gene="hemB"
                     /locus_tag="NGO_RS01980"
                     /old_locus_tag="NGO0385"
                     /old_locus_tag="NGO_0385"
     CDS             377945..378946
                     /gene="hemB"
                     /locus_tag="NGO_RS01980"
                     /old_locus_tag="NGO0385"
                     /old_locus_tag="NGO_0385"
                     /EC_number="4.2.1.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019271236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen synthase"
                     /protein_id="WP_164920399.1"
                     /translation="MQFPYRNVPASRMRRMRRDDFSRRLMREHMLTADDLIYPVFVLE
                     GAAREEDVPSMPGVKRQSLDRLLFTAEEAVKLGIPMLALFPVVTANKTGRAQEAYNPE
                     GLVPSTVRALRERFSELGIMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALC
                     HAEAGTQVVAPSDMMDGRIGAIREALEDAGHIHTRIMAYSAKYASAFYGPFRDAVGSS
                     GNLGKADKKTYQMDPANTDEALHEVALDIQEGADMVMVKPGLPYLDVVRRVKDEFGVP
                     TYAYQVSGEYAMLQAAVANGWLDGGKVVLESLLAFKRAGADGILTYYAIEAAKMLKR"
     gene            complement(379010..380167)
                     /locus_tag="NGO_RS01985"
                     /old_locus_tag="NGO0386"
                     /old_locus_tag="NGO_0386"
     CDS             complement(379010..380167)
                     /locus_tag="NGO_RS01985"
                     /old_locus_tag="NGO0386"
                     /old_locus_tag="NGO_0386"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019270119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PLP-dependent transferase"
                     /protein_id="WP_003698156.1"
                     /translation="MKFPTRTIHSGYDCDEHNRALMPPIYQNSMFALHEIGENVPYRY
                     SRLSNPTRQILEDTVADLEHGAAGFAFSSGMAGIDAVWRTFLRPGDTIVAVADIYGGA
                     YDLLVDVYQKWGVNVVFADLGNPDNLDELLKAHNVKLVWLEMPSNPLLRLVDIKALAA
                     KAKAADALVGIDNTFATPYLQQPLDMGCDFAFHSATKYLCGHSDVLMGIVVAKTKELA
                     QPLHDMMVHTGAIAGPTDCWLVLRGIKTLALRMEAHCKNALEIARRLEAHPAIEKVFH
                     PGLPSHEHYALAQAQMPKGIGGVVTVYLKNDTREAANSVIKNMKLVKMTSSLGGVESL
                     VNHCYSQSHSGVPHNVKMEMGIRVGLLRFSIGIEDVDDIWNDISAALDTTL"
     gene            380235..381143
                     /locus_tag="NGO_RS01990"
                     /old_locus_tag="NGO0387"
                     /old_locus_tag="NGO_0387"
     CDS             380235..381143
                     /locus_tag="NGO_RS01990"
                     /old_locus_tag="NGO0387"
                     /old_locus_tag="NGO_0387"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014580530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase I FolE2"
                     /protein_id="WP_017146743.1"
                     /translation="MQPPKASDIISHLQAGGRQRFFRRHLPAIQYTHLNNYLNIKDKQ
                     RMNAIADVQSSRDLRNLPINQVGIKDLRFPITLKTAEGTQSTVARLTMTVYLPAEQKG
                     THMSRFVALMEQHTEVLDFAQLHRLTAEMVALLDSRAGKISVSFPFFRKKTAPVSGIR
                     SLLDYDVSLTGEMKDGAYGHSMKVMIPVTSLCPCSKEISQYGAHNQRSHVTVSLTSDA
                     EVGIEEVIDYVETQASCQLYGLLKRPDEKYVTEKAYENPKFVEDMVRDVATSLIADKR
                     IKSFVVESENFESIHNHSAYAYIAYP"
     gene            381340..382005
                     /locus_tag="NGO_RS01995"
                     /old_locus_tag="NGO0388"
                     /old_locus_tag="NGO_0388"
     CDS             381340..382005
                     /locus_tag="NGO_RS01995"
                     /old_locus_tag="NGO0388"
                     /old_locus_tag="NGO_0388"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010357347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent oxidoreductase"
                     /protein_id="WP_003687816.1"
                     /translation="MTVLSKEQVLSAFKNRKSCRHYDAARKISAEDFQFILELGRLSP
                     SSVGSEPWQFVVVQNPEIRQAIKLFSWGMADALDTASHLVVFLAKKNARFDSPFMLES
                     LKRRGVTEPDAVEKSLARYQAFQADDIKILDDSRALFDWCCRQTYIALANMMTGAAMA
                     GIDSCPVEGFNYADMERVLSGQFGLFDAAEWGVSVAATFGYRVQEIVTKARRPLEETV
                     IWA"
     gene            complement(382060..382818)
                     /locus_tag="NGO_RS02000"
                     /old_locus_tag="NGO0389"
                     /old_locus_tag="NGO_0389"
     CDS             complement(382060..382818)
                     /locus_tag="NGO_RS02000"
                     /old_locus_tag="NGO0389"
                     /old_locus_tag="NGO_0389"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002235646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA pseudouridine synthase"
                     /protein_id="WP_003687817.1"
                     /translation="MNSKISSDHTEDTIRLSKRMAQLGLCSRREADGHIEQGWVTVNG
                     KTAVLGQKVSPADRIELNKKAHEQQAARITILLNKPVGYVSAQAEKGYKSAAELITPE
                     NCWEGDTSRISFDPKHKIGLAPAGRLDIDSVGLLVLTQDGRIAKQLIGENSGSEKEYL
                     VRVRGKLDEKGLALLNHGLSLDGDKLRPAKVEWQNEDQLRFVLKQGKKRQIRRMCELV
                     GLRVVGLKRIRMGKVKLGRLPPGKWRYLAPGESF"
     gene            complement(382843..383733)
                     /locus_tag="NGO_RS02005"
                     /old_locus_tag="NGO0390"
                     /old_locus_tag="NGO_0390"
     CDS             complement(382843..383733)
                     /locus_tag="NGO_RS02005"
                     /old_locus_tag="NGO0390"
                     /old_locus_tag="NGO_0390"
                     /EC_number="2.7.1.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016688388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(+) kinase"
                     /protein_id="WP_003687818.1"
                     /translation="MNSPFHNIGIVTRPNTPDIQDTAHTLITFLKQHGFTVYLDEVGV
                     RECCIYTQDTDGCHIVNKTELGQYCDLVAVLGGDGTFLSAAREITPRAVPIIGINQGH
                     LGFLTQIPREYMTDKLLPVLEGKYLAEERILIEAALIREGKTAERALALNDAVLSRGG
                     AGQMIEFEVFVNQEFVYTQRSDGLIVSTPTGSTAYSLAAGGPIMQAGLHAFTLVPICP
                     QSMTNRPIAIPDTSEIEILVTQGGDARVHFDGQSFIDVQNLDRIIIRRYHNPLRILHP
                     TDYQYFKTLRQKLHWGEQLV"
     gene            complement(383753..384319)
                     /locus_tag="NGO_RS02010"
                     /old_locus_tag="NGO0391"
                     /old_locus_tag="NGO_0391"
     CDS             complement(383753..384319)
                     /locus_tag="NGO_RS02010"
                     /old_locus_tag="NGO0391"
                     /old_locus_tag="NGO_0391"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019271930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003690844.1"
                     /translation="MSALLPIINRLILQSPDSRSELTSFAGKTLTLNIAGLKLAGRIT
                     EDGLLSAGNGFADTEITFRNSAIRKILQGGEPGAGDIRLEGDLILGIAVLSLLGSLRS
                     RASDELARIFGTQAGIGSRATDIGHGIKQIGRNIAEQIGGFSREPESANTGNEALADC
                     LDEISRLRDGVERLNERLDRLERDIWID"
     gene            complement(384369..385145)
                     /locus_tag="NGO_RS02015"
                     /old_locus_tag="NGO0392"
                     /old_locus_tag="NGO_0392"
     CDS             complement(384369..385145)
                     /locus_tag="NGO_RS02015"
                     /old_locus_tag="NGO0392"
                     /old_locus_tag="NGO_0392"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_003692783.1"
                     /translation="MRAVPPPHISITGLGYLGLPLAQKFYRHGSRVAAIKRSLTSDDI
                     NLPIHLDTFDLNRTDAFQTALWRHHADKPVWFFLLPPSFLAHYADTVKQWAELARACN
                     VQHLIFTSSTSVYGDKARECDETAAPDPQTESARQILAAEQHLLDNGVPNIDILRLGG
                     LYCAERHPVSRLVQKQNIQGGNRPVNIVHRDIAVENLFQTASNPGGRRLKNIIEPRHP
                     TRREFYTEEAAKLGLPAPDFSPDDSVGKIIRTVCDNGLSL"
     gene            complement(385200..385850)
                     /locus_tag="NGO_RS02020"
                     /old_locus_tag="NGO0393"
                     /old_locus_tag="NGO_0393"
     CDS             complement(385200..385850)
                     /locus_tag="NGO_RS02020"
                     /old_locus_tag="NGO0393"
                     /old_locus_tag="NGO_0393"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_003692786.1"
                     /translation="MPVTRIAKTNTYTRIIDASLALFNEEGERNISTNHIAAHLGISP
                     GNLYYHFRNKDEIIVQLFKRYSEALLAYLNEAVLPSDVEDSINYMAGIYDVMWEYRFL
                     FSDVNTLLARSAELLGEHNTFTQAKVSPLLVKLLTQLNGLNVINADQTAMNDLAVNMW
                     MVTKYWFDFDSSLRGRTKLTEDSKARGVRRTLSLLRPYLLPEHRAEYDRKIGNGNP"
     gene            complement(385862..386902)
                     /gene="murB"
                     /locus_tag="NGO_RS02025"
                     /old_locus_tag="NGO0394"
                     /old_locus_tag="NGO_0394"
     CDS             complement(385862..386902)
                     /gene="murB"
                     /locus_tag="NGO_RS02025"
                     /old_locus_tag="NGO0394"
                     /old_locus_tag="NGO_0394"
                     /EC_number="1.3.1.98"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019271933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate dehydrogenase"
                     /protein_id="WP_003692788.1"
                     /translation="MQPIRYRTDLTPYNTFGLHAQARAFIALKHADELRDIVRLPEFD
                     RDTVLWLGGGSNILLMQDYDGLVVHMENKGIREIARSDGMVLIEAQAGEIWHDFVLHT
                     VALGLSGLENLSLIPGTVGASPVQNIGAYGVEAKDVIHSVRCFDLDTETFVTLSNADC
                     RFAYRESLFKQEGKGRYVIVSVVFALKTHFVPNLGYGDLAAKVAELSAGREATAKDVS
                     DAVSAIRNSKLPDPKVLGNVGSFFKNPVVSAEKAATLLQRHPDMPRYPQPDGSVKLAA
                     GWLIDQCRLKGFQIGGAAVHDKQALVLVNKNNASANDVRQLAQHIKFTVFARFQVELH
                     AEPNWLPTSFSL"
     gene            complement(386946..388325)
                     /locus_tag="NGO_RS02030"
                     /old_locus_tag="NGO0395"
                     /old_locus_tag="NGO_0395"
     CDS             complement(386946..388325)
                     /locus_tag="NGO_RS02030"
                     /old_locus_tag="NGO0395"
                     /old_locus_tag="NGO_0395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002256528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium-coupled multidrug efflux MATE transporter
                     NorM"
                     /protein_id="WP_003687823.1"
                     /translation="MLLDLDRFSFSVFLKEIRLLTALALPMLLAQVAQVGIGFVDTVM
                     AGGAGKEDLAAVALGSSAFATVYITFMGIMAALNPMIAQLYGAGKTGEAGETGRQGIW
                     FGLILGIFGMILMWAAITPFRNWLTLSDYVEGTMAQYMLFTSLAMPAAMVHRALHAYA
                     SSLNRPRLIMLVSFAAFVLNVPLNYIFVYGKFGMPALGGAGCGVATMAVFWFSALALW
                     IYIAKEKFFRPFGLTAKFGKPDWAVFKQIWKIGAPIGLSYFLEASAFSFIVFLIAPFG
                     EDYVAAQQVGISLSGILYMIPQSVGSAGTVRIGFSLGRREFSRARYISGVSLVSGWVL
                     AVITVLSLVLFRSPLASMYNDDPAVLSIASTVLLFAGLFQPADFTQCIASYALRGYKV
                     TKVPMFIHAAAFWGCGLLPGYLLAYRFDMGIYGFWTALIASLTIAAVALVWCLEKYSM
                     ELVKSHKAV"
     gene            388662..389813
                     /locus_tag="NGO_RS02035"
                     /old_locus_tag="NGO0397"
                     /old_locus_tag="NGO_0397"
     CDS             388662..389813
                     /locus_tag="NGO_RS02035"
                     /old_locus_tag="NGO0397"
                     /old_locus_tag="NGO_0397"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002238977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase regulatory
                     subunit"
                     /protein_id="WP_003687826.1"
                     /translation="MQTWQLPEHIADVLPTNARQLESAREQLLALFRVHGYELVQPPL
                     MEYAHSLLTHIDAGLSLKTILVTDRLSGRQLGIRADITPQVARIDAHLLSANQGINRL
                     CYAGPVLHAQPDGLPNMREPLQAGAEMYGFADIRGDIELIDLMLKSMKIADMGKVLLS
                     LGHIGIFRALSDAAHLDAGQSAALLALMQDKDTGSVEAQVKAWKLDGMWAKAFSLLPR
                     LYGGREVLSDARGRLPDLSAVGGALDELQAVCDAFPDNEIHIDLSELRVDNYHTGLLY
                     AAYAADFHDAVARGGRYDGLGGYFGRARPATGFSFDLRSFIGRLPAVERQPAVLVDAE
                     DAEAAREAVEALREQGQCVVIDYGIGHNVSEELAGRLKKTDGVWQVVKR"
     gene            389918..391216
                     /locus_tag="NGO_RS02040"
                     /old_locus_tag="NGO0398"
                     /old_locus_tag="NGO_0398"
     CDS             389918..391216
                     /locus_tag="NGO_RS02040"
                     /old_locus_tag="NGO0398"
                     /old_locus_tag="NGO_0398"
                     /EC_number="6.3.4.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019271936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthase"
                     /protein_id="WP_010359891.1"
                     /translation="MAKNVVVIGAQWGDEGKGKIVDWLAEEAGGVVRFQGGHNAGHTL
                     VVGGKKTILRLIPSGILHEGLDCFIGSGVVVSPEALLGEIDELNAAGVKNVEGRLKIA
                     PTCPLILPYHIALDQAREASRGKGKIGTTGRGIGPAYEDKVARRAIRAADLLHPEKLR
                     EKLDAVLAYYNVQLQYLHNAGPVKAEDVMAVIEKVAPRIAPMIADVSRVLNEKNKNGE
                     KLLFEGAQGALLDIDYGTYPFVTSSNCLAGAASAGAGVGPQMLDYVLGIVKAYTTRVG
                     SGPFPTELFDEVGAGLAERGHEFGSVTGRARRCGWFDAAALKRSIQINGISGMCITKL
                     DVMDGVETINICVGYELPGGGKTDILPCGSDAVETCKPIYETMPGWRESTVGVKSYDA
                     LPANAKAYLKRIEEVCGAPVAIVSTGPDREETIVLHHPFA"
     gene            complement(391452..392291)
                     /gene="htpX"
                     /locus_tag="NGO_RS02045"
                     /old_locus_tag="NGO0399"
                     /old_locus_tag="NGO_0399"
     CDS             complement(391452..392291)
                     /gene="htpX"
                     /locus_tag="NGO_RS02045"
                     /old_locus_tag="NGO0399"
                     /old_locus_tag="NGO_0399"
                     /EC_number="3.4.24.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019270940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease HtpX"
                     /protein_id="WP_010357358.1"
                     /translation="MKRIFLFLATNIAVLVVINIVLAVLGINSRGGAGSLLAYSAVVG
                     FTGSIISLLMSKFIAKQSVGAEVIDTPRTEEEAWLLNTVEAQARQWNLKTPEVAIYHS
                     PEPNAFATGASRNSSLIAVSTGLLDHMTRDEVEAVLAHEMAHVGNGDMVTLTLIQGVV
                     NTFVVFLSRIIANLIARNNDGSQSQGTYFLVSMVFQILFGFLASLIVMWFSRQREYRA
                     DAGAAKLVGAPKMISALQRLKGNPVDLPEEMNAMGIAGDTRDSLLSTHPSLDNRIARL
                     KSL"
     gene            392506..393153
                     /gene="adk"
                     /locus_tag="NGO_RS02050"
                     /old_locus_tag="NGO0400"
                     /old_locus_tag="NGO_0400"
     CDS             392506..393153
                     /gene="adk"
                     /locus_tag="NGO_RS02050"
                     /old_locus_tag="NGO0400"
                     /old_locus_tag="NGO_0400"
                     /EC_number="2.7.4.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002232195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="WP_003687832.1"
                     /translation="MKALLLGAPGAGKGTQAQFITAAFGIPQISTGDMLRAAIKAGTP
                     LGLEAKKIIDEGGLVRDDIIIGMVKERIAQDDCKNGFLFDGFPRTLAQAEAMVEAGVG
                     LDAVVEIDVSDSVIVDRMSGRRVHLASGRTYHVTYNPPKTEGKDDVTGEDLIQRDDDK
                     EETVKKRLAVYHEQTEVLVDFYSKLEGEHAPKYIKVDGTQAVEAVKAEVLGALGK"
     gene            393677..394417
                     /gene="pyrF"
                     /locus_tag="NGO_RS02055"
                     /old_locus_tag="NGO0401"
                     /old_locus_tag="NGO_0401"
     CDS             393677..394417
                     /gene="pyrF"
                     /locus_tag="NGO_RS02055"
                     /old_locus_tag="NGO0401"
                     /old_locus_tag="NGO_0401"
                     /EC_number="4.1.1.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003756133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="orotidine-5'-phosphate decarboxylase"
                     /protein_id="WP_003687835.1"
                     /translation="MNPLITDFQTPQQRTPVIVALDFANEKDTLGFVRNLDPALCQIK
                     IGKELFTATGRSLAESLIHQGFKLFLDLKYHDIPHTVAQACKVAADMGVWMVDMHASG
                     GRRMMEAAAEAVAGYGTKPLLIGVTVLTSMEQSDLAEIGLNTAPEEQVIRLAKLAQSS
                     GLDGVVCSAQEAAPLRRELGRDFVLVTPGIRLDVAGNNDDQRRIMTPAEALAAGSTYL
                     VMGRPVTRAADPVAVLREVNRVANLEAN"
     gene            394473..395435
                     /gene="hldA"
                     /locus_tag="NGO_RS02060"
                     /old_locus_tag="NGO0402"
                     /old_locus_tag="NGO_0402"
     CDS             394473..395435
                     /gene="hldA"
                     /locus_tag="NGO_RS02060"
                     /old_locus_tag="NGO0402"
                     /old_locus_tag="NGO_0402"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose synthase"
                     /protein_id="WP_003687836.1"
                     /translation="MPAKFQQETLKSRFAQAKVLVVGDVMLDRYWFGDVSRISPEAPV
                     PVAKIGRIDQRAGGAANVARNIASLGGRAGLLSVTGDDEAAAALDALMVQDGVASYLM
                     RDKQIATTVKLRVVARNQQLIRLDFEEHPNREVLEQIKRKYREILPEYDAIIFSDYGK
                     GGLSHISDMIDWAKHVGKTVLIDPKGDDYEKYVGATLITPNCAELKEVVGSWKNEGDL
                     TEKAQNLRRHLDLTAVLLTRSEEGMTLFSEGEPIYQPTRAQEVYDVSGAGDTVIAGMG
                     LGLAAGCTMPEAMYLANTAAGVVVAKLGTAVCSFAELVEALDGQ"
     gene            395499..396503
                     /gene="rfaD"
                     /locus_tag="NGO_RS02065"
                     /old_locus_tag="NGO0403"
                     /old_locus_tag="NGO_0403"
     CDS             395499..396503
                     /gene="rfaD"
                     /locus_tag="NGO_RS02065"
                     /old_locus_tag="NGO0403"
                     /old_locus_tag="NGO_0403"
                     /EC_number="5.1.3.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015815422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-glyceromanno-heptose 6-epimerase"
                     /protein_id="WP_003687838.1"
                     /translation="MTIIVTGAAGFIGSNIVKALNQRGITDIVAVDNLTKGEKFKNLA
                     ECEIAHYLDKHEFIRQVREHILPYQNIEAVFHQGACSDTMNHDGLYMMENNYQYTLDL
                     LDWCQDERIPFLYASSAAVYGKGEIFREERELEKPLNVYGYSKFLFDQVLRRRMKEGL
                     TAQVVGFRYFNVYGQHEQHKGRMASVAFHHFHQYREHGYVNLFGSNDGYGNGEQTRDF
                     VSVEDVAKINLYFFDHPELSGIYNLGTGRSQQFNELAAAAVNACRAAEGKSELSLKEL
                     VEEELIRYIPFPDALKGKYQGFTQADITKLREAGYKEEFFDVKAGVNRYVKWMLENLA
                     "
     gene            396578..398122
                     /locus_tag="NGO_RS02070"
                     /old_locus_tag="NGO0404"
                     /old_locus_tag="NGO_0404"
     CDS             396578..398122
                     /locus_tag="NGO_RS02070"
                     /old_locus_tag="NGO0404"
                     /old_locus_tag="NGO_0404"
                     /EC_number="2.1.1.72"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system subunit
                     M"
                     /protein_id="WP_003687840.1"
                     /translation="MMTEMQQRAQLHRQIWKIADEVRGAVDGWDFKQYVLGTLFYRFI
                     SENFTDYMQAGDSSIDYAAMPDSIITPEIKDDAVKVKGYFIYPGQLFCNIAAEAHQNE
                     ELNTKLKEIFTAIESSASGYPSEQGIKGLFDDFDTTSSRLGSTVADKNKRLAAVLKGV
                     AELDFGNFEDHRIDLFGDAYEYLISNYAANAGKSGGEFFTPQSVSKLIARLAVHGQEK
                     VNKIYDPACGSGSLLLQAKKQFDEHIIEEGFFGQEINHTTYNLARMNMFLHNVNYNKF
                     HIELGDTLTNPKLKDSKPFDAVVSNPPYSIDWIGSDDPTLINDDRFAPAGVLAPKSKA
                     DFAFILHALNYLSGRGRAAIVSFPGIFYRGGAEQKIRQYLVEGNYVETVIALAPNLFY
                     GTCIAVNILVLSKHKDNTDIQFIDASGFFKKETNNNVLTEEHIAEIVKLFADKADVPH
                     IAQNAAQQTVKDNGYNLAVSSYVEAEDTREVIDIRQLNAEISETVAKIERLRREIDEV
                     IAEIET"
     gene            398238..399089
                     /gene="dinD"
                     /locus_tag="NGO_RS02075"
                     /old_locus_tag="NGO0405"
                     /old_locus_tag="NGO_0405"
     CDS             398238..399089
                     /gene="dinD"
                     /locus_tag="NGO_RS02075"
                     /old_locus_tag="NGO0405"
                     /old_locus_tag="NGO_0405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012503458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA damage-inducible protein D"
                     /protein_id="WP_003687842.1"
                     /translation="MTTENNAFENAKHIDETGNEYWSARTLQQILEYSEWRNFQRAID
                     KAITACETSGNDKNHHFVETNKMIALGKGGQREVADYRLSRYACYLIVQNGDPSKSVI
                     AAGQTYFAVQARRQELQDEAAFRSLGEDKQRLLLRRQLREHNTDLAAAAKDAGVEKPV
                     EYAVFQNHGYRGLYGGLDKQGIHSRKGLKKSQRILDHMNASEPAANLFRATQTEEKLR
                     RKNIQGKTQANRVHFEVGQKVRQTIEELGGIMPENQPVPEKSIKQLENEEQKRLAATE
                     QHQNGKK"
     gene            399256..399882
                     /locus_tag="NGO_RS02080"
                     /old_locus_tag="NGO_02155"
     CDS             399256..399882
                     /locus_tag="NGO_RS02080"
                     /old_locus_tag="NGO_02155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014580129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit S"
                     /protein_id="WP_025456033.1"
                     /translation="MDMQSKAKKLIEMIQTAPVEWKPLGEVLVRTKGTKITAGQMKEM
                     HKDNAPLKIFAGGKTFALVDFDDVPDKDIHREPSIIVKSRGIIEFEYYDKPFSHKNEM
                     WSYHSVNKHIYIKYVYYFLKTQENYFRNIGSKMQMPQIATPDTDNYKIPIPSLETQQK
                     IVKILDKFTELEATLEATLEAELALRKRQYRYYRDLLLDFDNQIGGDS"
     gene            399923..400477
                     /locus_tag="NGO_RS02085"
                     /old_locus_tag="NGO_02160"
     CDS             399923..400477
                     /locus_tag="NGO_RS02085"
                     /old_locus_tag="NGO_02160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002261775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit S"
                     /protein_id="WP_020996792.1"
                     /translation="MGEVAEYSKNRICSDKLNEHNYVGVDNLLQNREGKKLSGYVPSE
                     GKMTEYIVNDILIGNIRPYLKKIWQADCTGGTNGDVLVIRVTDEKVNPKYLYQVLADD
                     KFFAFNMKHAKGAKMPRGSKAAIMQYKIPIPPLPEQEKIVAILGKFDTLTHSVSEGLP
                     HEIALRRKQYEYYREQLLAFPKAA"
     gene            400709..403807
                     /locus_tag="NGO_RS02090"
                     /old_locus_tag="NGO0407"
                     /old_locus_tag="NGO_0407"
     CDS             400709..403807
                     /locus_tag="NGO_RS02090"
                     /old_locus_tag="NGO0407"
                     /old_locus_tag="NGO_0407"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction endonuclease subunit R"
                     /protein_id="WP_003706627.1"
                     /translation="MNLETKPIAETPNFIVLDQYEKIEQSGSYQSENRLEAELIADLQ
                     NQGYEYRKDLNSQSRLLENLRAQLQRLNDVAFSDGEWARFLTEYLDRPAENITDKTRK
                     IHDDHIYDFAFDDGRLKNIYLLDKKNLARNHVQLINQFEQTGTHANRYDVTVLVNGLP
                     LVQIELKKRGVAVREAFNQVHRYSKESFNSGNSLFKFLQIFVISNGTDTRYFANTTKR
                     DKNSFDFTMNWARSDNHPIKDLKDFTATFLQKSVLLSVLLHYSVFDANDTLLIMRPYQ
                     IAAAERILWKINSSAQAKNWSGPESGGYVWHTTGSGKTLTGFKAARLATESAFIDKVF
                     FVVDRKDLDYQTMKEYQRFSPDSVNGSESTAGLKRNLEKDGNKIIVTTIQKLNNLMKS
                     EDNLPVYHRQVVFIFDECHRSQFGEAQKNLKKKFKKFCQFGFTGTPIFPENALGAETT
                     AGVFGRELHSYVITDAIRDEKVLKFKVDYNDVRPQFKAVEAEQDEKELSAAENRQALL
                     HPERIREITQYILSRFRQKTHRLNAGGKGFNAMFAVSSVDAAKCYYEAFKTQQAGSLH
                     PLKTATIFSFAANEEQNAVGEIVDETFEPEAMDSSAKEFLQAAINDYNACFKTNFGTD
                     SKAFQNYYRDLAKRVKNREVDLLIVVGMFLTGFDAPTLNTLFVDKNLRYHGLMQAFSR
                     TNRIYDATKTFGNIVCFRDLEQATIDAITLFGDKNTKNVVLEKSYEEYMNGYTDSQTG
                     EARRGYLDVAKELHERFPDPDKIETEKDKKDFAKLFGEYLRAENVLQNYDEFAALREL
                     QNVDAADEDAMKAFQEKYYLSDEDVQEMRKVPMPSERAVQDYRSAYNDIRDWLRRQKA
                     GEQKEQSKIDWDDVVFEVDLLKSQEINLDYILQLVFEHHKKIKGKAELVEEIRRIIRA
                     SIGHRAKEGLIVDFINDTDLDKVPDVPAILETFYTYAQEVMRHEAAGLIAAEGLNETA
                     AKRYLTGSLKRGYASENGTELTETLPKMSPLNPQYLTKKQSVFQKIAAFVEKFAGIGA
                     DI"
     gene            complement(403847..406138)
                     /gene="clpA"
                     /locus_tag="NGO_RS02095"
                     /old_locus_tag="NGO0408"
                     /old_locus_tag="NGO_0408"
     CDS             complement(403847..406138)
                     /gene="clpA"
                     /locus_tag="NGO_RS02095"
                     /old_locus_tag="NGO0408"
                     /old_locus_tag="NGO_0408"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015815427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpA"
                     /protein_id="WP_003701038.1"
                     /translation="MLAPELEQILQQLYREARKAHYEFISLEHLLLVLIEEDAAVPNV
                     LKLCGADLKAVSEQLAASVAENTPLIPDHLLDTVETRPTLGFQRVIQRAMVHTQSAGK
                     GLAEPLDVLVALMSETDSHAVYFLGLQSVTRFEVLRCIAHGSPDEDEDDGNYFSDGMD
                     DDNENRTKPGKNPLSAYTVNLNAEVKAGRIDPLIGRKHEMERLVQILCRRRKNNPLLV
                     GEAGVGKTALADGLAHQIVNDDIPDALKEAEVYALDMGSLLAGTKYRGDFEARVKSVL
                     KQLEKIPHAILFIDEIHTIIGAGSTGGGTMDASNLLKPALAKGSLRCIGATTYDEYRT
                     IFDKDHALSRRFQKIDVVEPTVAETVQILRGLKPMFEAFHQVRYTQGALEAAAELSAR
                     YINERFLPDKAIDVMDEAGAAQRILPKSKQKKVIGKAQIETVIAKVARIPEKTVSHDD
                     KQVLQFLGRDLNNMVYGQEDAIDALVSAVKMSRSGLGLPDKPIGSFLFSGPTGVGKTE
                     VAKQLAYSMGVPLQRFDMSEYMERHAVSRLIGAPPGYVGFEQGGLLTEAVNKQPHCVL
                     LLDEIEKAHPDIFNVLLQVMDAGKLTDNNGKSADFRNVILIMTTNAGAESLSRPSLGF
                     TAKRERGDEMQAINKLFTPEFRNRLDAIIPFAPLSEPIIVKVVDKFLLQLEHRLLDKK
                     VEAEFTPALRKYLAEKGFDPQMGARPMHRLIQEKIRKPLADELLFGKLADGGFVRIDW
                     DAAKEEAVLKFKKSKVKIKTASA"
     gene            complement(406140..406442)
                     /gene="clpS"
                     /locus_tag="NGO_RS02100"
                     /old_locus_tag="NGO0409"
                     /old_locus_tag="NGO_0409"
     CDS             complement(406140..406442)
                     /gene="clpS"
                     /locus_tag="NGO_RS02100"
                     /old_locus_tag="NGO0409"
                     /old_locus_tag="NGO_0409"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003754853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease adapter ClpS"
                     /protein_id="WP_010951037.1"
                     /translation="MTAQHQSDTLLHRLNTLPPKRYGVFLLNDDYTTMEFVVEILTEI
                     FMLGQEQAVAVMLSVHHEGKGLCGTYTRDIAQTKQQQVMQRAKAEGHPLQCIVEEI"
     gene            406687..406890
                     /locus_tag="NGO_RS02105"
                     /old_locus_tag="NGO0410"
                     /old_locus_tag="NGO_0410"
     CDS             406687..406890
                     /locus_tag="NGO_RS02105"
                     /old_locus_tag="NGO0410"
                     /old_locus_tag="NGO_0410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006478030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="WP_002217533.1"
                     /translation="MATGIVKWFNDAKGFGFITPDEGGEDLFAHFSAINMEGFKTLKE
                     GQRVSFDVTTGPKGKQAANIQAA"
     gene            complement(407189..408520)
                     /gene="pmbA"
                     /locus_tag="NGO_RS02110"
                     /old_locus_tag="NGO0411"
                     /old_locus_tag="NGO_0411"
     CDS             complement(407189..408520)
                     /gene="pmbA"
                     /locus_tag="NGO_RS02110"
                     /old_locus_tag="NGO0411"
                     /old_locus_tag="NGO_0411"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003754858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metalloprotease PmbA"
                     /protein_id="WP_003687847.1"
                     /translation="MLFNHTASELLDLCRRTLDLAKAAGATAAEADFSESLGQSVSVR
                     LGEIEQIEFQQDKSLDITVYVGKRKGRAGTADFSEQALRDTVRAAADIARHTAEDGCA
                     GLADPELMAQHIGDPDLYHEWDLDTEAAVGLAKQCEQAALDTDSRIENSEGAAVQTGH
                     YQYVYGNTHGFAAHRQSTHHSISCSVVAADENGMQRDYWYDSACRHPDMDSPETIGQT
                     AARRTLRRLGSRSIPTGSYPVLFDTTVSGGLIGHLVGTLSGGALYRQSSFLIDSIGKK
                     VLPDFLNLREEPHIPRSFRSSYFDAEGVATAPRFVIQNGIVEGYFLGSYSARKLGMQT
                     TGNAGGAHNLYLNHTHETQSDLLKEMGTGLLVTELMGQGANTITGDYSRGAAGFWVEN
                     GVIAYPVHEITVAGRLQDMYRDIVGVADDALRRSSNKIGSILIAGMTVAGS"
     gene            408590..409180
                     /locus_tag="NGO_RS02115"
                     /old_locus_tag="NGO0412"
                     /old_locus_tag="NGO_0412"
     CDS             408590..409180
                     /locus_tag="NGO_RS02115"
                     /old_locus_tag="NGO0412"
                     /old_locus_tag="NGO_0412"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017146744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated protein"
                     /protein_id="WP_003706626.1"
                     /translation="MQGVRCKKPSERGGILLKYAIGKNSRIKMFEQEDEWISKTQMKK
                     QMNGLQDLGMELTRLSNDTLKKIGLDEDLYEAVVTYKKITSNGALKRQAQFIGRLMRD
                     TDPAPIEAFLAKLRGDDAAHNAFLQRVEQARVRLLADEGALTQFMSDFPNAGAGRLRT
                     LVRNTKKEQEQDKPPKNFRALFQELKTVMENGGAEI"
     gene            409227..409940
                     /locus_tag="NGO_RS02120"
                     /old_locus_tag="NGO0413"
                     /old_locus_tag="NGO_0413"
     CDS             409227..409940
                     /locus_tag="NGO_RS02120"
                     /old_locus_tag="NGO0413"
                     /old_locus_tag="NGO_0413"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002258153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003706625.1"
                     /translation="MLFRKTTAAVLAATLILNGCTMMLRGMNNPVSQTITRKHVDKDQ
                     IRAFGVVAEDNAQLEKGSLVMMGGKYWFAVNPEDSAKLTGLLKAGLDKPFQIVEDTPS
                     YARHQALPVKFEAPGSQNFSTGGLCLRYDTGRPDDIAKLKQLEFKAVKLDNRTIYTRC
                     VSAKGKYYATPQKLNADYHFEQSVPADIYYTVTEKHTDKSKLFGNILYTPPLLILDAA
                     AAVLVLPMALIAAANSSDK"
     gene            410009..411709
                     /gene="recJ"
                     /locus_tag="NGO_RS02125"
                     /old_locus_tag="NGO0414"
                     /old_locus_tag="NGO_0414"
     CDS             410009..411709
                     /gene="recJ"
                     /locus_tag="NGO_RS02125"
                     /old_locus_tag="NGO0414"
                     /old_locus_tag="NGO_0414"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded-DNA-specific exonuclease RecJ"
                     /protein_id="WP_003694944.1"
                     /translation="MSVKIQTRPVNTDVFNHLLAAGADPLIARLCASRGVQSPAELDD
                     KLASLLPYQSLTNCEAAAGRLADAVERKEKILIVADYDADGATACAVGLDGLAAMGAK
                     VDFLVPNRFEHGYGLTPELAEIAAAQGVDLLITVDNGIASIAGVARAQALGLDVIVTD
                     HHLPADTVPDCIIVNPNQKGCGFPSKSLAGVGVIFYVLTALRAELRRRNYFSDGIKEP
                     NLGGLLDLVALGTVADVVPLDHNNRILVSQGLKRMRSGKMRPGIRALFEVARRDWRKA
                     QPFDMGFALGPRINAAGRLDDMSVGIACLLARDDSEAQELAARLNNLNIERREIEQSM
                     LRDALNAFPETLPSGQTTLVAYRDDFHQGVVGIVASRLKDRFYRPTIVFAPADNGEVR
                     GSGRSIPNLHLRDALDLVSKRHPDLILKFGGHAMAAGLSILEHNIPAFQTAFEEAVRE
                     MVCEDDLSQTYITDGSLPACDITLEQAQNLACHVWGQGFAPPSFTDEFHVVRQQPLGA
                     EGKHKKAWLQKDGCEFEAMFWRCSEDIPEYIRTVYRPVANEWRNNLELQLYIDYWEAA
                     "
     gene            412067..413425
                     /locus_tag="NGO_RS02130"
                     /old_locus_tag="NGO0415"
                     /old_locus_tag="NGO_0415"
     CDS             412067..413425
                     /locus_tag="NGO_RS02130"
                     /old_locus_tag="NGO0415"
                     /old_locus_tag="NGO_0415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002243435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polynucleotide adenylyltransferase PcnB"
                     /protein_id="WP_010359904.1"
                     /translation="MLKKWLNKMLPSGRSSKKAESKTVIPAERHNISAEMLSFAAENV
                     IRRLKGAGFQAYVVGGAVRDLLLGIEPKDFDVATDATPEQVHKLFRRSRIIGRRFQIV
                     HVMNGAEIIEVTTFRGGAKVHQNAHGRIMKDNTYGSIEEDAMRRDFTCNALYYDPEKE
                     EILDFHNGIADVAARRLVMIGNAAERYQEDPVRILRAIRLSGKLGFELSEETAAPIAE
                     SICRLKHEPVARLFDEIMKLLFSGHARECLKRLNGFDIPDIHPLLNALRVSDGIAGKM
                     TALALKNTDERLRADKSVSVGFVLAALMWPELDRHWKSNLQQGLKPTPALSDAINTMR
                     ETVERGWGVPQRFSATMREIWMFQPQFENRKGARPHKLFAQARFRAAYDFLLLRAETG
                     NADRALAEWWTAFQTASAEQRTEMTKNEAAARHEKNEGQAKKRRRRRRKPKPKVVGTD
                     WE"
     gene            413598..413921
                     /locus_tag="NGO_RS02135"
                     /old_locus_tag="NGO0416"
                     /old_locus_tag="NGO_0416"
     CDS             413598..413921
                     /locus_tag="NGO_RS02135"
                     /old_locus_tag="NGO0416"
                     /old_locus_tag="NGO_0416"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687855.1"
                     /translation="MKKCILGILTACAAMPAFADRISDLEARLAQLEHRVAVLESGGN
                     TVKIDLFGSNSTMYVCSVTPFQKTFEASDRNEGVARQKVRQACNRETSAMFCGDEAIR
                     CRKFD"
     gene            complement(414026..414979)
                     /locus_tag="NGO_RS02140"
                     /old_locus_tag="NGO0417"
                     /old_locus_tag="NGO_0417"
     CDS             complement(414026..414979)
                     /locus_tag="NGO_RS02140"
                     /old_locus_tag="NGO0417"
                     /old_locus_tag="NGO_0417"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002258530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoH family protein"
                     /protein_id="WP_003687857.1"
                     /translation="MTHTVHLHLEETDNPTLQRLCGSFDSNLDSLAKALDIHISRRFE
                     HFTFNGAFAHAGKRALLKLLETAQTRDLNDSIIRLAAVETQTEDAGHQEKNHEHAYYF
                     RTKRGSIGGRTPRQNGYIRALLDHDIVFGLGPAGTGKTYLAVAAAVDAMEKHQVERII
                     LVRPAVEAGEKLGFLPGDLTQKVDPYLRPLYDALYDLMGFDRVTKLIEKGLIEIAPLA
                     YMRGRTLNGAYIILDEAQNTTPEQMKMFLTRIGFGAKAVITGDTSQIDLPKNIKSGLK
                     DAREKLHGVAGLYFHTFTGEDVVRHPLVQKIVEAYESAEHD"
     gene            complement(415005..416200)
                     /locus_tag="NGO_RS02145"
                     /pseudo
     CDS             complement(415005..416200)
                     /locus_tag="NGO_RS02145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003681294.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
     gene            416344..417049
                     /locus_tag="NGO_RS02150"
                     /old_locus_tag="NGO0420"
                     /old_locus_tag="NGO_0420"
                     /pseudo
     CDS             416344..417049
                     /locus_tag="NGO_RS02150"
                     /old_locus_tag="NGO0420"
                     /old_locus_tag="NGO_0420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002248833.1"
                     /note="The SIMPL domain is named for its presence in mouse
                     protein SIMPL (signalling molecule that associates with
                     mouse pelle-like kinase). Bacterial member BP26, from
                     Brucella, was shown to assemble into a channel-like
                     structure, while YggE from E. coli has been associated
                     with resistance to oxidative stress.; frameshifted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="SIMPL domain-containing protein"
     gene            complement(417115..417681)
                     /locus_tag="NGO_RS02155"
                     /old_locus_tag="NGO0421"
                     /old_locus_tag="NGO_0421"
     CDS             complement(417115..417681)
                     /locus_tag="NGO_RS02155"
                     /old_locus_tag="NGO0421"
                     /old_locus_tag="NGO_0421"
                     /EC_number="3.5.4.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003823864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dCTP deaminase"
                     /protein_id="WP_003687863.1"
                     /translation="MSIKSDKWIRRMSEEFGMIDPFEPNQIKEADGQRIISYGTSSYG
                     YDIRCANEFKIFTNINSTIVDPKNFDPKNFVTVEDDCCIIPPNSFALARTVEYFRIPR
                     NVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSNTTPLPAKIYAGEGVAQVLFF
                     ESDEVCETSYKDRNGKYMGQTGVTLPKA"
     gene            complement(417777..418166)
                     /locus_tag="NGO_RS02160"
                     /old_locus_tag="NGO0422"
                     /old_locus_tag="NGO_0422"
     CDS             complement(417777..418166)
                     /locus_tag="NGO_RS02160"
                     /old_locus_tag="NGO0422"
                     /old_locus_tag="NGO_0422"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687866.1"
                     /translation="MLKHLAFLLPAMMFALPAQTAVLSPYQETGCTYEGGIGKDGLPS
                     GKGIWRCRDGRGYTGSFKNGKFDGQGVYTVAAGREVFLEPFNSDSTKFRNMALSGTFK
                     QGLAHGRFAASQNGETLFYYEMRTRHD"
     gene            complement(418218..419117)
                     /gene="rdgC"
                     /locus_tag="NGO_RS02165"
                     /old_locus_tag="NGO0423"
                     /old_locus_tag="NGO_0423"
     CDS             complement(418218..419117)
                     /gene="rdgC"
                     /locus_tag="NGO_RS02165"
                     /old_locus_tag="NGO0423"
                     /old_locus_tag="NGO_0423"
                     /experiment="DESCRIPTION:Gene expression; mutation
                     analysis[PMID:10655208]"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687870.1"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination-associated protein RdgC"
                     /protein_id="WP_003687870.1"
                     /translation="MWFKQISFYPLNKEKLPEADVLADKLAEAEFTHCQGLDWFSEGF
                     TAPVSFSPELVFPADFTLRVALKKEEKVLPAGVIRDILEEKVAEIQNNEARNVGRKEK
                     QELKEQITDDLLPRAFTRSSRTEAVFNTRHGYLLVNNAASAKAENILTKLREALGGLE
                     ASLPNTKQSPSSLMTGWLLQGHCEGGFELDSDCELKGTGDIVPVVKVSKQDLTADEVV
                     QHVKNGKTVTRLGLVWREQIAFILTQDFTLKRIQYLDVLQEEAESNGDDAAGLAFASQ
                     ILMAESVSTMLEELVSYLGGWQD"
     gene            complement(419148..420605)
                     /gene="der"
                     /locus_tag="NGO_RS02170"
                     /old_locus_tag="NGO0424"
                     /old_locus_tag="NGO_0424"
     CDS             complement(419148..420605)
                     /gene="der"
                     /locus_tag="NGO_RS02170"
                     /old_locus_tag="NGO0424"
                     /old_locus_tag="NGO_0424"
                     /experiment="DESCRIPTION:Gene expression; muttion
                     analysis[PMID:10655208]"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003745900.1"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome biogenesis GTPase Der"
                     /protein_id="WP_010951041.1"
                     /translation="MKPTIALIGRPNVGKSTLFNRLTRTKDALVHDLPGLTRDRHYGH
                     GKVGSKPYFVIDTGGFEPVVDSGILHEMAKQTLQAVDEADAVVFLVDGRTGLTPQDKI
                     IADRLRQSPRPVYLAVNKGEGGDRAVLAAEFYELALGEPHVISGAHGDGVYYLIEEIL
                     ENFPEPEAEEADAKHPVFAVIGRPNVGKSTLVNAILGEKRVIAFDMAGTTRDSIHIDF
                     EREGKPFTIIDTAGVRRRGKVDEAVEKFSVIKAMQAVEAANVAVLVLDAQQDIADQDA
                     TIAGFALEAGRALVVAVNKWDGISEERREQVKRDISRKLYFLDFAKFHFISALKERGI
                     DGLFESIQAAYNAAMIKMPTPKITRVLQTAVERQQPPRAGLVRPKMRYAHQGGMNPPV
                     IVVHGNSLHAISDSYTRYLTQTFRKAFNLQGTPLRIQYNVSENPYENAEDKPKKKPLR
                     RVSLSNRIEKREGRKEEKNRFKKKTKVSVKKQFSK"
     gene            complement(420755..421384)
                     /locus_tag="NGO_RS02175"
                     /old_locus_tag="NGO0425"
                     /old_locus_tag="NGO_0425"
     CDS             complement(420755..421384)
                     /locus_tag="NGO_RS02175"
                     /old_locus_tag="NGO0425"
                     /old_locus_tag="NGO_0425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019742838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YfgM family protein"
                     /protein_id="WP_003690875.1"
                     /translation="MAAHLEEQQELDNFKYFWKTTGKWLFALLILAALGYLGYTVYQN
                     RAASQNQEAAAVLANIVEKAQNKAPQSEINAELSKLQQSYPHSISAAQATLMAAATEF
                     DAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEADFA
                     PLLMETKGDVYAAQEKSQEALKNYGQALEKMPQDSVGRELLQMKLDSLK"
     gene            complement(421385..422680)
                     /gene="hisS"
                     /locus_tag="NGO_RS02180"
                     /old_locus_tag="NGO0426"
                     /old_locus_tag="NGO_0426"
     CDS             complement(421385..422680)
                     /gene="hisS"
                     /locus_tag="NGO_RS02180"
                     /old_locus_tag="NGO0426"
                     /old_locus_tag="NGO_0426"
                     /EC_number="6.1.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002225391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine--tRNA ligase"
                     /protein_id="WP_003696863.1"
                     /translation="MAQKIQSVKGMNDLLPVGQKDFKLTAVFWQAFEDTVNRWTRAYG
                     YQQIRTPIVEQTGLFVRSIGEETDVVGKEMYTFSDSNDSLSLSLRPEGTASCLRAVVE
                     HNLLYNSPQKLWYMGPMFRRERPQKGRYRQFHQVGIEALGFEGPDIDAEIIAMSADLW
                     EKLGIREYLTLEINSLGNREERAAHRAALVEYLTRYEAQLDEDSKRRLKTNPLRVLDT
                     KNPDLQEICNAAPRLVDYLGEASQNHYARFKAMLDGLGIQYIENSRLVRGLDYYNQTV
                     FEWTTDKLGAQATVCGGGRYDGLIEELGGKPAPSIGFAMGIERLLLLVSEYGSLEVNA
                     APDVYAMHQGEGADLQVMKYAQALRAQGFNVIQHSGYQSLKAQMKKADNSGARFALIV
                     AQDELADGTVTLKDMNGAHGQQTVSATDLTDTLQQWKNA"
     gene            complement(422808..423464)
                     /locus_tag="NGO_RS02185"
                     /old_locus_tag="NGO0427"
                     /old_locus_tag="NGO_0427"
     CDS             complement(422808..423464)
                     /locus_tag="NGO_RS02185"
                     /old_locus_tag="NGO0427"
                     /old_locus_tag="NGO_0427"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003712823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_003687878.1"
                     /translation="MEQKRRFAASLLLAAALPLCAHSFPFAEENPIAYGKVKIQSWKA
                     RRDFNIVKQDLDFSCGAASVATLLNNFYGQTLTEEEVLEKLGKEQMRASFEDMRRIMP
                     DLGFEAKGYALSFEQLAQLKIPVIVYLKYRKDDHFSVLRGIGGNTVLLADPSPGHVSM
                     SRAQFLEAWQTREGNLAGKILAVVPKKAEAISNKLFFTHHPKRQTEFAVGQIRQGRAE
                     "
     gene            complement(423520..423744)
                     /locus_tag="NGO_RS02190"
                     /old_locus_tag="NGO0428"
                     /old_locus_tag="NGO_0428"
     CDS             complement(423520..423744)
                     /locus_tag="NGO_RS02190"
                     /old_locus_tag="NGO0428"
                     /old_locus_tag="NGO_0428"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003706621.1"
                     /translation="MMKNKYILIKAAIGITAISIFYLLTQGSIGKTEEPSYFLMFMFL
                     NSLWFEENKTVMAAVTAMIAAHFIFVALSD"
     gene            complement(424168..424454)
                     /locus_tag="NGO_RS02195"
                     /pseudo
     CDS             complement(424168..424454)
                     /locus_tag="NGO_RS02195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217501.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(424690..424962)
                     /locus_tag="NGO_RS02200"
                     /old_locus_tag="NGO_02280"
     CDS             complement(424690..424962)
                     /locus_tag="NGO_RS02200"
                     /old_locus_tag="NGO_02280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002220648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002222678.1"
                     /translation="MFAVIFFSTLGCILAWIRDIPKIKSKKILARSLYIIGIINVIIS
                     YVLIKNILVSVSDGGGIKYVAIYLSNLFFWTVLMYVLVKRLSKKPS"
     gene            complement(425839..426088)
                     /locus_tag="NGO_RS02205"
                     /old_locus_tag="NGO_02290"
                     /pseudo
     CDS             complement(425839..426088)
                     /locus_tag="NGO_RS02205"
                     /old_locus_tag="NGO_02290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687885.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(426078..426620)
                     /locus_tag="NGO_RS02210"
                     /old_locus_tag="NGO0432"
                     /old_locus_tag="NGO_0432"
     CDS             complement(426078..426620)
                     /locus_tag="NGO_RS02210"
                     /old_locus_tag="NGO0432"
                     /old_locus_tag="NGO_0432"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003706619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003690884.1"
                     /translation="MKRIFLPALPAILPLSAYADLPLTIEDIMTDKGKWKLETSLTYL
                     NSENSRAALAAPVYIQTGATSFIPIPTEIQENGSNTDMLAGTLGLRYGLTGNTDIYGS
                     GSYLWHEERKLDGNGKTRNKRMSDISAGISHTFLKDGKNPALISFLESTVYEKSRNKA
                     SLIKKRGLCPFYNLRINYEY"
     gene            426786..427709
                     /locus_tag="NGO_RS02215"
                     /old_locus_tag="NGO0433"
                     /old_locus_tag="NGO_0433"
     CDS             426786..427709
                     /locus_tag="NGO_RS02215"
                     /old_locus_tag="NGO0433"
                     /old_locus_tag="NGO_0433"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RluA family pseudouridine synthase"
                     /protein_id="WP_003696870.1"
                     /translation="MKKRNNPLPLLNGVKPSYLVLPHEKQFYGLPLLHFLCIRFPFLG
                     ADDWRRRLNSGFVVGSDGAALDEHSLFEPGKTMFYYRETGCESEPRIPFEEKILFVDE
                     HLIVVDKPHFLPVIPGGRFLRETLLTRLRLRPELQHLNVEDITPIHRLDKDTAGVMLL
                     SHNPATRGAYQTMFQNKTVWKTYEALAPTKTDLPYPLDVVSRLVRGEKFFTTQEAEGV
                     PNAHTTVELIENRGEFSLYRLTPHTGKKHQLRVHMMGLGMPLLNDALYPVPSEAGSED
                     YRKPLKLLAKKIAFADPLSGRERVFCSGFCL"
     gene            complement(427788..428429)
                     /locus_tag="NGO_RS02220"
                     /old_locus_tag="NGO0434"
                     /old_locus_tag="NGO_0434"
     CDS             complement(427788..428429)
                     /locus_tag="NGO_RS02220"
                     /old_locus_tag="NGO0434"
                     /old_locus_tag="NGO_0434"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012221511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_003706615.1"
                     /translation="MLKPETIHIPGPAGILETIHIPSEQVPARGVAVINHPNPLQGGT
                     NTNKVIQTAAKALSKLGFHCYLPNLRGVGGSEGTHDYGRGETQDCLAVIDYARAQHPE
                     APEFALSGFSFGGYVATFAAQVSIPDLLLLIGAAVCHYTDRPEPSAVPNVAKTLMIHG
                     AEDEVVEIEKALKWAEPQDLPVITIAGSTHFFHGKLIVLRDTILRFAPVCLNG"
     gene            complement(428484..429275)
                     /locus_tag="NGO_RS02225"
                     /old_locus_tag="NGO0435"
                     /old_locus_tag="NGO_0435"
     CDS             complement(428484..429275)
                     /locus_tag="NGO_RS02225"
                     /old_locus_tag="NGO0435"
                     /old_locus_tag="NGO_0435"
                     /EC_number="2.5.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019271718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine aminopropyltransferase"
                     /protein_id="WP_003687893.1"
                     /translation="MARHPYRRLRPAKSGFPEVGISEEGNIRSLHLGSDTVQSSMNLD
                     RPSELVLSYSRAMMGWLLFAERLPQHITQIGLGGGSFARWTDTYLPDTRQTAVDINPQ
                     VIAIARNLFELPFEGGKFEIIEADGAEYIKVFRHNTDIILVDGFDGEQIIDTLVEEPF
                     FRDCRNALSSDGIFVTNWWSGDKRYQRFIERLLSVFEGRVLELPAESHGNVAVMAFQS
                     SPKEQNIDKLKKRADKLSNAYGLDFHRMLAGLKASNPNNGKHFHL"
     gene            429441..429516
                     /locus_tag="NGO_RS02230"
                     /old_locus_tag="NGO_18826"
                     /old_locus_tag="NGO_t09"
     tRNA            429441..429516
                     /locus_tag="NGO_RS02230"
                     /old_locus_tag="NGO_18826"
                     /old_locus_tag="NGO_t09"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:429474..429476,aa:Thr,seq:tgt)
     gene            429658..430449
                     /gene="panB"
                     /locus_tag="NGO_RS02235"
                     /old_locus_tag="NGO0436"
                     /old_locus_tag="NGO_0436"
     CDS             429658..430449
                     /gene="panB"
                     /locus_tag="NGO_RS02235"
                     /old_locus_tag="NGO0436"
                     /old_locus_tag="NGO_0436"
                     /EC_number="2.1.2.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002222670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="WP_003687894.1"
                     /translation="MITVNTLQKMKAAGEKIVMLTAYESSFAALMDDAGVDVLLVGDS
                     LGMAVQGRQSTLPVSLRDMCYHTECVARGAKNAMIVSDLPFGAYQQSKEQAFAAAAEL
                     MAAGAHMVKLEGGVWMAETTEFLQMRGIPVCAHIGLTPQSVFAFGGYKVQGRGGKAQA
                     LLNDAKAHDEAGAAVVLMECVPAELAKKVTETVSCPTIGIGAGADCDGQVLVMHDMLG
                     IFPGKTAKFVKNFMRGQSSIQAAVRAYVAEVKAKTFPAAEHIFAD"
     gene            430572..431408
                     /locus_tag="NGO_RS02240"
                     /old_locus_tag="NGO0437"
                     /old_locus_tag="NGO_0437"
     CDS             430572..431408
                     /locus_tag="NGO_RS02240"
                     /old_locus_tag="NGO0437"
                     /old_locus_tag="NGO_0437"
                     /EC_number="6.3.2.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003712842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="WP_003687896.1"
                     /translation="MQIIHTIRELRTWRENIGKVAFVPTMGNLHEGHLALVREARKRA
                     DNVVVSIFVNRLQFGQGEDFDKYPRTLQQDADKLAAEGVAVVFAPDEKELYPNVEQRY
                     NVEPPHLQNELCGKFRPGHFRGVATVVSKLFNIVLPDVACFGKKDYQQLAVIKGLTED
                     LNFDIEIVPVDTGRAADGLALSSRNRYLSVGERAEAPRLYRELQAVAESLKQAGLDYA
                     GLERQAADHLTAAGWLVDYVEIRRADTLEMARAGDKKLVVLAAARLGTTRLIDNVEVG
                     LP"
     gene            431729..433572
                     /locus_tag="NGO_RS02245"
                     /old_locus_tag="NGO_02330"
                     /pseudo
     CDS             431729..433572
                     /locus_tag="NGO_RS02245"
                     /old_locus_tag="NGO_02330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002225374.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            433712..434293
                     /locus_tag="NGO_RS02250"
                     /old_locus_tag="NGO0439"
                     /old_locus_tag="NGO_0439"
     CDS             433712..434293
                     /locus_tag="NGO_RS02250"
                     /old_locus_tag="NGO0439"
                     /old_locus_tag="NGO_0439"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019272599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010357457.1"
                     /translation="MKHTVSASVILLLTACAQLPQNNENLWQPSEHISSFAAEGRLAV
                     KAEGKGSYANFDWTYQPPVETININTPLGSTLGQLCQDRDGALAVDGKGNVYQAEGTE
                     DLSRQLVGFKLPIQYLHIWAEGRRVAGAPYRIRSDGILEQYGWTIGRTADSGGQVRTL
                     QLNNGNLNIRLVFTEIGMPSETETPERCAARTR"
     gene            434303..435148
                     /gene="ispE"
                     /locus_tag="NGO_RS02255"
                     /old_locus_tag="NGO0440"
                     /old_locus_tag="NGO_0440"
     CDS             434303..435148
                     /gene="ispE"
                     /locus_tag="NGO_RS02255"
                     /old_locus_tag="NGO0440"
                     /old_locus_tag="NGO_0440"
                     /EC_number="2.7.1.148"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002235677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-(cytidine
                     5'-diphospho)-2-C-methyl-D-erythritol kinase"
                     /protein_id="WP_010951042.1"
                     /translation="MNIADGRQAFPAPAKLNLDLRITGRREDGYHNIESIFCLIDLQD
                     TVYLKPRDDGKIILHNPVGGIPQEADLSYRAASLLQKYARNLAGVEIWLDKKIPTGAG
                     LGGGSSDAATVLLVLNRWWQCGLTQWQLIDLGAALGADVPFFIFGKNAFASGIGKKLI
                     GMDIPKQWYVIVKPPVHVSTAKIFTYEGLTRDSASSIMPTFQNLQPFRNDMQAVVFKE
                     YPEVWKAYSELSKYGSAMMTGSGACIFAAFQARNSAYNIYRQVSGLYEAYLAEGLSKH
                     PLLSV"
     gene            435156..435231
                     /locus_tag="NGO_RS02260"
                     /old_locus_tag="NGO_18831"
                     /old_locus_tag="NGO_t10"
     tRNA            435156..435231
                     /locus_tag="NGO_RS02260"
                     /old_locus_tag="NGO_18831"
                     /old_locus_tag="NGO_t10"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:435189..435191,aa:Gln,seq:ttg)
     gene            435244..435319
                     /locus_tag="NGO_RS02265"
                     /old_locus_tag="NGO_18836"
                     /old_locus_tag="NGO_t11"
     tRNA            435244..435319
                     /locus_tag="NGO_RS02265"
                     /old_locus_tag="NGO_18836"
                     /old_locus_tag="NGO_t11"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:435277..435279,aa:Gln,seq:ttg)
     gene            435487..436470
                     /locus_tag="NGO_RS02270"
                     /old_locus_tag="NGO0441"
                     /old_locus_tag="NGO_0441"
     CDS             435487..436470
                     /locus_tag="NGO_RS02270"
                     /old_locus_tag="NGO0441"
                     /old_locus_tag="NGO_0441"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="WP_003687900.1"
                     /translation="MAAYDSLMVFTGNANPELAQRVVRHLDISLGNASVSKFSDGEVA
                     VELLENVRGRDVFILQPTCAPTNDNLMEILTMADALKRASAGRITTAIPYFGYARQDR
                     RPRSVRVPISAKLVANMLYSAGIDRVLTVDLHADQIQGFFDIPVDNIYATPILLNDIK
                     QQRIENLTVVSPDIGGVVRARAVAKSLNADLAIIDKRRPKANVAEVMNIIGDIQGKTC
                     LIVDDMIDTANTLCKAAVALKERGAERVLAYASHAVFSGEAVSRIASSEIDQVVVTDT
                     IPLSEAAKNCDRIRQVTIAGLLAETVRRISNEESVSYLFNEEVMTGSMLLP"
     gene            436537..437109
                     /locus_tag="NGO_RS02275"
                     /old_locus_tag="NGO0442"
                     /old_locus_tag="NGO_0442"
     CDS             436537..437109
                     /locus_tag="NGO_RS02275"
                     /old_locus_tag="NGO0442"
                     /old_locus_tag="NGO_0442"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003755233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L25/general stress protein
                     Ctc"
                     /protein_id="WP_003687901.1"
                     /translation="MTYEIQASVREAQGTGASRRLRREGQIPGILYGEGQEPVAIAVD
                     HKTVFYALEKESFHTALIKLSLNGETKDVIVRDFQMHPFRREVQHIDFQAVKADQLVR
                     IRVPLHIVNAENSQAVKLQGGRVSLLNTAVEVLALPANIPAFLDLDCAEVVAGDILHL
                     SDIKLPEGVESVSLKRNENLAVATVTGKKR"
     gene            complement(437235..438404)
                     /locus_tag="NGO_RS02280"
                     /old_locus_tag="NGO0443"
                     /old_locus_tag="NGO_0443"
     CDS             complement(437235..438404)
                     /locus_tag="NGO_RS02280"
                     /old_locus_tag="NGO0443"
                     /old_locus_tag="NGO_0443"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003707424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="WP_003687902.1"
                     /translation="MTAHKILPVLLPIILGVSHATAASPAPNRPTVHAAPTLQTPETL
                     TAAHIVIDLQSRQTLSAKNTNTPVEPAALTQLMTAYLVFKNMKSGNIQSEENLKIPES
                     AWASEGSRMFVRPGDTVSTDKLLKGMIALCANDAALTLADRLGNGSIENFVQQMNKEA
                     RRLGMKNTVFKNPTGLGREGQVSTAKDLSLLSEALMRDFPEYYPLFSIKSFKFENIEQ
                     NNRNILLYRDNNVNGLKAGHTESGGYNLAVSYSGNGRHILVITLGSESAETRASDNSK
                     LLNRALQAFDTPKIYPKGKTVAQIQISGGSKKTVRAGFLKEAYITLPHKEAKMAEQIL
                     ETIQPIPAPVKKGQILGKIKIRQNGHTIAEKEIVALENVEKRSRWQRLWTRLTGQ"
     gene            438553..440079
                     /gene="ilvA"
                     /locus_tag="NGO_RS02285"
                     /old_locus_tag="NGO0444"
                     /old_locus_tag="NGO_0444"
     CDS             438553..440079
                     /gene="ilvA"
                     /locus_tag="NGO_RS02285"
                     /old_locus_tag="NGO0444"
                     /old_locus_tag="NGO_0444"
                     /EC_number="4.3.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002252306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine ammonia-lyase, biosynthetic"
                     /protein_id="WP_003687904.1"
                     /translation="MNTPLPYSDYLIRILTASVYDVAVETPLEPARSLSVRLKNNILL
                     KREDLQPVFSFKIRGAYNKMSKLPKDALACGVIAASAGNHAQGVALSAQRLGCRAVIV
                     MPETTPKIKVDAVKSRGGEVVLRGVSYNDAYDYAMELAEQEGLTYIAPFDDPDVIAGQ
                     GTVGMEIVSQHPDPIRAVFVPIGGGGLAAGVAAFIKQVRPEIKVIGVQTNDSCCMKQS
                     VEAGEIVHLKDVGLFSDGTAVKVVGNGTFRLCKELLDEIITVDTDAVCGAVKDIFDDT
                     RSITEPAGALALAGLKAYIAREGAENQTLIAVTSGANMNFHRLRHVSERSELGEGNEG
                     IFAVTIPEERGSFLKFVNILGNRNITEFNYRYGGDEKAHIFVGLQAAGPQDLAVIGSR
                     LDEAGLPNVDLTNNEIAKIHIRYMVGGRTDKVGHERLVSFEFPERPGALARFLNHMQG
                     GWNITLFHYRNHGADYGRILVGIDVPPHDAAAFDGFLESLGYSYHEETQNAAYKLFLA
                     "
     gene            complement(440135..441211)
                     /locus_tag="NGO_RS02290"
                     /old_locus_tag="NGO0445"
                     /old_locus_tag="NGO_0445"
     CDS             complement(440135..441211)
                     /locus_tag="NGO_RS02290"
                     /old_locus_tag="NGO0445"
                     /old_locus_tag="NGO_0445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009173155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate/molybdate ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_003701047.1"
                     /translation="MSITIQNLNKKRFGNFHALKNINLNVPAGKLVSLLGPSGGGKTT
                     LLRIIAGLENADGGQILFDGQDVTAKHVRERKVGFVFQHYALFRHMNVFDNVAFGLTV
                     LPKPERPSKGQIRAKVEELLKLVQLSHLAKSYPHQLSGGQRQRIALARALAVEPKLLL
                     LDEPFGALDAKVRKELRTWLRDIHHNLGVTSILVTHDQEEALEVSDEIVVMNHGKIEQ
                     TGSAEAIYRKPENAFVTEFLGEADAFEGRIEKGIWHYNGFAWKLDAQYKWQEQTATGY
                     IRPHEWQIAAEHETPMIRAEIEKIHAVGALTHVLVKHGKQDVHITLAGSDAARYPIAE
                     GKKLNLIPKQVYVFSQNELIEYSI"
     gene            complement(441352..442173)
                     /gene="cysW"
                     /locus_tag="NGO_RS02295"
                     /old_locus_tag="NGO0446"
                     /old_locus_tag="NGO_0446"
     CDS             complement(441352..442173)
                     /gene="cysW"
                     /locus_tag="NGO_RS02295"
                     /old_locus_tag="NGO0446"
                     /old_locus_tag="NGO_0446"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003674970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter permease subunit CysW"
                     /protein_id="WP_003706605.1"
                     /translation="MKPYSANPNLTEPRRLRMLLIAAALGFLLLMLVVPLVAVFYEAL
                     KGGWDLYLKSLSDPEAWSAVKLTLITALIVVPVNAVLGVAMAWLLTRFDFLGKQLLTT
                     LLDLPFSVSPVVAGLMFVLLFGAHTALGSRLEAQGIQIIFAIPGIVLTALFVTFPFAA
                     REIIPLMQTQGDSEEQAALVLGASGWQMFWRVTLPNIKWTLLYGIILTNARAMGEFGA
                     VSVVSGHIRGETNTIPLLVEIFYNEYNFTGAFSLSGVLALLALATLAVQNIITKL"
     gene            complement(442362..443198)
                     /gene="cysT"
                     /locus_tag="NGO_RS02300"
                     /old_locus_tag="NGO_02385"
     CDS             complement(442362..443198)
                     /gene="cysT"
                     /locus_tag="NGO_RS02300"
                     /old_locus_tag="NGO_02385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003690892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter permease subunit CysT"
                     /protein_id="WP_157147424.1"
                     /translation="MFYVTAQNTRRTARLQTQPRSDRIVPVASGGFAVCDDGGGNRLG
                     RLSEHDCRAERAGGGAAEFADVVLCDADQCVVFGTLVAWVLVRYEFPGKDLANALVDL
                     PFALPTAVTGIALAALYAPNGWIGRFFEPLGIKIAFTPVGIWIALVVVSLPFIVRAVQ
                     PVLEELSGEYEEAAATLGANRFTTFRRVLLPEITPALLTGAGMMFARATGEYGSVIFI
                     AGSIPMISEILPLIITGKLEQFDVQGASAVALFMLLVSFVILFALNVLQWALGRRSGA
                     KG"
     gene            443377..443709
                     /locus_tag="NGO_RS02305"
                     /old_locus_tag="NGO0448"
                     /old_locus_tag="NGO_0448"
     CDS             443377..443709
                     /locus_tag="NGO_RS02305"
                     /old_locus_tag="NGO0448"
                     /old_locus_tag="NGO_0448"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003707437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687908.1"
                     /translation="MQILSFQADIAERMLEGTEGESVNENAQFVRTDNGYWIAWHEGV
                     AALLAPDTPPGIPCFWVEGAESLEELCAMVERGEFDEVEEFDGDDDAWLEAAKDCGHH
                     GDACACGH"
     gene            444039..444548
                     /locus_tag="NGO_RS02310"
                     /old_locus_tag="NGO0449"
                     /old_locus_tag="NGO_0449"
     CDS             444039..444548
                     /locus_tag="NGO_RS02310"
                     /old_locus_tag="NGO0449"
                     /old_locus_tag="NGO_0449"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003662333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenylcysteine carboxyl methyltransferase
                     family protein"
                     /protein_id="WP_003687909.1"
                     /translation="MTMILSILSLFFIIRLLFLAVSIKHEKALIAKGAKQYGKTNSTV
                     LAAVHTLYYLACFVWVWLSDTAFNGISLIGTLTVMASFVILSLIIKQLGEIWTVKIYI
                     LPNHQINRSWLFKTFRHPNYFLNIIPELIGIALLCQAWYVLLIGLPIYLLVLFKRIRQ
                     EEQAMATLF"
     gene            complement(444778..445360)
                     /locus_tag="NGO_RS02315"
                     /old_locus_tag="NGO_02400"
                     /pseudo
     CDS             complement(444778..445360)
                     /locus_tag="NGO_RS02315"
                     /old_locus_tag="NGO_02400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019957326.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase"
     gene            445352..445552
                     /locus_tag="NGO_RS02320"
     CDS             445352..445552
                     /locus_tag="NGO_RS02320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003694972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003694972.1"
                     /translation="MFHFVLLMLFLDVVFWQCCCKRIGGSRILPVLSDGNQLNLLCVI
                     IEDCNFGMTDWMYHERLRSYAA"
     gene            445524..446930
                     /gene="dnaB"
                     /locus_tag="NGO_RS02325"
                     /old_locus_tag="NGO0451"
                     /old_locus_tag="NGO_0451"
     CDS             445524..446930
                     /gene="dnaB"
                     /locus_tag="NGO_RS02325"
                     /old_locus_tag="NGO0451"
                     /old_locus_tag="NGO_0451"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="WP_010951043.1"
                     /translation="MNDYAAMPPEGREVGALSLPPHSMEAEQSVLGGLMLENPAWDRI
                     ADVVSGEDFYRHEHRLIFRSIAKLINEGRPADVITVQEDLQRNEELEAAGGFEYLITL
                     AQNTPSAANIRRYAEIVRERSIMRQLAEVGTEIARSAYNPQGRDAGRLLDEAENKVFQ
                     IAESTAKSKQGFLEMPDLLKEVVQRIDMLYSRDNPDEVTGVPTGFIDLDKKTSGLQPG
                     DLIIVAGRPSMGKTAFSINIAEYVAIEKHLPVAVFSMEMGGAQLVMRMLGSVGRLDQS
                     VLKTGRLEDEHWGRLNEAVVKLSDAPVYIDETPGLTALELRARARRLARQFNNKLGLI
                     VIDYLQLMAASGRSDNRASELGEISRSLKALAKELQVPIIALSQLSRTVEQRTDKRPM
                     MSDLRESGAIEQDADLIMFMYRDEYYNQDSPMKGLAECIIGKHRNGPVGKIFLTWTGQ
                     FTKFDNAAYIPEEAKIED"
     gene            447238..447903
                     /locus_tag="NGO_RS02330"
                     /old_locus_tag="NGO0452"
                     /old_locus_tag="NGO_0452"
     CDS             447238..447903
                     /locus_tag="NGO_RS02330"
                     /old_locus_tag="NGO0452"
                     /old_locus_tag="NGO_0452"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003699624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspH/FimT family pseudopilin"
                     /protein_id="WP_010951044.1"
                     /translation="MCTRKQQGFTLTELLIVMAIAAIMATIALPNMSGWIASRRIASH
                     AEQVANLLRFSRGEAVRLNLPVYICPVQVKKDGASNNRCDFSKKGWGMLAFGDKNGNK
                     EYDGDVADVFLRSVVLNDDINDKRIDYAFNHIAFGSSQPTADRVVWTFNQNGTFGYTT
                     DQHLTERSSFFYSDGYIQIVLTDARAVSDADRKFRSAVVLIDSSGRVEVCRKNDTRAV
                     CKH"
     gene            447935..448546
                     /gene="pilV"
                     /locus_tag="NGO_RS02335"
                     /old_locus_tag="NGO0453"
                     /old_locus_tag="NGO_0453"
     CDS             447935..448546
                     /gene="pilV"
                     /locus_tag="NGO_RS02335"
                     /old_locus_tag="NGO0453"
                     /old_locus_tag="NGO_0453"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002253554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus modification protein PilV"
                     /protein_id="WP_010951045.1"
                     /translation="MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVA
                     SVREAETQTIVSQITQNLMEGMLMNPTIDLDSNKKNYSLYMGKQTLSAVDGEFMLDAE
                     KSKAQLAEEQLKRFSHELKNALPDAVAIHYAVCKDSSGDAPTLSDSGAFSSNCDNKAN
                     GDTLIKVLWVNDSAGDSDISRTNLEVSGDNIVYTYQARVGGRE"
     gene            448543..449523
                     /locus_tag="NGO_RS02340"
                     /old_locus_tag="NGO0454"
                     /old_locus_tag="NGO_0454"
     CDS             448543..449523
                     /locus_tag="NGO_RS02340"
                     /old_locus_tag="NGO0454"
                     /old_locus_tag="NGO_0454"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010359920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilW family protein"
                     /protein_id="WP_010951046.1"
                     /translation="MKRKMLNVPKGGYDGMKGFTIVEFLVAGLLSIIVLIAVVSSYFT
                     SRKLNDVANERLAIQQDLRNAATLIVRDARMAGSFGCFNMSEHTKDDIVDSSNQTQSN
                     LAKPGAKQENPLFSLKRSGMDKQLIPVAESIDIKYPGFIQRLNALVFQYGIDDLDASA
                     ETVVVSSCSKIAKPGKKISTLQEAKSALQITNDDKQNGNITRQKHVVNAYAVGRFGNN
                     EESLFRFQLDDKGKWGNPQLLVKKVKRMDVRYIYVSGCPEDEDAGKEEKFRYTNKFDK
                     SKNAVTPAGVEVLLDSGLNAKIAASSDNSIYAYRINATIRGGNVCANRTL"
     gene            449502..450113
                     /locus_tag="NGO_RS02345"
                     /old_locus_tag="NGO0455"
                     /old_locus_tag="NGO_0455"
     CDS             449502..450113
                     /locus_tag="NGO_RS02345"
                     /old_locus_tag="NGO0455"
                     /old_locus_tag="NGO_0455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003752748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein"
                     /protein_id="WP_010951047.1"
                     /translation="MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNT
                     EQRISANESDRKLALSLAEAALREGEFQVLDLEYAADSKVTFSENCEKGLCTAVNVRT
                     NNNGSEEAFGNIVVQGKPAVEAVKRSCPAKSGKNSTDLCIDNKGMEYNKGAAGVSKMP
                     RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ"
     gene            450100..450588
                     /locus_tag="NGO_RS02350"
                     /old_locus_tag="NGO0456"
                     /old_locus_tag="NGO_0456"
     CDS             450100..450588
                     /locus_tag="NGO_RS02350"
                     /old_locus_tag="NGO0456"
                     /old_locus_tag="NGO_0456"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019272580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_003702442.1"
                     /translation="MMSNKMEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQS
                     QLYTEMVGINNVLKQFILKNPQDDNDTLKSKLKIFVSGYKMNPKIAKKYSVSVRFVDA
                     EKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDATSAQAYSDTLSADSGCEAFSNR
                     KK"
     gene            complement(450658..450966)
                     /locus_tag="NGO_RS02355"
                     /old_locus_tag="NGO0457"
                     /old_locus_tag="NGO_0457"
     CDS             complement(450658..450966)
                     /locus_tag="NGO_RS02355"
                     /old_locus_tag="NGO0457"
                     /old_locus_tag="NGO_0457"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003706588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AzlD family protein"
                     /protein_id="WP_010951048.1"
                     /translation="MKDLLSSPSFLLFSCMLAVTCPTRLIGFFALRNRTLSRRAQTVM
                     EAAPGCVLISVIAPYFVSDKPHELIAIALTAFAACRFSMLFTVLIGVGSSGISGWLMA
                     "
     gene            complement(450963..451674)
                     /locus_tag="NGO_RS02360"
                     /old_locus_tag="NGO_02440"
                     /pseudo
     CDS             complement(450963..451674)
                     /locus_tag="NGO_RS02360"
                     /old_locus_tag="NGO_02440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003686491.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="AzlC family ABC transporter permease"
     gene            451840..452292
                     /gene="dut"
                     /locus_tag="NGO_RS02365"
                     /old_locus_tag="NGO0459"
                     /old_locus_tag="NGO_0459"
     CDS             451840..452292
                     /gene="dut"
                     /locus_tag="NGO_RS02365"
                     /old_locus_tag="NGO0459"
                     /old_locus_tag="NGO_0459"
                     /EC_number="3.6.1.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002226436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dUTP diphosphatase"
                     /protein_id="WP_010951049.1"
                     /translation="MNIEVEMKVLDERMADFIPAYATEGSAGLDLRACLDEEVVLQPG
                     ETFLVPTGLAIYLANPAYAAVLLPRSGLGHKHGIVLGNLVGLIDSDYQGELKVSLWNR
                     GSEPFAVKPFERIAQMVIVPVVQAGFKRVEEFVGSSRGEGGFGSTGSH"
     gene            452364..453551
                     /gene="dapC"
                     /locus_tag="NGO_RS02370"
                     /old_locus_tag="NGO0460"
                     /old_locus_tag="NGO_0460"
     CDS             452364..453551
                     /gene="dapC"
                     /locus_tag="NGO_RS02370"
                     /old_locus_tag="NGO0460"
                     /old_locus_tag="NGO_0460"
                     /EC_number="2.6.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003752738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyldiaminopimelate transaminase"
                     /protein_id="WP_003706584.1"
                     /translation="MNTLLKQLKPYPFARLREAMQGISAPEGMEAVPLHIGEPKHPTP
                     KVITDALTASLRELEKYPLTAGLPELRQACANWLKRRYDGLTVNPDNEILPVLGSREA
                     LFSFVQTVLNPVSDGLKPVIVSPNPFYQIYEGATLLGGGEIHFANCPAPSFNPDWRSI
                     SEEVWERTKLVFVCSPNNPSGSVPDLDGWREVFDLQDKYGFIIASDECYSEIYFDGNK
                     PLGCLQAAAQSGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSA
                     MSIPVQRASIAAWNDEQHVIDNRRMYQEKFERVIPILQQVFDVKLPDASFYIWLKVPN
                     GDDLAFARNLWQKAAIQVLPGRFLARDTEQGNPGEGYVRIALVADVATCVKAAETIVS
                     LYR"
     gene            453863..454642
                     /gene="yaaA"
                     /locus_tag="NGO_RS02375"
                     /old_locus_tag="NGO0461"
                     /old_locus_tag="NGO_0461"
     CDS             453863..454642
                     /gene="yaaA"
                     /locus_tag="NGO_RS02375"
                     /old_locus_tag="NGO0461"
                     /old_locus_tag="NGO_0461"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019272575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxide stress protein YaaA"
                     /protein_id="WP_003706583.1"
                     /translation="MFFVLSPAKNLNEKDPCPVSEFTQPDLLAESEILMRQLRELAPQ
                     QIAELMHVSDKIALLNAERNAAWHTPFTPENAKQAVFMFNGDVYEGMDANTLNTNQIQ
                     YLQGHVRLLSGLYGLLRPLDLIQPYRLEMGTSFANLRGKNLYEFWGGIITNLLNDTLA
                     QAGSNTLVNLASQEYFKSVNTKKLRARLITPIFKDEKNGKYKIISFYAKRARGLMVRY
                     AAEHNITDPEMLKNFNYEGYAFNDAASNESEWVFMRSEQIK"
     gene            454725..454815
                     /locus_tag="NGO_RS02380"
                     /old_locus_tag="NGO_18841"
                     /old_locus_tag="NGO_t12"
     tRNA            454725..454815
                     /locus_tag="NGO_RS02380"
                     /old_locus_tag="NGO_18841"
                     /old_locus_tag="NGO_t12"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:454759..454761,aa:Ser,seq:tga)
     gene            454893..454979
                     /locus_tag="NGO_RS02385"
                     /old_locus_tag="NGO_18846"
                     /old_locus_tag="NGO_t13"
     tRNA            454893..454979
                     /locus_tag="NGO_RS02385"
                     /old_locus_tag="NGO_18846"
                     /old_locus_tag="NGO_t13"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:454927..454929,aa:Ser,seq:cga)
     gene            455173..456369
                     /locus_tag="NGO_RS02390"
                     /old_locus_tag="NGO0462"
                     /old_locus_tag="NGO_0462"
     CDS             455173..456369
                     /locus_tag="NGO_RS02390"
                     /old_locus_tag="NGO0462"
                     /old_locus_tag="NGO_0462"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002222648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase arm-type DNA-binding domain-containing
                     protein"
                     /protein_id="WP_010951050.1"
                     /translation="MAKIITPLSANQVKNAKPGDKLYKLSDGGGLALWVYPTGRRSWK
                     LSFMQDGRQQTISLGRYPDFSLAEAREWREEVRRKRAHGENVVNKKVRADFAFEKVAR
                     DWFVRWSKGRSEKYAGQVMRNFERWVFPAIGNLDIRQVRTADVVGCLRVMEARGIVDT
                     LRKTKNSLKMVFAFAVGSGMMEINPVAQIGSGVFERVKTKNMTALSPSELPRLIDFLE
                     QRNEFAVYAGRVHIHPVTRFCIYWLLLTMTRIREAALMEWSELDGEVWRIPAERKKER
                     RGHDVPLSRAMRWVLDQARGLNVNGRFVFESVNFQGHINKESPHVAMRRSGLDTTAHG
                     LRSLARTYLREVLKVYNDVAEKLLAHSLGTRTQTAYNRSELWEERKDAPERWGNDVLR
                     LADNGK"
     gene            complement(456725..456994)
                     /locus_tag="NGO_RS02395"
                     /old_locus_tag="NGO0463"
                     /old_locus_tag="NGO_0463"
     CDS             complement(456725..456994)
                     /locus_tag="NGO_RS02395"
                     /old_locus_tag="NGO0463"
                     /old_locus_tag="NGO_0463"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687928.1"
                     /translation="MESSDVQGRMETLAFATAPKKGGIRKSGFGRVILIKSGHIVIHN
                     ADGDSFATGYGVIAADIVSPDLKTDFDIFFPPESLLRYKKIGKKK"
     gene            complement(457189..457872)
                     /locus_tag="NGO_RS02400"
                     /old_locus_tag="NGO0464"
                     /old_locus_tag="NGO_0464"
     CDS             complement(457189..457872)
                     /locus_tag="NGO_RS02400"
                     /old_locus_tag="NGO0464"
                     /old_locus_tag="NGO_0464"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003706579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2786 domain-containing protein"
                     /protein_id="WP_003706579.1"
                     /translation="MDKEKVLDKIKKCLALGRSVNEHEAAQALRQAQALMEKYKVNAE
                     DIALSKVSEQKADRKMAFKLAGWQWGVANMIADIFGCKSYQRGKTMMFYGIGNRAETS
                     AYAFDVVYRQISADRRKFLKTCRAGKPSHRTYLADRFCGGWIASAWETVKKFEMSDEE
                     KAIMDGYKKKEYPDMAEARTRDAKSSILQGSKMEYEALTRGMESGKQVKLHYAVNGTG
                     FVKQIGGQT"
     gene            complement(457883..458419)
                     /locus_tag="NGO_RS02405"
                     /old_locus_tag="NGO0465"
                     /old_locus_tag="NGO_0465"
     CDS             complement(457883..458419)
                     /locus_tag="NGO_RS02405"
                     /old_locus_tag="NGO0465"
                     /old_locus_tag="NGO_0465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951051.1"
                     /translation="MQTVATKPTAKQMLAAKRAAKESTRQERAVKRAGTVRNVDRNRL
                     SARSKAQKENIARMLSGAKVSEDEALTCGIMMRLVAAKVRRYCGEHPGVFDGAAGSRQ
                     LERYIKPSEFHAVEIQPEACKALLQNYPAAAGNLGRRKQKKPRVRKRISPSRMARPNR
                     KQSERRMGKGAKLKYRTN"
     gene            complement(458530..458745)
                     /locus_tag="NGO_RS02410"
                     /old_locus_tag="NGO0466"
                     /old_locus_tag="NGO_0466"
     CDS             complement(458530..458745)
                     /locus_tag="NGO_RS02410"
                     /old_locus_tag="NGO0466"
                     /old_locus_tag="NGO_0466"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003691538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003691538.1"
                     /translation="MSYLEDVKNALRVIDNLCKEALKEPESLEGYIDEIRDKADEADT
                     SLEFLKDVINYGISDLKNVIEVFEDCV"
     gene            complement(458797..459288)
                     /locus_tag="NGO_RS02415"
                     /old_locus_tag="NGO0467"
                     /old_locus_tag="NGO_0467"
     CDS             complement(458797..459288)
                     /locus_tag="NGO_RS02415"
                     /old_locus_tag="NGO0467"
                     /old_locus_tag="NGO_0467"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017147284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="siphovirus Gp157 family protein"
                     /protein_id="WP_010951052.1"
                     /translation="MTALALYRCAADVQAALDYYFDSETEREDTLEAVIGQFEVKAQS
                     VIAYIKNQEITEKMLEGHIRRMTGKLKAVKAQNQSLKDYLARNMQAAGITEIKADDGT
                     FKASFRKSEAVVILDEAQIPAEFMREAVKTEPDKTAIRKAIESGRQVAGAKIEGRKNL
                     QIR"
     gene            complement(459285..459467)
                     /locus_tag="NGO_RS02420"
                     /old_locus_tag="NGO0468"
                     /old_locus_tag="NGO_0468"
     CDS             complement(459285..459467)
                     /locus_tag="NGO_RS02420"
                     /old_locus_tag="NGO0468"
                     /old_locus_tag="NGO_0468"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003691535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003691535.1"
                     /translation="MANIDLTQWDGKTIGAAANPEQGYINITIGSDDLFINIEQAYAI
                     HAALGEAVAEYEGGAQ"
     gene            complement(459607..460293)
                     /locus_tag="NGO_RS02425"
                     /old_locus_tag="NGO0469"
                     /old_locus_tag="NGO_0469"
     CDS             complement(459607..460293)
                     /locus_tag="NGO_RS02425"
                     /old_locus_tag="NGO0469"
                     /old_locus_tag="NGO_0469"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010357532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951053.1"
                     /translation="MSLILSVKDESNFKPCPAGSHHATCIRIIDLGTQLVEYQNEQKR
                     QHKILVQWEIDPEGDPEMLMPDGRPYLISRRYTASLHSKSQLATDLKSWRGRDFTPEE
                     RDNFDLRNILGKPCLLSIAHQESSDGKTTYANISAISNKMKSYTPKHPDNAVFAFDLS
                     DPDWANYGLLNEKLREQIAKSPEYAEAVNGRQPPAPPQKQAQAAEGRPEHPQGNAAPA
                     EDIEDDIPFN"
     gene            complement(460362..460523)
                     /locus_tag="NGO_RS11055"
                     /old_locus_tag="NGO_0470"
     CDS             complement(460362..460523)
                     /locus_tag="NGO_RS11055"
                     /old_locus_tag="NGO_0470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003702497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003693867.1"
                     /translation="MSFHPETAYNGGGETEPYGPSPEEIKYRQSPETAETRRMTEKQA
                     EGHIKSIIR"
     gene            complement(460520..460796)
                     /locus_tag="NGO_RS02430"
                     /old_locus_tag="NGO_02520"
                     /pseudo
     CDS             complement(460520..460796)
                     /locus_tag="NGO_RS02430"
                     /old_locus_tag="NGO_02520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010359972.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(460949..461281)
                     /locus_tag="NGO_RS02435"
                     /old_locus_tag="NGO0472"
                     /old_locus_tag="NGO_0472"
     CDS             complement(460949..461281)
                     /locus_tag="NGO_RS02435"
                     /old_locus_tag="NGO0472"
                     /old_locus_tag="NGO_0472"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003702498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010357536.1"
                     /translation="MKYYGTAAYGSPDWGMERYYAREDMRQALDGWEAENRILHESAL
                     IGIAKKSAREFVRDADGEPYSQEDWETYLTEDASRVGKDTEAAMNYAIDEREWFALAE
                     NIGRLANS"
     gene            complement(461422..461697)
                     /locus_tag="NGO_RS02440"
                     /old_locus_tag="NGO0473"
                     /old_locus_tag="NGO_0473"
     CDS             complement(461422..461697)
                     /locus_tag="NGO_RS02440"
                     /old_locus_tag="NGO0473"
                     /old_locus_tag="NGO_0473"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003694994.1"
                     /translation="MSYLDQPLKHGYGNGNGSGNGSGYGNGYGNGYGNGYGGVGGGGS
                     GSGYGNGNGYSNGSGNGDGDGNGNGSGNGSGYGNGYGNGYSNGSGNG"
     gene            complement(461694..462170)
                     /locus_tag="NGO_RS02445"
                     /old_locus_tag="NGO0474"
                     /old_locus_tag="NGO_0474"
     CDS             complement(461694..462170)
                     /locus_tag="NGO_RS02445"
                     /old_locus_tag="NGO0474"
                     /old_locus_tag="NGO_0474"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002255718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002255718.1"
                     /translation="MEANKFEVKSLSDLIKVFAGIAADFEAAMGVKRADISTEFDEPQ
                     HEPQPPVTVAEQKGINDFAIGKEVIIRTYSAGVWFGVLKQKAGNEVILTKARRMYSWW
                     AKESISLSGVARHGIRQDGSQICGELDSVWLEAIEIIPVTGGAAESIRTALEVAQS"
     gene            complement(462203..462403)
                     /locus_tag="NGO_RS02450"
                     /old_locus_tag="NGO0475"
                     /old_locus_tag="NGO_0475"
     CDS             complement(462203..462403)
                     /locus_tag="NGO_RS02450"
                     /old_locus_tag="NGO0475"
                     /old_locus_tag="NGO_0475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014580640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010359988.1"
                     /translation="MNELISRINRFGARAKDEQSLLLKVGEICRDAAATWTTRKSESL
                     NHTAFTFTVKKDGLKEKVMIVL"
     gene            complement(462601..463014)
                     /locus_tag="NGO_RS02455"
                     /old_locus_tag="NGO0476"
                     /old_locus_tag="NGO_0476"
     CDS             complement(462601..463014)
                     /locus_tag="NGO_RS02455"
                     /old_locus_tag="NGO0476"
                     /old_locus_tag="NGO_0476"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687963.1"
                     /translation="MIHLNVHYCDEIIRHAENDKYSLIGIFPDICHIPTPQAILGRLC
                     LSVSFSAEGMDIQTMKTGQIFLEIVRNDDVISALEIPSYDGSDTEENVSFMLHQTISG
                     LPVSDNDRIYVRMTTHNHILSESRPLSFSWLPYHS"
     gene            complement(463011..463472)
                     /locus_tag="NGO_RS02460"
                     /old_locus_tag="NGO_0477"
     CDS             complement(463011..463472)
                     /locus_tag="NGO_RS02460"
                     /old_locus_tag="NGO_0477"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009174532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_003687965.1"
                     /translation="MGATLTVAVAACTVSTPTSAIPVTHIKCLRINGQIKCVKPISPN
                     TTPAAEHIEHVRKNPRRKAAMDRAAARIADKIALKAGGETFVSLRMKKGFTQSELATA
                     AGLPQPYLSRIENSKQSLQDKTVQKLANALGVSPLEVRAAFERRYEYMEQA"
     gene            complement(463489..463926)
                     /locus_tag="NGO_RS02465"
                     /old_locus_tag="NGO0478"
                     /old_locus_tag="NGO_0478"
     CDS             complement(463489..463926)
                     /locus_tag="NGO_RS02465"
                     /old_locus_tag="NGO0478"
                     /old_locus_tag="NGO_0478"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009174531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003687967.1"
                     /translation="MELTVHFNAEQDLDRLFEKDEEAVGYLENVIAMIQADSAIFDGL
                     YKNRYFREYGEPIGPIDLEVKPILSLWGKDIKVLRVRFDSEEAAGYRIIYAPCHEKQP
                     NGTYIRRIDILAVVNKKTDEFDYQAEHPITKRIIKDYEELYSN"
     gene            complement(464039..464755)
                     /locus_tag="NGO_RS02470"
                     /old_locus_tag="NGO0479"
                     /old_locus_tag="NGO_0479"
     CDS             complement(464039..464755)
                     /locus_tag="NGO_RS02470"
                     /old_locus_tag="NGO0479"
                     /old_locus_tag="NGO_0479"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003687969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LexA family transcriptional regulator"
                     /protein_id="WP_003687969.1"
                     /translation="MPFIIDYQCLCAINSEIKMFSGEQLGQAISEAIKRKNVSQKEVA
                     DHFGVKQPSVSGWIKNGRIDKKHLDKLIDYFSDVVTPSHFGIETFRVLKSNEQSSIRF
                     PRLNAEATCGAGTINDHYIEVVDYVTVAAAWAREKLGGNLNKIQVITARGDSMEPTIE
                     NGDVMFVDTAVEAFDGDGLYLLWYIDGLKAKRLQSTVGGGLMIISDNSSYRTETVRGE
                     DLNAVRIIGRIRGAWRLSQF"
     gene            464830..465060
                     /locus_tag="NGO_RS02475"
     CDS             464830..465060
                     /locus_tag="NGO_RS02475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002242802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_020997318.1"
                     /translation="MSIQKAVDYFGNESRLARAIGVKQPTVWAWNKKGTPPPIIRCVQ
                     IEKLTGGAVNRKDLRPDDWHLIWPELAGDQPK"
     gene            465140..465295
                     /locus_tag="NGO_RS11060"
                     /old_locus_tag="NGO_0480"
     CDS             465140..465295
                     /locus_tag="NGO_RS11060"
                     /old_locus_tag="NGO_0480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003703527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689578.1"
                     /translation="MKKQDRNRLSKKDRRLIKKAMLKAAAKGCDEVYKIAPGLKDGFE
                     LLGKQPD"
     gene            complement(465272..465460)
                     /locus_tag="NGO_RS02480"
                     /old_locus_tag="NGO0481"
                     /old_locus_tag="NGO_0481"
     CDS             complement(465272..465460)
                     /locus_tag="NGO_RS02480"
                     /old_locus_tag="NGO0481"
                     /old_locus_tag="NGO_0481"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003691445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951056.1"
                     /translation="MPSDLSFILAKELIRSGSIRLSGSTAKGQAGELAVFIRTLRQKP
                     EESEPNTDDEYLIGLLSK"
     gene            465633..465860
                     /locus_tag="NGO_RS02485"
                     /old_locus_tag="NGO0483"
                     /old_locus_tag="NGO_0483"
     CDS             465633..465860
                     /locus_tag="NGO_RS02485"
                     /old_locus_tag="NGO0483"
                     /old_locus_tag="NGO_0483"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004520694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_003698261.1"
                     /translation="MNQKQTQCKQIVDYIRNKGCITSLEAYQNLKVTQLAARITDLEG
                     RGFVFAKPKYKVGNCKNPVAHYSIAKSGIEP"
     gene            465978..467042
                     /locus_tag="NGO_RS02490"
                     /old_locus_tag="NGO0484"
                     /old_locus_tag="NGO_0484"
     CDS             465978..467042
                     /locus_tag="NGO_RS02490"
                     /old_locus_tag="NGO0484"
                     /old_locus_tag="NGO_0484"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003693470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689134.1"
                     /translation="MMKPSESLRAAGRPIAYYPKLAKPLGGVNAAILFGHFFYWNDKT
                     QYESGIYRTAEEIEIETGLSVQEQRTARAKLRERGVLIETEKRIEHRIYYKLNLDAFD
                     DLMLQHSGGGESTAPKCNINSPELQNQHSGGGESTAPKCNINSPELQNQHSGSEESTA
                     VIRTEDLTEDLAVYTPLPPNAGNGKGGLNADAFVSADAETCGRETGEPTSPKAESDSN
                     GNGGLSGKPKNANVPRRRKTHGVPLQEIADLYNEVLGGRLPSVQVLNDTRKRAIANRW
                     CEMLGTAAPNGKVRFGDKETGLAWFAGFFRKVAMNPFWMGENQTGFAVGFDWIFKAGN
                     FVKILEWHPPKTNQAARGRA"
     gene            467039..468400
                     /locus_tag="NGO_RS02495"
                     /old_locus_tag="NGO0485"
                     /old_locus_tag="NGO_0485"
     CDS             467039..468400
                     /locus_tag="NGO_RS02495"
                     /old_locus_tag="NGO0485"
                     /old_locus_tag="NGO_0485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689132.1"
                     /translation="MNRIEETEAVQSLASVGAEQNILGGILIEPTAIARCAILTPEKF
                     YQAQHRIIFRALLDMAAANEPIDIITLNDKLEARGEAENAGGLAYLIDLNQNTPSAKN
                     ISRYVGIVNDRFVERGLLKASAAIEKIAVSKDGGTVAEKLSKAADELAAAGKDAVKRE
                     TKTFGQTVEDLIGGLDKRLDGVRFGLPTGLMKLDGMTGGLPDGNLIVIAARPSMGKTV
                     LAENIARFALKQGKAVHFQSYEMSAVELARRGMAAECNIPMQNLKTGNLTQSDYANMP
                     IYVSQAKEWKFDVNCDLLNVDELCFLAKEKKLTTGLDLLVVDHLHIMPRAGRDEVAEL
                     GNISRRLKNLAAELNIPVVLVAQLNRGNTKQADKRPNMADIRGSGAIEQDANIIIMPH
                     RESYYDGNENPSIAELIIAKNRDGETGTVVCGWKGQFMKFEEEPDLAWQAPKHDEYDP
                     YSV"
     gene            468417..468701
                     /locus_tag="NGO_RS02500"
                     /old_locus_tag="NGO_0486"
     CDS             468417..468701
                     /locus_tag="NGO_RS02500"
                     /old_locus_tag="NGO_0486"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951058.1"
                     /translation="MRETCFYCNHADFKTNTGTPVRGFAKCAKARNAEEKATYYPRTN
                     PCAAGAFQTASGAAVAKRTAVLGEYPPRNAPNLSGKAGKTLWEYPSLPEI"
     gene            468740..469234
                     /locus_tag="NGO_RS02505"
                     /old_locus_tag="NGO0487"
                     /old_locus_tag="NGO_0487"
     CDS             468740..469234
                     /locus_tag="NGO_RS02505"
                     /old_locus_tag="NGO0487"
                     /old_locus_tag="NGO_0487"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003691434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3310 domain-containing protein"
                     /protein_id="WP_003693463.1"
                     /translation="MTVRNTQTETVRTEAAPQQGGNTNPGYYKNRAFECVGFAQYLNF
                     NLGNAFKYIWRHKEKGGREDLEKALRYLERQRAGAPKFKKLKHRRYEKMYAGLKDCGF
                     DGGTEAALLAVISAAYYIRDGEDNFAWAAACVEDLLEKMPPEAGRAPHPESPMPPETA
                     GGGI"
     gene            469411..469560
                     /locus_tag="NGO_RS11065"
                     /old_locus_tag="NGO_0488"
     CDS             469411..469560
                     /locus_tag="NGO_RS11065"
                     /old_locus_tag="NGO_0488"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012503493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951059.1"
                     /translation="MDTLLSIITALSFAGAATLAVWLLVEAADAVLRRKREGKGEDDF
                     DGFGY"
     gene            469696..470241
                     /locus_tag="NGO_RS02510"
                     /old_locus_tag="NGO0489"
                     /old_locus_tag="NGO_02610"
     CDS             469696..470241
                     /locus_tag="NGO_RS02510"
                     /old_locus_tag="NGO0489"
                     /old_locus_tag="NGO_02610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014580343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RusA family crossover junction
                     endodeoxyribonuclease"
                     /protein_id="WP_010951060.1"
                     /translation="MQNLPQQGSPAKARGKTRGGGSRRDDGGKAARIHPRRTRRLPDI
                     GRRPVDATGRGMRVIRLILPYPVSANRYWRIWRNRAVRSAEAAAYKETVRRIAQGAGA
                     MPSEGFVAVRLRLIPKANKDGGANKTVIDLDNALKVALDALQGVAYHNDRQVRRIAAE
                     YGGEPVAGGGLAVEVGELDEK"
     gene            470508..470915
                     /locus_tag="NGO_RS02515"
                     /old_locus_tag="NGO0491"
                     /old_locus_tag="NGO_0491"
     CDS             470508..470915
                     /locus_tag="NGO_RS02515"
                     /old_locus_tag="NGO0491"
                     /old_locus_tag="NGO_0491"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003689098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689098.1"
                     /translation="MNQQEFEFMNDLARAFERRYRDTRSLNRCFSIEGRYMGEEACPH
                     KPEIGLRYGEDAMFLTLQAWAKVDAPQQEAVRISFGIGAKSQAAYEERLQAEIRRRGE
                     GPLHLQTDLGLAAWYRAIRQAAGNDFDLLFEKV"
     gene            471138..471644
                     /locus_tag="NGO_RS02520"
                     /old_locus_tag="NGO0492"
                     /old_locus_tag="NGO_0492"
     CDS             471138..471644
                     /locus_tag="NGO_RS02520"
                     /old_locus_tag="NGO0492"
                     /old_locus_tag="NGO_0492"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003706020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003706020.1"
                     /translation="MSKAINKLNEKEKEKIRLLFAQREKFYRILENPEQGFTPPTALL
                     KSGETCFLIDYVNMGEVVTERVRTYTGTRLKLGSTPVYLGGGKSVANEKQKNVAYGEL
                     VLTNFRLIFVGNMRSIDLPLDKINSVECFQSSIRISQSGKNKPIFFNTVFNPQLWKEA
                     ILVLSDKK"
     gene            471965..472186
                     /locus_tag="NGO_RS02525"
                     /old_locus_tag="NGO0493"
                     /old_locus_tag="NGO_0493"
     CDS             471965..472186
                     /locus_tag="NGO_RS02525"
                     /old_locus_tag="NGO0493"
                     /old_locus_tag="NGO_0493"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003689095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689095.1"
                     /translation="MNNSVQISNISIHQTEIGLFSLNDLHRASGGEDRHARLKAAANA
                     LEALSAHADAEHAEKIRPILPEIRNLSAV"
     gene            472479..472928
                     /locus_tag="NGO_RS02530"
                     /old_locus_tag="NGO0494"
                     /old_locus_tag="NGO_0494"
     CDS             472479..472928
                     /locus_tag="NGO_RS02530"
                     /old_locus_tag="NGO0494"
                     /old_locus_tag="NGO_0494"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003689093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689093.1"
                     /translation="MSGTKRKLGRPTDYTKDMADKICEKIANGRSLRSICAEDGVPPM
                     KTIYRWLEANEEFRHQYARAREKQADYFAEEIIEIADSAQAESAAVSKAKLQIDARKW
                     AASKIAPKKYGDKSELDVKSGDGSMRAAVRLDAEEYRKIAEDVLRRV"
     gene            472990..474411
                     /gene="terL"
                     /locus_tag="NGO_RS02535"
                     /old_locus_tag="NGO0495"
                     /old_locus_tag="NGO_0495"
     CDS             472990..474411
                     /gene="terL"
                     /locus_tag="NGO_RS02535"
                     /old_locus_tag="NGO0495"
                     /old_locus_tag="NGO_0495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003697216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage terminase large subunit"
                     /protein_id="WP_003697216.1"
                     /translation="MALGQFDDVETSVIRSLSSASLYMFTRRMFYQRRGYVWQRANHH
                     APICNALERVFNGETKRLIINIPPRYSKTEIAVVNFIAWAMGRVPDCEFIHASYSAAL
                     AVNNSVQIRNLVQHEEYRAIFPDLALAGESGHHWKTTAGGVMYATGAGGTITGFGAGR
                     HREGFGGCIIIDDPHKADEARSEVRRQNVIDWFQNTVESRKNSPDTPIILIMQRLHEK
                     DLAGWLLDGGNGEEWEHLCLPAIQEDGTALWPEKHDIETLRRMEQAAPYVFAGQYLQK
                     PAPPDGGTFKPDNLQFVKALPAGNIRWVRAWDLASTANGGDYTAGGRLGVTEDGRYII
                     ANVVRGRYGADERDRILRNTAQKDGVKTKISIPQDPGQAGKSQTLYLTRQLAGFSVSA
                     GPESGDKVTRAGPFAAQVNIGNVMVLDDGTWDTDALIAEMRMFPNGRHDDQIDCLGRA
                     FGELLDTRTGMIDFLRSQVEAVK"
     gene            474408..476555
                     /locus_tag="NGO_RS02540"
                     /old_locus_tag="NGO0496"
                     /old_locus_tag="NGO_0496"
     CDS             474408..476555
                     /locus_tag="NGO_RS02540"
                     /old_locus_tag="NGO0496"
                     /old_locus_tag="NGO_0496"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002255692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage portal protein"
                     /protein_id="WP_003691423.1"
                     /translation="MSKKTPLSQGFIARVAAGVRYAFTGNADGWFDAGEPPAPAAQQA
                     EGRRFDYEPFYNVGHSKPREREAVGFAQLRALADNYDVLRLVIEARKDQMECLKWTIQ
                     KRDVESTEDDESQRKDRKVDEAVAFFRSPDKEHTWADWLRILLEDLFVIDAPCIYPRK
                     TLGGGLYALEVMDGATIKRVLDNTGRMPLPPDTAYQQILHGMAAVDYTADELIYRSRN
                     NRSYKVYGYSPVEQIIMTVNIALKRQVHALEYYTAGSVPDALVGVPETWSADDIRRFQ
                     EYWDLLLSGETAQRRKMRFVPGELSRNFRETKQPPLKDVYDEWLARVVCFAFSVEPTP
                     FVAQVNRSVAETSREQSLSDGMGSLKNWVKALIDDVLARYMDMAAYEFVWKGEESLNP
                     KEQAEIYAIYKNAGILTADEIRAELGKEPLPGQGQPEPDKQDGRKPEEPPNQGAEKLG
                     KSESPMSEDESAALIEAYLLTRIDGLAEQIAALIEGAAVDWQAGDLAAELSRAAGVVA
                     NGLDFGDWSGLSDVVEPIIRRVAEDGAVAALLRVMPEPAAGMVTNIRSRAVKWAHERA
                     AEMVGMKRAGGGLVRNPAAEWQITEGTREMIRAQVAEAMRNGDSVQELAGRLKESHAF
                     GNARARTIARTETAMADGMGNLIGWEGTGLVAGKQWITAKDDKVSDVCNANGGMGVIG
                     LHEPFSHGALTIPGHPNCRCAVVPVLAGDMPES"
     gene            476623..477780
                     /locus_tag="NGO_RS02545"
                     /old_locus_tag="NGO0497"
                     /old_locus_tag="NGO_0497"
     CDS             476623..477780
                     /locus_tag="NGO_RS02545"
                     /old_locus_tag="NGO0497"
                     /old_locus_tag="NGO_0497"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002255691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951062.1"
                     /translation="MTKLYAQIAKTEAQDDGTVKVWGYASSEAVDSDGEVVAAEAMKA
                     AIPDYMKFGAVREMHGSNAAGTAIEINVEDDGRTFFGAHIVDPVAVTKVKTGVYKGFS
                     IGGSVTARNDLNKSQITGLKLTEISLVDRPANPDAVFTCFKADKPKDEAGAADKDGKP
                     SDKPTEEEDENPKDGDKGPKTEDKGDKDAGKKDEAGKSASVNLSESEIAALKAVLAKA
                     DKPKGGPAAKSMYQVKSPADVLMSLKWLVEDASYDNIDEAVTAQIKESAAGLAESLKA
                     LAASEADKPADGLAAKAGKSGDLAKAESADELAKAQDALKKSNDALAKAQAEIESLKK
                     QAVPPKGSTKAISKAEDNGEDPLKGFQPIVKNDGTLDDVATLIKAKQTGRL"
     gene            477821..479320
                     /locus_tag="NGO_RS02550"
                     /old_locus_tag="NGO0498"
                     /old_locus_tag="NGO_0498"
     CDS             477821..479320
                     /locus_tag="NGO_RS02550"
                     /old_locus_tag="NGO0498"
                     /old_locus_tag="NGO_0498"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002255690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951063.1"
                     /translation="MNVNQLTQETIELMKSAQAGGGPPDKGFTQPASFTAGLQTYDLS
                     APSQKLYPVLTPLRNRIPRVGGGRTIGSNWKAVTNINVGNQRAGIGEGRRGGVINHET
                     VERNAQFRAIGLENQVTFEADYAARGFEDVKALAVAQTLQATMVAEEMILLGGNTSLK
                     AGVTPTPTAVVSADAAGKISVSTLSVICVALGLQAYWDVAGANNGATGQSPNIKTAQV
                     PAKITRRNADGTTDTFGGGSARKSAAASVSGIEAGKKVTAVIPAVRGAVAYAWYWGAA
                     GSEKLGAVTTAAKVEISADAEGTQTAASLPSEDNSTSILEFDGLLTQIALPDSGAFWS
                     DNKGGGLTSDNAGGVYEFEEAFAHFFTRYRLSPDTVYVNARDLAALTKLIIGNSGAPL
                     IKLNVDVNNTANIRAGVVVGSYMNKITGDDLNIVVHPNLPAGTYLFYSSRLPAYVQGV
                     GNLLQVRTRQEYYQIEWPLRTRMYEYGVYADEVLQGMFMPAFGMITNVG"
     gene            479372..>479605
                     /locus_tag="NGO_RS02555"
                     /pseudo
     CDS             479372..>479605
                     /locus_tag="NGO_RS02555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002238697.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            479692..480222
                     /locus_tag="NGO_RS02560"
                     /old_locus_tag="NGO0500"
                     /old_locus_tag="NGO_0500"
     CDS             479692..480222
                     /locus_tag="NGO_RS02560"
                     /old_locus_tag="NGO0500"
                     /old_locus_tag="NGO_0500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003689080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage gp6-like head-tail connector protein"
                     /protein_id="WP_003689080.1"
                     /translation="MAAPVSLEEFKQRIGVEHDRRDDFFLSVIDGVSAAAEAYIGRSL
                     LAADYVGRYDGNGKDRIVLDNYPVLSVSSVKINGADAGGWEFDNWLLMRPEGFARGLK
                     NVEVSYRAGYERMPADIREAVMIIAVQRVNEIEGKGVRSKTLAGETVAFSTFGNSGGM
                     PPSAFAILNEYKRKGV"
     gene            480222..480702
                     /locus_tag="NGO_RS02565"
                     /old_locus_tag="NGO0501"
                     /old_locus_tag="NGO_02670"
                     /pseudo
     CDS             480222..480702
                     /locus_tag="NGO_RS02565"
                     /old_locus_tag="NGO0501"
                     /old_locus_tag="NGO_02670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003703855.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="HK97 gp10 family phage protein"
     gene            480699..481127
                     /locus_tag="NGO_RS02570"
                     /old_locus_tag="NGO0502"
                     /old_locus_tag="NGO_0502"
     CDS             480699..481127
                     /locus_tag="NGO_RS02570"
                     /old_locus_tag="NGO0502"
                     /old_locus_tag="NGO_0502"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002238694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689076.1"
                     /translation="MNREAVYSALWAKLDALDGFVTKSRKLVHWNDVKRYDQPALFMA
                     QGDMQALTLTGRETKWILRADVYLYVQTAGQPPAPVMNPLIDAVCNAVNAVHPVTGKT
                     DLTADGADIEYCRVEGTVETDEGTLGEQAVCIIPIVICAA"
     gene            481153..481926
                     /locus_tag="NGO_RS02575"
                     /old_locus_tag="NGO0503"
                     /old_locus_tag="NGO_0503"
     CDS             481153..481926
                     /locus_tag="NGO_RS02575"
                     /old_locus_tag="NGO0503"
                     /old_locus_tag="NGO_0503"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014580664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003691416.1"
                     /translation="MQLTFGSGEVFAQMITDAYGNRVQNATPVRIMGLQEMSVDLSAE
                     LKEFYGQNRYPLAVAQGKVKVSGKMKGALINGLTLNTLFFGTEYATGTMKALWAETTG
                     KVLDGDNYSYLQAAAPGGGKFAEDAGVMGQDGTAYIKVASSPKQGQYTVSESGVYAFN
                     SSDKGKTVYPSFTYTQTMPPAKKIELTNMATGNTPTFKMRYLTQFKGKKALLELESVT
                     SGKLGLFSTKNDDFSVPEIDFTASTDEAGFKIGTLWIQE"
     gene            481987..482316
                     /locus_tag="NGO_RS02580"
                     /old_locus_tag="NGO0504"
                     /old_locus_tag="NGO_0504"
     CDS             481987..482316
                     /locus_tag="NGO_RS02580"
                     /old_locus_tag="NGO0504"
                     /old_locus_tag="NGO_0504"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002238691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689072.1"
                     /translation="MTVRIKGVTVELNGADYVIPPIALGALEQLQERIGSFDGNAADA
                     GQISTVIDCAHAALKRNYPDLTREEAADLIDIGNMNEVFAAVMDVSGLKRKEQEAAQA
                     GEARAAD"
     gene            482328..482594
                     /locus_tag="NGO_RS02585"
                     /old_locus_tag="NGO0505"
                     /old_locus_tag="NGO_0505"
     CDS             482328..482594
                     /locus_tag="NGO_RS02585"
                     /old_locus_tag="NGO0505"
                     /old_locus_tag="NGO_0505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002212373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689070.1"
                     /translation="MIAHVCASTGWTWDYVADNLDLPRIKHLNEYWREHPPVHILAAS
                     YMGVKPSSGSVQSEADEAEAVGMLGGGELSEDEFDALLKAKGII"
     gene            482594..483193
                     /locus_tag="NGO_RS02590"
                     /old_locus_tag="NGO0506"
                     /old_locus_tag="NGO_0506"
     CDS             482594..483193
                     /locus_tag="NGO_RS02590"
                     /old_locus_tag="NGO0506"
                     /old_locus_tag="NGO_0506"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014580667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2460 domain-containing protein"
                     /protein_id="WP_003692874.1"
                     /translation="MGNAVFPEFPGLKWGRKKTAVWSTGTQKSASGREFRTAYYTYPQ
                     WRFSLSFEVLRTKASVNELEKLAGFFNARKGSFESFLYEDPADNAVTDQPVGNTVQGV
                     ARYQLVRSMGGFIEPVSAVKERPAVKVGGTALAYGRDYTVTDKGVLVFNTPQPPGRPI
                     TWTGGFYFRVRFTSDTVDFENVLGSLWAAKKIEFTSVKL"
     gene            483190..484044
                     /locus_tag="NGO_RS02595"
                     /old_locus_tag="NGO0507"
                     /old_locus_tag="NGO_0507"
     CDS             483190..484044
                     /locus_tag="NGO_RS02595"
                     /old_locus_tag="NGO0507"
                     /old_locus_tag="NGO_0507"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010357642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2163 domain-containing protein"
                     /protein_id="WP_010951065.1"
                     /translation="MKAATKELIGLLHGGDEFQMADLYTITLSGGRVLRHTGADMPVV
                     WDGQAYGAHELVIKRGATRTAVGLEVDSNTLQISAAPDYRLEGLQWAEAALGGVLDGA
                     RVKIDRVFFDAGLRPVGAVNIFSGRVSDVSGGRSSVKVDVKSDIELLNVSSPRNIYQA
                     GCMRTLYDDGCKVNREKFTVNGRVTENSRTGTVLKHNLTQPDGWFSQGVIKFAGGRNA
                     GLSRTVKAHGGNTFELALRLPYPPQAGDAFKVYPGCDKRRDTCKDKFDNIVHFRGFPF
                     IPSADTVV"
     gene            484046..484477
                     /locus_tag="NGO_RS02600"
                     /old_locus_tag="NGO0508"
                     /old_locus_tag="NGO_0508"
     CDS             484046..484477
                     /locus_tag="NGO_RS02600"
                     /old_locus_tag="NGO0508"
                     /old_locus_tag="NGO_0508"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002255685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C40 family peptidase"
                     /protein_id="WP_003689064.1"
                     /translation="MPSETDLRARIVEEARSWLGTPYHHHAMVKGAGVDCAMLLVAVY
                     GAVGLLPEGFDPRPYPQDWHLHRDCERYLGFVTQFCRETESPQAGDIAVWRFGRSFSH
                     GGILAGGGKVIHSYIGRGVVSDDIGQAELIGRGVRFFTFSF"
     gene            complement(484505..484786)
                     /locus_tag="NGO_RS02605"
                     /old_locus_tag="NGO0509"
                     /old_locus_tag="NGO_0509"
     CDS             complement(484505..484786)
                     /locus_tag="NGO_RS02605"
                     /old_locus_tag="NGO0509"
                     /old_locus_tag="NGO_0509"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007393562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_010951066.1"
                     /translation="MESRTLILRHLDALCDTPAQAANMRLRAGLMMHIADTVRENGWT
                     QKQAAEHCGLTRPRINDLLNGKIDKFSLDALVNINAGLGQCISLSFAPA"
     gene            485026..489171
                     /locus_tag="NGO_RS02610"
                     /old_locus_tag="NGO0510"
                     /old_locus_tag="NGO_0510"
     CDS             485026..489171
                     /locus_tag="NGO_RS02610"
                     /old_locus_tag="NGO0510"
                     /old_locus_tag="NGO_0510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014580253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1983 domain-containing protein"
                     /protein_id="WP_010951067.1"
                     /translation="MGGKSSTVTSAEERILSLQVQRSSQGLTLPVIYGRTRVAGNLIW
                     YGDFVTIEHKAVTRQGGKGGGGVKQVGISYTYEAAVMLALCEGEIQGVGRVWRDKEKF
                     DSPAQLRLTLMRGGDEQPLWTHLQQAKHQGQALNYSGTAYLCSPNYELTKSAQIYQHN
                     FEVIGKSGYSGNIPDANPREIVLDLLTNQRYGCGFPSQNIGDTDRYSNYCRAVGIFLS
                     PAYTEQGEAQRNISELLEQTNSAAVFSQGRLKIIPYGDGSHSGNGAVYVADNKAAYDL
                     TDDDFIVSGAQDPVKAGRKTNADAFNQIQVEYLDRDNDYNVAIAEAKDQANIEQYGLR
                     PKDAVRMHGICDAKVAQKVAQQLLQRALYVRNEYEFKLGWKYCLLEPMDIVTLTDAGL
                     GLNKTPVRITEIEEDGEGVLSVKAEDCPAGVYTVSEYPTQPSSGYSADYNVSPGNAHV
                     PVIFEAPLQLTGGEPQIWLATAGGGMWGGAEVWVSADGDSYTRVGAVNRKARFGALTA
                     DLPDGAVFDRTNTLGVEISAGQLTGGTEQDSRDLLTLCYVDGEFLAYADAELKGVGRY
                     TLGNLTRGAYGSAVNAHAAGSRFARIDEALFKYAVPRNWIGRTVWVKLVSYNVFGGGI
                     QDLAEVPAYSYTIEGAPLGQIQNLRLTSSWAYGKEAVIAWDKLDGADTYDVEIYAGGS
                     RRRLRAVDGIVDNSYTYTQADMKADGGQVRGIVFKVRGRAVTGKTGNWAQIAAQNPQL
                     QALQGISIDSGLRQAFFTCQKPDEEDFAGIIVWVCENAACPAADANKAYDGAETFITI
                     AKCGGKPLEKGKTYYLRAAGYDSFGKDNLKISGSISFTVYDVSATDLSESSLNKALRD
                     KINLIDGNGAGSVNERVEAVRSTADGNAAAVQTHARSINGLEAQYTVKVDANGKVAGF
                     GLATTPKNGTPESKFIVNADRFGIGAAGKADVFPFVVDTQKNRVGINGELVVNGKAVV
                     DKLNAGDIHGGKIAADTLDANRLKAGSVTAREIGAAAVTADKIGANAVTADKIQVADL
                     SAVSSNLGSITGGSLNIGGGNFTVSSDGILTADNAVIRGRIEADSGYFNGTVRASSVE
                     GDVLRAHRLRWTEGNVWVLDLDKDPLPRVLIPNFYVVSETFGNNRVQAKLLLNGGVLA
                     PREVRETENYTNYIWRGRTFGRYEDLPPRARGGGDYTEQSGSRYRTRLEYQIQVIPAG
                     KPVSLKLSLASHESVFSPFVSVSYLAQSDYEYKQLLGRMVWRTFAESFRYDSKKQIYL
                     GGDRRVHDYQNQMYKHWNAYGGLLQLPDDIYGISFEYRPFTNADWSTMLAFDRSDKFV
                     VVKKYRGHAPQQYSLFQEEFNTAVPKSNLLFFVEHWWQYIELRNIRVLIPESRENEVW
                     PSV"
     gene            489283..489588
                     /locus_tag="NGO_RS02615"
                     /old_locus_tag="NGO0511"
                     /old_locus_tag="NGO_0511"
     CDS             489283..489588
                     /locus_tag="NGO_RS02615"
                     /old_locus_tag="NGO0511"
                     /old_locus_tag="NGO_0511"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003689058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689058.1"
                     /translation="MIEDKKIVALNFAVEDGMTGASAAYHVVEHIGADYRNGYVTATL
                     NGYVSENAFKSGKRYLLARTLDFQETDITAPDPGWVYRKALEGAAGIPKDAQPVYAE"
     gene            489659..490129
                     /locus_tag="NGO_RS02620"
                     /old_locus_tag="NGO0513"
                     /old_locus_tag="NGO_0513"
     CDS             489659..490129
                     /locus_tag="NGO_RS02620"
                     /old_locus_tag="NGO0513"
                     /old_locus_tag="NGO_0513"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003692881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951069.1"
                     /translation="MLRFLTERRFLPAGFQAWLFGTATRVLEAVIGLGLSGYAAVFAL
                     APDEIYAWRIYYKFQDIPEAWTVGVLAAAGLLQTALLFARGVRACVASAYLLLFSGFV
                     WFLVSVAFWGAYPPLNTGMVVPPLLAFFCALAGNNALRFLFSAQKSRGLADEGS"
     gene            490130..490462
                     /locus_tag="NGO_RS02625"
                     /old_locus_tag="NGO0514"
                     /old_locus_tag="NGO_0514"
     CDS             490130..490462
                     /locus_tag="NGO_RS02625"
                     /old_locus_tag="NGO0514"
                     /old_locus_tag="NGO_0514"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003691408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003691408.1"
                     /translation="MGFLQFGLLFAAAGGVLGAVWASLQERGRPVQAVLEAFISAIAA
                     AAAAERFVPLDQAWTCAAAGVFAGMMTGHALDTVRALAPKVLRGYLGGLAEKLTGVKD
                     GGSSDGKD"
     gene            complement(490591..490824)
                     /locus_tag="NGO_RS02630"
                     /old_locus_tag="NGO0515"
                     /old_locus_tag="NGO_0515"
     CDS             complement(490591..490824)
                     /locus_tag="NGO_RS02630"
                     /old_locus_tag="NGO0515"
                     /old_locus_tag="NGO_0515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003692884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003692884.1"
                     /translation="MRSLSAGGSIRFHTRPYFKAFKISAGFQINAVKGAAHKTARKNR
                     RTDRYFSNKSNILRNSLKILVYSAYSYSFLNKD"
     gene            complement(490832..491179)
                     /locus_tag="NGO_RS02635"
                     /old_locus_tag="NGO0516"
                     /old_locus_tag="NGO_0516"
     CDS             complement(490832..491179)
                     /locus_tag="NGO_RS02635"
                     /old_locus_tag="NGO0516"
                     /old_locus_tag="NGO_0516"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002241441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system PemK/MazF family
                     toxin"
                     /protein_id="WP_010951070.1"
                     /translation="MYIPERGDIFHLAFDPAAGTEMKGGHYAIALSPRAYNRATGLVY
                     ACPISQGRAAAARSGGMISTLLGTGTATQGNVHCHRMKALDWKIRRAAFRETVPDYVI
                     EDVLARIGAVLFD"
     gene            complement(491179..491415)
                     /locus_tag="NGO_RS02640"
                     /old_locus_tag="NGO0517"
                     /old_locus_tag="NGO_0517"
     CDS             complement(491179..491415)
                     /locus_tag="NGO_RS02640"
                     /old_locus_tag="NGO0517"
                     /old_locus_tag="NGO_0517"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003689049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB/MazE/SpoVT family DNA-binding
                     domain-containing protein"
                     /protein_id="WP_003689049.1"
                     /translation="MLRLQKWGNSAAVRLPARLLTALNAKIGDALETEIRNGELLIRP
                     VKRYRLSDLLAETEAAPPRAEGWEEMPDVGQEGV"
     gene            491622..492161
                     /locus_tag="NGO_RS02645"
                     /old_locus_tag="NGO0518"
                     /old_locus_tag="NGO_0518"
     CDS             491622..492161
                     /locus_tag="NGO_RS02645"
                     /old_locus_tag="NGO0518"
                     /old_locus_tag="NGO_0518"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003703868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR02594 family protein"
                     /protein_id="WP_010951071.1"
                     /translation="MKELKWIEEARKYLGAHEKVNGKSNPVLLAMLQEMGNFNQEQKA
                     WWKETDTPWCGLFVGYCLGKSGRAVIRDWYRAKAWSMSGLTKLEAPAYGCIAVKPRRG
                     GGHVFFVVGKDAEGRILGLGGNQGNMVSIIPFDPADIDGYFWPSKLIGGKAVPSSPAE
                     GRYRLSDVAATAKQGAGEA"
     gene            492162..492506
                     /locus_tag="NGO_RS02650"
                     /old_locus_tag="NGO0519"
                     /old_locus_tag="NGO_0519"
     CDS             492162..492506
                     /locus_tag="NGO_RS02650"
                     /old_locus_tag="NGO0519"
                     /old_locus_tag="NGO_0519"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003695464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003695464.1"
                     /translation="MIGALLKNWKPLLILSAIAFFAVSWQLDRAAQYRRGYGAAVSEV
                     SERLKAAAVEHAEHARKSSAAYQAQKAAREEKERVRYVQTLKIIEKPVYRNACFDADG
                     VRELNAAVDDGG"
     gene            493004..493153
                     /locus_tag="NGO_RS11070"
                     /old_locus_tag="NGO_0521"
     CDS             493004..493153
                     /locus_tag="NGO_RS11070"
                     /old_locus_tag="NGO_0521"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003691402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689043.1"
                     /translation="MNAEGFCEKQTACRPDGRRNAGDRADLKAFEFAEQELANYREML
                     KRYAV"
     gene            493183..496230
                     /locus_tag="NGO_RS02655"
                     /old_locus_tag="NGO0522"
                     /old_locus_tag="NGO_0522"
     CDS             493183..496230
                     /locus_tag="NGO_RS02655"
                     /old_locus_tag="NGO0522"
                     /old_locus_tag="NGO_0522"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003692891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tape measure protein"
                     /protein_id="WP_010951073.1"
                     /translation="MSDLEAKVRITVENHTKQGFDSAAADADKAAEKMRSSGDNAAKG
                     FKAAIDSMHETMRNLHADVKAGFEAAGNQAQQASEKVRAEVGKIGSGLSGLTKLLAGL
                     ATADFAKSVLDTADAMQSINSQVRQVTSSETEYLAVQQQLLDTANRTRASLESTANLY
                     VSTSRALKDYGYTQQEILKFTEAANNAMTIGGVGAQQQAAALMQLSQALGSGVLQGDE
                     FKSISEAAPILLDTIAEYMGKSRDEIKKLGSEGKLTADVIFKAISGASEKFGEQAAKM
                     PVTMGQALTVFSNNWQSMVSKLLNDSGTMSGIAAVIKLIADNLNLVVPIVAGFAVAVA
                     AAVAPTLALNLALLANPFGIIAVAIGTVVGLIAKFGDEIDVFGGGWSNLSDVIRAVWQ
                     IITETVGEAVGTVKSWFDGLTGRLNEGAGGWPSLFGRVMSVISSAIGAYVNVYINIFA
                     TGWMLIKEAANDMPQFFANLGKAIGNVFISAIERMINKAVGMINSMIDFANKAASMAG
                     ISGIGKLNKVRMGRMDDGGLGERIHDSLTKDRAGAMANAVRERAADIHEADALKGRGG
                     GGHAKTARKKPGANQGGGKGGKSRSGGPGAAKDPMQAWEGEIKARKLAHREMQRETLA
                     HQEWDLAREAEYWRAKLATVDANGKTGVKIREKILMLEDQLSKQSTEAKMNQAAEWEK
                     LDKHKLEMEKDAADQALADGRISQLERLDLEIEFENRRYRIAYDALQERIALAEQDPA
                     YSQAAIGKLKAQMGELGRGHERTQAKNEGKRENQRRKDAPNVMEMLQDGGRNVWQEAQ
                     QQMGQAFTAMLARAQNFRQAMNGFFKSMGQTFIQEMVTKPLTGLMRRMVQESAIYKMI
                     FGTKETLETAAAAKTAATKATETTAVVSSNAVQAASGAAASQAHIPYVGPILAVAAMA
                     AMMSAVMGLMGGGGGSQTTTTTTRIPSAAGGWDIPAGINPLTQLHENEMVLPAEHAQT
                     IREMADQQGGGSTVIINSTGGDFIHKNDLAKLLKQMKRDFKFV"
     gene            complement(496290..496769)
                     /locus_tag="NGO_RS02660"
                     /old_locus_tag="NGO0523"
                     /old_locus_tag="NGO_0523"
     CDS             complement(496290..496769)
                     /locus_tag="NGO_RS02660"
                     /old_locus_tag="NGO0523"
                     /old_locus_tag="NGO_0523"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002248020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4760 domain-containing protein"
                     /protein_id="WP_002241413.1"
                     /translation="MTDNLIQIATPILTVIGVFVAAYGIMRNTENAKKRATIDMIMAE
                     RNNAALQEAITIVNGLAKTDGCILATYTSDTPDKKKDREAILTVLNQREFVCAGVLGG
                     ALHEKMYKDFEYSMLLRDWDNLSSFIFEIRRIRSAPTAFQEFEAVARKWKKKPLKTK"
     gene            complement(497111..498100)
                     /locus_tag="NGO_RS02665"
                     /old_locus_tag="NGO0524"
                     /old_locus_tag="NGO_0524"
     CDS             complement(497111..498100)
                     /locus_tag="NGO_RS02665"
                     /old_locus_tag="NGO0524"
                     /old_locus_tag="NGO_0524"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013747287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="WP_003689040.1"
                     /translation="MATITQRNGKWRVQIRMKGVSRSATFERASDAKAWAARIESQIM
                     DGIQGNAPRNTIFADLIRRYLSEVTPSKRGAREESYRIGRALKTPLAKVRLADLRPQD
                     FADWRDQRLQEVSPTSVGRELTTLSAVCEHAMKEWGLLRENPVRKISKPKKSRARTRR
                     PTEQEIADICAALLYRPNEKPKMAVQRVAVAVLFAIETAMRAGEICGLKWADVNMRRR
                     IAHLPITKNGDSRDVPLSLRAAELIEQLRGIDDTWVFSLDAKSLDVLFRRARDNCGIQ
                     GLHFHDTRREALTRLSKKVPVEVLAKISGHRDLRILLNVYYRPDMADIAKMLD"
     gene            complement(498360..498548)
                     /locus_tag="NGO_RS02670"
                     /old_locus_tag="NGO0525"
                     /old_locus_tag="NGO_0525"
     CDS             complement(498360..498548)
                     /locus_tag="NGO_RS02670"
                     /old_locus_tag="NGO0525"
                     /old_locus_tag="NGO_0525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014575381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689039.1"
                     /translation="MADGRKGFFDAIIKINIFFFPVKTPTLGAANPIAGGSTRFRFGA
                     EQMAVLYVPFCVLKHIGR"
     gene            498789..499823
                     /locus_tag="NGO_RS02675"
                     /old_locus_tag="NGO0526"
                     /old_locus_tag="NGO_0526"
     CDS             498789..499823
                     /locus_tag="NGO_RS02675"
                     /old_locus_tag="NGO0526"
                     /old_locus_tag="NGO_0526"
                     /EC_number="6.3.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine cyclo-ligase"
                     /protein_id="WP_003691398.1"
                     /translation="MSTSLSYRDAGVGIDAGDQLVEKIKPFAKRTMRPEVLGDLGGFG
                     ALVEIGKKYQNPVLVSGTDGVGTKLKLAFDWDKHDTVGIDLVAMSVNDILVQGAEPLF
                     FLDYFACGKLDVPRATDVIKGIAQGCEESGCALIGGETAEMPGMYPVGEYDLAGFAVG
                     VVEKENVITGLSIGAGDVVLGLASNGAHSNGYSLIRKIIERDNPDLDAEFDNGKTLRE
                     AVIAPTRLYVKPILAALEKFTIKGMAHITGGGITENVPRVLPKNTVAQIDAESWELPK
                     LFQWLQKAGNVETQEMYRTFNCGIGMVVIVAAEDADAVRSFLSGQGETVYRLGCIRER
                     QGNEHQTQVA"
     gene            500607..>500858
                     /locus_tag="NGO_RS02680"
                     /pseudo
     CDS             500607..>500858
                     /locus_tag="NGO_RS02680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014580096.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            500821..501474
                     /locus_tag="NGO_RS02685"
                     /old_locus_tag="NGO0528"
                     /old_locus_tag="NGO_0528"
     CDS             500821..501474
                     /locus_tag="NGO_RS02685"
                     /old_locus_tag="NGO0528"
                     /old_locus_tag="NGO_0528"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1595 family transposase"
                     /protein_id="WP_010951075.1"
                     /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFY
                     RKIRTVTNHRLALAADEVFECPAGPGASCFGVRRKGRRGRGAAGKAVVFGIPKRNGRA
                     YTVAEDDAEPETLPPAVKKKIMPDGIVYADSPGSRGKSDAGGFTRCRINRSKEFADRR
                     NHINGIGNFWNQAKRALRKYNGIDRKPFPPLLRECEFRFNFGTPSRQLKILRDRCGI"
     gene            501608..503635
                     /locus_tag="NGO_RS02690"
                     /old_locus_tag="NGO0529"
                     /old_locus_tag="NGO_0529"
     CDS             501608..503635
                     /locus_tag="NGO_RS02690"
                     /old_locus_tag="NGO0529"
                     /old_locus_tag="NGO_0529"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012221714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BCCT family transporter"
                     /protein_id="WP_003691396.1"
                     /translation="MSLSEFIERRTSFNPMVILTTLFFVCVLVVLVLTVPDQVQMWLD
                     RAKEVIFTEFSWFYVLTFSIFLGFLLILSVSGLGNIRLGRDEDVPEFGFLSWLAMLFA
                     AGMGVGLMFFGVAEPLMHYFSDITVGAPEHRQQQALLHTVFHWGVHAWSVYGTIALAL
                     AYFGFRYKLPLALRSCFYPLLKEKISGRFGDAIDIMALLATFFGIITTLGFGASQLGA
                     GLQEMGWIAENSFGVQVLIIAAVMSLAVVSAISGVGKGVKVLSELNLGLAFLLLFFVL
                     AADPTVYLLSAFGDNIGNYLGNLVRLSLKTYAYEREHKPWFESWTVLYWAWWCSWAPF
                     VGLFIARISKGRTIREFVFGVLLIPGLFGVLWFTVFGNTAIWLNDGVAGGMLEKMTSS
                     PETLLFKFFNYLPLPELTSIVSLLVISLFFVTSADSGIYVLNNITSRDKGLSAPRWQA
                     VMWGVLMSAVAVLLMRSGGLGNLQSMTLIVSLPFALLMLIMCFSLWKGLSADKKYFET
                     RVNPTSVFWTGGKWKERLVRIMSQTQEQDILKFLKHTASPAMHELQRELSEEYGLSVR
                     VDKMFHQDEPAIEFVIRKETMRDFMYGIKSVGQDVSDQLINDGKLPHIRHQTTYKPYA
                     YFFDGRVGYDVQYMNKDELIADILKNYERYLMLLDDVGQELMAHEQVELAE"
     gene            complement(503725..505278)
                     /locus_tag="NGO_RS02695"
                     /old_locus_tag="NGO0530"
                     /old_locus_tag="NGO_0530"
     CDS             complement(503725..505278)
                     /locus_tag="NGO_RS02695"
                     /old_locus_tag="NGO0530"
                     /old_locus_tag="NGO_0530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003708556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid--CoA ligase"
                     /protein_id="WP_003691393.1"
                     /translation="MNRTYANFYEMLAAACRKNGNGTAVFDGKEKTAYRALKQEAEAV
                     AAYLQNIGVKFGDTVALAVSNSTEFITAYFAVSAIGAVAVPMNTFLKNSEYAYILNDC
                     KARFLFASAGLSKELAGLKAQTPVEKIIWTDKSRPAGETAEGDAFFENVRRFPEKPDL
                     GRQPRINDLAHIIYTSGTTGHPKGALISYANLFANLNGIERIFKISKRDRFIVFLPMF
                     HSFTLTAMVLLPIYMACSIILVKSVFPFSNVLKQALLKRATVFLGVPAIYTAMSKAKI
                     PWYFRWFNRIRLFISGGAPLAEQTILDFKAKFPRAKLLEGYGLSEASPVVAVNTPERQ
                     KARSVGIPLPGLEAKAVDEELVEVPRGEVGELIVRGGSVMRGYLNMPAATDETIVNGW
                     LKTGDFVTIDEDGFIFIVDRKKDLIISKGQNVYPREIEEEIHKLDAVEAAAVIGVKDR
                     YADEEIVAFVQLKEGMDLGEDEIRRHLRTVLANFKIPKQIHFKDGLPRNATGKVLKRV
                     LKEQFEGNK"
     gene            complement(505529..506722)
                     /locus_tag="NGO_RS02700"
                     /old_locus_tag="NGO0532"
                     /old_locus_tag="NGO_0532"
     CDS             complement(505529..506722)
                     /locus_tag="NGO_RS02700"
                     /old_locus_tag="NGO0532"
                     /old_locus_tag="NGO_0532"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002239729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003691388.1"
                     /translation="MNPKHFIAFSALFAATQAEALPVASVSPDTVTVSPSAPYTDTNG
                     LLTDYGNAAASPWMKKLRSVAQGSGEAFRILQIGDSHTAGDFFTDALRKRLQKTWGDG
                     GIGWVYPANVKGQRMAAVRHSGNWQSFTSRNNTGDFPLGGILAQTGSGGGMTLTASDG
                     KTGKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLAIQTEMPWDIGFI
                     NIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNID
                     IADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVLLTEVQQMQRRVA
                     RQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAQGYRRAAEMLADSLEELVRA
                     AAIRQ"
     gene            complement(506719..507702)
                     /locus_tag="NGO_RS02705"
                     /old_locus_tag="NGO0533"
                     /old_locus_tag="NGO_0533"
     CDS             complement(506719..507702)
                     /locus_tag="NGO_RS02705"
                     /old_locus_tag="NGO0533"
                     /old_locus_tag="NGO_0533"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003702842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF459 domain-containing protein"
                     /protein_id="WP_003689032.1"
                     /translation="MKNFLSLFASILMSALIAVWFSQNPINAYWQQTYHRNSPLEPLA
                     AYGWWRSGAALQENAYALSDGIKTFLSGETPPTAQDGGSADMPPEAAASEAAPPAGGT
                     EWKQGTEAAAVRSGDKVFFAGDSLMQGVAPFVQKSLKQQYGIESANLSKQSTGLSYPS
                     FFDWPKTIEETLKKHPEISVLAVFLGPNDPWDFPVGKRYLKFASDEWAQEYLKRVDRI
                     LEAAHTHRVQVVWLGIPYMKKVKLDGQMRYLDKLLSEHLKGKIILIPTAQTLSGGKGR
                     YTDSVNVNGKPVRYRSKDGIHFTAEGQKLLAEKIMEKIVFEPSTQPSSTQP"
     gene            complement(507713..509149)
                     /locus_tag="NGO_RS02710"
                     /old_locus_tag="NGO0534"
                     /old_locus_tag="NGO_0534"
     CDS             complement(507713..509149)
                     /locus_tag="NGO_RS02710"
                     /old_locus_tag="NGO0534"
                     /old_locus_tag="NGO_0534"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014575397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBOAT family protein"
                     /protein_id="WP_003706086.1"
                     /translation="MPLLSVEFALFFIVFLPIYWGFAKYPSVQNLLLLAAGMGWLYHI
                     SPVFAAIIVLYSSCVYLLGELLRSDRESTRRFWLGCGIAASITVLGFFKYFDFFRPLI
                     AQYAGKGGAIDILMPLGLSYYTFQSVAYLVYCFRAPHAARFGWHELLLHLSFFPTVTS
                     GPIIRAAAFKSTDGEQAGALAQIRTRRPRSPVRPALAVSLILLGIAKKWWLAGILAEN
                     WVSPVFENPTQFDGWGVLAGVYGYTFQLFLDFSGYSDLVIGMAMLLGFRLPKNFSAPL
                     RAANIRAFWDKWHISLSTWIRDYIYIPLGGSKKGFLRTQLNLMAAMVLSGIWHGYGWN
                     FLIWGALHGTALALLNTGDRYFGRDALCRLKYLAPLSWFVTFHFVCLSFVVFNTANPD
                     DAGAVFSALFANAGGWNAPQRADMLLLASFASLMLLYPYLQRAFDGAVKGLEKIPMWL
                     WFIQISIILLLIIVLAPSGIPGFIYANF"
     gene            complement(509279..510444)
                     /locus_tag="NGO_RS02715"
                     /pseudo
     CDS             complement(509279..510444)
                     /locus_tag="NGO_RS02715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003713084.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transporter"
     gene            510885..511097
                     /locus_tag="NGO_RS02720"
                     /old_locus_tag="NGO0537"
     CDS             510885..511097
                     /locus_tag="NGO_RS02720"
                     /old_locus_tag="NGO0537"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy-metal-associated domain-containing
                     protein"
                     /protein_id="WP_003689029.1"
                     /translation="METLLLDIGGMSCGGCVKSVTRILESVKGVASVEVSLENKSATV
                     GYDPAQTAAEALIEAVEDGGYDAALK"
     gene            complement(511076..511285)
                     /locus_tag="NGO_RS02725"
                     /old_locus_tag="NGO_02840"
     CDS             complement(511076..511285)
                     /locus_tag="NGO_RS02725"
                     /old_locus_tag="NGO_02840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017147103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_017147103.1"
                     /translation="MQRAKAAFFFLFGIFCLSEGTIARKFNQFILPVQLNQMPSEGAE
                     RASDGIGETQRLQTAFLPLYFNAAS"
     gene            511297..512823
                     /locus_tag="NGO_RS02730"
                     /old_locus_tag="NGO0537a"
                     /old_locus_tag="NGO_02845"
     CDS             511297..512823
                     /locus_tag="NGO_RS02730"
                     /old_locus_tag="NGO0537a"
                     /old_locus_tag="NGO_02845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010357698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase regulatory domain-containing
                     protein"
                     /protein_id="WP_010357698.1"
                     /translation="MPGVSDIKNSYDDLMYESKAFSQTAINALEACARMMGLKPTAAA
                     KAKVLELGCSMGRNIITQALYYPDAEFVGIDLSGRQVAQGNAIIEKMGLENVRLEEKD
                     ILTVDESFGKFDYIIVHGIWSRVPDAVKDKIFSICRNNLTEYGIAYISYNVYPGWKRQ
                     EQLRDIMQFAGRDALGEPLEARTRKGLDAIKALAEILENDKGLGGGKLPAIQKILNHN
                     TYYVAHEYMEIFNDPIYVNGFIEWANRHRLAYIGDTDLHVSFVSWMAEHTRERILALA
                     GGDYIAKEFYSDILSDRQFHRSLLCREEVGDTVRRDESVAVEVIESLNFRPARGETIN
                     FDENDTLLSGIRDVMKTGEAFKTEDVAENLARRFPGLEFDRMKINSQLLLQTILGRFS
                     VSSDNAGKPFFEDHKTYVPARFTNYAAAFVEHGAGAFVRPANRYNESTPSFGYGHLYI
                     MRQLSRPTSKQALIETVAENLNIVSATPDGLTFHPPAEVYVEEILADLADRHFLVSAD
                     "
     gene            512905..514002
                     /locus_tag="NGO_RS02735"
                     /old_locus_tag="NGO0539"
                     /old_locus_tag="NGO_0539"
     CDS             512905..514002
                     /locus_tag="NGO_RS02735"
                     /old_locus_tag="NGO0539"
                     /old_locus_tag="NGO_0539"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002220905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003689027.1"
                     /translation="MNQTFTLPDTRPYPQNPIKNHLLLNAYQLAHNSSQASRKLSSGQ
                     LQTEIRGMLEQNHYINLSLALTMSPDAGTYAALLSSVNAVLDCEKEGEVQWFALPVVL
                     VSGCKKERAIEMKLPTEALFACLQNYPHLRALTQETQWLPYLVHSSDLSAVAPDEWWR
                     AKQNTEAAAQHLRRFAPRPLLLPEGQSVHVVYVLGFGSGKVQAALGQNLLQAGLPLMQ
                     VWQENLASEGITLFANPLSPDTPARALSDGSHTRQRMAMDVFAANAIRAVRMQGPRVG
                     VVAAAKAGGQILFGFNATDGAFEVVPQVFCWQLSFTDNIAVIQQNFLDLMAECRVEHV
                     YLLHNPLGEQENIPSYAEALKREGRNPFFSA"
     gene            514116..515231
                     /locus_tag="NGO_RS02740"
                     /old_locus_tag="NGO_02855"
                     /pseudo
     CDS             514116..515231
                     /locus_tag="NGO_RS02740"
                     /old_locus_tag="NGO_02855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000706318.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate kinase"
     gene            515299..515811
                     /locus_tag="NGO_RS02745"
                     /old_locus_tag="NGO0541"
                     /old_locus_tag="NGO_0541"
     CDS             515299..515811
                     /locus_tag="NGO_RS02745"
                     /old_locus_tag="NGO0541"
                     /old_locus_tag="NGO_0541"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017146763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low molecular weight phosphotyrosine protein
                     phosphatase"
                     /protein_id="WP_033909070.1"
                     /translation="MPSERVSASGGIALEQGWDMKKPKILFVCLGNICRSPMAEYILR
                     RRAAEAGIPLETDSAGTSGWHDGEDMHRETAKILKKYGIDASGFTSRKIRQSDATAFD
                     YIIAMDGKNLSELEKTFGRRPEKIFKLTDLIPESGYDHVPDPWYMGDFEETYRLADAG
                     CRALLEKISK"
     gene            515888..516364
                     /locus_tag="NGO_RS02750"
                     /old_locus_tag="NGO0542"
                     /old_locus_tag="NGO_0542"
     CDS             515888..516364
                     /locus_tag="NGO_RS02750"
                     /old_locus_tag="NGO0542"
                     /old_locus_tag="NGO_0542"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor"
                     /protein_id="WP_010357704.1"
                     /translation="MKTNFKQKIIEQARREDLQVTALREQVLDIVLQQSGVIKAYNVL
                     SQMQQQSEGVLAPPTAYRALDFWADQGVLHKVAAVNGYILCSHAQHECNDHCHDHEEA
                     EAHHSAFILVCTECGAADEQTLSHEWAALRAGVAESGFALKEEHVVLTGICKKCQK"
     gene            516352..517278
                     /locus_tag="NGO_RS02755"
                     /old_locus_tag="NGO0543"
                     /old_locus_tag="NGO_0543"
     CDS             516352..517278
                     /locus_tag="NGO_RS02755"
                     /old_locus_tag="NGO0543"
                     /old_locus_tag="NGO_0543"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003744588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_003706094.1"
                     /translation="MSEVKKTKVHLISGFLGTGKTTALKSLMAQKDPNEKWVIIVNEF
                     GEIGIDGAVLSDNGIPVAEIAGGCLCCTAGPQMGVTVQKMLRDAKPDRLMIEASGLAH
                     AASVIDELKAKPLDSLLEIGAVFTVVDPRQFINPDYAQQALYKDQIGICDVLAASKTD
                     LCTPEQLAEFHDKAAKLFPPKAKVVEVQNAQLDIQWLDIPVVEKSRYRLKALPDNTMG
                     FQSQGFTFPAGRDFNGEKLTNFFNDLPKMTEGLVRAKGVFQVLGTWVWLNWVDGQWGA
                     NQVSWRRDSRFELIAKSFDADLIEQKLKDALE"
     gene            517343..517900
                     /locus_tag="NGO_RS02760"
                     /old_locus_tag="NGO0544"
                     /old_locus_tag="NGO_0544"
     CDS             517343..517900
                     /locus_tag="NGO_RS02760"
                     /old_locus_tag="NGO0544"
                     /old_locus_tag="NGO_0544"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014582040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_010951078.1"
                     /translation="MKPKFKTVLTALLLAVSLPSMAATRVLMETDMGNIRLVLDESKA
                     SKTVANFVRYARKGFYDNTIFHRVIGGFVIQGDGLTEDLVQKATDKAVANESGNGLKN
                     TVGTIAMARTAAPDSAAAQFFINLADNGSLDYKNGQYGYTVFGRVESGMDTVSKIARV
                     KTATRGFYQNVPVQPVKIRRVVVGQ"
     gene            518016..520079
                     /locus_tag="NGO_RS02765"
                     /old_locus_tag="NGO0545"
                     /old_locus_tag="NGO_0545"
     CDS             518016..520079
                     /locus_tag="NGO_RS02765"
                     /old_locus_tag="NGO0545"
                     /old_locus_tag="NGO_0545"
                     /EC_number="3.1.21.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific DNA-methyltransferase"
                     /protein_id="WP_010951079.1"
                     /translation="MLPTQPNPTQPNPTQPNPTQPNPSPDLSDTAGANTEAIYTSDGI
                     TANSTQLEQLKKLFPACFDADGNFLIDRLQAEIAPQTDIGREFYEMNWLGKSYARLLR
                     NLPPETLISEDKTHNAKPENAGSQNLLIRGDNLEVLKHLKNAYANSVKMIYIDPPYNT
                     GSDGFVYQDDRKFTPAELALLANIDEDEAARILDFTDKGSNSHSAWLTFMYPRLYIAR
                     ELLKDDGVIFISIDDNEAAQLKLLCDEVFGEGNFVAQLPWRKRTAKSDVPFGISQDYE
                     WIFVFAKSCQFIAATKGKERRYYETDDFPDRPWRTHDLTKQTTAAERPNSFFTMVDPK
                     TGKKYPANPNATWRVTKDTFQDYYNKGKIVFPDDYDFLNISNPVMRYFKDDDMKKAGE
                     DFGKVAVSSRLPENVGTLADAVAEYLAIFSRTLPENIGMTKEGTKEITDLFGSKIFTF
                     PKPSQLIKFLVSISSKSNDLILDFFAGSGTTAHAVMQLNAEGQNGNRRYICVQLPEKT
                     AEKSEARKAGYPTIFDITKARIEKAAAKIRVEHPDYTGDSGFKIFQTADNFRQHPDKD
                     FSPEQPDLPLNDELSEEQLQTLLTTWTLYDGAALTTPVEPVRLGSYTAYLCEKRLYLL
                     NKGFTSADLLAFIKKLDDDADFNPNRVIVFGSNMASAMQHELDQAVRGYTNKKEIELN
                     VIIRV"
     gene            520169..523108
                     /locus_tag="NGO_RS02770"
                     /old_locus_tag="NGO0546"
                     /old_locus_tag="NGO_0546"
     CDS             520169..523108
                     /locus_tag="NGO_RS02770"
                     /old_locus_tag="NGO0546"
                     /old_locus_tag="NGO_0546"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III restriction-modification system
                     endonuclease"
                     /protein_id="WP_003689015.1"
                     /translation="MSGFNYEKNQPHQMRAVSAVLGVFDGATPKYRTADENPELLFAA
                     KQYANNILKVQSQNGIDGRFPDRSDDQNILDISMETGTGKTYTYTQTMFELHRWLGVF
                     KFIVVVPTLSIKAGTQQFLQSKALAEHFEQDFGGDYEGVRLKTYVVESAKKNKGKKSN
                     APITIEQFVKAENKKEIHVLLINAGMVNSSSMNDTGDKALKDLFDNPVDALAAVRPFM
                     IVDEPHKFPTRDSAKTWGNIKRLKPQYILRYGATFNDEYYNLLYRLTAVDAFNDGLVK
                     GVRVFQEEMQGGMDAAVKLVSSDGKEAKFELNEKDKKQTFKLAKGEDLAQIHPAISDL
                     KIDKMNKTVVVLSNGLELKTGAVINPYSYSQTVQDAMMQRAVAEHFKLERALLAERAP
                     QPKIKPLTLFFIDDIAGYRSGNELSGSLKDKFESWIRAEAARRLKTESDPFYRDYLQK
                     TLDDVSACHGGYFSKDNTDSDDRIEQEINEILHDKEKLLSLDNPRRFIFSKWTLREGW
                     DNPNVFQICKLRSSGSTTSKLQEVGRGLRLPVNELMARVRDVPYKLNYFVDSSEKDFV
                     KQLVGEINDNSFQEEISKKFTEELKQKILQKYPDIKPLVLVNQLFSDGIIDDNENFAE
                     DGYDKLKAAYPEAFPKGLDKGKVSNAKDEGKDTIIMREGKYEELKALWELIHHKAVLQ
                     YKIKDEAEFVDLFTAYLRENAAKFPQAGICTAVNEAYINNGLMLSRRIDSIEDEDFIR
                     FNTMTYREFLEKLAQTAKIQMQTLHQAFYRVRDELNIGDFLNMQTIAQIKNGFNRFLL
                     HHSFHKFELDYRLVGSKIHPTKFTNKDGKPRAVKKADLGRFEDTEHRPAAGYLFGEIF
                     YDSDIEHENVANNQIEGVIVFTKIPRNSIKIPVAGGGTYSPDFAYIVKTKSGEILNFV
                     IEAKGTDGAEDLRKSEERKIKHAEKLFAEISKEIKVVFKTQFDGERIAELIGQNMPAG
                     GHSENGH"
     gene            complement(523202..524161)
                     /gene="ttcA"
                     /locus_tag="NGO_RS02775"
                     /old_locus_tag="NGO0547"
                     /old_locus_tag="NGO_0547"
     CDS             complement(523202..524161)
                     /gene="ttcA"
                     /locus_tag="NGO_RS02775"
                     /old_locus_tag="NGO0547"
                     /old_locus_tag="NGO_0547"
                     /EC_number="2.8.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003702835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA 2-thiocytidine(32) synthetase TtcA"
                     /protein_id="WP_003692918.1"
                     /translation="MSKKTKQELENNKLSKRLRHAVGDTINDFNMIEPGDKIMVCLSG
                     GKDSYALLDILRRLQASAPIDFELVAVNLDQKQPGFPEEVLPTYLESIGVPYKIVEED
                     TYSTVKRVLDEGKTTCSLCSRLRRGILYRTAKELGCTKIALGHHRDDILATMFLNMFY
                     GGKLKAMPPKLVSDNGEHIVIRPLAYVKEKDLIKYAELKQFPIIPCNLCGSQPNLQRQ
                     VIGDMLRDWDKRFPGRIESMFSALQNVVPSHLADTELFDFAGLERGQNLKHGGDLAFD
                     SEKMPERFSDGSEEDESEIKIEPQKAERKVINILANKPKTCGP"
     gene            complement(524253..525116)
                     /locus_tag="NGO_RS02780"
                     /old_locus_tag="NGO0548"
                     /old_locus_tag="NGO_0548"
     CDS             complement(524253..525116)
                     /locus_tag="NGO_RS02780"
                     /old_locus_tag="NGO0548"
                     /old_locus_tag="NGO_0548"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="folate-binding protein YgfZ"
                     /protein_id="WP_025456464.1"
                     /translation="MKTLLPFFGVARVSGEDRQTFLHGQLSNDINNLQTGQACYATYN
                     TPKGRVIANMIVVNRGDDLLLIMAQDLLEATVKRLQMFVLRAKAVFEILEDYAVGAEL
                     AASAEPLAAQEPSLAFTSECVSDGICSVILHHRGILHIAPETALPPYDAAAENAWRLH
                     EIRSGYPWICAATKETAVAQMLNQHIIGGVHFKKGCYPGQEIIARAQYRGQVKRGLAV
                     LSGNSAAEAGILLTADGEEAGIVLDSVQDSENFTALAVIKFSAAQKELTVPNGGIFKA
                     VHLFFKTKNAE"
     gene            complement(525151..525513)
                     /locus_tag="NGO_RS02785"
                     /old_locus_tag="NGO0549"
                     /old_locus_tag="NGO_0549"
     CDS             complement(525151..525513)
                     /locus_tag="NGO_RS02785"
                     /old_locus_tag="NGO0549"
                     /old_locus_tag="NGO_0549"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RidA family protein"
                     /protein_id="WP_010357712.1"
                     /translation="MDIRYFGTTPRYSEAVCAGGLIFLSGMVPENGETAAEQTADVLA
                     QTDRWLAECGSDKAHVLDAVIYLRDMGDYAEMNGVWDAWVAAGRTPARACVEARLARP
                     EWRVEIKITAVKRDAATA"
     gene            525588..526067
                     /gene="ybaK"
                     /locus_tag="NGO_RS02790"
                     /old_locus_tag="NGO0550"
                     /old_locus_tag="NGO_0550"
     CDS             525588..526067
                     /gene="ybaK"
                     /locus_tag="NGO_RS02790"
                     /old_locus_tag="NGO0550"
                     /old_locus_tag="NGO_0550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cys-tRNA(Pro) deacylase"
                     /protein_id="WP_003691371.1"
                     /translation="MSKHTYPITPAVRVLRENGIEFEPFTYAYEEHGGTAQFARLFGK
                     DEHLVIKTIVLQDENGKGPIVLMHGDKQISTRNLARHLGAKHIEPAAPAQANKWTGYL
                     VGGTTPFGIRTKLDIYVEQSVMDLETIYINGGKRGFIIGIRPDDLNILNPKTIQAAV"
     gene            526089..526781
                     /locus_tag="NGO_RS02795"
                     /old_locus_tag="NGO0551"
                     /old_locus_tag="NGO_0551"
     CDS             526089..526781
                     /locus_tag="NGO_RS02795"
                     /old_locus_tag="NGO0551"
                     /old_locus_tag="NGO_0551"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002241619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DnaJ domain-containing protein"
                     /protein_id="WP_010357715.1"
                     /translation="MDKDLYAVLGVSPQAGADEIKRAYRKLAMKYHPDRNPGNLQAEE
                     KFKEIQRAYDTLSDLSKRTQYDASFRRHEERGRQEEAFRREQARREQFYGEQMRREQA
                     FRREFERQASRSRHAYEPSGSGSGRNYILAAYILFGLGAIIQFMPIVGVILAYMKRNS
                     LDSIVYAAHTEYLIKTFWRTFWLYLLGALTARFGIGVLVIIATTVWYFYRIIAGFIRF
                     NDGRAVAPEKWI"
     gene            526785..527660
                     /locus_tag="NGO_RS02800"
                     /old_locus_tag="NGO0552"
                     /old_locus_tag="NGO_0552"
     CDS             526785..527660
                     /locus_tag="NGO_RS02800"
                     /old_locus_tag="NGO0552"
                     /old_locus_tag="NGO_0552"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003751426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_003689009.1"
                     /translation="MAYLLISIVFSVSVSILLKMARKKKIDIAQAVAVNYVVAVILTL
                     SVLKPDVGNIGAFLPTWPLFAALGVLLPSVFVIMGKSVESAGIVKSDAAQRLSLFLPI
                     VAALTLFGEKLSEGKLIGLCLAFAALFCLLWKSDSGKKSGSAWRQALLLLGVWAGYGI
                     IDILFKQIAKSGTAFAGNLLVAFALAGVLMFACLFAKSVRWRVESVVGGILLGGLNFM
                     NIVTYITAHQMMKDSPTLVFAGMNIGVIVLGTLSGALFFKEKINTINTAGIVLSLCSI
                     ACLFYWTEVKALFGI"
     gene            527868..531488
                     /locus_tag="NGO_RS02805"
                     /old_locus_tag="NGO0553"
                     /old_locus_tag="NGO_0553"
     CDS             527868..531488
                     /locus_tag="NGO_RS02805"
                     /old_locus_tag="NGO0553"
                     /old_locus_tag="NGO_0553"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003706103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_010951080.1"
                     /translation="MMSGFSPKPKTIILSLAGAFGALAFADTPNNTEQQKELNTIVVH
                     GKRSADQKGADDVYYKNVSNAYVGKEYLERYRVQSAGDVLKGLNGVYNMNTRTAGGAI
                     TPNIRGITGKGRIPVTIDGTEQTIDVWMNNYGVGDRNYLDPALFRSIAVEKSPALTRG
                     VKSGVGGAMSIRTIEPSDIIPEGRNWGIEVKTEFSGNTVAQKNDLRQFLGRDYRTLSP
                     IGATADGVSGMPDVLTGYTGKPSPTALLLDEGIADTKFSGGKSHTNFKDDRQLMLSAA
                     FKTDITDGLAAYSHRQKGNYYAGKRGYQSYLNNPIYGADACYDQYPDKSWREKDILCK
                     SSASLVPNMAVLFRPGEEIMNSHTDTKILLLKNNWYLPDNQKISLQYMDNKIGFGEIN
                     PLITAWILGFAEQSLNEPVQQAPGIGTKIDSKTYKIGYEWKPQNNKWIDLQADMWRVK
                     TDSNRHQSGGPVVGVITSDFDYDLWYWCNIRKKPSPNLRGESCESAMTWNAYGSARTH
                     EEVLRMIEDTPDKIARKLAEYDENNRAITDRWMGHTGGYYTITPADKNVLTDQTNQIG
                     KMMNLAELKQKLNQERYYIEHPDRIIVPGARQRTDVVRNGFNLSNRLRLSDKLSLTLA
                     ADYQRETLEERTDTADSNDLMNTFGVLTRMAALGGPQSAKKREWGANLVFDWKPTSRL
                     NIQAGVRYQNYKGNNIELARQRAARNPWYQYGLGSDSYVTGLMMPYYELADEEDIANQ
                     KRMLQLYDPDRADGQVAEYQDLNRRFKEKNGYDFDPHDTLVGQDTRFYAKSDGNFVQY
                     ADGNKNTDVLYVLRRKQIIPMNAGKFDPGKVQITPEMYRERVNNPQGKSGSYRRYIPG
                     SHIYITPGSVREEMERMANENQIPSKEDNNQALEFNSDLNRTAWIRHQFGEADRWRMP
                     QEQRAHSWSPMLAVSYDLADNHRLFARYARMSRFPSLYELTAATGSGGLYGSETVAEY
                     SLKPEKSTNWEVGYNFNFAPHFAKLRQGDLRLTYYSNKIKNQIDTSNEDGGMIQYDKA
                     VSKGVELQSRLDSGRFFASFGGTYRLKHMVCDKGIAFKFDYYLQRVPECLEGGFGLSR
                     FFQSLQPKYSLTLDVGTRFFNEKLELGMRAIHHSKAERRNYDKLIADGAGQVYARNGK
                     PYGWHAATLLDAYARYRIGKHIDLNFSVTNLANRYYLDPMSSTPVPGPGRTITFGIKG
                     RF"
     gene            531770..532720
                     /locus_tag="NGO_RS02810"
                     /old_locus_tag="NGO0554"
                     /old_locus_tag="NGO_0554"
     CDS             531770..532720
                     /locus_tag="NGO_RS02810"
                     /old_locus_tag="NGO0554"
                     /old_locus_tag="NGO_0554"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003706105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003706105.1"
                     /translation="MKASQLTLAVLLAAAFGSAYAVEVKGGDSSKGQLIQAAESDFLP
                     FGSGAADIKVSTGNGLSKSINLEAGPAQRIRNKYGNAPINGGNQNTNVNGAANSRYLQ
                     PGDINPIAGWFSKTRLAQVWYEKRANNTEVFSVRQMADPLLPIAPKFGGMTFAKVPTA
                     ATNVFFGEWAPRKGNSNQITNSTDLNMNDGNRTVWFVGENPTKNTRNLTAVTYNVVGI
                     NKHTPGKNDFYTGEITATFGTGDKGFMSGELEHTDDGELSFNGVEITNADGSFNSIPG
                     RNNEGIKGQFYGNGAAAMAGYATRGTDNKGDDVAFGGAKK"
     gene            532940..534433
                     /locus_tag="NGO_RS02815"
                     /old_locus_tag="NGO0555"
                     /old_locus_tag="NGO_0555"
     CDS             532940..534433
                     /locus_tag="NGO_RS02815"
                     /old_locus_tag="NGO0555"
                     /old_locus_tag="NGO_0555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF560 domain-containing protein"
                     /protein_id="WP_010951081.1"
                     /translation="MTHRLCLLFLPLCTVCLAAPSNDAADERRRLLDEGSRQTQQYRE
                     SGWLDTEQARGEVEENDGYISIGGEIYQVGDTAEELESAIYHALNARQWHKVRQFAAR
                     YAKLPRHKPALIHLADALQKRDEGDFRAAGNSFQTALEAEPDNPRLLLEAGRFYAEDN
                     QNKESAAAFEKVLKTDIPAETRPIVENYLSELGKRRRWHGQISLGYGYNSNVNQGNGI
                     NQCVWEIAGMCLMERTLPAPTDSTFSSYSATAEKTVPLKGNHGVQVRGVLYGNRYTEK
                     DKDSAAMPDYGYRNGSLYAGYAYADARSSFSLLPYFEYDFRNRHTHYRAWGADADWSR
                     TLSPHWRINSHAGAKKTGYGGQSKTYFADFKQYELGAGAEFSITLKSGLLVNFDAARK
                     AYPEKSSSSKEYTARLGAYRLFSGGTYLNAVLLYRRSLYDAASFVSDNKRRRDKQYIM
                     MAAAGFPQWNIKGVYPELRFRRTIAHSNAVYYRYRQNEWLLGFKYRF"
     gene            complement(534501..535898)
                     /gene="aspA"
                     /locus_tag="NGO_RS02820"
                     /old_locus_tag="NGO0556"
                     /old_locus_tag="NGO_0556"
     CDS             complement(534501..535898)
                     /gene="aspA"
                     /locus_tag="NGO_RS02820"
                     /old_locus_tag="NGO0556"
                     /old_locus_tag="NGO_0556"
                     /EC_number="4.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009311384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="WP_010951082.1"
                     /translation="MTVRIEHDLLGDREIPAEVYWGIHTLRAIENFKISTQKISDVPQ
                     FVRSIVMVKKATAQANGELGAVKPEIAAAIEKACDEVLLNNRCLDQFPSDVYQGGAGT
                     SVNMNTNEVIANLALEALGYEKGRYDIVNPMDHVNASQSTNDAYPTGFRLAVYYSIGE
                     LLDKLTVLKNAFAAKAEAFKDVLKMGRTQLQDAVPMTAGQEFQSFQVLLEEEILNLDR
                     TRQLLLEVNLGATAIGTGVNTPKGYAELVVKKLSEVSGLPCKLTENLIEATSDCGAYV
                     MVHGALKRTAVKLSKICNDLRLLSSGPRAGLKEINLPELQAGSSIMPAKVNPVIPEVV
                     NQVCFKVIGNDTTITFAAESGQLQLNVMEPVIAQCMFETISLLGNAAVNLSDKCVKGI
                     TVNREICERYVFNSIGLVTYLNPYIGHRNGDLVGKICAQTGKGVREVVLERGLLSEEE
                     INRILSPENLMNPHL"
     gene            complement(536176..536736)
                     /locus_tag="NGO_RS02825"
                     /old_locus_tag="NGO0558"
                     /old_locus_tag="NGO_0558"
     CDS             complement(536176..536736)
                     /locus_tag="NGO_RS02825"
                     /old_locus_tag="NGO0558"
                     /old_locus_tag="NGO_0558"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009311439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyisoprenoid-binding protein"
                     /protein_id="WP_003691360.1"
                     /translation="MKKIIFAALAAAAVGTASATYKVDEYHANVRFAIDHFNTSTNVG
                     GFYGLTGSVEFDQAKRDGKIDITIPVANLQSGSQPFTGHLKSADIFDAAQYPDIRFVS
                     TKFNFNGKKLVSVDGNLTMRGKTAPVKLKAEKFNCYQSPMAETEVCGGDFSTTIDRTK
                     WGVDYLVNAGMTKNVRIDIQIEAAKQ"
     gene            536937..537590
                     /locus_tag="NGO_RS02830"
                     /old_locus_tag="NGO0559"
                     /old_locus_tag="NGO_0559"
     CDS             536937..537590
                     /locus_tag="NGO_RS02830"
                     /old_locus_tag="NGO0559"
                     /old_locus_tag="NGO_0559"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1595 family transposase"
                     /protein_id="WP_010951083.1"
                     /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFY
                     RKIRTVANHRLALAADEVFEGPAGPGGSCFGGRRKGRRGRGAAGKAVVFGIPKRNGRA
                     YTVAADDAEPETLLPAVKKKIMPDGIVYADSPGSRGKSDAGGFTRCRINRSKEFADRR
                     NHINGIGNFWNQAKRALRKYNGIDRKPFPPLLRECEFRLNFGTPSRQLKILRDRCGI"
     gene            537765..540009
                     /locus_tag="NGO_RS02835"
                     /pseudo
     CDS             537765..540009
                     /locus_tag="NGO_RS02835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003685727.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
     gene            540134..541684
                     /locus_tag="NGO_RS02840"
                     /old_locus_tag="NGO0561"
                     /old_locus_tag="NGO_0561"
     CDS             540134..541684
                     /locus_tag="NGO_RS02840"
                     /old_locus_tag="NGO0561"
                     /old_locus_tag="NGO_0561"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003707855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YdgA family protein"
                     /protein_id="WP_003688997.1"
                     /translation="MKKPLISVAAVLLGVALGTPYYLGVKAEESLTQQQKILQKTGFL
                     TVESHQYDRGWFTSTETTVIRLKPELLHNAQKYLPDNLKIVLEQPVTLVNHITHGPFA
                     GGFGTQAHIETEFKYAPETEKVLERFFGKQVPVSLANTVYFNGSGKMEVSVPAFDYEE
                     LSGIRLHWEGLTGETVYQKGFKSYRNSYDAPLFKIKLADKGDAAFEKAHFDSETSDGI
                     NPLALGSSNLTLEKFSLEWKEGVDYNVKLNELVNLVTDLQIGAFINPNGSIAPSKIEV
                     GKLAFSTKTGESGAFIDSEGRFRFDTLVYGDEKYGPLDIHIAAEHLDASALTVLKRKF
                     AQISAKKMTEEQIRNDLIAAVKGDASGLFTHDPVLNIKIFRFTLPQGKIDVGGKIMFK
                     GMKKEDLNQLGLMLKKTEANIRMSIPQKMLEDLAVSQAGNIFSVNAEDEAEARASIAD
                     INETLRLMVDSTVQSMAREKYLTLDGNQIDTVISLKNNALKLNGKTLQNEPDPDFDEG
                     DMVSGQPH"
     gene            complement(542108..543892)
                     /gene="lpdA"
                     /locus_tag="NGO_RS02845"
                     /old_locus_tag="NGO0562"
                     /old_locus_tag="NGO_0562"
     CDS             complement(542108..543892)
                     /gene="lpdA"
                     /locus_tag="NGO_RS02845"
                     /old_locus_tag="NGO0562"
                     /old_locus_tag="NGO_0562"
                     /EC_number="1.8.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019272436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoyl dehydrogenase"
                     /protein_id="WP_003700029.1"
                     /translation="MALVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKA
                     TMDVPAEVAGVIKEVKVKVGDKISEGGLIVVVEAEGAAAAPKAEAAAAPAQEAPKAAA
                     PAPQAAQFGGAADAEYDVVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGVCLNVG
                     CIPSKALLHNAAVIDEVRHLAANGIKYPKPELDIDMLRAYKDGVVSRLTGGLAGMAKS
                     RKVDVIQGDGQFLDPHHLEVSLTAGDAYEQAAPTGEKKIVAFKNCIIAAGSRVTKLPF
                     IPEDPRIIDSSGALALKEVPGKLLIIGGGIIGLEMGTVYSTLGSRLDVVEMMDGLMQG
                     ADRDLVKVWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVA
                     AGRAPNGKLISAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEG
                     HVAAENCAGHKAYFDARVIPGVAYTSPEVAWVGETELSAKASGRKITKANFPWAASGR
                     AIANGCDNGFTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAADIGKTIHP
                     HPTLGESIGMAAEVALGVCTDLPPQKKK"
     gene            complement(543910..544344)
                     /locus_tag="NGO_RS02850"
                     /old_locus_tag="NGO0563"
                     /old_locus_tag="NGO_0563"
     CDS             complement(543910..544344)
                     /locus_tag="NGO_RS02850"
                     /old_locus_tag="NGO0563"
                     /old_locus_tag="NGO_0563"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_029670159.1"
                     /translation="MSYLYRGISCQQDEQNNGQLKPKGNKAEVAIRYDGKFKYDGKAT
                     HGPSVKNAVYAHQIETDLYDGCYISTTTDKEIAKKFATSSGIENGYIYVLNRDLFGQY
                     SIFEYEVEHPENPDEKEVTIRAEDCGCIPEEVIIAKELIEIN"
     gene            complement(544445..546034)
                     /gene="aceF"
                     /locus_tag="NGO_RS02855"
                     /old_locus_tag="NGO0564"
                     /old_locus_tag="NGO_0564"
     CDS             complement(544445..546034)
                     /gene="aceF"
                     /locus_tag="NGO_RS02855"
                     /old_locus_tag="NGO0564"
                     /old_locus_tag="NGO_0564"
                     /EC_number="2.3.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003702824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoyllysine-residue acetyltransferase"
                     /protein_id="WP_010357738.1"
                     /translation="MSIVEIKVPDIGGHENVDIIAVEVKAGDTIAVDDTLITLETDKA
                     TMDVPADAAGVVKEVKVKVGDKISEGGVILTVETGAAAAEAAPAAAAEAQPAPAAAGG
                     ATVQVAVPDIGGHTDVDVIAVEIKVGDTVAEDDTLITLETDKATMDVPCTAAGVVKAV
                     FLKVGDKVSEGSAIIEVETAGSAAAAPAPAAQAAAPAAVPTSAAPAAVPTSASPAAAK
                     IDEAAFAKAHAGPSARKLARELGVDLGQVKGSGLKGRIMGDDIKAFVKSVMQGGAAKP
                     AAAGASLGGGLDLLPWPKVDFSKFGNVEVKELSRIKKISGQNLSRNWVVIPHVTVHEE
                     ADMTELEEFRKQLNKEWEREGVKLSPLAFIIKASVSALKAFPEFNASLDGDNLVLKNY
                     FNIGFAADTPNGLVVPVIKDVDQKGLKQISQELTELSKKAREGKLKPQEMQGACFTIS
                     SLGGIGGTGFTPIVNAPEVAILGVCKSQIKPVWNGKEFAPRLMCPLSLSFDHRVIDGA
                     AGMRFTVFLANLLKDFRRITL"
     gene            complement(546184..548847)
                     /gene="aceE"
                     /locus_tag="NGO_RS02860"
                     /old_locus_tag="NGO0565"
                     /old_locus_tag="NGO_0565"
     CDS             complement(546184..548847)
                     /gene="aceE"
                     /locus_tag="NGO_RS02860"
                     /old_locus_tag="NGO0565"
                     /old_locus_tag="NGO_0565"
                     /EC_number="1.2.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009173178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase (acetyl-transferring),
                     homodimeric type"
                     /protein_id="WP_003691347.1"
                     /translation="MSTQLHDVDPIETQEWLDALSSVLEYEGGERAQYLLENLLKYCR
                     DKGVRMPHGTTTPYLNTVSVENEKGIPGDQNIEHRIRAFVRWNAAAIVLRAGKKDLEL
                     GGHIASFQSAATMYEVGFNHFWKAKGEGEEGDLVFFQGHVAPGIYARAFVEGRLTEDQ
                     LNNFRQEVDGHGLPSYPHPHLLPDFWQFPTVSMGLGPIMAIYQARFLKYLESRGLAKT
                     KGRKVWCFCGDGEMDEPESQGAIALAAREGLDNLIFVINCNLQRLDGPVRGNGKIIQE
                     LEGNFAGAGWNVVKVIWGRRWDRLLAKDKDGILRQRMEECLDGDYQTYKSKDGAYVRE
                     HFFNTPELKALVADMTDEQLWALNRGGHDPQKVYNAYDRAANHADGKPTVILAKTIKG
                     YGMGASGEGQNVAHQAKKMDKASLKQFRDRFDIPVTDEQIESGDLPYLTFAPDTEEYK
                     YLHARRDALGGYLPQRKPTQEVLEVPELSAFDAQLKSSGEREFSTTMAFVRILSTLLK
                     DKKIGKRVVPIVPDESRTFGMEGMFRQYGIWNPKGQQYTPQDKDQLMFYKESVDGQIL
                     QEGINEPGAMADWIAAATSYANSDFAMIPFYIYYSMFGFQRIGDLAWAAGDMHARGFL
                     LGGTAGRTTLNGEGLQHEDGHSHIQADLIPNCVSYDPTFQYEVAVIVQDGLRRMYANN
                     EDVFYYITLMNENYTHPDMPEGAEQDILKGMYLLKAGGKGDKKVQLMGSGTILQEVIA
                     GAELLKADFGVEADIWSCPSFNLLHRDAIETERFNRLHPLEAEKVPFVTSQLQGHDGP
                     VIAATDYIRSYADRIRAYIPNDYHVLGTDGFGRSDSRANLRRFFEVDRYNVAVAALAA
                     LAEQGKVSKETVQQAIEKYGIKADSAPSWKR"
     gene            549544..551256
                     /locus_tag="NGO_RS02865"
                     /old_locus_tag="NGO0566"
                     /old_locus_tag="NGO_0566"
     CDS             549544..551256
                     /locus_tag="NGO_RS02865"
                     /old_locus_tag="NGO0566"
                     /old_locus_tag="NGO_0566"
                     /EC_number="6.1.1.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline--tRNA ligase"
                     /protein_id="WP_010951084.1"
                     /translation="MKASQFFISTLKEAPAEAAFASHKLMIRAGLIKANASGLYTWMP
                     MGLRVLRKVENVVREEMARAGSVELLMPVVQPAELWQESGRWEFYGKELLRLKDRHER
                     DFCMGPTCEEVIADIVRKEINSYKQLPKNFYHIQTKFRDEVRPRFGVMRAREFVMKDA
                     YSFHADYASLQATYDAMYDAHCRIFTRLGLAFRPVAADTGSIGGTGSHEFQVLAESGE
                     DVIAYSDTSDYAANIELAPTLPLKGERAAAQAVLTKVHTPNVKTIESLVEFLNIPVEQ
                     TLKSIVVEGENEGELVLLLLRGDHEFNDIKAEKLAGVKSPLTMASPAAIVEQFGANGG
                     SLGPVGFTGKVYADFATEKGADWVIGANEDDYHYTGFNFGRDAAEPEFVDLRNVVEGD
                     ESPDGQGRLKLARGIEVGHVFQLRGKYTQAMNVSFLDNNGKSQIMEMGCYGIGITRVV
                     AAAIEQNNDEKGIIWTKAMAPFEVVIVPMNYKKSDTVREAADRIYAELLAAGADVLLD
                     DRDERAGVLLNDSELLGIPHRIVIGDRALKEGNVEYAERRGNEAQAVAIGEIVARVTA
                     SLNA"
     gene            551319..551975
                     /locus_tag="NGO_RS02870"
                     /old_locus_tag="NGO0567"
                     /old_locus_tag="NGO_0567"
     CDS             551319..551975
                     /locus_tag="NGO_RS02870"
                     /old_locus_tag="NGO0567"
                     /old_locus_tag="NGO_0567"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002224485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase family protein"
                     /protein_id="WP_003688991.1"
                     /translation="MASVFLEGEAVEVGNIFCIGRNYAAHVEELKNEIPSEPVVFMKP
                     SGSILNSGGTILLPEFSRDVQFECELVLLIGRDSDGTGEGEDILGCVAGYGVGLDLTA
                     RDIQCRLKAQGLPWLKAKGFRHSACVSDFAAADRIGNQDKVLFSLKQNGVLKQRGETG
                     LMIYPIREILHKLAADYGLGKGDLVFTGTPSGVGAIGAGDNLALELDGLVCASFTIGC
                     "
     gene            complement(551985..552440)
                     /gene="ruvX"
                     /locus_tag="NGO_RS02875"
                     /old_locus_tag="NGO0568"
                     /old_locus_tag="NGO_0568"
     CDS             complement(551985..552440)
                     /gene="ruvX"
                     /locus_tag="NGO_RS02875"
                     /old_locus_tag="NGO0568"
                     /old_locus_tag="NGO_0568"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019272431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase RuvX"
                     /protein_id="WP_003706124.1"
                     /translation="MHKIPKGTALAFDFGEARIGVAQGDAELGLSHPLATVTGGSNDE
                     KFAAIAKLVQEWQPRYFVVGLPVHADGTEHEMTHLSRKFGRRLNGRFNLPVYWVDERL
                     SSVCAESLLSEAQVLGKKRKSVLDQVAAQAILHGFLEGGPAECFNGREG"
     gene            complement(552433..552981)
                     /locus_tag="NGO_RS02880"
                     /old_locus_tag="NGO0569"
                     /old_locus_tag="NGO_0569"
     CDS             complement(552433..552981)
                     /locus_tag="NGO_RS02880"
                     /old_locus_tag="NGO0569"
                     /old_locus_tag="NGO_0569"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003713629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YqgE/AlgH family protein"
                     /protein_id="WP_003688988.1"
                     /translation="MNLSNHFLVAMPDMEDAFFSQSVVYICKHDEDGALGIAINKPSP
                     ITMDMIFSATGKNIPMRMQHDSVMMGGPVQVERGYVVHTPIGNWQSSIGVSDGIALTS
                     SRDVLENISREGAVDKALISIGYSSWSKGQLERELADNAWLTVPADEHILFDIPYEHR
                     YAAAFAKLGIDPLALFSGAGHA"
     gene            complement(552983..553543)
                     /locus_tag="NGO_RS02885"
                     /old_locus_tag="NGO0570"
                     /old_locus_tag="NGO_0570"
     CDS             complement(552983..553543)
                     /locus_tag="NGO_RS02885"
                     /old_locus_tag="NGO0570"
                     /old_locus_tag="NGO_0570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003710122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CreA family protein"
                     /protein_id="WP_003691340.1"
                     /translation="MNRLLLLSAAVLPTACGSGETDKIGRASTVFNMLGKNDRIEVEG
                     FDDPDVQGVACYISYAKKGGLKEMVNLEEDASDASVSCVQTASSISFDETAVRKPKEV
                     FKRGTGFAFKSRQIVRYYDPKRKAFAYLVYSDKIVQGSPKNSLSAVSCFGSGIPQTDG
                     VQADTSGKLLAGACIISNPIKNPDKR"
     gene            553869..555665
                     /locus_tag="NGO_RS02890"
                     /old_locus_tag="NGO0571"
                     /old_locus_tag="NGO_0571"
     CDS             553869..555665
                     /locus_tag="NGO_RS02890"
                     /old_locus_tag="NGO0571"
                     /old_locus_tag="NGO_0571"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan DD-metalloendopeptidase family
                     protein"
                     /protein_id="WP_010951085.1"
                     /translation="MRYKPLLLALMLVFSTPAVAAHDAAHNRSAEVKKQAKNKKEQPE
                     AAEGKKEKGKNAAVKDKKTGGKEAAKEFKKTAKNRKEAEKEATSRQSARKGREGDKES
                     KAEHKKAHGKPVSGSKEKNAKTQPENKQGKKGAKGQGNPRKGGKAEKDTVSANKKARS
                     DKNGKAVKQDKKHTEEKNAKTDSDELKAAVAAATNDVENKKALLKQSEGMLLHVSNSL
                     KQLQEERIRQERIRQERIRQARGNLASVNRKQREAWDKFQKLNTELNRLKTEVAATKA
                     QISRFVSGNYKNSRPNAVALFLKNAEPGQKNRFLRYTRYVNASNREVVKDLEKQQKAL
                     AVQEQKINNELARLKKIQANVQSLLKKQGVTDAAEQTESRRQNAKISKDARKLLEQKG
                     NEQQLNKLLSNLEKKKAEHRIQDAEAKRKLAEAKLAAAEKARKEAAQQKAEARRAEMS
                     NLTAEDRNIQAPSVMGIGSADGFSRMQGRLKKPVDGVPTGLFGQNRSGGDVWKGVFYS
                     TAPATVESIAPGTVSYADELDGYGKVVVIDHGENYISIYAGLSEISAGKGYTVAAGSK
                     IGTSGSLPDGEEGLYLQIRYRGQVLNPSGWIR"
     gene            555792..557267
                     /locus_tag="NGO_RS02895"
                     /old_locus_tag="NGO0572"
                     /old_locus_tag="NGO_0572"
     CDS             555792..557267
                     /locus_tag="NGO_RS02895"
                     /old_locus_tag="NGO0572"
                     /old_locus_tag="NGO_0572"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003691337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S41 family peptidase"
                     /protein_id="WP_003688980.1"
                     /translation="MSKPVFKKIALYTLGAISGVAVSLAVQGFAAEKDGRDNEVLPVQ
                     SIRTMAEVYGQIKANYYHDKPDADLFEGAMKGMVAGLDPHSEYMDKKGYAEIKESTSG
                     EFGGLGMEIGQEDGFVKVVSPIEDTPAERAEVKSGDFIVKIDNVSTRGMTVSEAVKKM
                     RGKPGTKITLTLSRKNADKPIVVNLTRAIIKVKSVRHHLIEPDYGYIRVSQFQERTVE
                     SVNTAAKELVKENKGKPLKGLVLDLRDDPGGLLTGAVGVSAAFLPSEAVVVSTKGRDG
                     KDGMVLKAVPEDYVYGMGGDPLAGIPAELKTIPMTVLVNSGSASASEIVAGALQDHKR
                     AVIVGTQSFGKGSVQTLIPLSNGSAVKLTTALYYTPNDRSIQAQGIVPDVEVKDKERT
                     FESREADLVGHIGNPLGGEDVNSETLAVPLEKDADKPAAKEKGKKKKDEDLSSRRIPN
                     PAKDDQLRKALDLVKSPEQWQKSLGLAAKKPVSNKDKKDKK"
     gene            557597..559624
                     /gene="uvrB"
                     /locus_tag="NGO_RS02900"
                     /old_locus_tag="NGO0573"
                     /old_locus_tag="NGO_0573"
     CDS             557597..559624
                     /gene="uvrB"
                     /locus_tag="NGO_RS02900"
                     /old_locus_tag="NGO0573"
                     /old_locus_tag="NGO_0573"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002245989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit B"
                     /protein_id="WP_010951086.1"
                     /translation="MEVIRYPNSPFKLHQPFPPAGDQPTAIAGLIEGLSDGLAYQTLL
                     GVTGSGKTYTMANVIAQSGRPAIIMAHNKTLAAQLYAEMREFFPENAVEYFVSYYDYY
                     QPEAYVPSRDLFIEKDSAINEHIEQMRLSATKNLMTRDDVIIVATVSAIYGIGDPTEY
                     QQMVLSVKEGDTIEQRDIIATLVSMQYERGDLDFKRGSFRVRGDVIDVYPAESSENAL
                     RISLFDDEIDRLDMFDPLSGSLHQRVGRYTVFPSSHYVTPRDTVLRACESIKEELRER
                     IEFFAREQRPVEQQRIEQRTRFDLEMLYEMGFCKGIENYSRHFSGKKEGEPPPTLMDY
                     LPDNAIMFIDESHVTVTQIGGMYKGDASRKQNLVDYGFRLPSARDNRPLKFHEFEKVM
                     PQTVFVSATPAKYEEEHAGQVVEQVVRPTGLVDPQTIIRPVATQVDDLMSEINDRIQK
                     GERVLVTTLTKRMAEQLTDYYSELGIKVRYLHSDIDTVERVEIIRDLRLGLFDVLVGI
                     NLLREGLDIPEVSLVAILDADKEGFLRSHRSLIQTIGRAARNVNGVAILYADKITDSM
                     KAAVDETERRREKQIKFNEEHGIVPQQIKKQVKDIIDGVYHEEDSGKGRRQGKNKVKV
                     GEIHNEEDAIKEIAKLEKAMQQAARDLQFEEAAVLRDRISNIKENLLFGAE"
     gene            complement(559802..560560)
                     /locus_tag="NGO_RS02905"
                     /old_locus_tag="NGO0574"
                     /old_locus_tag="NGO_0574"
     CDS             complement(559802..560560)
                     /locus_tag="NGO_RS02905"
                     /old_locus_tag="NGO0574"
                     /old_locus_tag="NGO_0574"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase family protein"
                     /protein_id="WP_003688976.1"
                     /translation="MPRFPRTLPRLTAVLLLACTAFSAAAHGNHTHWGYTGHDSPESW
                     GNLSEEFRLCSTGKNQSPVNITETVSGKLPAIKVNYKPSMVDVENNGHTIQVNYPEGG
                     NTLTVNGRTYTLKQFHFHVPSENQIKGRTFPMEAHFVHLDENKQPLVLAVLYEAGKTN
                     GRLSSIWNVMPMTAGKVKLNQPFDASTLLPKRLKYYRFAGSLTTPPCTEGVSWLVLKT
                     YDHIDQAQAEKFTRAVGSENNRPVQPLNARVVIE"
     gene            complement(560969..561316)
                     /locus_tag="NGO_RS02910"
     CDS             complement(560969..561316)
                     /locus_tag="NGO_RS02910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010357745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010357745.1"
                     /translation="MTYLKVIAISIVLYILLLQINLKMLEKRIDFLVENIDKYYQQYG
                     SYPNNFDFISTKTDFTTESYCDFWDKNIAGYGNCYFVKNDKDYTILVMGFSSKILFSS
                     HNKIKEFNSNKYD"
     gene            complement(561640..562356)
                     /gene="trmB"
                     /locus_tag="NGO_RS02915"
                     /old_locus_tag="NGO0575"
                     /old_locus_tag="NGO_0575"
     CDS             complement(561640..562356)
                     /gene="trmB"
                     /locus_tag="NGO_RS02915"
                     /old_locus_tag="NGO0575"
                     /old_locus_tag="NGO_0575"
                     /EC_number="2.1.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002252596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanosine(46)-N7)-methyltransferase TrmB"
                     /protein_id="WP_003688973.1"
                     /translation="MTDTPENQTPNDLPAGHSRSIRSFVLRQSHMTAAQQRAIDTLWD
                     SFGIDYQATPADLDARFGSSRPKILEIGFGMGMASAEIARRLPETDFLAIDVHGPGVG
                     NLLKLINENHLENIRVMRHDAVEVVENMLQDGSLDGIHIFFPDPWHKKRHHKRRLIQA
                     PFIAKLLPKLKTGGYIHLATDWEEYAQQMLEVLSSFDNLQNTAADYAPTPDYRPETKF
                     EARGKRLGHGVWDLVFKRIG"
     gene            complement(562498..563564)
                     /locus_tag="NGO_RS02920"
                     /old_locus_tag="NGO_03050"
                     /pseudo
     CDS             complement(562498..563564)
                     /locus_tag="NGO_RS02920"
                     /old_locus_tag="NGO_03050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002247834.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="sel1 repeat family protein"
     gene            complement(564000..565886)
                     /gene="uvrC"
                     /locus_tag="NGO_RS02925"
                     /old_locus_tag="NGO0578"
                     /old_locus_tag="NGO_0578"
     CDS             complement(564000..565886)
                     /gene="uvrC"
                     /locus_tag="NGO_RS02925"
                     /old_locus_tag="NGO0578"
                     /old_locus_tag="NGO_0578"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002227258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit UvrC"
                     /protein_id="WP_003702813.1"
                     /translation="MPSEAVFQMIDMNTENRSPEQFDIPLFLKNLPKLPGVYRFFDEG
                     GNVLYVGKAVNLKRRVSGYFQKNDHSPRIALMVKQVRHIETTITRSEAEALILENNFI
                     KALSPKYNILFRDDKSYPYLMLSGHQYPQMAYYRGTLKNPNQYFGPYPNSNAVRDSIQ
                     VLQKVFMLRTCEDSVFEHRDRPCLLYQIKRCTAPCVGHISEEDYCDSVRQAATFLNGK
                     TDELTRTLQHKMQTAAANLQFEEAARYRDQIQALGIIQSNQFIDSKNPNNPNDIDLLA
                     LAVSDGLVCVHWVSIRGGRHVGDKSFFPDTKNDPEPNGQDYAEAFVAQHYLGKSKPDI
                     IISNFPVPDALKEALEGEHGKQMQFVTKTIGERKVWLKMAEQNAQMAITQRHLQQSNQ
                     QHRIDELAKILGMNSDGINRLECFDISHTQGEATIASCVVYDEQNIQPSQYRRYNITT
                     AKPGDDYAAMREVLTRRYGKIQEAEANGESVKWPDVVLIDGGKGQIGVAVSVWEELGL
                     HIPLVGIAKGPERKAGMEELILPFTGELFRLPPNSPALHLLQTVRDESHRFAITGHRK
                     KRDKARVTSSLGDIPGVGSKRRQALLTRFGGLRGVIAASREDLEKVEGISKALAETIY
                     NHLH"
     gene            complement(565941..568118)
                     /locus_tag="NGO_RS02930"
                     /old_locus_tag="NGO0579"
                     /old_locus_tag="NGO_0579"
     CDS             complement(565941..568118)
                     /locus_tag="NGO_RS02930"
                     /old_locus_tag="NGO0579"
                     /old_locus_tag="NGO_0579"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-translocating P-type ATPase"
                     /protein_id="WP_010951087.1"
                     /translation="MQQKIRFQIEGMTCQACASRIEKVLNKKDFVESAGVNFASEEAQ
                     VTFDGSKTSVADIAKIIEKTGYGAKEKTEDTLPQPEAEHHIGWRLWLLLTINIPFLIG
                     MVGMMLKGLNWTRHDWMIPPVWQFVLASIVQLWLAIPFYKSAWASIKGGLANMDVLVT
                     IGTVSIYLYSVYMLFFSSHAAHGMAHVYFEAGVMVIGFVSLGKFLEHRTKKSSLNSLG
                     LLLKLTPTQVNVQRNGEWKQLPIDQVQIGDLIRTNHGERIAADGIIESGSGWADESHL
                     TGESNPEEKKAGGKVLAGALMTEGSVVYRAAQLGSQTLLGDMMNALSEAQGSKAPIAR
                     VADKAAAVFVPTVVGIALLTFIVAWLIKGDWTVALMHAVAVLVIACPCALGLATPAAI
                     MVGMGKAVKHGIWFKDAAAMEEAAHVDAVVLDKTGTLTEGRPQVAAVYYVPDSGFDED
                     ALYRIAAAVEQNAAHPLARAIVSAAQARGLEIPAAQNAQTVVGAGITAEVEGVGLVKS
                     GKAEFAELTLPKFSDGVWEIASAVTVSVNGKPIGAFALSDALKADTAEAIGRLKKHNI
                     DVYIMSGDNQSTVEYVAKQLGIAHAFGNMSPCDKAAEVQKLKAAGKTVAMVGDGINDA
                     PALAAANVSFAMKGGADVAEHTASATLMQHSVNQLADALLISQATLENIKQNLFFAFF
                     YNILGIPLAALGFLNPVIAGAAMAASSVSVLGNALRLKWVKID"
     gene            568257..569207
                     /gene="trxB"
                     /locus_tag="NGO_RS02935"
                     /old_locus_tag="NGO0580"
                     /old_locus_tag="NGO_0580"
     CDS             568257..569207
                     /gene="trxB"
                     /locus_tag="NGO_RS02935"
                     /old_locus_tag="NGO0580"
                     /old_locus_tag="NGO_0580"
                     /EC_number="1.8.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin-disulfide reductase"
                     /protein_id="WP_003688968.1"
                     /translation="MSQHRKLIILGSGPAGYTAAVYAARANLNPVIITGIAQGGQLMT
                     TTEVDNWPADADGVQGPELMARFLAHAERFGTEIIFDQINAVDLQKRPFALKGDMGEY
                     TCDALIVATGASAKYLGLPSEEAFAGKGVSACATCDGFFYKNQDVAVVGGGNTAVEEA
                     LYLANIAKTVTLIHRRSEFRAEKIMIDKLMKRVEEGKIILKLESNLQEVLGDDRGVNG
                     ALLKNNDGSDQQIAVSGIFIAIGHKPNTDIFKGQLEMDEAGYLKTKGGTADNVGATNI
                     EGVWAAGDVKDHTYRQAITSAASGCQAALDAERWLGSQNI"
     gene            569363..569731
                     /gene="rpsF"
                     /locus_tag="NGO_RS02940"
                     /old_locus_tag="NGO0581"
                     /old_locus_tag="NGO_0581"
     CDS             569363..569731
                     /gene="rpsF"
                     /locus_tag="NGO_RS02940"
                     /old_locus_tag="NGO0581"
                     /old_locus_tag="NGO_0581"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002223699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="WP_003688967.1"
                     /translation="MRHYEIVFIVHPDQSEQVPAMVERYKTMITEANGKIHRLEDWGR
                     RQLAYPINKIHKAHYVLMNIETTPEVVGELETAFRFNDAVLRHLTIKTKHAVTEASPM
                     LGGEKAKNLLVGAAEEAAAQ"
     gene            569732..570034
                     /gene="priB"
                     /locus_tag="NGO_RS02945"
                     /old_locus_tag="NGO0582"
                     /old_locus_tag="NGO_0582"
     CDS             569732..570034
                     /gene="priB"
                     /locus_tag="NGO_RS02945"
                     /old_locus_tag="NGO0582"
                     /old_locus_tag="NGO_0582"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003678153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal replication protein N"
                     /protein_id="WP_003692950.1"
                     /translation="MGFTNLVSLAALIEKAFPIRYTPAGIPVLDIILKHESWQEENGQ
                     QCLVQLEIPARILGRQAEEWQYRQGDCATVEGFLAQKSRRSLMPMLRIQNIKEYKG"
     gene            570041..570271
                     /gene="rpsR"
                     /locus_tag="NGO_RS02950"
                     /old_locus_tag="NGO0583"
                     /old_locus_tag="NGO_0583"
     CDS             570041..570271
                     /gene="rpsR"
                     /locus_tag="NGO_RS02950"
                     /old_locus_tag="NGO0583"
                     /old_locus_tag="NGO_0583"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009120066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="WP_002213306.1"
                     /translation="MARQSFKRRKFCRFTAEKIQEVDYKQVDLLKDFISENGKIIPAR
                     ITGTKAFYQRQLAVAVKRARFLALLPYTDQHK"
     gene            570288..570740
                     /locus_tag="NGO_RS02955"
                     /old_locus_tag="NGO0584"
                     /old_locus_tag="NGO_0584"
     CDS             570288..570740
                     /locus_tag="NGO_RS02955"
                     /old_locus_tag="NGO0584"
                     /old_locus_tag="NGO_0584"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003743490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="WP_002232586.1"
                     /translation="MQIILLEKIGGLGNLGDIVTVKNGYARNFLIPAGKAKRATEANM
                     KEFEARRAELEAKQAEILADARARQEKLDGQTVTVAQKAGVDGRLFGSVTNADIAAAI
                     VAAGIEAVKANVRLPNGPLKAVGEYEVEVALHTDAVAKITVAVIAAAE"
     gene            complement(571363..572169)
                     /locus_tag="NGO_RS02960"
                     /old_locus_tag="NGO0585"
                     /old_locus_tag="NGO_0585"
     CDS             complement(571363..572169)
                     /locus_tag="NGO_RS02960"
                     /old_locus_tag="NGO0585"
                     /old_locus_tag="NGO_0585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003691331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite exporter TauE/SafE family protein"
                     /protein_id="WP_003688964.1"
                     /translation="MWHWDIILILLAVGSAAGFIAGLFGVGGGTLIVPVVLWVLDLQG
                     LAQHPYAQHLAVGTSFAVMVFTAFSSMLGQHKKQAVDWKTIFAMMPGMIFGVFAGALS
                     AKYIPAFGLQIFFILFLTAVAFKTLHTGRQTASRPLPGLPGLTAVSTLFGAMSSWVGI
                     GGGSLSVPFLIHCGFPAHKAIGTSSGLAWPIALSGAISYLVNGLNIAGLPEGSLGFLY
                     LPAVAVLSAATIAFAPLGVKTAHKLSSAKLKESFGIMLLLIAGKMLYNLL"
     gene            complement(572170..572916)
                     /gene="pssA"
                     /locus_tag="NGO_RS02965"
                     /old_locus_tag="NGO0586"
                     /old_locus_tag="NGO_0586"
     CDS             complement(572170..572916)
                     /gene="pssA"
                     /locus_tag="NGO_RS02965"
                     /old_locus_tag="NGO0586"
                     /old_locus_tag="NGO_0586"
                     /EC_number="2.7.8.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002251375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--serine
                     O-phosphatidyltransferase"
                     /protein_id="WP_002213318.1"
                     /translation="METPTNTPQRSLRQNSIYLLPNSFTIAALFSAFYAITQSMHGRY
                     ETAAIAVFISMLLDGMDGRVARLTNSQSAFGEQLDSLADMVSFGVAPALIAYKWQLWQ
                     FGKIGYSVAFIYCACAALRLALFNTLIGKVDKRWFIGVPSPTAAALIVGLIWVNHSVE
                     KFPAVHWWALGITLFAGLSMIVQIPFWSFKEINIRRQVPFVGMLLAVLLLLLVTWEPS
                     LVLFLFFLGYSLSGYIMAARRFWKKYRKAD"
     gene            573500..573982
                     /locus_tag="NGO_RS02970"
                     /old_locus_tag="NGO0588"
                     /old_locus_tag="NGO_0588"
     CDS             573500..573982
                     /locus_tag="NGO_RS02970"
                     /old_locus_tag="NGO0588"
                     /old_locus_tag="NGO_0588"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4189 domain-containing protein"
                     /protein_id="WP_003691328.1"
                     /translation="MMKKILAVSALCLMTAAAQAADTYGYLAVWQNPQDANDVLQVKT
                     TKEDSAKSEAFAELEAFCKGQDTLAGIAEDEPTGCRSVVSLNNTCVSLAYPKALGAMR
                     VENAVVITSPRFTSVHQVALNQCIKKYGAQGQCGLETVYCTSSSYYGGAVRSLIQHLK
                     "
     gene            complement(574029..575240)
                     /locus_tag="NGO_RS02975"
                     /old_locus_tag="NGO0589"
                     /old_locus_tag="NGO_0589"
     CDS             complement(574029..575240)
                     /locus_tag="NGO_RS02975"
                     /old_locus_tag="NGO0589"
                     /old_locus_tag="NGO_0589"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-xanthine permease"
                     /protein_id="WP_003688961.1"
                     /translation="MNQLKLAVSGAQILFVAFGAMVLVPLLTGLNPALALLGAGLGTL
                     LFQITTKRKVPIFLGSSFAFIAPIIYSVGEWGLPSTMFGLFAAGFMYFVFAALIRWRG
                     LAAVHKLLPPVVTGPVIMVIGLSVAVAASSMAMGQADGKQVIDYTDSLILSGFTFAVT
                     AIVSVFGSRMMKLIPILIGVASGYVLALLMGLVDTTSIAHAPWFAVPHFETPQVNWQA
                     ALFMLPVAVAPAIEHIGGIMAIGNVTGKDYTKDPGLDKTLAGDGLGVCVAGLIGGPPV
                     TTYGEVTGAVMITKNSNPVIMTWAAVFAVCMAFFGKFNAFLASIPMPVMGGIMLLLFG
                     TIASLGIKTLIDAKVDLMLPKNLVIVSSVLTTGIGGMTLKLGSFSFVGVGLCAVLAIV
                     LNSLLPDPKES"
     gene            575462..577900
                     /locus_tag="NGO_RS02980"
                     /old_locus_tag="NGO0590"
                     /old_locus_tag="NGO_0590"
     CDS             575462..577900
                     /locus_tag="NGO_RS02980"
                     /old_locus_tag="NGO0590"
                     /old_locus_tag="NGO_0590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019270134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA translocase FtsK"
                     /protein_id="WP_003691325.1"
                     /translation="MTEKSHKKTAKGRAGSPSPTSARNKKADNGARGNKVSERLKAVK
                     ELQKTEAKKARPEHVVNLIADALWLMGLAATLYLAISLISFDMGDPSWSHSSPVVEDA
                     ANWGGLFGAYVADVGYYLFGWSFWWWIAAACVVLYKNFRLHAKQTENEAYNHKIAAAA
                     LFVLTVFSPVLEYFVLGGKYADSLPVGAGGMVGIRVGAVFAWLLGKSGSLLIILVVLL
                     LSLSLLVQISWLEFLNGAGRAVQNRLSALSGKVMALRKRRPNTKTDGVDTQNTRRMVK
                     EAKNITAKPVALPEGSSSNRKSVAVSVAPPPKIQPSLFEDNEVQQNGEYHKPTLNLLR
                     IPDSEPVSINPAELERTAELIESKLAEFGIGVQVVSATSGPVITRYEIEPAQGVKGSQ
                     IVALSKDLARSMSLQSVRIVETIAGKNTMGIELPNDKRQDVMLSEILSSPVFAEAKSK
                     LTVALGKDIAGTPVVGDLAKMPHLLVAGMTGSGKSVGVNGMIMSMLFKATPEEVRFIM
                     IDPKMLELSIYDGIPHLLCPVVTDMREAGQALNWCVAEMEKRYRLLSHAGVRNLEGFN
                     QKVEQAKAAGKPLLNPFSLNLDEPEPLEKLPMIVVVIDELADLMMTERKAVEQQIARL
                     AQKARAAGIHMIVATQRPSVDVVTGLIKANIPTRMAFTVQSKIDSRTILDQMGADELL
                     KYGDSLFLQPGSAEPTRLQGTFVSDGEVHQVVNYVKSQAPADYIEGLLSGEAALETAN
                     IVNPNADSDELFDQAVAYVLESKKTSISSLQRQLRIGYNRAANLMEALENAGIVSPSD
                     LNGSRKILAHKDHL"
     gene            complement(578101..578550)
                     /locus_tag="NGO_RS02985"
                     /old_locus_tag="NGO0590a"
                     /old_locus_tag="NGO_03125"
     CDS             complement(578101..578550)
                     /locus_tag="NGO_RS02985"
                     /old_locus_tag="NGO0590a"
                     /old_locus_tag="NGO_03125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_030003511.1"
                     /translation="MSTFFRQTAQAMTAKHIGRFPLSELDQVIDWQPIEQYLIRQKTR
                     YLRDRRGRPAHPLSSMFKAVLPGQWHSLSDPELEHSLITRIGFNLFCRFDGPGIPGCS
                     TLCRYRKFRYARAAYFGLLKVGVQSHLKAMCLNLLKAANRLSAPAAA"
     gene            578775..580085
                     /locus_tag="NGO_RS02990"
                     /old_locus_tag="NGO0592"
                     /old_locus_tag="NGO_0592"
     CDS             578775..580085
                     /locus_tag="NGO_RS02990"
                     /old_locus_tag="NGO0592"
                     /old_locus_tag="NGO_0592"
                     /EC_number="5.2.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003742150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="WP_025456469.1"
                     /translation="MSVTVEILENLERKVVLSLPWSEINAETDKKLKQTQRRAKIDGF
                     RPGKAPLKMIAQMYGASAQNDVINELVQRRFYDVAVAQELKVAGYPRFEGVEEQDDKE
                     SFKVAAIFEVFPEVVIGDLSAQEVEKVTASVGDAEVDQTVEILRKQRTRFNHVDREAR
                     NGDRVIIDFEGKIDGEPFAGGTSKNYAFVLGAGQMLPEFEAGVVGMKAGESKDVTVNF
                     PEEYHGKDVAGKTAVFTITLNNVSEPTLPEVDADFAKALGIADGDVAKMREEVKKNVS
                     REVERRVNEQTKESVMNALIKAVELKVPVALVNEEAARLANEMKQNFVNQGMTDAANL
                     DLPLDMFKEQAERRVSLGLILAKLVDENKLEPTEGQIKAVVANFAESYEDPQEVIDWY
                     YADTSRLQAPTSLAVESNVVDFVLGKAKVNKKALSFDEVMGAQA"
     gene            580181..580795
                     /gene="clpP"
                     /locus_tag="NGO_RS02995"
                     /old_locus_tag="NGO0593"
                     /old_locus_tag="NGO_0593"
     CDS             580181..580795
                     /gene="clpP"
                     /locus_tag="NGO_RS02995"
                     /old_locus_tag="NGO0593"
                     /old_locus_tag="NGO_0593"
                     /EC_number="3.4.21.92"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003713157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp endopeptidase proteolytic
                     subunit ClpP"
                     /protein_id="WP_003688955.1"
                     /translation="MSFDNHLVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDES
                     ANLVVAQLLFLESENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAAS
                     MGAFLLSAGEKGKRFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKLNRLM
                     AKHCGRDLADLERDTDRDNFMSAEEAKEYGLIDQVLENRASLRL"
     gene            complement(580849..582114)
                     /gene="ispG"
                     /locus_tag="NGO_RS03000"
                     /old_locus_tag="NGO0594"
                     /old_locus_tag="NGO_0594"
                     /gene_synonym="gcpE"
     CDS             complement(580849..582114)
                     /gene="ispG"
                     /locus_tag="NGO_RS03000"
                     /old_locus_tag="NGO0594"
                     /old_locus_tag="NGO_0594"
                     /gene_synonym="gcpE"
                     /EC_number="1.17.7.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014575413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin-dependent
                     (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase"
                     /protein_id="WP_003688953.1"
                     /translation="MNTLQRRKTHQVLIDHITVGSEAPVVIQSMTNTDTADAKATALQ
                     IKELSDAGSEMVRITVNSPEAASKVAEIRRRLDDMGYATPLIGDFHFNGERLLAEFPE
                     CGKALSKYRINPGNVGKGVKGDEKFAFMIRTAAENDKAVRIGVNWGSLDQSLAKRMMD
                     ANLVSSAPKPPEEVMKEALIVSALESAEKAVLLGLPEDKIILSCKVSAVHDLIQVYRE
                     LGSRCVYPLHLGLTEAGMGSKGIVASTAALSVLLQEGIGDTIRISLTPEPGSPRTQEV
                     VVGQEILQTMGLRSFTPMVTACPGCGRTTSTVFQELAQDVQNYLRQKMSIWRTLYPGV
                     ESLNVAVMGCVVNGPGESKLADIGISLPGTGETPVAPVYVDGERKVTLKGNNIASEFL
                     AIVEEYVKTNYGKNSSKRNKGKVIPIQSL"
     gene            complement(582130..582891)
                     /gene="pilW"
                     /locus_tag="NGO_RS03005"
                     /old_locus_tag="NGO0595"
                     /old_locus_tag="NGO_0595"
     CDS             complement(582130..582891)
                     /gene="pilW"
                     /locus_tag="NGO_RS03005"
                     /old_locus_tag="NGO0595"
                     /old_locus_tag="NGO_0595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus biogenesis/stability protein PilW"
                     /protein_id="WP_003688950.1"
                     /translation="MPFKPSKRISLLLVLALGACSTSYRPSRAEKANQVSNIKTQLAM
                     EYMRGQDYRQATASIEDALKSNPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPD
                     SAEINNNYGWFLCGRLNRPAESMAYFDKALADPTYPTPYIANLNKGICSAKQGQFGLA
                     EAYLKRSLAAQPQFPPAFKELARTKMLAGQLGDADYYFKKYQSRVEVLQADDLLLGWK
                     IAKALGNVQAAYEYEAQLQANFPYSEELQTVLTGQ"
     gene            complement(582894..583988)
                     /gene="rlmN"
                     /locus_tag="NGO_RS03010"
                     /old_locus_tag="NGO0596"
                     /old_locus_tag="NGO_0596"
     CDS             complement(582894..583988)
                     /gene="rlmN"
                     /locus_tag="NGO_RS03010"
                     /old_locus_tag="NGO0596"
                     /old_locus_tag="NGO_0596"
                     /EC_number="2.1.1.192"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA (adenine(2503)-C(2))-methyltransferase
                     RlmN"
                     /protein_id="WP_003688948.1"
                     /translation="MKTNLLNYDLQGLTRHFADMGEKPFRAKQVMRWMHQSGAQNFDE
                     MTDLAKSLRHKLNEQASIEIPKLMMSQESSDGTRKWLLDVGTGNGVETVFIPESDRGT
                     LCISSQVGCALECTFCSTGRQGFNRNLTAAEIIGQLWWANKAMGVTPKNERVISNVVM
                     MGMGEPMANFDNVVTALSIMLDDHGYGLSRRRVTVSTSGMVPQMDRLRDVMPVALAVS
                     LHASNDEVRNQIVPLNKKYPLKELMAACQRYLVKAPRDFITFEYVMLDGVNDKAQHAY
                     ELIELVKDVPCKFNLIPFNPFPNSGYERSSNENIRIFRDILQQAEFVVTVRKTRGDDI
                     DAACGQLAGQVQDKTRRQQKWQQILIGQQG"
     gene            complement(584132..584557)
                     /gene="ndk"
                     /locus_tag="NGO_RS03015"
                     /old_locus_tag="NGO0597"
                     /old_locus_tag="NGO_0597"
     CDS             complement(584132..584557)
                     /gene="ndk"
                     /locus_tag="NGO_RS03015"
                     /old_locus_tag="NGO0597"
                     /old_locus_tag="NGO_0597"
                     /EC_number="2.7.4.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate kinase"
                     /protein_id="WP_003688947.1"
                     /translation="MAIERTISIIKPDAVGKNVIGKIYSRFEENGLKIVAAKMKQLTL
                     KEAQEFYAVHKDRPFYAGLVEFMTGGPVMIQVLEGENAVLKNRELMGATNPTEAAEGT
                     IRADFATSVSINAVHGSDSVENAALEIAYFFSQTEICPR"
     gene            complement(584616..585767)
                     /locus_tag="NGO_RS03020"
                     /old_locus_tag="NGO0598"
                     /old_locus_tag="NGO_0598"
     CDS             complement(584616..585767)
                     /locus_tag="NGO_RS03020"
                     /old_locus_tag="NGO0598"
                     /old_locus_tag="NGO_0598"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015815648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapE"
                     /protein_id="WP_003688944.1"
                     /translation="MNNRDQLFKAPPFENHSPLTWYQAASQLPNFIRDDAQAAAIEHL
                     DRLWTELMMFKRKRNRFLGRSLRSPQVPKGLYFYGGVGRGKSFLMDAFFGCLPYRRKR
                     RVHFHAFMAEIHRRLKALKSESNPLKSVAAEITKETRVLCFDEFHVSDIADAMILGRL
                     LENLLNEGVVLVATSNYAPSELYPQGQNRSGFLPTIALIESSLTVLNVDGGEDYRLRT
                     LRPAEIFFTPANEENEAKLAKLFKEMTGITDLNPGISTIHGREIPHKAESGRTIWFDF
                     RALCFSPRSQSDYLYLAEHYEMVFISGLEQLSPQEKAEARRLTWLIDVLYDFRVKLCA
                     TGAVDVNHIYTEGDFAEEFTRTASRMVEMQSEVYLEQPHLTLSPKASGG"
     gene            complement(586297..587124)
                     /gene="fghA"
                     /locus_tag="NGO_RS03025"
                     /old_locus_tag="NGO0600"
                     /old_locus_tag="NGO_0600"
     CDS             complement(586297..587124)
                     /gene="fghA"
                     /locus_tag="NGO_RS03025"
                     /old_locus_tag="NGO0600"
                     /old_locus_tag="NGO_0600"
                     /EC_number="3.1.2.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011961786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-formylglutathione hydrolase"
                     /protein_id="WP_003688942.1"
                     /translation="MKLIEQHQIFGGSQQVWAHHAQTLQCEMKFAVYLPDNPENQPLG
                     VIYWLSGLTCTEQNFITKSSFRRYAAEHQVVVVAPDTGPRGEQVPNGAAYDLGQGAGF
                     YLNATEQPWAANYQMYDYILNELPRLIEEHFPTNGKRSIMGHSMDGHGALVLALRNRE
                     HYQSVSAFSPILSPSLVPWGEKAFTAYLGKDREKWQQYDANSLIQQGYKVQGMRIDQG
                     LEDEFLPTQLRTKDFIETCRAANQPIDVRFHKGYDHSYYFIASFIGEHIAYHAAFLK"
     gene            complement(587133..588270)
                     /locus_tag="NGO_RS03030"
                     /old_locus_tag="NGO_03170"
                     /pseudo
     CDS             complement(587133..588270)
                     /locus_tag="NGO_RS03030"
                     /old_locus_tag="NGO_03170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012054862.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="S-(hydroxymethyl)glutathione dehydrogenase/class
                     III alcohol dehydrogenase"
     gene            588393..588800
                     /locus_tag="NGO_RS03035"
                     /old_locus_tag="NGO0602"
                     /old_locus_tag="NGO_0602"
     CDS             588393..588800
                     /locus_tag="NGO_RS03035"
                     /old_locus_tag="NGO0602"
                     /old_locus_tag="NGO_0602"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003752636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_003688937.1"
                     /translation="MTYTTAKAAEKIGISAHTLRFYDKEGLLPNIGRDEYGNRCFTDN
                     DLQWLYLLQCLKNTGMSLKDIKRFAECTVIGDDTIEERLSLFENQIENVKCQIAELKR
                     YLDLLEYKLAFYQKAKALGSVKAVNLPQIPETA"
     gene            complement(588996..589310)
                     /locus_tag="NGO_RS03040"
                     /old_locus_tag="NGO0603"
                     /old_locus_tag="NGO_0603"
     CDS             complement(588996..589310)
                     /locus_tag="NGO_RS03040"
                     /old_locus_tag="NGO0603"
                     /old_locus_tag="NGO_0603"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003744632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integration host factor subunit beta"
                     /protein_id="WP_002213349.1"
                     /translation="MTKSELMVRLAEVFAAKNGTHLLAKDVEYSVKVLVDTMTRSLAR
                     GQRIEIRGFGSFDLNHRPARIGRNPKTGERVEVPEKHVPHFKPGKELRERVDLALKEN
                     AN"
     gene            complement(589321..591006)
                     /gene="rpsA"
                     /locus_tag="NGO_RS03045"
                     /old_locus_tag="NGO0604"
                     /old_locus_tag="NGO_0604"
     CDS             complement(589321..591006)
                     /gene="rpsA"
                     /locus_tag="NGO_RS03045"
                     /old_locus_tag="NGO0604"
                     /old_locus_tag="NGO_0604"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009173289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="WP_003691321.1"
                     /translation="MSMENFAQLLEESFTLQEMNPGEVITAEVVAIDQNFVTVNAGLK
                     SESLIDVAEFKNAQGEIEVKVGDFVTVTIESVENGFGETKLSREKAKRAADWIALEEA
                     MENGNILSGIINGKVKGGLTVMISSIRAFLPGSLVDVRPVKDTSHFEGKEIEFKVIKL
                     DKKRNNVVVSRRAVLEATLGEERKALLENLQEGSVIKGIVKNITDYGAFVDLGGIDGL
                     LHITDLAWRRVKHPSEVLEVGQEVEAKVLKFDQEKQRVSLGMKQLGEDPWSGLTRRYP
                     QATRLFGKVSNLTDYGAFVEIEQGIEGLVHVSEMDWTNKNVHPSKVVQLGDEVEVMIL
                     EIDEGRRRISLGMKQCQANPWEEFAANHNKGDKISGAVKSITDFGVFVGLPGGIDGLV
                     HLSDLSWTESGEEAVRKYKKGEEVEAVVLAIDVEKERISLGIKQLEGDPFGNFISVND
                     KGSLVKGSVKSVDAKGAVIALSDEVEGYLPASEFAADRVEDLTTKLKEGDEVEAVIVT
                     VDRKNRSIKLSVKAKDAKESREALNSVNAAANANAGTTSLGDLLKAKLSGEQE"
     gene            complement(591159..591815)
                     /locus_tag="NGO_RS03050"
                     /old_locus_tag="NGO0605"
                     /old_locus_tag="NGO_0605"
     CDS             complement(591159..591815)
                     /locus_tag="NGO_RS03050"
                     /old_locus_tag="NGO0605"
                     /old_locus_tag="NGO_0605"
                     /EC_number="2.7.4.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013448998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(d)CMP kinase"
                     /protein_id="WP_003688932.1"
                     /translation="MNRQKVIAIDGPGASGKGTVAARVAAALGYDYLDTGALYRLTAL
                     YAQKQGVEWHDEENVSALAKKLPAVFSGNRILLDGEDVSDGIRTEAIGMGASAVAQWP
                     KVRAALLQRQRDFLTEKGLVADGRDTGSVVFPQAELKIFLTAESKIRAERRAKQIGIP
                     CEGFTFERILSDIETRDEADRNRKVAPLKQQPDALLLDTSRLTIEETVKKVLDWYRKV
                     "
     gene            complement(592048..593418)
                     /locus_tag="NGO_RS03055"
                     /old_locus_tag="NGO0606"
                     /old_locus_tag="NGO_0606"
     CDS             complement(592048..593418)
                     /locus_tag="NGO_RS03055"
                     /old_locus_tag="NGO0606"
                     /old_locus_tag="NGO_0606"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium-dependent transporter"
                     /protein_id="WP_003692969.1"
                     /translation="MSSPSNTNRQTWSSRLTYILTVAGATVGFGATWRFPYLVGENGG
                     GAYVFLFCIAMLVIGIPMILVENVIGRRKGVNALDAFGGPMNGKPVAKIWKLVGRMGL
                     LGAFGIMAYYMVLGGWVISYIVNIIGGNLNISSPVDGVVTKGFFTEHIENSPWEIASY
                     TLLFVAVNQWILVKGVIGGIEKTAKYLMPLLFLFLIAMVVRNVTLPGAMEGVAFYLKP
                     DFSKITAELFVFVLGQVFFALSLGFGVMITLSSYLDKNENLVQTAVITAITNTIIAVL
                     AGFMIFPSLFSFGVAPNSGPTLVFQSLPIVFSHMWAGPVFAVIFFSLLLIAALTTSLT
                     IYEVLITTIQEKTKIRRTAAITIVLSVIFVFGNIPSILSYGPWKDVSVFGKNIFDAFD
                     YISGNILFMLTALGSALFVGFVMKDEAKEELLYKGNHTTVNIWFAYVKYLVPLVILLI
                     FVSNLF"
     gene            complement(593892..594584)
                     /locus_tag="NGO_RS03060"
                     /old_locus_tag="NGO0607"
                     /old_locus_tag="NGO_0607"
     CDS             complement(593892..594584)
                     /locus_tag="NGO_RS03060"
                     /old_locus_tag="NGO0607"
                     /old_locus_tag="NGO_0607"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002220881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="WP_003688930.1"
                     /translation="MKLIKYLQYQGIGSRKQCQWLIRGGYVSINGTCMDDTDADIDSS
                     YVETLDIDGEAVTVVPEPYFYILLNKPEDYETSHKPKHYRSVFSLFPDNMRNIDMQAV
                     GRLDADTTGVLLITNDGKLNHNLTSPSRKIPKLYEVTLKHPTGETLCETLKNGVPLHD
                     ENETVCAADAVLENPTTLLLTITEGKYHQVKRMVAAAGNRVQHLHRRRFAHLETENLK
                     PGEWKFIECPKF"
     gene            complement(594652..596628)
                     /locus_tag="NGO_RS03065"
                     /old_locus_tag="NGO0608"
                     /old_locus_tag="NGO_0608"
     CDS             complement(594652..596628)
                     /locus_tag="NGO_RS03065"
                     /old_locus_tag="NGO0608"
                     /old_locus_tag="NGO_0608"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013448995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysM peptidoglycan-binding domain-containing
                     protein"
                     /protein_id="WP_003706149.1"
                     /translation="MSKLKTIALTASGLSVCPGFLYAQNTSSHQVGLAIMRLNSSILD
                     LPPTKQYFQSGSLWDELRQGFRMGEVNPELVRRHESKFIASRSYFDRVVNRSRPYMYH
                     IANEVKKRNMPAEAALLPFIESAFVTKAKSHVGASGLWQFMPATGRHYGLEKTPVYDG
                     RHDVYAATDAALNYLQYLYGLFGDWPLAFAAYNWGEGNVGRAVNRARDQGLEPTYENL
                     RMPNETRNYVPKLLAVRNIIATPQSFGMNISDIDNKPYFQAVEPGRPLDNEAIARLAG
                     ITQSELLALNPAFNVPAFIPKNKRKLLLPVASVQTFQSNYLNAAPDSLFSWEVYTPAA
                     KTSLSDISTATGMSIADIKRLNNLNGNLVNAGRSILVAKNGKTLHTASESVVSIDIDN
                     TPDTYRSNMPAGTVNVSIARIQPAAAQTADITVAPLPQETVRTEPDPLVRITEPALAT
                     AAAQPQTEKQTAMPSETQTATLAQVIPPNDMQAADELMQLVARNNLRRQAEETISAVI
                     GTPDTVAEHNISSSPQHTVAADGKRRARLETRVAKAADGEAETSPLHASIHRVVEGDT
                     LFNIAKRYNVSVADLIVANNIKGNTIQKGQVLRLAQAAPAQTRIEKVSYTARKGDTFK
                     SIAARFNIHIDDIRRLNPNLNTINPGQRVKLIGS"
     gene            596807..597472
                     /locus_tag="NGO_RS03070"
                     /old_locus_tag="NGO0609"
                     /old_locus_tag="NGO_0609"
     CDS             596807..597472
                     /locus_tag="NGO_RS03070"
                     /old_locus_tag="NGO0609"
                     /old_locus_tag="NGO_0609"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013448994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase domain-containing protein"
                     /protein_id="WP_003688928.1"
                     /translation="MDAWFEDTAMGRYVAKLEQDFFNRYVASYRFSGMCAVQVGGQWL
                     SLSEDIVCVPRDMSMSAENMALADVFADMLLLPHTLECGVPSQILSEAHRILKPSGRL
                     MLTGFNPYSLWGFCRWFDGVRLPEKRFCLPLPELKRQLADAGFDIEFGKFMVYLPPVS
                     SLGQIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAWDGYWGGKALAAGAAR
                     VAD"
     gene            597525..598352
                     /gene="mutM"
                     /locus_tag="NGO_RS03075"
                     /old_locus_tag="NGO0610"
                     /old_locus_tag="NGO_0610"
     CDS             597525..598352
                     /gene="mutM"
                     /locus_tag="NGO_RS03075"
                     /old_locus_tag="NGO0610"
                     /old_locus_tag="NGO_0610"
                     /EC_number="3.2.2.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002255798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-formamidopyrimidine glycosylase"
                     /protein_id="WP_003688927.1"
                     /translation="MPELPEVETTLRGIAPHIEGKTVEAVILRQLKLRWQINPDLGEI
                     LSGRQVLSCGRRAKYLIVRFQTGILLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVF
                     SDGTVMRYRDPRKFGAILWYEGIEERHPLLEKLGPEPLSEAFCTDYLYAGLKAQKRAV
                     KLALMDNTVVVGVGNIYANESLFRAGISPHRPANRLKKKECAVLVETVKAVLQRAIET
                     GGSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCLRCGGLVVKETLGQRGTFYCTNCQK"
     gene            598440..599207
                     /locus_tag="NGO_RS03080"
                     /old_locus_tag="NGO0611"
                     /old_locus_tag="NGO_0611"
     CDS             598440..599207
                     /locus_tag="NGO_RS03080"
                     /old_locus_tag="NGO0611"
                     /old_locus_tag="NGO_0611"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_003688926.1"
                     /translation="MSSNKASFFTRLRRLCRLTVWLFKTGKNLRGIDGGCPKSRNRAV
                     IALGKGALAALDIGLEVGRPAPEHPNGVLVAANHVSWLDIFAMSAVYPSSFIAKQEIK
                     SWPVLGKMGQNAGTVFINRNSRRDIEPINRAVCETLQRGQNVSFFPEARTSSGLGLLP
                     FKAALFQSAIDAGAKVLAVALRYYDETGKRTARPSYADVGLPTCLWRIVSMKKLTIKV
                     DFVCVADAAESEDRYALKDKIEESIRAVVAGDADVAV"
     gene            complement(599470..599781)
                     /locus_tag="NGO_RS03085"
                     /old_locus_tag="NGO0613"
                     /old_locus_tag="NGO_0613"
     CDS             complement(599470..599781)
                     /locus_tag="NGO_RS03085"
                     /old_locus_tag="NGO0613"
                     /old_locus_tag="NGO_0613"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002237051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003688925.1"
                     /translation="MLAILLSAILGLVSTTAAAGTSEPAHRHTKHISKANKQMLHPEC
                     RKYLERRAAWYRSQGNVQELRENKKARKAFRTLPYAEQKIQCRAAYEAFDDFDGGRFR
                     R"
     gene            600312..602591
                     /gene="nrdA"
                     /locus_tag="NGO_RS03090"
                     /old_locus_tag="NGO0614"
                     /old_locus_tag="NGO_0614"
     CDS             600312..602591
                     /gene="nrdA"
                     /locus_tag="NGO_RS03090"
                     /old_locus_tag="NGO0614"
                     /old_locus_tag="NGO_0614"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003756856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-diphosphate reductase subunit
                     alpha"
                     /protein_id="WP_003702805.1"
                     /translation="MNTPTDLKVTKRDGRLEAIDLDKIHRVVTWAAEGLENVSVSQVE
                     LKSHIQFYNGIRTDDIHETIIKAAADLISEDTPDYQYLAARLAIFHLRKIAYGEYEPP
                     HLYNHVKKLTDAGKYDRHILEDYSREEFDELNAYIDHERDMSFSYAAVKQLEGKYLVQ
                     NRVTRQIYETPQFLYVLVAMCLFSKYPKEARLDYVKRFYDAVSTFKVSLPTPIMSGVR
                     TPTRQFSSCVLIECDDSLDSINATTSAIVKYVSQRAGIGINAGRIRGLDSEIRGGEAR
                     HTGCIPFFKMFQAAVKSCSQGGVRGGAATLFYPLWHIEAESLLVLKNNRGVEDNRIRQ
                     LDYGVQINRLLYTRLIKGGNITLFSPNEVSGLYEAFFADQDEFERLYTKYEQDPNIRK
                     RIIPAADLFSTLMQERAGTGRIYIQNVDHCNTHSPFDPRVAPVHQSNLCMEIALPTKP
                     LDNINDPDGEIALCTLSAFNLGALNSLDELEGLADLTVRALDALLDYQGYPVEAARTS
                     TMDRRSLGIGVINYAYYLAKNGVRYSDGSALGLTHRTFEAIQYYLLKASANLAKEYGA
                     CTLFNQTVYSQGKLPIDTYKKDLDAVCGEPLHYDWESLRADIVKYGLRNSTLTALMPS
                     ETSSQIANATNGIEPPRGLVTVKASKDGILKQVVPEFETLKNAYETLWQLPGNEGYLK
                     LVGVMQKFVDQAISANTAYDPGKFEGNKVSMKQMLKDLLTAYKYGVKTLYYHNTRDGA
                     DDTQTDIQDDGCAGGACKI"
     gene            602883..604037
                     /gene="nrdB"
                     /locus_tag="NGO_RS03095"
                     /old_locus_tag="NGO0615"
                     /old_locus_tag="NGO_0615"
     CDS             602883..604037
                     /gene="nrdB"
                     /locus_tag="NGO_RS03095"
                     /old_locus_tag="NGO0615"
                     /old_locus_tag="NGO_0615"
                     /EC_number="1.17.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009427513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     beta"
                     /protein_id="WP_003688921.1"
                     /translation="MSCEHLVMSYSTFPKTKNDALKEPMFFGQPVNVARYDQQKYEVF
                     EKLIEKQLSFFWRPEEIDVSRDRIDYANLPEHEKHIFISNLKYQTLLDSIQGRSPNVA
                     LLPLVSIPELETWVETWSFSETIHSRSYTHIIRNIVNDPSVVFDDIVENEYITARAED
                     IACYYDDLIEYTQYYNLLGEGVHNVGGKPVTVSLRGLKKKLYLCLMCVNVLEAIRFYV
                     SFACSFAFAERELMEGNAKIIKLIARDEALHLTGTQHMLNLMRSGVDDPEMAEIAAEL
                     QDECFQLFKKAAEQEKEWAAYLFKDGSMIGLNKEILSQYVEYITNLRMQAVGLPAGFE
                     GANQNPIPWINAWLSSDNVQVAPQEVEISSYLIGQIDSEVNTDDLGDFEL"
     gene            604158..604448
                     /locus_tag="NGO_RS03100"
                     /old_locus_tag="NGO6151"
                     /old_locus_tag="NGO_6151"
     CDS             604158..604448
                     /locus_tag="NGO_RS03100"
                     /old_locus_tag="NGO6151"
                     /old_locus_tag="NGO_6151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002260650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2Fe-2S ferredoxin-like protein"
                     /protein_id="WP_003688918.1"
                     /translation="MARIGTNKGLFELLEGETLLEGLERTGHMVEYQCRSGYCGSCRV
                     KILEGSVTYREPPLAFLGRDEILPCCCCVEGDVRLDCGLAGEDEGLSDSLLK"
     gene            complement(604489..604767)
                     /gene="ftsB"
                     /locus_tag="NGO_RS03105"
                     /old_locus_tag="NGO0616"
                     /old_locus_tag="NGO_0616"
     CDS             complement(604489..604767)
                     /gene="ftsB"
                     /locus_tag="NGO_RS03105"
                     /old_locus_tag="NGO0616"
                     /old_locus_tag="NGO_0616"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003752666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsB"
                     /protein_id="WP_002213385.1"
                     /translation="MKWVTVVLSFALVCCQYSLWFGKGSIGRNSSLREQIAVQEEKNQ
                     TLALRNHSLAAEVYDLENGQEAISEIARVELGYIQDGETFYRLIRHNR"
     gene            complement(604935..606221)
                     /gene="eno"
                     /locus_tag="NGO_RS03110"
                     /old_locus_tag="NGO0617"
                     /old_locus_tag="NGO_0617"
     CDS             complement(604935..606221)
                     /gene="eno"
                     /locus_tag="NGO_RS03110"
                     /old_locus_tag="NGO0617"
                     /old_locus_tag="NGO_0617"
                     /EC_number="4.2.1.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019270954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopyruvate hydratase"
                     /protein_id="WP_003691316.1"
                     /translation="MSAIVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTG
                     QKEALELRDGDKSRYSGKGVLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTEN
                     KGNLGANATLAVSMAVARAAAEDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSL
                     NIQEFMIMPVGAKSFREALRCGAEIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEA
                     LQLMVEAAEAAGYKAGEDVLFALDCASSEFYKDGKYHLEAEGRSYTNAEFAEYLEGLV
                     NEFPIISIEDGMDENDWEGWKLLTEKLGKKVQLVGDDLFVTNPKILAEGIEKGVANAL
                     LVKVNQIGTLSETLKAVDLAKCNRYASVMSHRSGETEDSTIADLAVATNCMQIKTGSL
                     SRSDRMAKYNQLLRIEEELAEAAYYPGKAAFYQLGK"
     gene            complement(606268..606708)
                     /locus_tag="NGO_RS03115"
                     /old_locus_tag="NGO0618"
                     /old_locus_tag="NGO_0618"
     CDS             complement(606268..606708)
                     /locus_tag="NGO_RS03115"
                     /old_locus_tag="NGO0618"
                     /old_locus_tag="NGO_0618"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002223715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4149 domain-containing protein"
                     /protein_id="WP_003688914.1"
                     /translation="MMQTFRKISLYAATLWLGMQIMAGYIAAPVLFKMLPKMQAGEIA
                     GVLFDILSWSGLAVWGTVLAAAFAALTRRQTALLLFLLSALAANQFLVTPVIEALKYG
                     HENWLLSVAGGSFGMWHGISSMTFMATALLSAVLSWRLSGKEAV"
     gene            complement(606723..607565)
                     /gene="kdsA"
                     /locus_tag="NGO_RS03120"
                     /old_locus_tag="NGO0619"
                     /old_locus_tag="NGO_0619"
     CDS             complement(606723..607565)
                     /gene="kdsA"
                     /locus_tag="NGO_RS03120"
                     /old_locus_tag="NGO0619"
                     /old_locus_tag="NGO_0619"
                     /EC_number="2.5.1.55"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003752673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-8-phosphooctulonate synthase"
                     /protein_id="WP_003688911.1"
                     /translation="MDIKINDITLGNNSPFVLFGGINVLEDLDSTLQTCAHYVEVTRK
                     LGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPV
                     AEVCDVIQLPAFLARQTDLVAAMAETGNVINIKKPQFLSPSQMKNIVEKFREAGNGKL
                     ILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQTRDAGSAASGGRRAQA
                     LDLALAGMATRLAGLFLESHPDPKLAKCDGPSALPLHLLENFLIRIKALDDLIKSQPI
                     LTIE"
     gene            complement(607587..607970)
                     /locus_tag="NGO_RS03125"
                     /old_locus_tag="NGO0620"
                     /old_locus_tag="NGO_0620"
     CDS             complement(607587..607970)
                     /locus_tag="NGO_RS03125"
                     /old_locus_tag="NGO0620"
                     /old_locus_tag="NGO_0620"
                     /EC_number="4.1.1.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate 1-decarboxylase"
                     /protein_id="WP_003688909.1"
                     /translation="MFRTILGGKIHRATVTEADLNYVGSITVDQDLLDAAGICPNEKV
                     AIVNNNNGERFETYTIAGKRGSGVICLNGAAARLVQKGDIVIIMSYIQLSEPEIAAHE
                     PKVVLVDGNNKIRDIISYEPPHTVL"
     gene            complement(608132..608434)
                     /locus_tag="NGO_RS03130"
                     /old_locus_tag="NGO0621"
                     /old_locus_tag="NGO_0621"
     CDS             complement(608132..608434)
                     /locus_tag="NGO_RS03130"
                     /old_locus_tag="NGO0621"
                     /old_locus_tag="NGO_0621"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2004 domain-containing protein"
                     /protein_id="WP_010951091.1"
                     /translation="MDAFAAFLSELEKADDAARAALTEYLKRDSRYIDFHTEDTQTSR
                     DAAKFVRTMQLIYISLWAKNPAFAVMDYMPANIESDEILAVKLHLDGSIFSIDWES"
     gene            complement(608660..612364)
                     /gene="mfd"
                     /locus_tag="NGO_RS03135"
                     /old_locus_tag="NGO0623"
                     /old_locus_tag="NGO_0623"
     CDS             complement(608660..612364)
                     /gene="mfd"
                     /locus_tag="NGO_RS03135"
                     /old_locus_tag="NGO0623"
                     /old_locus_tag="NGO_0623"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003692981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription-repair coupling factor"
                     /protein_id="WP_010951092.1"
                     /translation="MTCPIPKPREKSRWFNLSQGSLPLALARYLPHKRLKAVLTQDAE
                     QALRLQTAWRFFRPHDTAVFLPDWETLPYERFSPHQDLVSERLSALWQIKSGAADVLF
                     VPVATAMQKLPPVPFLAGRTFWLKTGQTLDIGRLKTDLVDAGYNHVSHVVAAGEFAVR
                     GGIVDLFPMGSETPYRIDLFDDEIDSIKTFDTDTQRTISPVSEIRLLPAHEFPTDSEA
                     QKIFRSRFREEVDGNPNDAAVYKAVSNGHFGAGVEYYLPLFFENELETLFDYIGEDAL
                     FVSLGDVHAEANRFWNDVKSRYAMAQGDETYPPLLPQHLYLSADVFAGRLKNYGQVLP
                     DVSGKAHSLPDLAVNRQSDDPLQALKDFQTAFDGRILLCAESLGRRETMLGFLQQNGL
                     KAKPVSDWQGFLSAHEPLMITVAPLAYGFKLGGLQSSSQQQTVPASEGEGKAVTDQTE
                     FSASATNPLPSPLPQEREQSAAAVSDGLKAAAVSTESSLYLVASDLHGQTRQQSAPSP
                     VGEGWGEGKAVAAQSAIAVITESDLYQYVARSRVHNRRKKHAAVSDGLLRDLAEINIG
                     DPVVHEEHGIGRYTGLVTMDLGGETNEMMLLEYAGEAQLYVPVSQLHLISRYSGQAHE
                     SVALHKLGSGAWNKAKRKAAEKARDTAAELLNLYAQRAAQSGHKFEINESDYQAFADG
                     FGYEETEDQAAAIAAVIKDLTQAKPMDRLVCGDVGFGKTEVALRAAFVAVMGGKQVAV
                     LAPTTLLVEQHAQNFADRFADFPVKVASLSRFNNSKATKATLEGMADGTVDIVIGTHK
                     LVQDDIKFKNLGLLIIDEEHRFGVRQKEQLKRLRANVDILTMTATPIPRTLSMALEGL
                     RDFSLITTAPSRRLAVKTFVKPFSEGSVREAVLRELKRGGQVFFLHNEVDTIENMRER
                     LETLLPEARIGVAHGQLRERELEQVMRDFLQQRFNVLLCSTIIETGIDIPNANTIIIN
                     RADKFGLAQLHQLRGRVGRSHHQAYAYLLTPEYITKDAEKRLDAIAAADELGAGFTLA
                     MQDLEIRGAGEILGEGQSGEMMQVGFTLYTEMLKQAVRDLKKGRQPDLDAPLGITTEI
                     KLHSPALLPEDYCPDIHERLVLYKRLAVCETVQKINAIHEELVDRFGLTEQPVKTLIE
                     SHHLRLAAKELGIDAIDATSEAVTVTFGKHHCIDPTGIILLIQTDKKYRLAGADKLRF
                     AAEMENIEVRINTVKTVLKTLQGKRLPKGN"
     gene            612585..613976
                     /locus_tag="NGO_RS03140"
                     /old_locus_tag="NGO0624"
                     /old_locus_tag="NGO_0624"
     CDS             612585..613976
                     /locus_tag="NGO_RS03140"
                     /old_locus_tag="NGO0624"
                     /old_locus_tag="NGO_0624"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003755428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA/acyl-ACP dehydrogenase"
                     /protein_id="WP_014580229.1"
                     /translation="MDTAAFLKHIESAFRRIFSDGIDLMRYLPEDKWLALKQAGLLLP
                     FLDKKHGGRKGSQFEIQEVLRIAGHYGVPVTLRTGIEGALVLQPLQEFGGEAQVAQGL
                     DMIFKGEGGGLGVTEPETSGAAIAREMQSCYEYTDEQTIYVNAAKYWQGNSQSDFLLV
                     AAKERKNGKLAKVIDLLLVPKTYIRCETLASEGLRAVRYAVNRIDAEMPATAVMKLSR
                     GDAAGLRAFQNIFIRSRLQLIGMTHGIMEYILDNLNRYVRNDIRFVDYERREIQRRHQ
                     VSEILYRYVCHSVSPVAPVAHQLMEANIVKTLATEYTYAAAQMLQKLLGAKGFERGHP
                     AGNIAIDIRPFTIFEGPNDMLYAEIYDQFVRATAEEKEAGIKLDKNQTLLDRLQTDVR
                     FAAVARDYALPEDIRSFLQEHTLTDACALQKVFIGKIIARLFVFVQEEHEDTTAFLLN
                     DIRKDILDCRYCG"
     gene            614124..615215
                     /gene="mltB"
                     /locus_tag="NGO_RS03145"
                     /old_locus_tag="NGO0626"
                     /old_locus_tag="NGO_0626"
     CDS             614124..615215
                     /gene="mltB"
                     /locus_tag="NGO_RS03145"
                     /old_locus_tag="NGO0626"
                     /old_locus_tag="NGO_0626"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013448979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic murein transglycosylase B"
                     /protein_id="WP_003688898.1"
                     /translation="MEKRKILPLAICLAALSACTAMEARTPRANEAQAPRADEMKKES
                     RPAFDAAAVPVSDSGFAANANVRRFVDDEVGKGDFSQAEWQDFFDKAAYKADIVKIMH
                     RPSTSRPWYVFRTGNSGRAKFHGARRFYAENRAVIDDVAQKYGVPAELIVAIIGIETN
                     YGKNTGSFRVADALATLGFDYPRRAGFFQKELVELLKLAKEEGGDVFAFKGSYAGAMG
                     MPQFMPSSYRKWAVDYDGDGHRDIWGNVGDVAASVANYMKQHGWRTGGKMLVSATLAP
                     GADVQAIIGEKTALTRTVADLKAYGIIPGETLADDEKAVLFKLETAPGVFEYYLGLNN
                     FYTVWQYNHSRMYVTAVRDIANSLGGPGL"
     gene            complement(615338..617344)
                     /locus_tag="NGO_RS03150"
                     /old_locus_tag="NGO0627"
                     /old_locus_tag="NGO_0627"
     CDS             complement(615338..617344)
                     /locus_tag="NGO_RS03150"
                     /old_locus_tag="NGO0627"
                     /old_locus_tag="NGO_0627"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017628975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific recombinase"
                     /protein_id="WP_003688896.1"
                     /translation="MADMKKITPQNLRPLLSESLGHTDFVNVLNALIKFLRRGGKKCA
                     GERFDLIIDTFKQDRELLSRFSRCFYIWLAQIHIYPALIKLGIFSRHSFAREMGIRIY
                     ERFNPSYKDFANLGEVFLYLFHSENDDKWLQTLNIRQWLVLYELIRSHAEPSKLQTAG
                     IRLADARLRAIEMLSVWTASEAIEPDLIRIAPRLLEADSSFVALQRETAKLVEHYRNG
                     TAPYDTAHLEVMFDQCFSQIDYLRRKGTGAGSGSSVKVAHLLERLRQTVGRLKLLTDI
                     QTGAGNSNRLTIALMNSLIYAAVEQYSTRHLRRSSIRMLARSITENKSHHGEHYITRN
                     RKEYFKMFYSAAGGGGIIALMALLKIRIGTLDLSPFLASLSAGFNYGIGFMIIHMLHC
                     TVATKQPAMTAASFAEQVDLNEGGKAVDNKLSKLLIDVCRSQSVAVFGNVSIAILLAC
                     AISFGYAHLYRLPILDAHTAAYQFKSIDIINHPTLWYAAIAGLWLFCSGIIAGFFDNR
                     ADYLNLRQRLPFNPLLRKIMRPGPRRVLAAYIHKHYGSLVGNFIFGMLLGMTGYFGHL
                     LGLPLDIRHVAFSSANLGYAAVSGNVGFGTFVLGIFSVLAIGLVNLCVSFSLALFVAL
                     RSRGTKIGSIRNLIKSFWNQIKSNPCILFLPPAKGQGHPPSDKP"
     gene            617567..618220
                     /locus_tag="NGO_RS03155"
                     /old_locus_tag="NGO0628"
                     /old_locus_tag="NGO_0628"
     CDS             617567..618220
                     /locus_tag="NGO_RS03155"
                     /old_locus_tag="NGO0628"
                     /old_locus_tag="NGO_0628"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1595 family transposase"
                     /protein_id="WP_010951093.1"
                     /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFY
                     RKIRTVANHRLALAADGVFEGPAGPGGSYFGGRRKGRRGRGAAGKAVVFGIPKRNGRA
                     YTVAADNAEPETLPPAVKKKIMPDGIVYADSPGSRGKLDAGGFTRCRINRSKEFADRR
                     NHINGIGDFWNQAKRALRKYNGIDRKPFPPFLRECEFRLNFGTPSRQLKILRDRCGI"
     gene            complement(618439..621189)
                     /gene="gyrA"
                     /locus_tag="NGO_RS03160"
                     /old_locus_tag="NGO0629"
                     /old_locus_tag="NGO_0629"
     CDS             complement(618439..621189)
                     /gene="gyrA"
                     /locus_tag="NGO_RS03160"
                     /old_locus_tag="NGO0629"
                     /old_locus_tag="NGO_0629"
                     /EC_number="5.6.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014573944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="WP_003692988.1"
                     /translation="MTDATIRHDHKFALETLPVSLEDEMRKSYLDYAMSVIVGRALPD
                     VRDGLKPVHRRVLYAMHELKNNWNAAYKKSARIVGDVIGKYHPHGDSAVYDTIVRMAQ
                     NFAMRYVLIDGQGNFGSVDGLAAAAMRYTEIRMAKISHEMLADIEEETVNFGPNYDGS
                     EHEPLVLPTRFPTLLVNGSSGIAVGMATNIPPHNLTDTINACLRLLDEPKTEIDELID
                     IIQAPDFPTGATIYGLGGVREGYKTGRGRVVIRGKTHIEPIGKNGEREAIVIDEIPYQ
                     VNKAKLVEKIGDLVREKTLEGISELRDESDKSGMRVVIELKRNENAEVVLNQLYKLTP
                     LQDSFGINMVVLVDGQPRLLNLKQILSEFLRHRREVVTRRTLFRLKKARHEGHIAEGK
                     AVALSNIDEIIKLIKESPNAAEAKEKLLARPWRSSLVEEMLTRSGLDLEMMRPEGLAA
                     NIGLKKQGYYLSEIQADAILRMSLRNLTGLDQKEIIESYKNLMGKIIDFVDILSKPER
                     ITQIIRDELEEIKTNYGDERRSEINPFGGDIADEDLIPQREMVVTLTHGGYIKTQPTT
                     DYQAQRRGGRGKQAAATKDEDFIETLFVANTHDYLMCFTNLGKCHWIKVYKLPEGGRN
                     SRGRPINNVIQLEEGEKVSAILAVREFPEDQYVFFATAQGMVKKVQLSAFKNVRAQGI
                     KAIALKEGDYLVGAAQTGGADDIMLFSNLGKAIRFNEYWEKSGNDEAEDADIETEISD
                     DLEDETADNENTLPSGKNGVRPSGRGSGGLRGMRLPADGKIVSLITFAPETEESGLQV
                     LTATANGYGKRTPIADYSRKNKGGQGSIAINTGERNGDLVAATLVGETDDLMLITSGG
                     VLIRTKVEQIRETGRAAAGVKLINLDEGETLVSLERVAEDESELSGASVISNVTEPEA
                     EN"
     gene            complement(621287..621787)
                     /gene="hscB"
                     /locus_tag="NGO_RS03165"
                     /old_locus_tag="NGO0630"
                     /old_locus_tag="NGO_0630"
     CDS             complement(621287..621787)
                     /gene="hscB"
                     /locus_tag="NGO_RS03165"
                     /old_locus_tag="NGO0630"
                     /old_locus_tag="NGO_0630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002248857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S protein assembly co-chaperone HscB"
                     /protein_id="WP_003688894.1"
                     /translation="MSQYFTLFRIEPAFDIGTENLEQTYRALAARFHPDKFASASAFE
                     QKQAVMMSSTINDAYRTLKNPIDRAAYLLKTSGIDADAPEHTSFAPDFLMQQMEWRET
                     LMEARAGNNLESLKNLDNEIRAEQEKLFCGLKQSFARQDCDTAAQQVRQGRFLDKLRH
                     EISSAL"
     gene            621869..622090
                     /locus_tag="NGO_RS03170"
                     /old_locus_tag="NGO_03320"
     CDS             621869..622090
                     /locus_tag="NGO_RS03170"
                     /old_locus_tag="NGO_03320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003764848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alternative ribosome-rescue factor A"
                     /protein_id="WP_003688893.1"
                     /translation="MGGKAQHNKGKIRDNALKALVKSDLFRHKVERKRKGKGSYNRQE
                     AKKRRDGFDTVPPFLCLKRGSSRRSRRSL"
     gene            complement(622050..622370)
                     /gene="iscA"
                     /locus_tag="NGO_RS03175"
                     /old_locus_tag="NGO0632"
                     /old_locus_tag="NGO_0632"
     CDS             complement(622050..622370)
                     /gene="iscA"
                     /locus_tag="NGO_RS03175"
                     /old_locus_tag="NGO0632"
                     /old_locus_tag="NGO_0632"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003764837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster assembly protein IscA"
                     /protein_id="WP_010951096.1"
                     /translation="MITLTENAAKHINDYLAKRGKGLGVRLGVKTSGCSGMAYNLEFV
                     DEANGDDLIFEGHGARIYIDPKSLVYLDGTQVDYTKEDLQEGFKFENPNVKDSCGCGE
                     SFHV"
     gene            complement(622457..622843)
                     /gene="iscU"
                     /locus_tag="NGO_RS03180"
                     /old_locus_tag="NGO0633"
                     /old_locus_tag="NGO_0633"
     CDS             complement(622457..622843)
                     /gene="iscU"
                     /locus_tag="NGO_RS03180"
                     /old_locus_tag="NGO0633"
                     /old_locus_tag="NGO_0633"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003674559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S cluster assembly scaffold IscU"
                     /protein_id="WP_002213175.1"
                     /translation="MAYSDKVIDHYENPRNVGTFDKNDESVGTGMVGAPACGDVMRLQ
                     IKVNDEGIIEDAKFKTYGCGSAIASSSLITEWVKGKSLDDALAIKNSEIAEELELPPV
                     KIHCSILAEDAVKAAVADYRKRQENR"
     gene            complement(622856..623350)
                     /locus_tag="NGO_RS03185"
                     /old_locus_tag="NGO_03335"
     CDS             complement(622856..623350)
                     /locus_tag="NGO_RS03185"
                     /old_locus_tag="NGO_03335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fic family protein"
                     /protein_id="WP_003688888.1"
                     /translation="MQPITGNFDLAHLQTIHRELFGNVYDWAGKIRRVDISKGNTRFA
                     NFAFIENESRKLLEKLKNENYLRVLDKDKFAERAAYYLDELNVLHPFREGNGRTLRLF
                     MTQLAIKNGFQIHWQNISAEQMIQACIQAYHADSSLLARLIIRQFRTIVFFRRLKHQQ
                     TTIF"
     gene            complement(623656..623967)
                     /locus_tag="NGO_RS03190"
                     /old_locus_tag="NGO0635"
                     /old_locus_tag="NGO_0635"
     CDS             complement(623656..623967)
                     /locus_tag="NGO_RS03190"
                     /old_locus_tag="NGO0635"
                     /old_locus_tag="NGO_0635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003688887.1"
                     /translation="MGGALRLMSNKGCLRKNTMKVKIINLPNGYKRIIYGKYFEQFDL
                     DYEQDLDVLKKDIEFALSVIEYNRSIFKKFSSLFENKIIFVYQGGHHLDIIDRDKGSL
                     K"
     gene            complement(623952..625166)
                     /gene="iscS"
                     /locus_tag="NGO_RS03195"
                     /old_locus_tag="NGO0636"
                     /old_locus_tag="NGO_0636"
     CDS             complement(623952..625166)
                     /gene="iscS"
                     /locus_tag="NGO_RS03195"
                     /old_locus_tag="NGO0636"
                     /old_locus_tag="NGO_0636"
                     /EC_number="2.8.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016687546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IscS subfamily cysteine desulfurase"
                     /protein_id="WP_003688882.1"
                     /translation="MTVKTPVYLDYAATTPVDKRVAEKMIPYLTETFGNPASNSHAFG
                     WTAEEAVEKARADIAALINADPKEIVFTSGATESDNLAIKGAANFYKTKGKHLITVKT
                     EHKAVLDTMRELERQGFEVTYLGVQENGLIDLEELKAAIRDDTILISIMWVNNEIGVV
                     QNIPAIGEICRERKIAFHVDAAQACGKVPVDVEAAKIDLLSMSAHKVYGPKGIGALYV
                     RRKPRVRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELAQDTAHYLKLRDI
                     FLKGIEGIEEVYINGDLEHRAPNNLNVSFNFVEGESLIMAVKELAVSSGSACTSASLE
                     PSYVLRALGRNDELAHSSLRITFGRMTTEEEVQFAAELIKSKIGKLRELSPLWEMFKD
                     GIDLNSIEWAAH"
     gene            complement(625195..625641)
                     /gene="iscR"
                     /locus_tag="NGO_RS03200"
                     /old_locus_tag="NGO0637"
                     /old_locus_tag="NGO_0637"
     CDS             complement(625195..625641)
                     /gene="iscR"
                     /locus_tag="NGO_RS03200"
                     /old_locus_tag="NGO0637"
                     /old_locus_tag="NGO_0637"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004519894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S cluster assembly transcriptional regulator
                     IscR"
                     /protein_id="WP_003688879.1"
                     /translation="MRLTTKGRFAVTAMLDLAMNAQTGAVKLSAISERQNISLSYLEQ
                     LFGKLRRAGLVESLRGPGGGYILAAPPAQINIAQIISAAEDRLDATQCGSKANCHHGA
                     PCLTHDLWENLNKTINDYLGSVTLQSIIEQKNNGDGSRVVQFTHIH"
     gene            625640..625870
                     /locus_tag="NGO_RS03205"
                     /old_locus_tag="NGO0638"
                     /old_locus_tag="NGO_0638"
     CDS             625640..625870
                     /locus_tag="NGO_RS03205"
                     /old_locus_tag="NGO0638"
                     /old_locus_tag="NGO_0638"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003691301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003691301.1"
                     /translation="MVVVARVGFFIVGGIVQYLSVSVKYGGAVADCLFKWRYSLILLY
                     LFGFLNQLVMFFEERRLGRFAGKRFQNDLIYF"
     gene            625991..627163
                     /locus_tag="NGO_RS03210"
                     /old_locus_tag="NGO0639"
                     /old_locus_tag="NGO_0639"
     CDS             625991..627163
                     /locus_tag="NGO_RS03210"
                     /old_locus_tag="NGO0639"
                     /old_locus_tag="NGO_0639"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-hydroxy-acid oxidizing protein"
                     /protein_id="WP_010951097.1"
                     /translation="MKRDLSKMTCIEDLHRVAKRKMPRMFYDYIDSGSWTETTYRENT
                     SDFKDIRFRQKVLVNMEGRSLETKMIGGDVKMPVAIAPTGFTGMAHADGEILAARAAE
                     KFGIPFTLSTMSICSIEDVAENTSAPFWFQLYVMRDREFMENLIKRAKDAKCSALVLT
                     ADLQVLGQRHKDIKNGLSAPPKPTIANLINLATKPEWCMKMLNTERRTFRNIVGHAKN
                     VGDLSSLSSWTAEQFDPRLSWDDVARIKDLWGGKLIIKGIMEPEDAEKAAKSGADALV
                     VSNHGGRQLDDTVSAIKALPDIVSAVGSDIEVWMDSGIRSGQDILKAWALGAKGTMIG
                     RAFLYGLGAYGEEGVTRALEILYKEMDVSMAFTGHRDIQDVDASILRSKDWGRETV"
     gene            complement(627312..630086)
                     /locus_tag="NGO_RS03215"
                     /old_locus_tag="NGO0640"
                     /old_locus_tag="NGO_0640"
     CDS             complement(627312..630086)
                     /locus_tag="NGO_RS03215"
                     /old_locus_tag="NGO0640"
                     /old_locus_tag="NGO_0640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012503692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase family protein"
                     /protein_id="WP_010951098.1"
                     /translation="MANNKTLFDWVEDRKSMLEEMEQTDFFALPEFVSNNLKYPFFEW
                     QKSALENFVIFDRTSKLKDFPDIKNRPTHLLFNMATGAGKTMMIAALILYYFEKGYRH
                     FLFFVNKNNIVYKTENNFIDPTHPKFLFTEKILQGDTVIPIRKVETFSQYSDGIEIKF
                     TSIQKLYNDIHTERENQTTLADLHELNLVILGDEAHHLNAQTKGKKQGELDLEKEMNE
                     RTSDAEIERKGWEHMVLELLLNKNGNPGQNVLLEFTATLPENAEVQQKYADKIITKFG
                     LKEFLQKGYTKEINLVSGTLNKKERVLHALLFAWYRHQIALKYGIANFKPVMLFRSKT
                     IDESKADYSAFLNWVENVQADDFSFLTTFSTSLSDSNNANEQGKTRTEQALKFMQENK
                     FEFVHLANWVKQNYQKHNVIITNSETNKTKTEKTDSETEKLLNNLEAADNPIRAIFTV
                     DRLTEGWDVLNLFDIVRLYEGQNGGGSNKKSGKTAAATVSEKQLIGRGVRYFPFAFEG
                     KQPNKRKFDNDMQHELRILEELFYYTHDEQSRYITELKNELRKDGYLPEKDDDKVLTT
                     FKLKSEFADNKDFRELLIWANKKIPNPNAKSNNADSLQANPQTLSFQVHGNQLLQETQ
                     FTADENDETARQIGTQNNFTQTIKMSEMERHIFNKALHIKGKNSQSLFHFDRLQSKLD
                     IQNRNELQNKLLKDWQIEFLGLEQDKQVRPDDKLAGCLKILEMVEKHLNESDIPFIGT
                     KEFTPKKLWEIFGTPKQKWVKKDDIKTAIATQNDWYVMDNFAGTGLEEALIQFISARL
                     GDLKSQYDVHLIRNEEVFKLNNFADGEGFMPDFVLLLKDKQKSSSDSVDDFLHYQIFI
                     EPKGGHLVENDSWKEAFLKSITVEYGRDKILQKNTPHYRLIGLPFFTDHQKNGQFTEL
                     FPLGAASLEK"
     gene            complement(630076..632346)
                     /locus_tag="NGO_RS03220"
                     /old_locus_tag="NGO0641"
                     /old_locus_tag="NGO_0641"
     CDS             complement(630076..632346)
                     /locus_tag="NGO_RS03220"
                     /old_locus_tag="NGO0641"
                     /old_locus_tag="NGO_0641"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002260102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III restriction endonuclease HindVIP
                     subunit M"
                     /protein_id="WP_010951099.1"
                     /translation="MKTGIQTELAQALLSHEKIWANEEKTILAKNILLDLVEKTDPSI
                     IGLLLNNDELKRHFFVEVNGVLVFKLQDFRFFLDKHSINNSYTKYANRIGLTDGNRFL
                     KDNSDIVLDFPFKDCVLNGGQSTEEGEEIYFKRNNSQPASQPASQPASQPASQPASQP
                     ASQPASQPASQPASQPASQPASQPASQLYTKLTRKRQEIFFNQTLAFDEIDRLFDAKA
                     FSKFSRHTADGKQPVGEIKRRSDGTPAENLIIKGNNLIAMHSLAKQFKGKVKLIYIDP
                     PYNTETDSFAYNDKFSHSTWLTFMKNRLEIAKELLKDDGLIFVQCDDKEQAYLKVLLD
                     ETFTRENFINCIAVKMSEPSGNKMAHTSHRLPKIKEYILIYKNKNIKLNPIREQKSEW
                     DNEYNIFLENFTQEDKKFIDLIVNSQTENKEINGNTLKEIDILLKKISPISVNQKLAQ
                     LNIKDNEVIKWKLDNAYRIVRTAASSSVKKLADEKKEICQQQFFSVISKRDKLLYIVK
                     SDYSKDAKAPRVQVLFAEDYLSISLCDLWTNINTTGLEAEGNVELKNGKKPESLIETI
                     IKLATNENDIVLDYHLGSGTTAAVAHKMNRQYIGIEQMDYIETLAVERMKKVIDGEQG
                     GISKAVNWQGGGEFVYAELSPFNETAKQQILACENSDGIKTLFEGLCERHFLKYNVSV
                     NEFSQIIEEPEFQSLALDEQKQMMLEMLDLNQMYISLSEMDDEQFAGCLNDDDKALSR
                     AFYQSVKHQAEKKDGE"
     gene            complement(632563..633483)
                     /gene="truB"
                     /locus_tag="NGO_RS03225"
                     /old_locus_tag="NGO0642"
                     /old_locus_tag="NGO_0642"
     CDS             complement(632563..633483)
                     /gene="truB"
                     /locus_tag="NGO_RS03225"
                     /old_locus_tag="NGO0642"
                     /old_locus_tag="NGO_0642"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002250227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine(55) synthase TruB"
                     /protein_id="WP_003697163.1"
                     /translation="MTNKPAKRPVNGVLLLDKPEGLSSNTALQKARRLFHAEKAGHTG
                     VLDPLATGLLPVCFGEAAKFAQYLLDADKAYTATLKLGEASSTGDAEGEIIAAARADI
                     SLAEFQTACQALTGNIRQVPPMFSALKHEGKPLYEYARKGIVIERKPRDITVYSIDIA
                     EFDAPKAVISVRCSKGTYIRTLSEGIAKHIGTFAHLTALRRTETAGFTIAQSHTLEAL
                     ANLNETERDGLLLPCDVLVSHFPQTVLNDYAVHMLQCGQRPRFEEDLPSDTPVRVYTE
                     NGRFVGLAEYQKEICRMKALRLMNTAASSA"
     gene            complement(633541..634065)
                     /locus_tag="NGO_RS03230"
                     /old_locus_tag="NGO0643"
                     /old_locus_tag="NGO_0643"
     CDS             complement(633541..634065)
                     /locus_tag="NGO_RS03230"
                     /old_locus_tag="NGO0643"
                     /old_locus_tag="NGO_0643"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002237089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003688872.1"
                     /translation="MNNLIPEHLAAYAHSDNLQIEGGHRCFSLSCQGRDTFHIRYYGE
                     PFDGLITDTDKAPVKIVAVEAVSGDEIVLFDGAEHGYNAMFCDKYSQNQKQNRTLTDL
                     DEYTYRVPIHLYYNIDYEDEYEDFVNSEGQVPLIDGRIISFDSLKRNGFDAISIDLID
                     EKHSVRELLNEELS"
     gene            complement(634076..634447)
                     /gene="rbfA"
                     /locus_tag="NGO_RS03235"
                     /old_locus_tag="NGO0644"
                     /old_locus_tag="NGO_0644"
     CDS             complement(634076..634447)
                     /gene="rbfA"
                     /locus_tag="NGO_RS03235"
                     /old_locus_tag="NGO0644"
                     /old_locus_tag="NGO_0644"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosome-binding factor RbfA"
                     /protein_id="WP_010951100.1"
                     /translation="MKKPQRGYARQDRVKEQIMRELAELVRTGLKDPRAGFITINEVE
                     ITRDYSHATVFYTVLNQDTREITEEVLEHARGHLRSELSKRIKLFKIPELHFKYDESL
                     ERGMSLSALIDQVAAEKPVED"
     gene            634630..635874
                     /gene="clpX"
                     /locus_tag="NGO_RS03240"
                     /old_locus_tag="NGO0645"
                     /old_locus_tag="NGO_0645"
     CDS             634630..635874
                     /gene="clpX"
                     /locus_tag="NGO_RS03240"
                     /old_locus_tag="NGO0645"
                     /old_locus_tag="NGO_0645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002246949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpX"
                     /protein_id="WP_003706165.1"
                     /translation="MSNENRTCSFCGKSKSHAKHLIEGKNAYICDECVANCLEILYEG
                     DNGGTPPENAGGEPEESGKLPTPAEIVANLDDYVIGQGQAKKALAVAVYNHYKRLRHP
                     KADGGVELSKSNILLIGPTGSGKTLLAQSLARKLDVPFVMADATTLTEAGYVGEDVEQ
                     IITKLLGKCDFDVEKARHGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGT
                     VASVPPQGGRKHPNQEFINVDTANILFICGGAFAGLEKVIRQRTEKGGIGFGASVHSK
                     DENAGITKLFGIVEPEDLIKFGLIPELIGRLPVIATLEELDEDALINILTEPKNALVK
                     QYQALFGIENVGLEFEEGALRSIARQAMERKTGARGLRSIVERCLLDTMYRLPDLQGL
                     KKVVVGKAVIEEGREPELVFES"
     gene            complement(635981..637174)
                     /locus_tag="NGO_RS03245"
                     /old_locus_tag="NGO0646"
                     /old_locus_tag="NGO_0646"
     CDS             complement(635981..637174)
                     /locus_tag="NGO_RS03245"
                     /old_locus_tag="NGO0646"
                     /old_locus_tag="NGO_0646"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002235895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="WP_003691287.1"
                     /translation="MQNYLTPNFAFAPMIPERASGSRVWDTEGREYIDFSGGIAVNAL
                     GHCHPALVDALNAQMHKLWHISNIYTTRPAQELAQKLVKHSFADKVFFCNSGAEANEA
                     ALKLARKYARDRFGGGKSEIVACINSFHGRTLFTVSVGGQPKYSKDYAPLPQGITHVP
                     FNDIAALEAAVGEQTCAVIIEPIQGESGILPATAEYLQAARRLCDRHNALLILDEVQT
                     GMGHTGRLFAYEHYGVVPDILSSAKALGCGFPIGTMLATEKIAAAFQPGTHGSTFGGN
                     PMACAVGSRAFDIINAPETLHNVRSQGQKLQTALLDLGRKTGLFSQVRGMGLLLGCAL
                     DTPYRGRSSEIAATSLKHGVMILVAGADVLRFAPSLLLNDEDIAEGLRRLEHVLTEFA
                     AANRP"
     gene            complement(637273..637530)
                     /locus_tag="NGO_RS03250"
                     /old_locus_tag="NGO_03400"
     CDS             complement(637273..637530)
                     /locus_tag="NGO_RS03250"
                     /old_locus_tag="NGO_03400"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_154235979.1"
                     /translation="MKVTKKPPRFRAACFAYGMDFKQAQKAPHVCVVPIAVSGCKRFA
                     LHDEMPSEDKNIGEILNQNAAAPQALYRNFFVFFSYPVENI"
     gene            637578..638078
                     /locus_tag="NGO_RS03255"
                     /old_locus_tag="NGO0647"
                     /old_locus_tag="NGO_0647"
     CDS             637578..638078
                     /locus_tag="NGO_RS03255"
                     /old_locus_tag="NGO0647"
                     /old_locus_tag="NGO_0647"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002234980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010357954.1"
                     /translation="MDAMPQTAVQNENLHTCSIIVDDAQDFSPMLLDAGRDDTLISES
                     MIPQIRTVAALIAAERHDFSRSSPAEFTDAADFFAARILVLGVRRFHLDVSLLQILKT
                     ANKRACRFAEKHRLFFTPAQAELSLNKHKNRRLLTIETEHEVENKGNPVANSLAFVRK
                     LHTLPL"
     gene            638163..638717
                     /locus_tag="NGO_RS03260"
                     /old_locus_tag="NGO0648"
                     /old_locus_tag="NGO_0648"
     CDS             638163..638717
                     /locus_tag="NGO_RS03260"
                     /old_locus_tag="NGO0648"
                     /old_locus_tag="NGO_0648"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014580810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003688863.1"
                     /translation="MKKIIASALIATFALTACQDDTQARLERQQKQIEALQQQLAQQA
                     DDTVYQLTPEAVKDTIPAQAQANGNNGQPVTGKDGQQYIYDQSTGSWLLQSLIGAAAG
                     AFIGNALANKFTRAGNQDSPVARRARAAYHQSARPNARTSRDLNTRSLRAKQQAAQAQ
                     RYRPTTRPPVNYRRPAMRGFGRRR"
     gene            638731..638931
                     /locus_tag="NGO_RS03265"
                     /old_locus_tag="NGO0649"
                     /old_locus_tag="NGO_0649"
     CDS             638731..638931
                     /locus_tag="NGO_RS03265"
                     /old_locus_tag="NGO0649"
                     /old_locus_tag="NGO_0649"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009348581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003688861.1"
                     /translation="MPSEGLSDGIFVFVRGIVMLPFDFQTAFCFQAFDVGMAILIYVR
                     WQGGIVIPPLGFQTASYRTVKP"
     gene            complement(639282..640670)
                     /locus_tag="NGO_RS03270"
                     /old_locus_tag="NGO0650"
                     /old_locus_tag="NGO_0650"
     CDS             complement(639282..640670)
                     /locus_tag="NGO_RS03270"
                     /old_locus_tag="NGO0650"
                     /old_locus_tag="NGO_0650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002237086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_003688859.1"
                     /translation="MSIKFADLNLDKNILSAVSSEGYESPTPIQAQAIPFALEGCDIM
                     ASAQTGSGKTAAFLLPTLQRLTKRSEKPGKGPRALVLAPTRELAAQVEKNALAYAKNM
                     RWFRTVSIVGGTSFGYQTRALSKPVDLIVATPGRLTDLMQSGKVDFERLEVLILDEAD
                     RMLDMGFIDDIETIVEATPADRQTLLFSATWDGAVGKLARKLTKDSEIIEVERVDGQG
                     KIEEQLLYCDDMRHKNRLLDHILRDANIDQCVIFTSTKAMTEVIADELYEKGFAANCL
                     HGDMPQGWRNRTLTDLRKGRCKILVATDVAARGIDVPTITHVINYDLPKQAEDYVHRI
                     GRTGRAGRTGIAITFAEVNEYVKVHKIEKYINRKLPELTIEGMEPARKRKSAGGKPKG
                     KGGWGDRKSGGRRGDHKPGKEGFGGKTRGEGFKKEGFKKDSFKKTGEGFKGKRKAGDS
                     FAGKSERRYKDR"
     gene            640998..641945
                     /locus_tag="NGO_RS03275"
                     /old_locus_tag="NGO0651"
                     /old_locus_tag="NGO_0651"
     CDS             640998..641945
                     /locus_tag="NGO_RS03275"
                     /old_locus_tag="NGO0651"
                     /old_locus_tag="NGO_0651"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003713688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_012503687.1"
                     /translation="MTDITPFANRLGKNIKHLMKWAKRNGIEAWRIYDRDIPQFPFAA
                     DVYGDRIHLQEYDTGWLMRPGEYEAWLAEVLEAVAFVTGFEPEQIRLKRRERQKGLQQ
                     YEKTGKAGDDFVIAENGRKFWVNLDKYLDTGFFLDHRNTRKKVGETAAGKRFLNLFSY
                     TGSFTVYAATGGAASSETVDLSNTYLDWARRNFELNGIDMERHKIVRADVFQYLQTAY
                     GEGRQFDLIVMDPPSFSNSKKMPGILDIQRDHQKLIDGAVNLLASDGILYFSNNLRSF
                     VLDDSVSEQYAVKDISKQSVPEDFRNKKIHRCWEIRHKS"
     gene            complement(641997..642329)
                     /gene="trxA"
                     /locus_tag="NGO_RS03280"
                     /old_locus_tag="NGO0652"
                     /old_locus_tag="NGO_0652"
     CDS             complement(641997..642329)
                     /gene="trxA"
                     /locus_tag="NGO_RS03280"
                     /old_locus_tag="NGO0652"
                     /old_locus_tag="NGO_0652"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002233994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin TrxA"
                     /protein_id="WP_002247584.1"
                     /translation="MSSELIVHTGDAAFEQDVLKSDLPVLLDFWAPWCGPCKMIAPIL
                     DDIAAEFEGRLKVVKINIDDNEATPSRFGVRGIPTLMVFKNGEVVATKVGALAKGQLT
                     AFVEASIA"
     gene            642627..643100
                     /locus_tag="NGO_RS03285"
                     /old_locus_tag="NGO0653"
                     /old_locus_tag="NGO_0653"
     CDS             642627..643100
                     /locus_tag="NGO_RS03285"
                     /old_locus_tag="NGO0653"
                     /old_locus_tag="NGO_0653"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004519850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster repair protein DnrN"
                     /protein_id="WP_003688853.1"
                     /translation="MTDFSVWEAAPFGATVDHILQRYHNVHRAQFEELVPLAQKVAQV
                     HADTFPAEIAGLLADMRDELLMHMMKEERMLFPMINQGVGRGAAMPISVMMHEHEEHD
                     RAIARLKELTGNFHAPEGACGSWTRLYALAKEMADDLNDHIHLENDILFARVLDS"
     gene            complement(643171..643992)
                     /gene="nadE"
                     /locus_tag="NGO_RS03290"
                     /old_locus_tag="NGO0654"
                     /old_locus_tag="NGO_0654"
     CDS             complement(643171..643992)
                     /gene="nadE"
                     /locus_tag="NGO_RS03290"
                     /old_locus_tag="NGO0654"
                     /old_locus_tag="NGO_0654"
                     /EC_number="6.3.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002229591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(+) synthase"
                     /protein_id="WP_003691281.1"
                     /translation="MMRIFSTGGKMDTQAVITHIVRWLDEYAAQANAKGFVVGVSGGI
                     DSAVVSTLAARTGRTTLLLDMPIRQHPGQLERARRHIRNLQGQYANVSAQTANLTDTF
                     QTFEQTVGVHQTAFANQPLSLANARSRLRMLTLYYYGQIHGLLVTGTGNKVEDFGVGF
                     FTKYGDGGVDISPIADLTKTQVYRLAEALGVDEAIQKAPPTDGLWDTERTDEEQMGAS
                     YPELEWAMGVYGTRKPEDFEGRRREVLEIYTRLHRAMQHKINPIPVCRIPPELLG"
     gene            644189..645544
                     /locus_tag="NGO_RS03295"
                     /old_locus_tag="NGO0655"
                     /old_locus_tag="NGO_0655"
     CDS             644189..645544
                     /locus_tag="NGO_RS03295"
                     /old_locus_tag="NGO0655"
                     /old_locus_tag="NGO_0655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002220833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII large subunit"
                     /protein_id="WP_003688847.1"
                     /translation="MSDFFHSDVLSVSELNAFAKSILENHLAGLWIAGEVSNLTRAAS
                     GHYYFSLKDSRAQVRCAMFKGAAARLAQPLKEGDHIEVAGKISIYEARGEFQITVNEV
                     RLKGLGQLYEAYERLKAQLQAEGAFAAERKKPLPVRPQCIGIVTSLAAAALRDVVTTL
                     KRRAPEIPVIVYPAAVQGAGSGFQIAQAIKTASQRAECDVLIVCRGGGSIEDLRAFNE
                     EPVVRAIEACTIPVVSGVGHETDFTLADFVADVRAPTPTGAAELVSPNRQESLHRLVQ
                     AQGRLKTVLEQRYFDASQKLDWLARQIRHPRQKLDEQRASIGKLAQTLSYSMTQNLRA
                     HTARFERQTQALQHCRPDVSVYRQDIVRLQTALPAAFSRLLARRRQSLTAQAALLEAV
                     SPQHILERGFSVVKNTRGQVIRNADVLKQGQKLHITFSDGETDVRVSKEQGQQDLFDC
                     I"
     gene            646046..647587
                     /locus_tag="NGO_RS03300"
                     /old_locus_tag="NGO0656"
                     /old_locus_tag="NGO_0656"
     CDS             646046..647587
                     /locus_tag="NGO_RS03300"
                     /old_locus_tag="NGO0656"
                     /old_locus_tag="NGO_0656"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003707780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OFA family MFS transporter"
                     /protein_id="WP_003688844.1"
                     /translation="MKFLDREASIAKPGFNRWLVPPAALAVHLAIGQIYAYSVFNAPL
                     TKLIGITESAAGDWKLTTVGWIFSIALAMLGASAALFGTWMERVGPRKAIFAAACCFS
                     LGFFVSAFGVRTHNLFLLYLGNGVIGGVGLGLGYIGPVSTLMKWFPDKPGMATGLAIM
                     GFGGGAMLASPLSVSLMNAFSNAASVGVAETFAVLGLFYLALMMFGAFTIRVPADGWK
                     PEGYTVPKTQNKPVSSNHVNVSQAMKTPQFWLLFWVLCLNVTAGIGVLGQASVMIQEL
                     FSETSAGRQAAVGAGAAAGFVSLLSLFNMGGRFLWSSVSDKIGRKNTYTIFFVLGSLL
                     YFAVPSIGEGGSKALFIIGFCVIISMYGGGFAAIPAYLKDLFGTYQVGAIHGRILLAW
                     STAAVIGPVLVNYIRQSQIDSGIPAAQAYSVTMYIMAGLLIVGLLCNLAVKSVHEKHH
                     EKDIKTAARSGNPDDETAISDAYLVGEKVSGDGISVWWRWALAVIPLAYGVVMVFVKA
                     LDLFS"
     gene            complement(647646..648695)
                     /locus_tag="NGO_RS03305"
                     /old_locus_tag="NGO0657"
                     /old_locus_tag="NGO_0657"
     CDS             complement(647646..648695)
                     /locus_tag="NGO_RS03305"
                     /old_locus_tag="NGO0657"
                     /old_locus_tag="NGO_0657"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002250226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA pseudouridine synthase"
                     /protein_id="WP_003695399.1"
                     /translation="MSKQPTSKRQWRDGAAPSAKKTAKPFKSKARPKDETRKTAAQAY
                     GQKASDGIKLQNAPKQRAAKAKKLVVRNPNQKIMEHARDLKERRSDLSRMEPERLQKV
                     LAASGVGSRREMEEWINNGWVTVNGKTAQLGDKVTPDDHVTVKGSIIKLKWADRLPRI
                     ILYYKQEGEIVSRDDPQGRVSIFDRLPQAASSRWVAIGRLDINTSGLLILTTSGELVQ
                     RFAHPSFEVEREYAVRVLGGLTTEQMRSLTEEGVMLEDGLAKVERIYEQGGEGANKWY
                     NIVIKEGRNREVRRIFESQGLTVSRLVRVAFGPIGLPNRLKRGQFYELNPAEVANILK
                     WADMLLPGERRRKKA"
     gene            complement(648704..648856)
                     /locus_tag="NGO_RS11075"
     CDS             complement(648704..648856)
                     /locus_tag="NGO_RS11075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020424398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003695397.1"
                     /translation="MHKLCPQSRSDDFIRKTAASGTISNRPTEDGILSTRPAAHAAEE
                     PPYQAS"
     gene            648916..649548
                     /gene="pdxH"
                     /locus_tag="NGO_RS03310"
                     /old_locus_tag="NGO0658"
                     /old_locus_tag="NGO_0658"
     CDS             648916..649548
                     /gene="pdxH"
                     /locus_tag="NGO_RS03310"
                     /old_locus_tag="NGO0658"
                     /old_locus_tag="NGO_0658"
                     /EC_number="1.4.3.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="WP_003688841.1"
                     /translation="MDLHNIREDYSKRELSEADCADNPIEQFERWLDEAVRAEVNEPT
                     AVNVAAVDGRGRPNSRMVLLKEVNSEGFVFFTNYHSRKGRSLELNPFAAMTFFWPELE
                     RQVRVEGRVGRLAEKLSDEYFESRPYQSRLGAWASAQSEVIPNKAVLVAKAAAVGLKH
                     PLHVPRPPHWGGYIVIPDLIEFWQGRPSRLHDRIQYRLLDGGWIRERLSP"
     gene            complement(649678..650688)
                     /locus_tag="NGO_RS03315"
                     /old_locus_tag="NGO0659"
                     /old_locus_tag="NGO_0659"
     CDS             complement(649678..650688)
                     /locus_tag="NGO_RS03315"
                     /old_locus_tag="NGO0659"
                     /old_locus_tag="NGO_0659"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2Fe-2S iron-sulfur cluster binding
                     domain-containing protein"
                     /protein_id="WP_003706173.1"
                     /translation="MNHTVTLPDQTTFAAGDGETVLSAAARQNLNLPHSCKNGVCGQC
                     KAELASGDIQMGGHSEQALSEAEKAQGKILMCRTTAQSDININIPGCKADALPVRTLP
                     ARIESMVFKHDVAFLKLALPKAPPFAFYAGQYIDLLLPGNVSRSYSIANSPDQEGILE
                     LHIRRRENGVCSEMIFGSEPKVKEKGIVRVKGPLGSFTLQEDSGKPVILPATDTGYAP
                     IRSILLDLIRQNSSRAAHFYWGARHQDDLYALEEAQGLACRLKNTCFTPVLSRPGEGW
                     QGRKGHVQDIAAQDHPDLSEYEVFACGSPAMTEQAKNLFVQQHKLPENLFFSDAFTPS
                     AS"
     gene            complement(650780..652210)
                     /gene="gatB"
                     /locus_tag="NGO_RS03320"
                     /old_locus_tag="NGO0660"
                     /old_locus_tag="NGO_0660"
     CDS             complement(650780..652210)
                     /gene="gatB"
                     /locus_tag="NGO_RS03320"
                     /old_locus_tag="NGO0660"
                     /old_locus_tag="NGO_0660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003698528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase
                     subunit GatB"
                     /protein_id="WP_003688837.1"
                     /translation="MTWETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHASVVECAL
                     PGVLPVMNREVVEKAIKLGLALDAKINRKNVFDRKNYFYPDLPKGYQISQLDLPIVEH
                     GKLEIVVGGDVKTINVTRAHMEEDAGKSVHEGLNGATGIDLNRAGTPLLEVVSEPEMR
                     SAAEAVAYAKALHSLVTWLDICDGNMAEGSFRIDANVSVRPKGQAEFGTRREIKNLNS
                     FRFLDQAINYEAEAQIEILEDGGTVQQATMLFDPEKGETRVMRLKEDAHDYGYFPDPD
                     LLPVIISDAQMQKAKAEMPELPKEMAARFVADYGVSEYDARLLTASRVQAAYFEEAAK
                     ESGQGKPTANWMNGELAATLNKEGMELADSPITAPRLAALVGKIADGTLSGKLAKKAF
                     EAMWAEPETSIAEIIEKHSLQQMTDTGAVEAMVDEVLANNAKAVEQFKSGNEKALNAI
                     VGQVMKTSKGKANPAQVQELIKAKLA"
     gene            complement(652253..653185)
                     /locus_tag="NGO_RS03325"
                     /old_locus_tag="NGO0661"
                     /old_locus_tag="NGO_0661"
     CDS             complement(652253..653185)
                     /locus_tag="NGO_RS03325"
                     /old_locus_tag="NGO0661"
                     /old_locus_tag="NGO_0661"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003702780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VirK/YbjX family protein"
                     /protein_id="WP_003695394.1"
                     /translation="MKQNRTFTFPDFRTVYSYAPLYRLQHLKYTLRKFFGKKEIYAFE
                     QFVNASPIRQGLFLHCPQDAYPLLREFVDRRFNCKRRLDAMTADFLMAEKLFGTDVLC
                     QMEDCRFHLVLAHLSDGISLWLNRNDNCVEEGAWSLSLRDEAGNRLYMATFAFVGTHL
                     LTASVQGPSGEEAKDTVRRITKQLHGLRPQQLMVTALQYFAAALKLDGAIGIAQKHQV
                     KLRWKLKKRVKMNYDAFWQEYGASLERDGYWHLPQTPARKDLADIESKKRSMYRKRYE
                     MLDDMVAKMKDSLKTEARGISDGIQTEKPLRRTV"
     gene            complement(653182..654627)
                     /gene="gatA"
                     /locus_tag="NGO_RS03330"
                     /old_locus_tag="NGO0662"
                     /old_locus_tag="NGO_0662"
     CDS             complement(653182..654627)
                     /gene="gatA"
                     /locus_tag="NGO_RS03330"
                     /old_locus_tag="NGO0662"
                     /old_locus_tag="NGO_0662"
                     /EC_number="6.3.5.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003674612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase
                     subunit GatA"
                     /protein_id="WP_010951102.1"
                     /translation="MTQYTLKQAGSLLQSKQISAVELASAYLAAIAEKNPALNGYITI
                     DQDKTLAEARAADERIAQGNASALTGVPVAYKDIFCQTGWRSACASKMLDNFIFPYTA
                     TVVQNLLDEGMVTLGRTNMDEFAMGSTNENSFYGAAKNPWNPEHVPGGSSGGSAAVVA
                     ARLAPAALGSDTGGSIRQPASHCGITGIKPTYGTVSRFGMVAYASSFDQAGPMAQTAE
                     DCAILLNAMAGFDPKDSTSFEREKEDYTRDLDKPLKGVKIGLPKEYFSEGNSTDVQTA
                     LQNTIDLLKAQGAELVEVSLPQTKLSIPAYYVLASAEAGTNLSRYDGVRYGHRAAQFG
                     DLEEMYGKTRAEGFGSEVKRRIMIGTYVLSHGYYDAYYLKAQKLRRLVADDFQTAFAR
                     CDLILAPTAPSAAPKIGADTSPVETYLSDIYTIAVNLAGLPALTLPAGFSGGGLPVGV
                     QLVGNYFAEAKILGAAHQIQLNSDWHGKRPE"
     gene            complement(654690..654980)
                     /gene="gatC"
                     /locus_tag="NGO_RS03335"
                     /old_locus_tag="NGO0663"
                     /old_locus_tag="NGO_0663"
     CDS             complement(654690..654980)
                     /gene="gatC"
                     /locus_tag="NGO_RS03335"
                     /old_locus_tag="NGO0663"
                     /old_locus_tag="NGO_0663"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009117012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase
                     subunit GatC"
                     /protein_id="WP_003688831.1"
                     /translation="MALTLADVDKIARLSRLQLTAEEKEKSLQELNDIFTMVEQMQNI
                     NTDGIEPMAHPHEVALRLREDEVTETDRAAEYQAVAPEVRNRLYIVPQVIEE"
     gene            655130..655783
                     /locus_tag="NGO_RS03340"
                     /old_locus_tag="NGO0664"
                     /old_locus_tag="NGO_0664"
     CDS             655130..655783
                     /locus_tag="NGO_RS03340"
                     /old_locus_tag="NGO0664"
                     /old_locus_tag="NGO_0664"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012221757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarC family protein"
                     /protein_id="WP_003688829.1"
                     /translation="MGLGMEIGKLIVAFLVLINPFSALSLYLDLTNGHSTKERRKVAR
                     TAAVAVFAVIAVFALIGGALLKVLGISVGSFQVGGGILVLLIAISMMNGNDNPAKQNL
                     GAQPETGQARPARNAGAIAVVPIAIPITIGPGGISTVIIYASAAKTYSDIALIIAAGL
                     VVSAICYAILIVAGKVSRLLGATGLTILNRIMGMMLAAVSVEIIVSGLKTIFPQLAG"
     gene            655788..657131
                     /locus_tag="NGO_RS03345"
                     /old_locus_tag="NGO0665"
                     /old_locus_tag="NGO_0665"
     CDS             655788..657131
                     /locus_tag="NGO_RS03345"
                     /old_locus_tag="NGO0665"
                     /old_locus_tag="NGO_0665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase family protein"
                     /protein_id="WP_003691271.1"
                     /translation="MFHSVNVFTGETLYRRPDQDYAEFERRLADLKMHGRAFAQLGVT
                     ERAARLQKFAGRLEAEKERFAEMVCEEVGRCLHECRAEIVKSIELIRYYARLAPELLA
                     HKTIATQASLSQVRFEPLGVVFAVMPWNYPVWQVLRFAVPAMCAGNACAVKPAPSVAR
                     VSRALFDLASDGIPLAGAWLDEADTLKAVEDTDAMAFTGSTHTGRILAAHAGANLKKT
                     VLELGGSNAFIVMPDADLERAAAEACYSRFRDAGQSCNAAKRIIVTEAAADRFIQLFL
                     AECAKLKMGDPKHPDTTLAPLHREDLRDRVHGQVEDAVSNGAVCLTGGKVPQGSGWFY
                     PATVLDRVNPACRVWREEVFGPVALILRAENEEHAICLANDSPFGLGACIYTADTERA
                     WRFAEKIQAGSVFINRHTSSDLRLPFGGVKDSGYGRELSEFGLYEFVNVKTYWQK"
     gene            complement(657180..657608)
                     /locus_tag="NGO_RS03350"
                     /old_locus_tag="NGO0666"
                     /old_locus_tag="NGO_0666"
     CDS             complement(657180..657608)
                     /locus_tag="NGO_RS03350"
                     /old_locus_tag="NGO0666"
                     /old_locus_tag="NGO_0666"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4124 domain-containing protein"
                     /protein_id="WP_003688825.1"
                     /translation="MNFALSVITFTLASFLPVPPAGTAVFTWKDGGGNSYSDVPKQLH
                     PDQSQILNLRTLQTKPAVKPKPAVDTNADSAKENEKDIAEKNGQLEEEKKKIAETERQ
                     NKEENCRISKMNLKAVGNSNAKNKDDLIRKYNNAVNKYCR"
     gene            657756..657896
                     /locus_tag="NGO_RS03355"
     CDS             657756..657896
                     /locus_tag="NGO_RS03355"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162098116.1"
                     /translation="MEYGYATVYFGKEKENCRQARIKSDEARDSAFGVESVESAVFDI
                     FN"
     gene            complement(657954..659210)
                     /locus_tag="NGO_RS03360"
                     /old_locus_tag="NGO0668"
                     /old_locus_tag="NGO_0668"
     CDS             complement(657954..659210)
                     /locus_tag="NGO_RS03360"
                     /old_locus_tag="NGO0668"
                     /old_locus_tag="NGO_0668"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003752501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RsmB/NOP family class I SAM-dependent RNA
                     methyltransferase"
                     /protein_id="WP_003688821.1"
                     /translation="MNAAQLDHTAKVLAEMLTFKQPADAVLSAYFRKHKKLGRQDRHE
                     IAETAFAALRHYQKISTALRRPHAQPRKAALAALVLGRSTNISQIKDLLDEEETEFFG
                     NLKARKTEFSDGLNTAAELPQWLVEQLQQHWSEEEILAFGRSINQAAPLDIRVNTLKG
                     KRDKVLPLLQAESPDAEATPYSPWGIRLKNKIALNKHELFLDGTLEVQGEGSQLLALL
                     VGAKRGEIIVDFCAGAGGKTLAVGAQMANKGRIYAFDIAEKRLANLKPRMTRAGLTNI
                     HPERIGSEHDTRIARLAGKADRVLVDAPCSGLGTLRRNPDLKYRQSAETVAKLLEQQH
                     SILDAASKLVKPQGCLVYATCSVLPEENELQIKRFLSEHPEFEPVNCAELLQNLKVDL
                     DTGKYLRLDSARHQTDGFFAAVLQRK"
     gene            complement(659246..660115)
                     /locus_tag="NGO_RS03365"
                     /old_locus_tag="NGO0669"
                     /old_locus_tag="NGO_0669"
     CDS             complement(659246..660115)
                     /locus_tag="NGO_RS03365"
                     /old_locus_tag="NGO0669"
                     /old_locus_tag="NGO_0669"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003702776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1853 family protein"
                     /protein_id="WP_003691269.1"
                     /translation="MTDIRISMNYALDALWWKLTSQPVRDLASLLTAPPLWQSGCELS
                     VRELLGERGFRYLLALDADPAPLTDYLAQRAPFDHRLGIYAEELLAFWFTNAPHTKLH
                     AYNLTVFSDGQTLGAADFVVSLNQQPYHIELACKYYGGDQVQNLRGLNPKDTLTDKAA
                     KLVQQFQLVHTSQGKATLAAQDLPENPLPASIVRGIGFFPQGFHAFEPPLNPYGWRGI
                     YIQDWAEYGFERQEARYHLLDRMVYLAPARVAETETLNATEIRRIDQGLIAVLECRPD
                     GFWHEIERIMKAV"
     gene            complement(660156..660971)
                     /locus_tag="NGO_RS03370"
                     /old_locus_tag="NGO0670"
                     /old_locus_tag="NGO_0670"
     CDS             complement(660156..660971)
                     /locus_tag="NGO_RS03370"
                     /old_locus_tag="NGO0670"
                     /old_locus_tag="NGO_0670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003746040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="WP_003688817.1"
                     /translation="MTALKPALPDYLGNIRIILTRTSHPANIGSAARAMKTMGLHRLT
                     IVTPNLMATPMTENPPVFNPDDVQSFALPEESFILASGAADVLHNAEIVATLDEALAD
                     TTIACALTSRRREITAPLQTPRDLVPELLQAANRGEKVALVFGNETFGLSIEEVRACN
                     RLMTINGNPDYFSLNLAQAVQVVCYEIFSQTDSPMTHLQQEDHAATHEQIKGMLAHME
                     SVMDDIGFFNRRNGERLMRRMQSLFGRANTQTEDIDILRGFFNTVSHRIHKKD"
     gene            661005..661205
                     /locus_tag="NGO_RS03375"
     CDS             661005..661205
                     /locus_tag="NGO_RS03375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080282901.1"
                     /translation="MRRLFRSDGEMPSELFFNNVGNLTLRLKQTRVRRYFTRFGRVCP
                     NQINSDFAAPKDCTSEPAVCHP"
     gene            661215..662000
                     /locus_tag="NGO_RS03380"
                     /old_locus_tag="NGO0671"
                     /old_locus_tag="NGO_0671"
     CDS             661215..662000
                     /locus_tag="NGO_RS03380"
                     /old_locus_tag="NGO0671"
                     /old_locus_tag="NGO_0671"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015815663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="WP_003688815.1"
                     /translation="MNPFLNTAFKAARRAGQMMIRAAGNLDAVKTDSKAFNDFVSDVD
                     RNSEIILVEALKEAYPHHKITCEESGFHGKATAEYEWIIDPLDGTTNFLHGHPQYAIS
                     MALLHKGVLQEALVYAPERNDVYMASRGKGALLNDRRIRVSNRIELNRCLIGTGFPVV
                     DQSMMDKYLAILKDFLAKTAGGRREGAASLDLCAVATGRFDGFFEFNLKPWDIAAGAL
                     IVQEAGGIVTDMSGEDAWLESGDIVAANPKVLAQMLKIISAHV"
     gene            662306..662959
                     /locus_tag="NGO_RS03385"
                     /old_locus_tag="NGO0673"
                     /old_locus_tag="NGO_0673"
     CDS             662306..662959
                     /locus_tag="NGO_RS03385"
                     /old_locus_tag="NGO0673"
                     /old_locus_tag="NGO_0673"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1595 family transposase"
                     /protein_id="WP_010951083.1"
                     /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFY
                     RKIRTVANHRLALAADEVFEGPAGPGGSCFGGRRKGRRGRGAAGKAVVFGIPKRNGRA
                     YTVAADDAEPETLLPAVKKKIMPDGIVYADSPGSRGKSDAGGFTRCRINRSKEFADRR
                     NHINGIGNFWNQAKRALRKYNGIDRKPFPPLLRECEFRLNFGTPSRQLKILRDRCGI"
     gene            complement(662987..664057)
                     /gene="leuB"
                     /locus_tag="NGO_RS03390"
                     /old_locus_tag="NGO0674"
                     /old_locus_tag="NGO_0674"
     CDS             complement(662987..664057)
                     /gene="leuB"
                     /locus_tag="NGO_RS03390"
                     /old_locus_tag="NGO0674"
                     /old_locus_tag="NGO_0674"
                     /EC_number="1.1.1.85"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009311437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="WP_003697157.1"
                     /translation="MTKHIAILRGDGIGPEIVAETVRVLDKFIAQGLDADYEYAPLGG
                     EAYDEYGHPYPEFTQNLCRKADAVLLGAVGSPQYDNLDRPLRPERGLLAIRKDLNLFA
                     NLRPAVLYPELANASTLKPEIVAGLDILIVRELTGDIYFGEPRGIRVLENGEHEGYNT
                     MKYSESEIRRIAHVAFQSAQKRSKKVCSVGKANVLETTELWREIFEEIGKQYPDVELS
                     HMYVDNAAMQLVRAPKQFDVIATGNIFGDILSDEASMLTGSIGMLPSASLDENGKGLY
                     EPSHGSAPDIAGQNKANPLATILSLAMLLRYSLNDEARAQQVENSVQKVLQQGLRTGD
                     IYEEGTKLVSCSEMGDAVLAAL"
     gene            complement(664091..664822)
                     /locus_tag="NGO_RS03395"
                     /old_locus_tag="NGO0675"
                     /old_locus_tag="NGO_0675"
     CDS             complement(664091..664822)
                     /locus_tag="NGO_RS03395"
                     /old_locus_tag="NGO0675"
                     /old_locus_tag="NGO_0675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002239104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NgoBV family restriction endonuclease"
                     /protein_id="WP_003697156.1"
                     /translation="MIKLTAQQIFDKLLDEEKILSANGQIRFFLGDVDIIVKQKDVVG
                     NIIQEWLGGWLRKREIEFDVSTNTQMPPDFFLNKKDRSRELLEVKAFNRNACPGFDIA
                     DFKMYSDEIIHKPYMLDVDYLIFGYDMDDNGNVTIKDLWLKKVWQITRSMDGWAINLQ
                     VKKGVVHKIRPGVWYSINKKNMPMFECLEDFVSAIEETVYQNPATRHNASLWKKKFEE
                     AYKKHYNRSISIPRWHEIAHKYKKK"
     gene            complement(664838..666109)
                     /locus_tag="NGO_RS03400"
                     /old_locus_tag="NGO0676"
                     /old_locus_tag="NGO_0676"
     CDS             complement(664838..666109)
                     /locus_tag="NGO_RS03400"
                     /old_locus_tag="NGO0676"
                     /old_locus_tag="NGO_0676"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002223735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA cytosine methyltransferase"
                     /protein_id="WP_003688809.1"
                     /translation="MQQIKFIDLFSGMSGIRKGFEQACRKQSVACECVFTSEIKPAAL
                     EVLKQNYPDEVPYGDITKIETGDIPDFDILLAGFPCQAFSFAGKRLGFEDTRGTLFFD
                     VARILKAKKPKGFILENVEGLVTHDRKDSTQKIGRTLTVILETLEALGYYVSWKVLNA
                     KDFGIPQNRKRIYLTGSLKSKPDLSFETSPSPKLKNILESGLPTESSPFIKKLLKKFP
                     PSELYGKSVKDKRGGKNNIHSWDIELKGAVTEEEKQLLNILLKERRKKKWASEIGIDW
                     MDGMPLTKAQISTFYKHPDLQNILDSLTDKGYLVLEHPKQKIGGQRIKDESLPKGYNI
                     VSGKKSFEINKILDPNDVAPTLVAMDMEHLFVVDNGGLRTLTGKEGLRLFGYPDDYSF
                     DIPKKDRCDLLGNTVAVPVIKAVSERLLHTL"
     gene            complement(666276..666917)
                     /gene="leuD"
                     /locus_tag="NGO_RS03405"
                     /old_locus_tag="NGO0677"
                     /old_locus_tag="NGO_0677"
     CDS             complement(666276..666917)
                     /gene="leuD"
                     /locus_tag="NGO_RS03405"
                     /old_locus_tag="NGO0677"
                     /old_locus_tag="NGO_0677"
                     /EC_number="4.2.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002241612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="WP_010357988.1"
                     /translation="MKAFTKITAIVAPLDRSNVDTDAIIPKQFLKSIKRSGFGPNAFD
                     EWRYLDHGEPGMDNGKRPLNPDFSLNQPRYQGAQILLTRKNFGCGSSREHAPWALDDY
                     GFRAIIAPSFADIFFNNCYKNGLLPIVLTEEQVDRLFKEVEANEGYRLSIDLAEQTLT
                     TPGGETFTFDITEHRKHCLLNGLDEIGLTLQHADKIKAFEEKRRQSQPWLFNG"
     gene            complement(666979..667233)
                     /locus_tag="NGO_RS03410"
                     /old_locus_tag="NGO0678"
                     /old_locus_tag="NGO_0678"
     CDS             complement(666979..667233)
                     /locus_tag="NGO_RS03410"
                     /old_locus_tag="NGO0678"
                     /old_locus_tag="NGO_0678"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003688807.1"
                     /translation="MNKLFVTALSALALSACAGTWQGAKQDTARNLDKTQAAAERAAE
                     QTGNAVEKGWDKTKEAVKKGGNAVGRGISHLGKKIENATE"
     gene            complement(667328..668737)
                     /gene="leuC"
                     /locus_tag="NGO_RS03415"
                     /old_locus_tag="NGO0679"
                     /old_locus_tag="NGO_0679"
     CDS             complement(667328..668737)
                     /gene="leuC"
                     /locus_tag="NGO_RS03415"
                     /old_locus_tag="NGO0679"
                     /old_locus_tag="NGO_0679"
                     /EC_number="4.2.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013448951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="WP_010951104.1"
                     /translation="MTAQTLYDKLWNSHVVREEGDGTVLLYIDRHLVHEVTSPQAFEG
                     LKMAGRKLWRIDSVVSTADHNTPTGDWDKGIQDPISKLQVDTLDQNIKEFGALAYFPF
                     MDKGQGIVHVMGPEQGATLPGMTVVCGDSHTSTHGAFGALAHGIGTSEVEHTMATQCI
                     TAKKSKSMLIAADGKLKAGVTAKDVALYIIGQIGTAGGTGYAVEFGGEAIRSLSMEGR
                     MTLCNMAIEAGARSGMVAVDQTTIDYVKGKPFAPEGEAWDKAVEYWRTLVSDEGAVFD
                     KEYRFNAEDIEPQVTWGTSPEMVLNIGGKVPNPAEETDPVKRSGIERALEYMGLKAGT
                     PLNEIPVDIVFIGSCTNSRIEDLREAAAIAKGHKKAGNVQRVLIVPGSGLVKEQAEKE
                     GLDKIFIEAGFEWREPGCSMCLAMNADRLAPRQRCASTSNRNFEGRQGNGGRTHLVSP
                     AMAAAAAVTGHFTDIRTMA"
     gene            668989..670338
                     /gene="gshA"
                     /locus_tag="NGO_RS03420"
                     /old_locus_tag="NGO0680"
                     /old_locus_tag="NGO_0680"
     CDS             668989..670338
                     /gene="gshA"
                     /locus_tag="NGO_RS03420"
                     /old_locus_tag="NGO0680"
                     /old_locus_tag="NGO_0680"
                     /EC_number="6.3.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003677363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_003688804.1"
                     /translation="MKLPVMSPEHSAQLQAFEAKILSNHAKIEAWFRTQWNAHRPPFY
                     GSVDIRNAGYKISSIDMNLFPGGFNNLNPNFIPLAAVAAQDAVQRACETEKSVLIIPE
                     NHTRNTFYLQNVYALGEIFRSAGCEVRLGSLNPEVTEPAEFETALGDKILLEPLLRTR
                     DRVHLADGFSPCVVLLNNDLSAGIPDILKGIGQTVLPPLHGGWTTRRKTNHFGAYNQV
                     AAEFAKLIDIDEWQINPYFEKIGGLDFQGREGEDALAEAVERVLAKIQAKYDESGIAD
                     KPFVIVKADAGTYGMGVMSVKSSDEVRGLNRKNRNKMAKVKEGLEVSEVIVQEGVYTY
                     ETLNGAVCEPVVYMMDRFVIGGFFRVHEGRGADENLNAGGMVFVPLSNSIPTGNGDNS
                     QEAPEACKRVFEQWDSLGMPRSEKDCDVDNEHNRLYVYGVMARLSLLAASIELEETA"
     gene            670461..671138
                     /locus_tag="NGO_RS03425"
                     /old_locus_tag="NGO0681"
                     /old_locus_tag="NGO_0681"
     CDS             670461..671138
                     /locus_tag="NGO_RS03425"
                     /old_locus_tag="NGO0681"
                     /old_locus_tag="NGO_0681"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002220931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="WP_003688801.1"
                     /translation="MSIKQWPEGERPREKLLERGAAALSDAELLAILLRVGTRGMSAV
                     DLARYLLQEFGSLGRLMSAEVGKLSAYKGMGTASFTQFAVVREIGRRILEEELQEEIT
                     LSDPDTVADYLRFHLGQEKVEVSVALLLNRQNQLIAVRELSRGTVAENTIYIREIVKL
                     ALDEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLDHFIVTSQTVRSF
                     RQLGLMP"
     gene            671211..671936
                     /locus_tag="NGO_RS03430"
                     /old_locus_tag="NGO0682"
                     /old_locus_tag="NGO_0682"
     CDS             671211..671936
                     /locus_tag="NGO_RS03430"
                     /old_locus_tag="NGO0682"
                     /old_locus_tag="NGO_0682"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epoxyqueuosine reductase QueH"
                     /protein_id="WP_010951106.1"
                     /translation="METQNKPTVTDIDRPILVPPGGHKKVLLHSCCAPCSGEVMEAML
                     ASGIGYTIYFYNPNIHPHKEYMLRKEENMRFAEKFGIPFIDKDDDYENDRKEWFAKAK
                     GMEFEPERGIRCTMCFDMRFEKAAQYAHEHGFPVFTSSLGISRWKNMAQINDCGHRAA
                     APYDDVAYWDFNWRKGGGGARMIEISKRENFYQQEYCGCAYSLRDSNAHRKSQGRIPV
                     KLGVLYYGDESTQYEPAPVRVDK"
     gene            672088..673368
                     /locus_tag="NGO_RS03435"
                     /old_locus_tag="NGO0683"
                     /old_locus_tag="NGO_0683"
     CDS             672088..673368
                     /locus_tag="NGO_RS03435"
                     /old_locus_tag="NGO0683"
                     /old_locus_tag="NGO_0683"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003693022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CAP domain-containing protein"
                     /protein_id="WP_003693022.1"
                     /translation="MKSLFIWLLLLGSAAGVFYHTQNQSLPAGELVYPSAPQIRDGGD
                     ALHYLNRIRTQIGLHALAHAPVLENSARRHARYLTLNPEDGHGEHHPDNPHYTAQKLT
                     ERTRLAGYLYNGVHENISTEEEAAESSDSDIRTQQRQVDALMSAIYHRLSLLDRHTDE
                     AGAAFVRENGKTVLVFNQGNGSFERACAKGRRQPEAGRKYYRNACHNGAAVYADEAMP
                     VTELLYTAYPVGGGALPYFYGERPDPVPEYEITGNPASIDFSEAAGKIAMKSFKLYQG
                     KNEIRPVRVLTAGNDPNGRLTAHQFALFPLKPLEYGTLYTAVFDYVRNGRHAQAKWQF
                     RTRKPDYPYFEVNGGETLAVRKGEKYFIHWRGRWCLEACTRYTYRRQFGNSLSILRHE
                     AGGIVFSVSGMAGSRIRLTPEDSPERGVTLYLQD"
     gene            673374..674552
                     /gene="hflX"
                     /locus_tag="NGO_RS03440"
                     /old_locus_tag="NGO0684"
                     /old_locus_tag="NGO_0684"
     CDS             673374..674552
                     /gene="hflX"
                     /locus_tag="NGO_RS03440"
                     /old_locus_tag="NGO0684"
                     /old_locus_tag="NGO_0684"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003698516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase HflX"
                     /protein_id="WP_003706184.1"
                     /translation="MSGRTGRNSATQAQPERVMLVGVMLDKDDTGSNAARLNGFQTAL
                     AEAVELVKAAGGDSVRVETAKRDRPHTALFVGTGKAAELSEAVAADGIDLVVFNHELT
                     PTQERNLEKILQCRVLDRVGLILAIFARRARTQEGRLQVELAQLSHLAGRLIRGYGHL
                     QSQRGGIGMKGPGETKLETDRRLTAHRINALKKQLANLKKQRALRRKSRESGRIKTFA
                     LVGYTNVGKSSLFNRLTKSGIYAKDQLFATLDTTARRLYISPACSIILTDTVGFVSDL
                     PHKLISAFSATLEETVQADVLLHVVDAAARNSGQQIEDVENVLQEIHAHDIPCIKVYN
                     KTDLLPSEEQNTGIWRDAAGKIAAVRISVAENTGIDALREAIAEYCAAAPNTDETEMP
                     "
     gene            674549..677005
                     /locus_tag="NGO_RS03445"
                     /old_locus_tag="NGO0685"
                     /old_locus_tag="NGO_0685"
     CDS             674549..677005
                     /locus_tag="NGO_RS03445"
                     /old_locus_tag="NGO0685"
                     /old_locus_tag="NGO_0685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013448947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal translocating P-type ATPase"
                     /protein_id="WP_010951108.1"
                     /translation="MKKTCFHCGLDVPENLHLTVRYEGEDRETCCVGCQAVAQSIIDS
                     GLGSYYKRRTADAKKTELPPQEILDQIRLYDLPEVQSDFVETHNGTHEAVLMLSGITC
                     AACVWLIEQQLLRTDGIVRIDLNYSTHRCRVVWDDGKIRLSDILLKIRQTGYTAAPYD
                     AQKIEAANQKERKQYIVRLAVAGLGMMQTMMFALPTYLYGGDIEPDFLQILHWGGFLM
                     VLPVVFYCAVPFYQGALRDLKNRRAGMDTPIAAAIIMTFIAGIYSLATNAGQGMYFES
                     IAMLLFFLLGGRFMEHIARRKAGDAAERLVKLIPAFCHRMPGYPAVQDVRESAVVKLQ
                     AGDIVMVKPGETIPVDGTVLEGNSAVNESMLTGESLPVAKMPSEKVTAGTLNTQSPLI
                     IRTDRTGGGTRLSHIVRLLDRALAQKPRTAELAEQYASSFIFGELLLAVPVFIGWTLY
                     ADAHTALWITVALLVITCPCALSLATPTALAASTGTLAREGILIGGKQAIETLSQTTD
                     IIFDKTGTLTQGNPAVRRIELLGSMTEAQVLAVAQSLEQQSEHPLARAILNCRISGGS
                     VPEIQVGQRLNRIGEGVGAQLTVNGETQVWALGRASYVAEISGKEPQTEGGGSAVYLG
                     SQSGFQAVFYLQDPLKDSAAEAVRQLAGKNLTLHILSGDREEAVAETARALGIAHYRA
                     QAMPEDKLEYVEALQKEGKKVLMIGDGINDAPVLAQADVSAAAVGGTDIARDGADIVL
                     LNEDLRTVAHLLDQARRTRHIIRQNLIWAGAYNIIAVPLAVLGYVQPWIAALGMSFSS
                     LAVLGNALRLHKRGEMPSEQ"
     gene            complement(677673..678449)
                     /locus_tag="NGO_RS03450"
                     /old_locus_tag="NGO0687"
                     /old_locus_tag="NGO_0687"
     CDS             complement(677673..678449)
                     /locus_tag="NGO_RS03450"
                     /old_locus_tag="NGO0687"
                     /old_locus_tag="NGO_0687"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014575386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin--NADP reductase"
                     /protein_id="WP_003702769.1"
                     /translation="MAAFNTQKVLSVHHWTDAYFTFTCIRDESLRFENGQFVMVGLMA
                     DGKPLMRAYSVASANWEEHLEFFSIKVQDGPLTSRLQHLKVGDEVLISKKPTGTLVAG
                     DLNPGKHLYLLSTGTGIAPFLSITKDPEIYEQFEKIILVHGVRYKKDLAYYDRFTKEL
                     PEHEYLGDLVKEKLIYYPIVSREEFEHRGRLTDLMVSGKLFEDIGLPKINPQDDRAML
                     CGSPAMLKDTCKVLDDFGLTVSPKTGVRGDYLIERAFVDQ"
     gene            complement(678637..679419)
                     /locus_tag="NGO_RS03455"
                     /old_locus_tag="NGO0688"
                     /old_locus_tag="NGO_0688"
     CDS             complement(678637..679419)
                     /locus_tag="NGO_RS03455"
                     /old_locus_tag="NGO0688"
                     /old_locus_tag="NGO_0688"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003750451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010360148.1"
                     /translation="MQETRFSILLDELAAKQEATIAPYLLADGTKVWVRKAGRHNARW
                     RYALLGMVARYLKLGVLKPVPSLGGEPAIATESKRLYELRSAGIAVPELLALRKNALM
                     FGNLEGIPLDTQIRQEAEAGKADAWLAGLEAIARVHKKRQFLSQAFARNMMWDGKNIS
                     FLDFEDDPSEVLTIAQCQARDWLCYIHSTALILKNGGLLEAAAEKWGGVLSDQPAEIQ
                     KLIAGTVKPILPIRRLEHPRWGRDALRLAASISLISLADMPP"
     gene            complement(679478..680887)
                     /locus_tag="NGO_RS03460"
                     /old_locus_tag="NGO0689"
                     /old_locus_tag="NGO_0689"
     CDS             complement(679478..680887)
                     /locus_tag="NGO_RS03460"
                     /old_locus_tag="NGO0689"
                     /old_locus_tag="NGO_0689"
                     /EC_number="4.2.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002242742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="WP_003688790.1"
                     /translation="MRYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRETLD
                     KWRGLAYPELAFEIMCLFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKIQ
                     ALSNGPTLAFKDMAMQFLGNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVN
                     VFMLSPDGKMSAFQRAQMYSLQDGNIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIG
                     TVNSINWGRIVAQVVYYFAGYFNATSSNDETVSFCVPSGNFGNVCAGHIAKQMGLPVR
                     CLIVATNENDVLDEFFKTGAYRPRNSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQ
                     EINTLWAEVAAGKGFDLRFALDKVGGKYGFTSGKSTHADRLATIRQVYEQDKELIDPH
                     TANGVKVAREVREAGETVVCLETALAAKFDATIREAVGDVAIPRPAALEGLENLPQRV
                     QTVPNSADAVKGIIEQTLA"
     gene            complement(680960..681328)
                     /locus_tag="NGO_RS03465"
                     /old_locus_tag="NGO0690"
                     /old_locus_tag="NGO_0690"
     CDS             complement(680960..681328)
                     /locus_tag="NGO_RS03465"
                     /old_locus_tag="NGO0690"
                     /old_locus_tag="NGO_0690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003710052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003691259.1"
                     /translation="MNKTLSILPAAILLGGCAAGGNTFGSLDGGTGMGGSIVKMTVES
                     QCRAELDRRSEWRLTALAMSAEKQAEWENKICGCATEEAPNQLTGNDVMQMLNQSTRN
                     QALAALTVKTVSACFKRLYR"
     gene            complement(681579..683030)
                     /locus_tag="NGO_RS03470"
                     /old_locus_tag="NGO_03625"
                     /pseudo
     CDS             complement(681579..683030)
                     /locus_tag="NGO_RS03470"
                     /old_locus_tag="NGO_03625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217121.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3360 family protein"
     gene            683284..684200
                     /locus_tag="NGO_RS03475"
                     /old_locus_tag="NGO_03630"
                     /pseudo
     CDS             683284..684200
                     /locus_tag="NGO_RS03475"
                     /old_locus_tag="NGO_03630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002255891.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
     gene            complement(684226..684697)
                     /locus_tag="NGO_RS03480"
                     /old_locus_tag="NGO_0693"
                     /pseudo
     CDS             complement(684226..684697)
                     /locus_tag="NGO_RS03480"
                     /old_locus_tag="NGO_0693"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003691253.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(684728..687346)
                     /locus_tag="NGO_RS03485"
                     /old_locus_tag="NGO0694"
                     /old_locus_tag="NGO_0694"
     CDS             complement(684728..687346)
                     /locus_tag="NGO_RS03485"
                     /old_locus_tag="NGO0694"
                     /old_locus_tag="NGO_0694"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003706192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter outer membrane beta-barrel
                     domain-containing protein"
                     /protein_id="WP_010951109.1"
                     /translation="MNQEGITAHGNATITLKAKENNKITVENAAYSSDGISTLINRTG
                     ARPGTRDDGNKIILEAGGDNIVTMKSGDADADYVNNSKVLTETPYYKSKRGSNGIFAY
                     GDKSLVKLIGENNIVKSEISEKSKALNGGFRHIGIYSWQNAKVELSAKSDNIVQGGIW
                     GLYSNNSSISLKGKNNVISNPKYNVFAYKKAKVDLTVENKNTLSDAEFGVYALNTSMV
                     NLSSKDNNEVKSTQVGLYSQDGGSINVDRKDNIIEGDAVALVGKGGSQNIRASRTNLI
                     SSKSLGIHAEQAAKIAITGASNTIHASNAAIRSLDKSEVKIDGQITIDSNVANLARQD
                     GSIHLNYKDDTRITGATVSDKGLVAIKPLNNTNIVADTIHYKGDVLAVNKGKVELDFT
                     PNILLAGRLDNFSGLTDSKHKNLFENYVANLDSKSAGEINFNLAKDALWTMTGQSWLD
                     KLEGQGTIDFNNDAKTSGRALHIGELAGANKFLMHLNKDGIHSDMLYVKKGTSTPQEV
                     VVKNLSEVLDSMNYGERLRFATVTNSKNEFVNGKKYIDDTHLMEDALTVEYSAHNGDK
                     NNKDDYNKSFNGSEMTAEKAGDDYVNKTYTDNRQNVYLVKQATGNPSRNVKNINDMFD
                     STAHYAFTLDTYAKREGERAFSTLDKKEGDWIRLTHTRVIQSNAFRFHNNDFEIGYDR
                     FSLNEQEKKRKWGISLDYGHGRTSLWNTFGKDKIRKYELALYNTTQYIDKEGDETGYI
                     DNVLKIGKLRNRVIARNHMGQLWGKGKYSNTLFSISTEYGRRKFLDDDKLWRITPQVQ
                     LQYSYLRGTGYRIDNGINVNLSHANSLIGRLGLDVVRKFDGGKKLFYIKGNIFHEFLG
                     SRSFKAFEGKSHYAQK"
     gene            complement(687402..687863)
                     /locus_tag="NGO_RS03490"
                     /old_locus_tag="NGO_03645"
     CDS             complement(687402..687863)
                     /locus_tag="NGO_RS03490"
                     /old_locus_tag="NGO_03645"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter"
                     /protein_id="WP_105211394.1"
                     /translation="MRVQVFLRGIETAFKSNTVLTGNNNKISITTEGDGLGLGVNGLQ
                     SNSPYSGHTTGTFINNQPSNTTQPSLDGTSTIELKAVKGNNEVDLNVKNHASVKGIIT
                     SHSAKATLEAEEDNIVRVKNPDTKTALINAWKEKYPNNSPEPYRVGGSIHD"
     gene            complement(687832..688380)
                     /locus_tag="NGO_RS03495"
                     /old_locus_tag="NGO_03650"
     CDS             complement(687832..688380)
                     /locus_tag="NGO_RS03495"
                     /old_locus_tag="NGO_03650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003695363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_105211395.1"
                     /translation="MELITTGEGADGDLLVNGSYGIRSFADLKLEYKPELSVRSNHDI
                     IFNNDFQSVDVQPYSGNIHLDVKGKIQFNLNVADKVTDPTTHQEKLVNDNALVRYVNN
                     ITPSDENDKGSISFHSKTGNLFNMNVNVHKGTHHFGIHNLRNTNVNLTAEDGDNVVAI
                     KGKLAEPMPAGKVESTSFFKGY"
     gene            688651..689961
                     /locus_tag="NGO_RS03500"
                     /old_locus_tag="NGO0696"
                     /old_locus_tag="NGO_0696"
     CDS             688651..689961
                     /locus_tag="NGO_RS03500"
                     /old_locus_tag="NGO0696"
                     /old_locus_tag="NGO_0696"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003742707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication-associated recombination protein A"
                     /protein_id="WP_003688780.1"
                     /translation="MTDLFVREPDAPLAERLRPHTLDDVIGQQHLIGEGKPLRVAVEG
                     GKPHSMLLWGPPGVGKTTLARILAQSFNAQFLPVSAVFSGVKDIRGAIDKAEIALQQG
                     RATILFVDEVHRFNKAQQDAFLPHVESGLLTFIGATTENPSFEVNPALLSRAQVYVLQ
                     SLSSDDLKKLIAKVLALPEYRDFTIEADVQELLVNTADGDARRLLNLLEQLLRAADTR
                     RLKILTTEFLADSLGAQIRRFDKGGESFYNQISALHKSVRGSHPNAALYWFCRMLDGG
                     TDPRYLARRIVRIAWEDIGLADPRAFQIANDAAATFERLGSPEGELALAQAVLYLAAA
                     AKSNAGYKAYNQMRRFVKENASDEVPVHLRNAPTKLMKELGYGREYRYAHDEPNAYAA
                     GESYMPDGLDEPDFYQPVPRGLEIKIGEKLAWLKSLDEEALKAK"
     gene            690081..693086
                     /locus_tag="NGO_RS03505"
                     /old_locus_tag="NGO0697"
                     /old_locus_tag="NGO_0697"
     CDS             690081..693086
                     /locus_tag="NGO_RS03505"
                     /old_locus_tag="NGO0697"
                     /old_locus_tag="NGO_0697"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002232507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction endonuclease subunit R"
                     /protein_id="WP_025456474.1"
                     /translation="MSQTHNENSRVKIPAVLHLMRLGYDYLSLKNANWDRQTNIFPEI
                     FVDSLCRINPDLPPDDARRLLADIRLELDNEDLGQKFYERLTNQSGGKKLIDFQNFDN
                     NSFHVVTELPCINGDEAFRPDIALLVNGMPLVFIEVKKPNNKGGIGEERERMGKRAKN
                     PKFRRFINITQFMIFSNNMEYDDGATEPAQGAFYASSACGKPVFNYFREEHKLNLTEL
                     LDTLSDDLENNVLQDNNLPVIKHSPEFISNKSPDTPTNRILTSLLCRERLSFLLQHGL
                     TYVKASQGLVQKHIMRYPQLFATLAIEKHLANGGKKGVIWHTQGSGKTALAYYNTRYL
                     THYYAKQGIVPKFYFIVDRLDLLKQAQREFTARDLVVHTIDSREAFAADIKSAQTLHN
                     HAGKAEITVVNIQKFQDDPDVVARNDYDLAIQRVYFLDEVHRSYNPKGSFLANLNQSD
                     VNAVKIGLTGTPLIGVTAGNVNTRELFGDYIHKYYYNASIADGYTLRLIREEIGSRYK
                     AQLQEALAQLEIEKGSFDRKEIYAHPHFVHPMLDYILDDFAKFRKTNQDESLGAMVVC
                     DSAEQARQLFEHFQTASDHNFTAALILHDVGTKEERDQWVKDFKAGKIDILFVYNMLL
                     TGFDAPRLKKLYLGRLIKAHNLLQTLTRVNRTYKSYRYGYVVDFADIEREFDKTNRAY
                     WDELSNELGDEIGSYSQLFKTAEEIEQEIADIKNALFDFDTENAEEFCSQISQIEDKK
                     QLLALKKALQTAKELYNILRLQGSHEFLAHLDFDKLNLLYRETAARLDTLNLAEKLQQ
                     GDTAHLLNEALEDVYFQFVKIGEAELKLADDLKDIMRKVREGLAGNFDQDDPEYISLR
                     EELERIFKKKNLAEVGQEEMQANIATLQTVYTKIKEPNRQNDLLRHKYGGDAKYARIH
                     KRLMENAALYGDKLKVFNALSGVKTDADQKVLDMEQILDNQNYFEKQMQGIVLKRFRT
                     EQQFPVQPADIQAINRLLVREYLKESGRI"
     gene            693136..>693366
                     /locus_tag="NGO_RS03510"
                     /old_locus_tag="NGO_0698"
                     /pseudo
     CDS             693136..>693366
                     /locus_tag="NGO_RS03510"
                     /old_locus_tag="NGO_0698"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004143539.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyacid dehydrogenase"
     gene            693416..694618
                     /locus_tag="NGO_RS03515"
                     /old_locus_tag="NGO0699"
                     /old_locus_tag="NGO_0699"
     CDS             693416..694618
                     /locus_tag="NGO_RS03515"
                     /old_locus_tag="NGO0699"
                     /old_locus_tag="NGO_0699"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003693039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit S"
                     /protein_id="WP_003691244.1"
                     /translation="MNHFKKQQIQNIADFNPREQLAKGALAKSVPMAMLKEFQRQITG
                     YEIKAFNGGAKFRNGDTLLAKITPCLENGKTAFVDILDDGEVAFGSTEFIVLRAKNET
                     NPEFLYYFAISPDFRKRAIECMEGTSGRQRVNENALKTLELPIPEPQIQQSIAAVLSA
                     LDKKIALNKQINARLEEMAKTLYDYWFVQFDFPDANGKPYKSSGGDMVFDETLKREIP
                     KGWGSIELQSCLAKIPNTTKILNKDIKDFGKYPVVDQSQDFICGFTNDEKSILNPQDA
                     HIIFGDHTRIVKLVNFQYARGADGTQVILSNNERMPNYLFYQIINQIDLSSYGYARHF
                     KFLKEFKIILPSKDISQKYNEIANTFFVKVRNNLKQNHHLTQLRDFLLPMLMNGQVSV
                     RCSGARDG"
     gene            694611..695171
                     /locus_tag="NGO_RS03520"
                     /old_locus_tag="NGO0700"
                     /old_locus_tag="NGO_0700"
     CDS             694611..695171
                     /locus_tag="NGO_RS03520"
                     /old_locus_tag="NGO0700"
                     /old_locus_tag="NGO_0700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002239757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002239757.1"
                     /translation="MDKLFKILLNISSTSLLLSIYFIKSQYYILDLTWFYRVISNHWI
                     EPISKLSLLFYFLIPFIATATVLWLSKYLGKDEFKQGEVKELEYVNDNFLPSYLGYFF
                     VALSIPDNNLFLLFVMYGIIFLLVSCSKSFYFNPVFFLFGYRFYQAKTESGLLLVLIS
                     KQEFRTPQSVSSIAVYRINNFTFLEK"
     gene            695182..696024
                     /locus_tag="NGO_RS03525"
                     /old_locus_tag="NGO0701"
                     /old_locus_tag="NGO_0701"
     CDS             695182..696024
                     /locus_tag="NGO_RS03525"
                     /old_locus_tag="NGO0701"
                     /old_locus_tag="NGO_0701"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003688774.1"
                     /translation="MNFVLAKITCKKDLVKILSDDHIFPDFSYENLNFITYNYDYNLD
                     DDTWFQIENLKNQDFCPKFLDNSNLFDSKMFSEIKKEEINIEKLKYLVSCTNDALFFQ
                     KITSSLLLKKKHLLTICGNGAKLCEPQDLLVIKDIPDAVYIIKDDKLIFRTLSSISNI
                     FKGIEDLYREATNTEVQQFLESDFIDLKEDFLSEKVSIPNRKRIALVQDRLNNMTLDQ
                     RQELLNYLAEYNNNILKFNADGSRVEISTDVQLKHLLYGIDERYYTTALGKEKRLANS
                     VQPI"
     gene            696091..697692
                     /locus_tag="NGO_RS03530"
                     /old_locus_tag="NGO0702"
                     /old_locus_tag="NGO_0702"
     CDS             696091..697692
                     /locus_tag="NGO_RS03530"
                     /old_locus_tag="NGO0702"
                     /old_locus_tag="NGO_0702"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002232504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent DNA methyltransferase"
                     /protein_id="WP_003688773.1"
                     /translation="MTEQHFTEQIKSLIDSLKTICANYGLGNDGNEFKIISQAFLYKF
                     LNDKYDFEVKKIRKEKPDEPIEFVNMDIDGKTAVLKPEHSIKYLSERQNGADFAKLFD
                     DTLTDIAAHNAELFSVKTEGGAKIVLFERISQYITDEGRRDDFCRALISKLAGFSFEA
                     IFAQKFDFFATIFEYLIKDYNSNSGGKYAEYYTPHAVARIMADILVPEDVRGQIRSVD
                     VYDPSAGSGTLLMNVAHAIGEDKCMIYTQDISQKSSNLLRLNLILNNLVHSLNNVVQG
                     NTILSPAHKDASGCLKKFDFIVSNPPFKLDFSDFRDRLESDENHERFFAGIPKIKPTK
                     KEKMEIYQLFIQHILFSLKENGKAAIVLPTGFITAKSGIDKKIREYLVENKMLAGVVS
                     MPSNIFATTGTNVSILFIDKTNKDKVVLIDASGLGEKIKDGKNQKTVLSCEEEQKICN
                     TFTNKQAVEDFSVVVGYDEIKAKNHSLSAGQYFEVKIDYVDISADEFAQKIAGFSADL
                     DKLFAESAELEKEIKDRLAMLKFNS"
     gene            697703..697840
                     /locus_tag="NGO_RS03535"
                     /old_locus_tag="NGO_03690"
     CDS             697703..697840
                     /locus_tag="NGO_RS03535"
                     /old_locus_tag="NGO_03690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010358022.1"
                     /translation="MKPVKLKMPSESLSDGILFGLENTYAVLSPKERIQKTKATGIHR
                     K"
     gene            complement(698003..699340)
                     /gene="ribB"
                     /locus_tag="NGO_RS03540"
                     /old_locus_tag="NGO0704"
                     /old_locus_tag="NGO_0704"
     CDS             complement(698003..699340)
                     /gene="ribB"
                     /locus_tag="NGO_RS03540"
                     /old_locus_tag="NGO0704"
                     /old_locus_tag="NGO_0704"
                     /EC_number="4.1.99.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002227297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxy-2-butanone-4-phosphate synthase"
                     /protein_id="WP_014580213.1"
                     /translation="MTDTAGLRRRNLRQWIAEHYGGLQNRFAEAVALNTGELSALLKN
                     KSFGEKKARKIEQAAKMPAFWLDTEHTGRPPGHTGKHTMSHISPIPEILADIKAGKMV
                     IITDAEDRENEGDLLMAAQFVTPEAVNFMIKHARGLVCLPMEGAMVEKLGLPMMTQKN
                     GAQYGTNFTVSIEAAHGITTGISAADRALTIQTAVSPTAKPADIVQPGHIFPLRAQKG
                     GVLVRAGHTEAGVDLAQMNGLIPAAVICEIINDDGTMARMPELMKFAEEHKLKIGTIA
                     DLIEYRSRTESLLEDMGDAPVQTPWGEFQQHVYVDKLSGETHLALVKGTPSADTETLV
                     RVHEPFSVMDFIQANPRHSWSLPKALERVQQAESGVVILLHHTEDGASLLDRTLPKGA
                     NQAYKWDSKSYGIGAQILAGLHVKKLRVLGQPSSFTGLTGFGLEVVGFEEAEK"
     gene            complement(<699927..700178)
                     /locus_tag="NGO_RS03545"
                     /pseudo
     CDS             complement(<699927..700178)
                     /locus_tag="NGO_RS03545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_060537127.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            700379..701170
                     /locus_tag="NGO_RS03550"
     CDS             700379..701170
                     /locus_tag="NGO_RS03550"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="filamentous hemagglutinin N-terminal
                     domain-containing protein"
                     /protein_id="WP_003691236.1"
                     /translation="MNKTLYRVIFNRKRGAVVAVAETTKREGKSCADSGSGSVYVKSV
                     SFIPTHSKAFCFSALGFSLCLALGTVNIAFADGIITDKAAPKTQQATILQTGNGIPQV
                     NIQTPTSAGVSVNQYAQFDVGNRGAILNNSRSNTQTQLGGWIQGNPWLTRGEARVVVN
                     QINSSHPSQLNGYIEVGGRRAEVVIANPAGIAVNGGGFINASRATLTTGQPQYQAGDF
                     SGFKIRQGNAVIAGHGLDARDTDFTRILVCQQNHLDQYGRTSRHS"
     gene            702491..704650
                     /locus_tag="NGO_RS03555"
     CDS             702491..704650
                     /locus_tag="NGO_RS03555"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hemagglutinin repeat-containing protein"
                     /protein_id="WP_162098493.1"
                     /translation="MQTEKDGLHNEQTFGEKKVFSENGKLHNYWRARRKGHDETGHRE
                     QNYTLPEEITRDISLGSFAYESHSKALSRHAPSQGTELPQSNRDNIRTAKSNGISLPY
                     TPNSFTPLPGSSLYIINPANKGYLVETDPRFANYRQWLGSDYMLGSLKLDPNNLHKRL
                     GDGYYEQRLINEQIAELTGHRRLDGYQNDEEQFKALMDNGATAARSMNLSVGIALSAE
                     QAAQLTSDIVWLVQKEVKLPDGGTQTVLMPQVYVRVKNGGIDGKGALLSGSNTQINVS
                     GSLKNSGTIAGRNALIINTDTLDNIGGRIHAQKSAVTATQDINNIGGILSAEQTLLLN
                     AGNNINNQSTAKSSQNAQGSSTYLDRMAGIYITGKEKGVLAAQAGKDINIIAGQISNQ
                     SDQGQTRLQAGRDINLDTVQTGKYQEIHFDADNHTIRGSTNEVGSSIQTKGDVTLLSG
                     NNLNAKAAEVGSAKGTLAVYAKNDITISSGIHAGQVDDASKHTGRSGGGNKLVITDKA
                     QSHHETAQSSTFEGKQVVLQAGNDANILGSNVISDNGTRIQAGNHVRIGTTQTQSQSE
                     TYHQTQKSGLMSAGIGFTIGSKTNTQENQSQSNEHTGSTVGSLKGDTTIVASKHYEQT
                     GSNVSSPEGNNLISTQSMDIGAAQNQLNSKTTQTYEQKGLTVAFSSPVTDLAQQAIAV
                     AHKAANKSDKAKTTALMPWRLPMQVGRPIKQAKAHKT"
     gene            704610..705743
                     /locus_tag="NGO_RS03560"
     CDS             704610..705743
                     /locus_tag="NGO_RS03560"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hemagglutinin repeat-containing protein"
                     /protein_id="WP_025455886.1"
                     /translation="MAGLSNRQRRTKLSQWYNQCQTSQHLHNLRRTAKPTNHPSSSQS
                     SPSESNSSRRQNYPYCRRCGEQSNINITGSGVSGRAGTGLIADKQIHLQSAEQSNTER
                     SQNKSAGWNAGAAVSFGQGGWSLGVAAGGNVGKGYGYGDSVTHRHSHIGDKGSQTLIQ
                     SGGDTIIKGAQVRGKGVQVNAKNLSIQSVQDRETYQSKQQNAGAQVTVGYGFSASGDY
                     SQSKIRADHASVTEQSGIYAGEDGYQIKVGNHTGLKGGIITSSQSAKDKGKNRFSTGT
                     LAGSDIQNYSQYEGKSFGLGASVAVSGKTLGQGAKNKPQDKHLTSIADKNGASSSVGY
                     GSDSDSQSSITKSGINTQKHSNHRRSRTNQADRQNSGTNQSRY"
     gene            705814..706260
                     /locus_tag="NGO_RS03565"
                     /old_locus_tag="NGO_03710"
     CDS             705814..706260
                     /locus_tag="NGO_RS03565"
                     /old_locus_tag="NGO_03710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003693044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003693044.1"
                     /translation="MQSELDLQRTVSQDFSKNVQQTNTEINQHLDKLKADKEAAETAA
                     AEALANGDMETAKRKAHEAQDAAAKADNWQQGKVILNMLASGLAEPTQSGAGIAAATA
                     SPDVSYAIGQHFKDLAGQNANGKLTASQETAHVLAHAVLGAAVAAA"
     gene            706285..706518
                     /locus_tag="NGO_RS03570"
                     /old_locus_tag="NGO_03715"
     CDS             706285..706518
                     /locus_tag="NGO_RS03570"
                     /old_locus_tag="NGO_03715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VENN motif pre-toxin domain-containing protein"
                     /protein_id="WP_003688757.1"
                     /translation="MGAGGSEAAAPIIGKWLYGKGDGGSLNAEEKETVSAITRMLGTA
                     AGAAEGNSSADAVWGCFQTASDFASSFSYPINM"
     gene            706556..707353
                     /locus_tag="NGO_RS03575"
                     /old_locus_tag="NGO_03720"
     CDS             706556..707353
                     /locus_tag="NGO_RS03575"
                     /old_locus_tag="NGO_03720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012503667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ShlB/FhaC/HecB family hemolysin
                     secretion/activation protein"
                     /protein_id="WP_012503667.1"
                     /translation="MFLCIAIIARLHYLDQSYETFLFLQKCISSLSLITVSPIIDGCL
                     PTLTSAAPTPEAVSQQQDILQRQREKQLREQMQPEQDVRLDGTDTGIEKMATQVGGAN
                     SDEASPCFPISEVELVGEEAAKFRFALNHALCQTHFVSGKCLHAGDINQIMSLAQNAL
                     IGRGYTTTRILAAPQDLNSGKLQLTLMPGYLRSIRIDRSNDDQTHAGRIAAFQNKFPT
                     RSNDLLNLRDLEQGLENLKCLPTAEADLQIVPVEREPNQSDVVVQWR"
     gene            707384..708412
                     /locus_tag="NGO_RS03580"
                     /old_locus_tag="NGO_03725"
     CDS             707384..708412
                     /locus_tag="NGO_RS03580"
                     /old_locus_tag="NGO_03725"
                     /inference="COORDINATES: protein motif:HMM:NF015803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ShlB/FhaC/HecB family hemolysin
                     secretion/activation protein"
                     /protein_id="WP_012503666.1"
                     /translation="MDNSGSEATGKYQGNITFSADNPFGLSDMFYVNYGRSIGGTPDE
                     ENFDGHRKEGGSNNYAVHYSAPFGKWTWAFNHNGYRYHQAVSGLSEVYDYNGKSYNTD
                     FGFNRLLYRDAKRKTYLSVKLWTRETKSYIDDAELTVQRRKTTGWLAELSHKGYIGRS
                     TADFKLKYKHGTGMKDALRAPEEAFGEGTSRMKIWTASADVNTPFQIGKQLFAYDTSV
                     HAQWNKTPLTSQDKLAIGGHHTVRGFDGEMSLPAERGWYWRNDLSWQFKPGHQLYLGA
                     DVGHVSGQSAKWLSGQTLAGTAIGIRGQIKLGGNLHYDIFTGRALKKPEYFQTKKWVT
                     GFQVGYSF"
     gene            708430..708798
                     /locus_tag="NGO_RS03585"
                     /old_locus_tag="NGO0709"
                     /old_locus_tag="NGO_0709"
     CDS             708430..708798
                     /locus_tag="NGO_RS03585"
                     /old_locus_tag="NGO0709"
                     /old_locus_tag="NGO_0709"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003691231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951111.1"
                     /translation="MYDKIHKSCRFFAGSFCFMFGAVPDNRVKFPLAHYFKIEILYFI
                     SLLLKRCSHFFIGFIIHHLIYGFWRQGLTAFAAVIDFWNRGNAFKESKAIRPDADGGA
                     IIHLLEFVAIGADSCDDYVG"
     gene            complement(709174..710214)
                     /gene="mutY"
                     /locus_tag="NGO_RS03590"
                     /old_locus_tag="NGO0710"
                     /old_locus_tag="NGO_0710"
     CDS             complement(709174..710214)
                     /gene="mutY"
                     /locus_tag="NGO_RS03590"
                     /old_locus_tag="NGO0710"
                     /old_locus_tag="NGO_0710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017629112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="A/G-specific adenine glycosylase"
                     /protein_id="WP_012503665.1"
                     /translation="MNTPIPFSERLIRWQKQHGRHHLPWQVKNPYCVWLSEIMLQQTQ
                     VAAVLDYYPRFLEKFPTVQTLAAAPQDEVLSLWAGLGYYGRARNLHKAAQQIVGQFGG
                     TFPSERKDLETLCGVGRSTAAAISAFAFNRRETILDGNVKRVLCRVFAQDGNPQDKKF
                     ENSLWTLAESLMPSENADMPTYTQGLMDLGATVCKRTKPLCRQCPMADICEAKKQNRT
                     AELPRKKTALEVQTLPLYWLIVRNRDGAILLEKRTAKGIWGGLYCVPCFESLNGLSDF
                     AAKLSLTMADMDEQTALTHRLTHRLLMITPFEGQMPSEHHSDGIWIKPGHLKDYGLPK
                     PLEIYLNGNRLE"
     gene            710377..711416
                     /locus_tag="NGO_RS03595"
                     /old_locus_tag="NGO0711"
                     /old_locus_tag="NGO_0711"
                     /pseudo
     CDS             710377..711416
                     /locus_tag="NGO_RS03595"
                     /old_locus_tag="NGO0711"
                     /old_locus_tag="NGO_0711"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002225132.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-dependent alcohol dehydrogenase family
                     protein"
     gene            711637..711822
                     /locus_tag="NGO_RS03600"
                     /old_locus_tag="NGO0712"
                     /old_locus_tag="NGO_0712"
     CDS             711637..711822
                     /locus_tag="NGO_RS03600"
                     /old_locus_tag="NGO0712"
                     /old_locus_tag="NGO_0712"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003688739.1"
                     /translation="MGYFGGNGGYLKRKQPKNLWLDVGCLKKRNFAKVSERYFLTTVN
                     LLVSAAHHGILPIGRFL"
     gene            complement(712011..712649)
                     /locus_tag="NGO_RS03605"
                     /old_locus_tag="NGO0713"
                     /old_locus_tag="NGO_0713"
     CDS             complement(712011..712649)
                     /locus_tag="NGO_RS03605"
                     /old_locus_tag="NGO0713"
                     /old_locus_tag="NGO_0713"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 4-hydroxy-2-oxoglutarate
                     aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase"
                     /protein_id="WP_003695341.1"
                     /translation="MSKLTPREILTAGAVVPVMAIDDLSTAVDLSRALVEGGIPTLEI
                     TLRTPVGLEAIRLIAKEMPNAIIGAGTVTNPEQLKAVEDAGAVFAISPGLHESLARAG
                     RNSGIPLIPGVATPGEVQLALEHGIDTLKLFPAEVVGGKAMLKALYGPYADVRFCPTG
                     GISLATAPDYLALPNVLCVGGSWLTPKEAVKNKDWDTITRLAKEAAALKPKA"
     gene            complement(712859..714694)
                     /gene="edd"
                     /locus_tag="NGO_RS03610"
                     /old_locus_tag="NGO0714"
                     /old_locus_tag="NGO_0714"
     CDS             complement(712859..714694)
                     /gene="edd"
                     /locus_tag="NGO_RS03610"
                     /old_locus_tag="NGO0714"
                     /old_locus_tag="NGO_0714"
                     /EC_number="4.2.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphogluconate dehydratase"
                     /protein_id="WP_003691226.1"
                     /translation="MNHTPIHPKLAEITGRIIERSRPTREKYLAKIRSAKQMGRLERN
                     QLGCSNLAHGYAAMPKSIKIEMLQETVPNLGIITAYNDMVSAHQPFKDFPDQIKDEAQ
                     KNGATAQVAGGTPAMCDGITQGYAGMELSLFSRDVIAMSTAVGLSHQMFDGSLFMGVC
                     DKIVPGLMIGALSFGHIPGIFVPAGPMSSGIGNKEKARTRQLFAEGKVGRDELLKSEM
                     GSYHSPGTCTFYGTANSNQMMMEMMGVHLPAAAFVHPYTDLREALTRYAAGHLARGIK
                     NGTIKPLGEMLTEKSFINALIGLMATGGSTNHTMHLVAMARAAGVILNWDDFDEISSI
                     IPLLIRVYPNGKADVNHFTAAGGLPFVIRELLDAGLLHDDVDTVVGHGMRHYTKEPFL
                     IDGKLEWREAPETSGNDDILRKADNPFSPDGGLRLMKGNIGRGVVKVSAVREGCRIIE
                     APAIVFNDQREVLAAFERGELERDFICVVRYQGPRANGMPELHKLTPPLGILQDRGFK
                     VALLTDGRMSGASGKVPASIHMTPEALMGGNIAKIRTGDLIRFDSVTGELNVLINEAE
                     WNVREVERIDLGANQQGCGRELFAGFRSMTSSAETGAMSFGGEFA"
     gene            715214..716659
                     /gene="zwf"
                     /locus_tag="NGO_RS03615"
                     /old_locus_tag="NGO0715"
                     /old_locus_tag="NGO_0715"
     CDS             715214..716659
                     /gene="zwf"
                     /locus_tag="NGO_RS03615"
                     /old_locus_tag="NGO0715"
                     /old_locus_tag="NGO_0715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002220804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate dehydrogenase"
                     /protein_id="WP_003693052.1"
                     /translation="MSTQTNFDLVLFGATGDLAMRKLLPCLYQAHVAGLLHPEGRILG
                     VSRSELDTEGFLAKVETSSKIHVKENFSGEAWASFVERLAYLKVDVTQPDDFAALGDL
                     VKARKETDNVVIYLSTAPKFFAQACENLAAIGLNADNVRVVLEKPLGTDLASSQQINT
                     DVARYFKEGQIYRIDHYLGKESLQNLLALRFANVMFEPLWNNKYIESVQLTIAEQLGV
                     EERGEFYDITGALRDMVQNHLMQMLCMTAMEAPAGLDADAVRDEKVKVIKSLKPLTIE
                     SVNENVVRGQYTAAKGMNGYLEEINVPQDSFTETYVAIKAEIENERWKGVPFYLRTGK
                     RMAGKVAEIVLNFRPLQNHIFDNSQTAPNRLVIELQPNESVRLYTQVKTPGAGNKVEV
                     TPLGVDLGKAVEGRRAEAYERLLLDVINGKLALFNRRDELEAAWEYVMPILENWANNT
                     TPPHGYGAHSWGPEAARELLARDGNKWHEEQ"
     gene            716811..717506
                     /gene="pgl"
                     /locus_tag="NGO_RS03620"
                     /old_locus_tag="NGO0716"
                     /old_locus_tag="NGO_0716"
     CDS             716811..717506
                     /gene="pgl"
                     /locus_tag="NGO_RS03620"
                     /old_locus_tag="NGO0716"
                     /old_locus_tag="NGO_0716"
                     /EC_number="3.1.1.31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013448834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconolactonase"
                     /protein_id="WP_003688731.1"
                     /translation="MFVWHEYENAAEAAQSLADAVADALQGALDEKGGAVLAVSGGRS
                     PIAFFNALSQKDLDWKNVGITLADERIVPTNHADSNTGLVREYLLKNKAAAAVWIPMV
                     EDGKTETELHPDAVVDYALKHYKQPDVLILGMGNDGHTASIFPKAPQFQTAIDGSAGV
                     ALVHTTPVTAPHERISMTLDAIAHTGHVFLAIQGEEKKAVFDQAAQGENREYPISLVL
                     NHQGVNCHVFYAE"
     gene            717487..718473
                     /locus_tag="NGO_RS03625"
                     /old_locus_tag="NGO0717"
                     /old_locus_tag="NGO_0717"
     CDS             717487..718473
                     /locus_tag="NGO_RS03625"
                     /old_locus_tag="NGO0717"
                     /old_locus_tag="NGO_0717"
                     /EC_number="2.7.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucokinase"
                     /protein_id="WP_010951113.1"
                     /translation="MSSTPNKHADYPRLVADIGGTNARFALETAPCVIEKVAVLPCKE
                     YDTVTDAVRAYLNQSGATGVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQALGLDT
                     LILLNDFTAQALAVTQTSSKDLMQVGGQKPVEFAPKAVIGPGTGLGVSGLVHSPAGWV
                     ALAGEGGHTSFPPFDDMEVLIWQYAKNKYRHVSAERFLSGAGLSLIYETLAVKQKAEP
                     AKLMPSEITEKALNCESPLCRQALDIFCAMLGTVASNLALTLGARGGVYLCGGIIPRM
                     LDYFKTSPFRSRFENKGRFEAYLAAIPVYVVLSEFPGIAGAAAALGNHLKNV"
     gene            718522..719370
                     /gene="hexR"
                     /locus_tag="NGO_RS03630"
                     /old_locus_tag="NGO0718"
                     /old_locus_tag="NGO_0718"
     CDS             718522..719370
                     /gene="hexR"
                     /locus_tag="NGO_RS03630"
                     /old_locus_tag="NGO0718"
                     /old_locus_tag="NGO_0718"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002239863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator HexR"
                     /protein_id="WP_003688727.1"
                     /translation="MLSKISESLADLSGAERKVAECALAEPKWFVHAAVAEIADRASV
                     SQPTVIRFCRSLGYKGLPEFKLSLSASIGHEGMPYVHEELNADDDMANVVEKVLGNAA
                     AALLGERRFLKESELENGIATLMHARRVEFYGVGNSGIVAQDAQHKFFRFGMSTVAYV
                     DTHTQLMAASVLSDQDVLVAISNTGSSIELLDAVSIAKENGASVIALTRNDSPLAQLA
                     DCVLSVATQENAELYTPMVSRLLQLAVIDILAIGLALRLGDAASLQLQKSKKSIHNKH
                     IDYDKD"
     gene            719596..721242
                     /gene="pgi"
                     /locus_tag="NGO_RS03635"
                     /old_locus_tag="NGO0719"
                     /old_locus_tag="NGO_0719"
     CDS             719596..721242
                     /gene="pgi"
                     /locus_tag="NGO_RS03635"
                     /old_locus_tag="NGO0719"
                     /old_locus_tag="NGO_0719"
                     /EC_number="5.3.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002241709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="WP_003688725.1"
                     /translation="MKHLHDLPAWSKLWNHFDDSKTLHMREMFEQDPQRAERYWLQVG
                     GLTLDYSKNRINDETMSLLFELAREAGVPERMRQMFHGEKINTTENRAVLHVALRNRT
                     NSPIMVDGEDVMPKVNRVLQRMGEFAHEVRSGSWLGYTNQVITDVVNIGIGGSDLGPL
                     TMCTALKPFGHPRLNMHFVSNVDGSQLRDVLSKVHPETTLFIIASKTFTTQETLTNAL
                     TAREWFLNHAGDEEAVAKHFAAVSTNRKAVAEFGIDIANMFEFWDWVGGRYSLWSAIG
                     LPIMLYLGEENFIEMLNGAHLMDQHFINTPLERNLPVILALIGIWYINYYGGGSHVIA
                     PYDQHLHRLPKFIQQLDMESNGKQVTLDGKAVGHETSPIIWGETGINGQHAFFQLLHQ
                     GTHITPIDLIASLEKRSNLPGHHEILLANVFAQAEAFMCGKTPDEVRAELKAQGMDEA
                     RIEELVPHKTFSGNRPTNLILMDKVNPRNMGSLIAMYEHKTFVQGIIWGINSFDQWGV
                     ELGKQLAKTILGELTGETEPQKHDSSTERLINLYLQTNRK"
     gene            721459..722472
                     /locus_tag="NGO_RS03640"
                     /old_locus_tag="NGO0721"
                     /old_locus_tag="NGO_0721"
     CDS             721459..722472
                     /locus_tag="NGO_RS03640"
                     /old_locus_tag="NGO0721"
                     /old_locus_tag="NGO_0721"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003702747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1311 domain-containing protein"
                     /protein_id="WP_003693055.1"
                     /translation="MKKNLPALALASMLILSGCDRLGIGNPFSGKEISCGSEETKEIL
                     VKLVRDNVEGETVKTFDDDAFKDQAFADIGISHIRRMVERLGITVDEVRTTEKTDTSS
                     KLKCEAALKLDVPDDVVDYAVAANQSIGNSHKKTPDFFEPYYRKEGAYYVKTISYSVQ
                     PTDDKSKIFAELSQAHDIIHPLSELVSMALIKEPLDKAKQRNEKLEAAEATAQEAREA
                     EEAAAQEALGREQEAARVSEWEERYKLSRSEFEQFWKGLPQTVQNKLQASQKTWKSGM
                     DKICANNAKAEGETPNGIKVSELACKTAETEARLEELHNRKKALIDEMVREEDKKELP
                     KRL"
     gene            722517..722657
                     /locus_tag="NGO_RS11080"
                     /old_locus_tag="NGO_0722"
     CDS             722517..722657
                     /locus_tag="NGO_RS11080"
                     /old_locus_tag="NGO_0722"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003698491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003688719.1"
                     /translation="MPQYRNWQNGLGAKCADGDEYGVAQSDCRTREINAKTKEIQGYL
                     ID"
     gene            722896..723144
                     /locus_tag="NGO_RS03645"
                     /old_locus_tag="NGO0723"
                     /old_locus_tag="NGO_0723"
     CDS             722896..723144
                     /locus_tag="NGO_RS03645"
                     /old_locus_tag="NGO0723"
                     /old_locus_tag="NGO_0723"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system HicB family
                     antitoxin"
                     /protein_id="WP_003688716.1"
                     /translation="MFHLEGLLQENLPIPEAQSIEVNRDNPDYADAVLWTMVEADDAA
                     LTGQVRFNVSWPQHILNRVDACTAARHETRAVFWRKPP"
     gene            complement(723578..725031)
                     /locus_tag="NGO_RS03650"
                     /pseudo
     CDS             complement(723578..725031)
                     /locus_tag="NGO_RS03650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002232432.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="tail fiber protein"
     gene            complement(725260..725829)
                     /locus_tag="NGO_RS03655"
                     /old_locus_tag="NGO_03835"
     CDS             complement(725260..725829)
                     /locus_tag="NGO_RS03655"
                     /old_locus_tag="NGO_03835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010358063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail fiber protein"
                     /protein_id="WP_010358063.1"
                     /translation="MANATEQNQFDQAVRLIEPGDSVVVGPGAPVNQPLQALANRTLL
                     LKNQTEALQTASDTKAAASTAVNAGDGLTGGGSLAQSRTIALGAPGQITATSQNTVPK
                     NGHTHAIDTARTDRAGIVRLDNAISEAEDTAATPKAVKTALDQARAAAATADLKVSLS
                     DNQTVTGQKTFTAETQFQSGIRLSANPTH"
     gene            complement(725869..726432)
                     /locus_tag="NGO_RS03660"
                     /old_locus_tag="NGO0725a"
                     /old_locus_tag="NGO_03840"
     CDS             complement(725869..726432)
                     /locus_tag="NGO_RS03660"
                     /old_locus_tag="NGO0725a"
                     /old_locus_tag="NGO_03840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003695326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail protein"
                     /protein_id="WP_003695326.1"
                     /translation="MNSTVPANNSPLQHALAKLTERETAAVSRQLDPARCDPGFLPFH
                     AFARSIGTEEGWDFAETDEARRNLIAGFAEIHARKGTPYAIRALFPILRLGEIQIIER
                     DGEFKWDGSVLFDGSRTFGRREGDWAEYRIVLTRPVSIRQTARIRAMLAEIAPLRCEL
                     TALDYRNHPHRWNGKIRFNGEYGFGTT"
     gene            complement(726522..727315)
                     /locus_tag="NGO_RS03665"
                     /old_locus_tag="NGO0727"
                     /old_locus_tag="NGO_0727"
                     /pseudo
     CDS             complement(726522..727315)
                     /locus_tag="NGO_RS03665"
                     /old_locus_tag="NGO0727"
                     /old_locus_tag="NGO_0727"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012503655.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate protein"
     gene            complement(727336..727662)
                     /locus_tag="NGO_RS11085"
                     /old_locus_tag="NGO_03855"
     CDS             complement(727336..727662)
                     /locus_tag="NGO_RS11085"
                     /old_locus_tag="NGO_03855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GPW/gp25 family protein"
                     /protein_id="WP_003688709.1"
                     /translation="MTDAENGRGQDTLAHIAQSIRNILFTRIGTRLMREEYGSFIPDL
                     IDMPAGHAAIALIHQAAVTALARWKPRITVRRIQADTADLAAGKIKLTLDVTLADGGE
                     RTYRIK"
     gene            complement(727659..727853)
                     /locus_tag="NGO_RS11090"
                     /old_locus_tag="NGO_03860"
     CDS             complement(727659..727853)
                     /locus_tag="NGO_RS11090"
                     /old_locus_tag="NGO_03860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010358072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate assembly protein"
                     /protein_id="WP_010358072.1"
                     /translation="MELKAVTSLTIDTPQTTITGHLTVNQTTTAQGLLTYQNGMNGQG
                     GSLSEHTHPDDSGGTTEKPQ"
     gene            complement(<727879..728241)
                     /locus_tag="NGO_RS11095"
                     /pseudo
     CDS             complement(<727879..728241)
                     /locus_tag="NGO_RS11095"
                     /inference="COORDINATES: protein motif:HMM:NF016595.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="phage baseplate assembly protein V"
     gene            complement(728344..728556)
                     /locus_tag="NGO_RS03675"
                     /old_locus_tag="NGO0729"
                     /old_locus_tag="NGO_0729"
     CDS             complement(728344..728556)
                     /locus_tag="NGO_RS03675"
                     /old_locus_tag="NGO0729"
                     /old_locus_tag="NGO_0729"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002232331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_002243493.1"
                     /translation="MELGYTPYNLRTLRNRCKLTQAELAQIVGVKHYIQVGRWEAEPD
                     TETRRADMPLEKWRQFLDWIEKTNAV"
     gene            complement(728611..729264)
                     /locus_tag="NGO_RS03680"
                     /old_locus_tag="NGO0730"
                     /old_locus_tag="NGO_0730"
     CDS             complement(728611..729264)
                     /locus_tag="NGO_RS03680"
                     /old_locus_tag="NGO0730"
                     /old_locus_tag="NGO_0730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS1595 family transposase"
                     /protein_id="WP_010951115.1"
                     /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFY
                     RKIRTVTNHRLALAADEVFECPAGPGGSYFGGRRKGGRGRGAAGKAVVFGIPKRNGRA
                     YTVAADDAEPETLLPAVKKKIMPDGIVYADSPGSRGKLDAGGFTRCRINRSKEFADRR
                     NHINGIGNFWNQAKRALRKYNGIDRKPFPPLLRECEFRLNFGTPSRQLKILRDRCGI"
     gene            complement(729286..729570)
                     /locus_tag="NGO_RS03685"
                     /old_locus_tag="NGO0731"
                     /old_locus_tag="NGO_0731"
     CDS             complement(729286..729570)
                     /locus_tag="NGO_RS03685"
                     /old_locus_tag="NGO0731"
                     /old_locus_tag="NGO_0731"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003706224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003706224.1"
                     /translation="MNRAALFNRYPEWIIGQDGASRFITHCRYPRLIAKIHRQTDGEC
                     PGGHYRHSENGITLYDFIFFGGKPADEARFAAVLTETCRRAVKKIGSVPD"
     gene            complement(729607..729870)
                     /locus_tag="NGO_RS03690"
                     /old_locus_tag="NGO0732"
                     /old_locus_tag="NGO_0732"
     CDS             complement(729607..729870)
                     /locus_tag="NGO_RS03690"
                     /old_locus_tag="NGO0732"
                     /old_locus_tag="NGO_0732"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003688704.1"
                     /translation="MADILPSDKRRQPPKTKGNPINIIEQETKRTELRKIDAEIAKII
                     ADAHKINAESVKIAQESRWYPMMAATGLVTAIAAVLALIFKFA"
     gene            complement(729890..731169)
                     /locus_tag="NGO_RS03695"
                     /old_locus_tag="NGO_03890"
                     /pseudo
     CDS             complement(729890..731169)
                     /locus_tag="NGO_RS03695"
                     /old_locus_tag="NGO_03890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014575451.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="integrase arm-type DNA-binding domain-containing
                     protein"
     gene            complement(731378..732157)
                     /locus_tag="NGO_RS03700"
                     /old_locus_tag="NGO0734"
                     /old_locus_tag="NGO_0734"
     CDS             complement(731378..732157)
                     /locus_tag="NGO_RS03700"
                     /old_locus_tag="NGO0734"
                     /old_locus_tag="NGO_0734"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016687762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin--NADP reductase"
                     /protein_id="WP_003688701.1"
                     /translation="MAASPEAKFTEEKILWVKHHTPKLITFAISRPESYRFKAGQFSR
                     LGFYEGKGFIWRAYSVVSAEYADTLEYFAVLIQDGPMSALFAKMQQGDTILLDKNATG
                     FLLPERFPDGKDLVMLCTGSGIAPFLSILEQPEIRQRFDTVNLIHSVSFPEELIFNDR
                     LAALSEHPLVGEYGHSFRFVPVTTRAANPSGLSGKRIPELLKNNSIEQALHTKLTPES
                     TRFMICGNPEMVKDTFQTLLDMGYAMHRNRIPGQIMMENGF"
     gene            733057..734115
                     /gene="dinB"
                     /locus_tag="NGO_RS03705"
                     /old_locus_tag="NGO0738"
                     /old_locus_tag="NGO_0738"
     CDS             733057..734115
                     /gene="dinB"
                     /locus_tag="NGO_RS03705"
                     /old_locus_tag="NGO0738"
                     /old_locus_tag="NGO_0738"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003674485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV"
                     /protein_id="WP_003695315.1"
                     /translation="MSLRKIIHIDMDAFYASVELREQPHLKGRPVVVAWEGARSVICA
                     ASYEARQFGLHSAMSVATVKRLCPQAVYVPPHFDLYRQVSAQIHAVFRRYTDLIEPLS
                     LDEAYLDVTRNFKNIPYAGEVAKEIRAAIFAETGLTASAGIAPNKFLAKIASDWRKPN
                     GQFVLPPHKVMAFLETLPLGKIPGAGKVTLKKMQSLGMRTAGDLRRFERGELLNHFGR
                     YGYRLYDLARGTDEHPVKAERERLQISTEITLPEDLPLGQAAGHLPHLAEDLWRQITR
                     KNVEAQSVTLKLKTYDFRIITRTLTYSSVLPDCAALLQAAQMLMARVPPQTEDAFRLI
                     GIGVGRLVPKNQQQDLWA"
     gene            complement(734185..736200)
                     /gene="rep"
                     /locus_tag="NGO_RS03710"
                     /old_locus_tag="NGO0739"
                     /old_locus_tag="NGO_0739"
     CDS             complement(734185..736200)
                     /gene="rep"
                     /locus_tag="NGO_RS03710"
                     /old_locus_tag="NGO0739"
                     /old_locus_tag="NGO_0739"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014580815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase Rep"
                     /protein_id="WP_003706226.1"
                     /translation="MMKLNAQQLEAVRYLGGPLFVLAGAGSGKTGVITQKIKHLIVNV
                     GYLPHTVAAITFTNKAAAEMQERVAKMLPKPQTRGLTICTFHSLGMKILREEANHIGY
                     KKNFSILDSTDSAKIIGELLGGTGKEAVFKAQHQISLWKNDLKTPEDVVQTASNVREQ
                     QTARVYASYQETLQSYQAVDFDDLIRLPAVLLQQNSEVRNKWQRRLRYLLVDECQDTN
                     TCQFALMKLLTGAEGMFTAVGDDDQSIYAWRGANMENLRKMQENYPQMKVIKLEQNYR
                     STARILKIANKVIENNPKLFTKKLWSQLGEGEPVKVVACQNEQHEADWVVSQIVKQKL
                     IGGDKTRYADFAVLYRGKHQARIFEEALRGARIPYRLSGGQSFFDKAEIKDVLSYVRL
                     LANPNDDPAFLRAVTTPKRGIGDVTLGKLNAYAHEHECSLYEAAQNEEALATLNNTNR
                     QHLQAFMDMFGNYRAKAEIDEAGEFINSLLEEIDYENHLMQNEEGKAGEIKWRNVGEL
                     VSWFARKGERDGKNVIELAQTVALMTLLEGKDEEETDAVSLSTLHAAKGLEYPYVFLV
                     GCEEGVLPHNDSIEEGNVEEERRLMYVGITRAKRQLTLTHCVKRKKQGIWQFPEPSRF
                     IDEMPQEDLKILGRKGGEPIVSKEEGRRNLADIIGRIDNLKKSGPAD"
     gene            complement(736220..736984)
                     /locus_tag="NGO_RS03715"
                     /old_locus_tag="NGO0740"
                     /old_locus_tag="NGO_0740"
     CDS             complement(736220..736984)
                     /locus_tag="NGO_RS03715"
                     /old_locus_tag="NGO0740"
                     /old_locus_tag="NGO_0740"
                     /EC_number="4.2.1.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I 3-dehydroquinate dehydratase"
                     /protein_id="WP_003688696.1"
                     /translation="MHTSLTVKNTVIGSGRTKIAVPLVARDAADLSSVLSQIKNLPFD
                     IVEFRADFLECAGSIGEVLRHTQAVRDALPDKPLLFTFRRHCEGGSFPCSDDYYFELL
                     DALIESRLPDIIDIELFSGETAVRRAVANAQKNGIAALLCNHEFHRTPPQEEIVCRLK
                     QMEDCGADICKIAVMPQSSEDVLTLLSATLEAKRLVAKPVITMSMGQTGAVSRLAGQV
                     FGSSITFGSGTQNSAPGQIGVSALRAALDCLESGAD"
     gene            737184..738230
                     /gene="recA"
                     /locus_tag="NGO_RS03720"
                     /old_locus_tag="NGO0741"
                     /old_locus_tag="NGO_0741"
     CDS             737184..738230
                     /gene="recA"
                     /locus_tag="NGO_RS03720"
                     /old_locus_tag="NGO0741"
                     /old_locus_tag="NGO_0741"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002216923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecA"
                     /protein_id="WP_003688695.1"
                     /translation="MSDDKSKALAAALAQIEKSFGKGAIMKMDGSQQEENLEVISTGS
                     LGLDLALGVGGLPRGRIVEIFGPESSGKTTLCLEAVAQCQKNGGVCAFVDAEHAFDPV
                     YARKLGVKVEELYLSQPDTGEQALEICDTLVRSGGIDMVVVDSVAALVPKAEIEGDMG
                     DSHVGLQARLMSQALRKLTGHIKKTNTLVVFINQIRMKIGVMFGSPETTTGGNALKFY
                     SSVRLDIRRTGSIKKGEEVLGNETRVKVIKNKVAPPFRQAEFDILYGEGISWEGELID
                     IGVKNDIINKSGAWYSYNGAKIGQGKDNVRVWLKENPEISDEIDAKIRALNGVEMHIT
                     EGTQDETDGERPEE"
     gene            complement(738883..739218)
                     /locus_tag="NGO_RS03725"
                     /old_locus_tag="NGO0742"
                     /old_locus_tag="NGO_0742"
     CDS             complement(738883..739218)
                     /locus_tag="NGO_RS03725"
                     /old_locus_tag="NGO0742"
                     /old_locus_tag="NGO_0742"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009173318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YbaB/EbfC family nucleoid-associated protein"
                     /protein_id="WP_003688693.1"
                     /translation="MFGKAGLGGLMKQAQQMQENMKKAQAKLAETEIEGEAGNGLVKI
                     TMTCAHEVRKIDISPDLIQEAADDKEMLEDLILAALKSARGKAEETANKTMGAFTQDL
                     PPGVGDFFR"
     gene            complement(739299..741422)
                     /gene="dnaX"
                     /locus_tag="NGO_RS03730"
                     /old_locus_tag="NGO0743"
                     /old_locus_tag="NGO_0743"
     CDS             complement(739299..741422)
                     /gene="dnaX"
                     /locus_tag="NGO_RS03730"
                     /old_locus_tag="NGO0743"
                     /old_locus_tag="NGO_0743"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="WP_003695312.1"
                     /translation="MAYQVLARKWRPKTFSDLVGQEHVVKALQNALDEGRLHHAYLLT
                     GTRGVGKTTIARILAKSLNCENAQHGEPCGVCQSCTQIDAGRYVDLLEIDAASNTGID
                     NIREVLENAQYAPTAGKYKVYIIDEVHMLSKSAFNAMLKTLEEPPEHVKFILATTDPH
                     KVPVTVLSRCLQFVLRNMTAQQVADHLAHVLDSEKIAYDPPALQLLGRAAAGSMRDAL
                     SLLDQAIALGSGKVAENDVRQMIGAVDKQYLYELLTGIVNQDGEALLAKAQEMAACAV
                     GFDNALGELAILLQQLALIQAVPSALAHDDPDSDILHRLAQTISGEQIQLYYQIAVHG
                     KRDLGLAPDEYAGFMMTLLRMLAFAPLAAASCDANAVIENTELQSPSAQTAEKETAAK
                     KPQPRPEADAAQTPVQTASAAAMPSEGKTAGPVSHQENNDVPPWEDAPDKTETAAGTA
                     RTSAKSIQTASEAETPPENQVSKNKAADNETEASLSEVPSENPIQATPNDEAVETETF
                     AHEAPAEPFYGFPDNDCPPEDGVEIPPPDWANVLPADTAGGGTDEEAEAGGIGGNNTP
                     SAPPPEFSTENWAAIVRHFARKLGAAQMPAQHSAWTEYRSDTGLMVLAMTAEARATAD
                     KKRLDKIRDTLAQAYGLQLTLQTEDWRDEAGRETPAMQDKRVQAEDRQKAQALLEADP
                     AAQKILQAFGAQWQPESLELAANRP"
     misc_feature    complement(740194..740233)
                     /gene="dnaX"
                     /locus_tag="NGO_RS03730"
                     /old_locus_tag="NGO0743"
                     /old_locus_tag="NGO_0743"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01843"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="This ribosomal frameshift element is known only in
                     the genus Neisseria; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /db_xref="RFAM:RF01843"
     gene            complement(741517..743493)
                     /gene="mutL"
                     /locus_tag="NGO_RS03735"
                     /old_locus_tag="NGO0744"
                     /old_locus_tag="NGO_0744"
     CDS             complement(741517..743493)
                     /gene="mutL"
                     /locus_tag="NGO_RS03735"
                     /old_locus_tag="NGO0744"
                     /old_locus_tag="NGO_0744"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002235944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair endonuclease MutL"
                     /protein_id="WP_003698476.1"
                     /translation="MPRIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVD
                     VELEGGGIRLIRVGDNGGGIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLAS
                     IASVSRLTLTSRQEDSSHATQVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKF
                     LKSENTEYAHCATMLERLALAHPHIAFSLKRDGKQVFKLPAQSLHERIAAIVGDDFQT
                     ASLEIDSGNSALRLYGAIAKPTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLH
                     NALTPAFVLFLELPPEAVDVNVHPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTE
                     SVSNAGEVLHDITGVTPAPMPSENDGENLFDSASNHPTGNKPDTRNAFGSSGKTAPMP
                     YQAARAPQQHSLSLRESRAAMDTYAELYKKTDDIDLELSQFEQARFGNMPSETPAHKT
                     DTPLSDGIPSQSELPPLGFAIAQLLGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQR
                     QENGNLQSQHLLIPVTFAASHEECAALADHAETLAGFGLELSDMGGNTLAVRAAPVML
                     GKSDVVSLARDVLGELAQVGSSQTIASHENRILATMSCHGSIRAGRRLTLPEMNALLR
                     DMENTPRSNQCNHGRPTWVKLTLKELDTLFLRGQ"
     gene            743637..743822
                     /locus_tag="NGO_RS03740"
                     /old_locus_tag="NGO0745"
                     /old_locus_tag="NGO_0745"
     CDS             743637..743822
                     /locus_tag="NGO_RS03740"
                     /old_locus_tag="NGO0745"
                     /old_locus_tag="NGO_0745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002230667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3460 family protein"
                     /protein_id="WP_003706231.1"
                     /translation="MYHYQSEATQFLNRLIEEKPELAQERLKNQGLLWDVELNPEEQK
                     NFESAKVAKKPYTYYQD"
     gene            743833..744501
                     /locus_tag="NGO_RS03745"
                     /old_locus_tag="NGO0746"
                     /old_locus_tag="NGO_0746"
     CDS             743833..744501
                     /locus_tag="NGO_RS03745"
                     /old_locus_tag="NGO0746"
                     /old_locus_tag="NGO_0746"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-methyltransferase"
                     /protein_id="WP_003688686.1"
                     /translation="MTTHLSNVAPDLQNYLNAIGEPEHPVLTRLREKAGHHRMGKMAI
                     AREQAAVLVWLAKLIRAEKYLEIGVFTGYSSTALALALPEHGRITACDINVTFTDTAR
                     QVWNEAGVAHKISLHLQPALLTLDDLIAQGEAGSYDLALIDADKPPTPQYFERCLKLV
                     RQGGIIAIDNILLNGRVMREAAFDAPPSVKILKDFNQNLPNDTRIVPITLPVGDGLTL
                     LLKK"
     gene            744501..745214
                     /locus_tag="NGO_RS03750"
                     /old_locus_tag="NGO0747"
                     /old_locus_tag="NGO_0747"
     CDS             744501..745214
                     /locus_tag="NGO_RS03750"
                     /old_locus_tag="NGO0747"
                     /old_locus_tag="NGO_0747"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003751770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="WP_003697104.1"
                     /translation="MKTKLPLFIIWLSVSASCASVLPVPEGSRTEMPTQENASDGIPY
                     PVPTLQDRLDYLEGKIVRLSNEVEMLNGKVKALEHTKIHPSGRTYVQKLDDRKLKEHY
                     LNTEGGSASAHTVETAQNLYNQALKHYQNGRFSAAAALLKGADGGDGGSIAQRSMYLL
                     LQSRARMGNCESVIEIGGRYANRFKDSPTAPEVIFKIGECQYRLQQKDIARATWRSLI
                     QTYPGSPAAKRAAAAVRKR"
     gene            745262..745747
                     /gene="purE"
                     /locus_tag="NGO_RS03755"
                     /old_locus_tag="NGO0748"
                     /old_locus_tag="NGO_0748"
     CDS             745262..745747
                     /gene="purE"
                     /locus_tag="NGO_RS03755"
                     /old_locus_tag="NGO0748"
                     /old_locus_tag="NGO_0748"
                     /EC_number="4.1.1.21"
                     /EC_number="5.4.99.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013449086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide mutase"
                     /protein_id="WP_003688684.1"
                     /translation="MIQIGIIMGSNSDWPVMRQAAQFLEEFGVEYEARVVSAHRTPDL
                     MFEYAETARARGIKAIIAGAGGAAHLPGMVAAKTTVPVLGVPVPSKYLRGEDSLLSIV
                     QMPKGVPVATFAIGEAGAANAALFAISMLANENPELAQKLADFRAKQEQTVLNMELEQ
                     I"
     gene            complement(745959..746447)
                     /locus_tag="NGO_RS03760"
                     /old_locus_tag="NGO_03975"
     CDS             complement(745959..746447)
                     /locus_tag="NGO_RS03760"
                     /old_locus_tag="NGO_03975"
                     /inference="COORDINATES: protein motif:HMM:NF024751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_025462866.1"
                     /translation="MTRPAGFSDCQRVCPDETGFDRRLFRPYARSLKGQMAKARISGK
                     RYRRLSLVSAQVGNRPIAPMVCQNTVAGVFFEARFQQCLLPALAQKSVIISDNARFRR
                     MGALRGTAEKLGHKVLPPAPCSPEPNPIEKVWANIKRYLRTVLSDYARFDDALLSYFD
                     FN"
     gene            complement(746456..746719)
                     /locus_tag="NGO_RS03765"
     CDS             complement(746456..746719)
                     /locus_tag="NGO_RS03765"
                     /inference="COORDINATES: protein motif:HMM:NF013842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_005231956.1"
                     /translation="MSRNTLYLRIRLKKQTGSLKHQVTGLNAAKSDRQKPARYVGRHP
                     DACLHEIAKHFDCTAAAVCHAPKQMRMARKKRPPLTKDKTRPK"
     gene            <747141..747506
                     /locus_tag="NGO_RS03770"
                     /old_locus_tag="NGO_03985"
                     /pseudo
     CDS             <747141..747506
                     /locus_tag="NGO_RS03770"
                     /old_locus_tag="NGO_03985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002225556.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            747669..748577
                     /locus_tag="NGO_RS03775"
                     /old_locus_tag="NGO0751"
                     /old_locus_tag="NGO_0751"
     CDS             747669..748577
                     /locus_tag="NGO_RS03775"
                     /old_locus_tag="NGO0751"
                     /old_locus_tag="NGO_0751"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter outer membrane beta-barrel
                     domain-containing protein"
                     /protein_id="WP_003688683.1"
                     /translation="MRFPLPITNAVLKITNGAMEFKSEDIGTIKLTKATFHLKKDTSL
                     TTPEGTTLLSGGTLTLSNTGISLSGTTSVFEKGTFTNGGIITLANQSYADKLTIEGNY
                     VGKDGVLKVNTEWNSPGDDQGGNSQSDLLEITGDASGKTTVISVGKDGKENIIDGSIG
                     ELSDRYKRSAAVVKVLGQDKGAETGKLNIEDAKHTYTMRDTFSGTAKTTGAGELQLVS
                     HKDEAGATEYFWTLTTPNQDKTIITPSAPAYALVPRQNLESGYAMLDTLHQRRGENQT
                     LSRDRQGNYRQDAEATDIKATKAPWV"
     gene            complement(748733..749389)
                     /locus_tag="NGO_RS03780"
                     /old_locus_tag="NGO0752"
                     /old_locus_tag="NGO_0752"
     CDS             complement(748733..749389)
                     /locus_tag="NGO_RS03780"
                     /old_locus_tag="NGO0752"
                     /old_locus_tag="NGO_0752"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_003688682.1"
                     /translation="MTIKIILIDDHTLFRSGIKALLSRQHGFEVIGEAADGLSGIKMI
                     SRLQPDVVLLDLDMPGMNGREALSQIISINPQQAVIMLTVSEDSDDLTECMRIGARGY
                     LLKNINADFLLESIRKAAEGDNVFSPEMTAKLVKSLISPQPAQRTQALSSLTPRELEI
                     LGYLAAGHSNKIIARHLDLAESTVKVHVQNLLRKLNLSSRVQAAVYAIRHNVPQPVPE
                     "
     gene            complement(749386..751155)
                     /locus_tag="NGO_RS03785"
                     /old_locus_tag="NGO0753"
                     /old_locus_tag="NGO_0753"
     CDS             complement(749386..751155)
                     /locus_tag="NGO_RS03785"
                     /old_locus_tag="NGO0753"
                     /old_locus_tag="NGO_0753"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pili methyl-accepting chemotaxis
                     transducer N-terminal domain-containing protein"
                     /protein_id="WP_003699959.1"
                     /translation="MILPTRFSDGIPLSLRLKLLTGLWVGLAALSVVLTLLLSFRLEN
                     AASVIEEAGNLKMQAYRLAYMAGEGSPRAQIDNQIAEFEKSLKRISQSDAIHPLIPSD
                     NPLAYDLIQSMLIIDWQANILPPLQAYRRPTQIELYRFAGNIELFLQALENAGEKNTW
                     WLRRFQWVIMLMTLVSSVLMLFWHQIWVIRPLQALREGAERIGQRHFDIPVPEDGTPE
                     FKQVGRCFNQMALRLKTLYDDLEGQVAEQTHNLEKQNRNLTLLYRTTRDLHQSYTPRQ
                     AAEEFLNHILPAVGAQSGNICLENGSDTDISVHTAEHGKKPPLEKYHDETFPIEYQNE
                     KLGMLSLGFSDGTSLTGDDRTLLQTLIRQLGVSLAGAKQEEEKRLLAVLQERNLIAQG
                     LHDSIAQALTFLNLQVQMLETAFAENKREEAAENIGFIKTGVQECYEDVRELLLNFRT
                     KISNKEFPEAVADLFARFTQQTGITVETVWENGSFLPTQDEQLQMIFILQESLSNIRK
                     HARATHVKFTLSEYGGRFTMTIQDNGQGFDTEKIGEPTGSHVGLHIMQERAKRIRAVL
                     EIRSQAQQGTTVSLTGAPKESLP"
     gene            751362..751976
                     /locus_tag="NGO_RS03790"
                     /old_locus_tag="NGO0754"
                     /old_locus_tag="NGO_0754"
     CDS             751362..751976
                     /locus_tag="NGO_RS03790"
                     /old_locus_tag="NGO0754"
                     /old_locus_tag="NGO_0754"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014575380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor guanylyltransferase"
                     /protein_id="WP_003691204.1"
                     /translation="MKTSNFPKSPPALKTFALILAGGLADRMGGEDKGLALLEGRPLI
                     DRVIGKIRPQVSHIVISANRNLEEYARRSPHVFPDARQWQHFGPLSALCTAANDLQLA
                     AADWLLIVPCDMPYLPDDLVARFESVSKRTPLCNAFYVETPVTMHYNIMYIRPQILQS
                     AIPYLFSGMKTLRSWLQQQRARPVRFEFDGHFADLNTQTDLQEG"
     gene            752139..752756
                     /locus_tag="NGO_RS03795"
                     /old_locus_tag="NGO0755"
                     /old_locus_tag="NGO_0755"
     CDS             752139..752756
                     /locus_tag="NGO_RS03795"
                     /old_locus_tag="NGO0755"
                     /old_locus_tag="NGO_0755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003677445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin synthase"
                     /protein_id="WP_010358100.1"
                     /translation="MFTGIVQGLGKLTAIHRPSEAFQTYVVELPQEAAENLQHGASVA
                     NNGCCLTITEIEGNRVSFDLMAETLAKTNLGLLKEGDCVNIERAARFGDEIGGHVMSG
                     HIMATVPIVEIERDGFNRTVWFALPHELKPYILTKGFVGLDGCSLTIGKVEDSRFNVH
                     LIPETLERTLFGSRKAGDRINIEIDPNTQAIVDTVERLMAQRYAK"
     gene            752764..753627
                     /locus_tag="NGO_RS03800"
                     /old_locus_tag="NGO0756"
                     /old_locus_tag="NGO_0756"
     CDS             752764..753627
                     /locus_tag="NGO_RS03800"
                     /old_locus_tag="NGO0756"
                     /old_locus_tag="NGO_0756"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002241590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_003688678.1"
                     /translation="MELNEFLDKAYAVLRRLDAVLPPEPGHTDWNALAFRWQSAGKKG
                     FLEHLPDPHVFPLSRLAGVGRQTELLVRNTEQFIAGRPANNVLMSGARGTGKSSLVKA
                     LLHEYADKGLRLIEVDKSDLIGLPYLLALLKERPEKFIVFCDDLSFESGDETYKALKT
                     ALDGGLSQRCANVMVYATSNRRHLMPEYLDENAGTTGVRGEIHQKEAVEEKVSLSDRF
                     GLWLSFYPFDQNDYLAAVRSWLEDFDVPYDEAARTAALQWAQMRGNRSGRSAWQFACD
                     WAGRLPEQRAP"
     gene            complement(753640..754074)
                     /locus_tag="NGO_RS03805"
                     /old_locus_tag="NGO0757"
                     /old_locus_tag="NGO_0757"
     CDS             complement(753640..754074)
                     /locus_tag="NGO_RS03805"
                     /old_locus_tag="NGO0757"
                     /old_locus_tag="NGO_0757"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019273326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Spy/CpxP family protein refolding chaperone"
                     /protein_id="WP_003688677.1"
                     /translation="MPLPAPCRFAKPAASFLSMALLSCQLSHAATAYIPPNDFQPNCD
                     IRRLGLTQGQHNELRKIRAAFKMAGDRARLKVMHSEHSRRRSVVEIISSDVFNRNEAR
                     DYVESRYHSSMDFAVDELEIQHRFFHILTPQQQQMWLSSCLK"
     gene            754220..754912
                     /gene="rpe"
                     /locus_tag="NGO_RS03810"
                     /old_locus_tag="NGO0758"
                     /old_locus_tag="NGO_0758"
     CDS             754220..754912
                     /gene="rpe"
                     /locus_tag="NGO_RS03810"
                     /old_locus_tag="NGO0758"
                     /old_locus_tag="NGO_0758"
                     /EC_number="5.1.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003688675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="WP_010951116.1"
                     /translation="MTAYRIAPSILSADFARLGEEVANVIAAGADLIHFDVMDNHYVP
                     NLTFGPMVCAALKPYASVPIDVHLMVEPVDDLIQSFAKAGASIITFHPEASRHIDRSL
                     SLIRDMGCQAGLVLNPATPVYVLENVLDRLDMVLLMSVNPGFGGQSFIPHTLEKIRQV
                     RAMLDRYEGKSGRRIAIEVDGGIKTDNIAAVARAGADTFVAGSAIFGKPDYKAVIAAM
                     RAELEKAARAEP"
     gene            complement(755151..756182)
                     /gene="ruvB"
                     /locus_tag="NGO_RS03815"
                     /old_locus_tag="NGO0760"
                     /old_locus_tag="NGO_0760"
     CDS             complement(755151..756182)
                     /gene="ruvB"
                     /locus_tag="NGO_RS03815"
                     /old_locus_tag="NGO0760"
                     /old_locus_tag="NGO_0760"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002217138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction branch migration DNA helicase
                     RuvB"
                     /protein_id="WP_003691202.1"
                     /translation="MLQTDNLTAAQPQRIVAAQTASAQEELLERALRPKTLDDYIGQH
                     KAKEQLAIFIQAAKKRGEALDHVLLFGPPGLGKTTLAHIIAKELGVNLRQTSGPVLER
                     AGDLAALLTNLDPHDVLFIDEIHRLSPVVEEILYPALEDYRLDIMIGEGPAARSVKID
                     LPPFTLVGATTRAGMLTNPLRDRFGIVSRLEFYENRDLTTIVSRSAQLLQLDMGEEGA
                     MEVAKRSRGTPRIANRLLRRVRDFADVKNNGVIDAAVADAALSMLDVDAQGLDVMDRK
                     FLEAVLHKFGGGPVGLDNVAAAIGESTDTIEDVIEPYLIQQGFLQRTPRGRMATERAY
                     LHFGLPVEK"
     gene            complement(756266..756574)
                     /locus_tag="NGO_RS03820"
                     /old_locus_tag="NGO0761"
                     /old_locus_tag="NGO_0761"
     CDS             complement(756266..756574)
                     /locus_tag="NGO_RS03820"
                     /old_locus_tag="NGO0761"
                     /old_locus_tag="NGO_0761"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002219238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951118.1"
                     /translation="MTLKTDLLPKINNEDYQRLILKHSAEFSGGETRLLNEILEKFNF
                     DVVQAQALAQAVMQQVRFDPNAYHIDSDDEDTTGICPHCINPPMPPLHDYLVWRETRG
                     "
     gene            complement(756992..758224)
                     /locus_tag="NGO_RS03825"
                     /old_locus_tag="NGO0763"
                     /old_locus_tag="NGO_0763"
     CDS             complement(756992..758224)
                     /locus_tag="NGO_RS03825"
                     /old_locus_tag="NGO0763"
                     /old_locus_tag="NGO_0763"
                     /EC_number="2.7.7.72"
                     /EC_number="3.1.3.-"
                     /EC_number="3.1.4.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012221678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multifunctional CCA addition/repair protein"
                     /protein_id="WP_003706239.1"
                     /translation="MQTYLVGGAVRDYLLGLPVKDRDWVVVGADAQTMLAQGFQPVGK
                     DFPVFLHPKTHEEYALARTERKTAKGYAGFSFHADKDVTLEQDLMRRDLTINAMAQDA
                     DGKIIDPFGGQRDLAAGILRHVSPAFAEDPVRILRAARFAARYGFEIAEETIKLMRQM
                     VENGEADALVAERVWQELAKGLMEKNPRKMIEMLRECGALQVLLPEVDALFGVPQRAD
                     YHPEIDSGIHTLMTLQRAADMGLSLPERYAALLHDLGKAKTPPDILPRHHGHDINGVE
                     PVREVNQRLRAPRQCAELAELVCRWHIIFHQVGQLKSQTILNVLKKTDAFRRPERFQT
                     ALNVCIADTQGRLNREHTPYPQRAHWLALLEAANQADSGKIAAECRAQGKAHFIAEQI
                     DRARLAQIAPLQKTFRGA"
     gene            complement(758303..759931)
                     /locus_tag="NGO_RS03830"
                     /old_locus_tag="NGO0764"
                     /old_locus_tag="NGO_0764"
     CDS             complement(758303..759931)
                     /locus_tag="NGO_RS03830"
                     /old_locus_tag="NGO0764"
                     /old_locus_tag="NGO_0764"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014582023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-F family ATPase"
                     /protein_id="WP_010951119.1"
                     /translation="MISTNGITMQFGAKPLFENVSVKFGEGNRYGLIGANGSGKSTFM
                     KILGGDLEQTAGEVAIENGVRLGKLRQDQFAYEDMRVLDVVMMGHTEMWAAMTERDAI
                     YANPEATEDDYMKAAELEAKFAEYDGYTAEARAAELLSGVGISEDLHNAKMAEVAPGF
                     KLRVLLAQALFSKPDVLLLDEPTNNLDINTIRWLEGVLNQYDSTMIIISHDRHFLNEV
                     CTHMADLDYNTITIYPGNYDDYMLASAQSRERALKDNAKAKEKLQELQEFVARFSANK
                     SKARQATSRLKQADKIKSEMVEVKPSTRQNPYIRFEADEKAKLHRQAVEVEKLAKRFE
                     TQLFRNLNFILEAGQRLAIIGPNGAGKSTLLKLLAGAYNPEYSDGLLPDEGSIKWAEK
                     ASVGYYPQDHENDFDVDMDLSEWMRQWGREGDDEQVIRGTLGRLLFGSNDVVKKVKVL
                     SGGEKGRMLYGKLLLLKPNVLVMDEPTNHMDMESIESLNMALDKYNGTLIFVSHDRQF
                     VSSLATQIIELDGKGGYEHYLGDYESYLEKKGVA"
     gene            760081..760455
                     /locus_tag="NGO_RS03835"
                     /old_locus_tag="NGO0765"
                     /old_locus_tag="NGO_0765"
     CDS             760081..760455
                     /locus_tag="NGO_RS03835"
                     /old_locus_tag="NGO0765"
                     /old_locus_tag="NGO_0765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014582022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase"
                     /protein_id="WP_003688664.1"
                     /translation="MIILHGIPNCDTVKKAKNRLAGYGLEFGFRDFKKQMPSEAEICS
                     WLEQVPLATLFNKRGTSWRKLDAETQQKALSSTAEAVKLMSEMPSLIKRPVLECGSRV
                     YVGFSEETYDGIFNRQAPCRQG"
     gene            760504..762042
                     /locus_tag="NGO_RS03840"
                     /old_locus_tag="NGO0766"
                     /old_locus_tag="NGO_0766"
     CDS             760504..762042
                     /locus_tag="NGO_RS03840"
                     /old_locus_tag="NGO0766"
                     /old_locus_tag="NGO_0766"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002237006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SurA N-terminal domain-containing protein"
                     /protein_id="WP_003697101.1"
                     /translation="MFHSIEKYRTPAQVLLGLIALTFVGFGVSTVSHPGADYIVQVGD
                     EKISEHSINNAMQNEQADGGSPWRDAVFQSLLQRAYLKQGAKLMGISVSSEQIKQMIV
                     DDPNFHDANGKFSHALLSQYLSQRHMSEDQFVEEIRDQFALQNLVSLVQNGVLVGDAQ
                     AEQLIRLTQVNRTIRSHTFNPDEFIAQVKASEADLQKFYNANKKDYLLPQAVKLEYVA
                     LNLKDFADKQTVSETEVKNAFEERVARLPAHEAKPSFEQEKAAVENELKMKKAVADFN
                     KAKEKLGDDAFNHPSSLAEAAKNSGLKVETQETWLSRQDAQMSGMPENLINAVFSDDV
                     LKKKHNSEVLTINSETAWVVRAKEVREEKNLLFEEAKDAVRQAYIRTEAAKLAENKAK
                     EVLTQLNGGKAVDVKWSEVSVLGAQQARQSMPPEAYAELLKAKPANGKPAYVRLTGLP
                     APVIVEAQAVTPPEDIAAQLPPAKQALAQQQSANTFDLLIRYFNGKIKQTKGAQSVDN
                     GDGQ"
     gene            762109..762726
                     /gene="recR"
                     /locus_tag="NGO_RS03845"
                     /old_locus_tag="NGO0767"
                     /old_locus_tag="NGO_0767"
     CDS             762109..762726
                     /gene="recR"
                     /locus_tag="NGO_RS03845"
                     /old_locus_tag="NGO0767"
                     /old_locus_tag="NGO_0767"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002237005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein RecR"
                     /protein_id="WP_003706246.1"
                     /translation="MNSKKQDAFQRLIGALKVLPNVGPKSAQRMAYHLLQQKRKEAEE
                     LVDALQTALRQVCHCARCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNIEAANCH
                     DGLYFVLMGQINTALGMDVSAIALDRLAQRLDGGEIEEIIIATAFTAEGNATAYVLSE
                     FFKNLPYKVSRLSQGIPLGGELEYVDAGTLAQAVYERRLIKEGGA"
     gene            complement(762782..763061)
                     /locus_tag="NGO_RS03850"
                     /old_locus_tag="NGO_04070"
                     /pseudo
     CDS             complement(762782..763061)
                     /locus_tag="NGO_RS03850"
                     /old_locus_tag="NGO_04070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003683377.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            763287..764534
                     /locus_tag="NGO_RS03855"
                     /old_locus_tag="NGO0769"
                     /old_locus_tag="NGO_0769"
     CDS             763287..764534
                     /locus_tag="NGO_RS03855"
                     /old_locus_tag="NGO0769"
                     /old_locus_tag="NGO_0769"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002220969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein-releasing ABC transporter permease
                     subunit"
                     /protein_id="WP_003706248.1"
                     /translation="MFSLEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVL
                     SVMNGFQKEIRGQLLNVAPHAEIGYIDNTDTDWRNLLRFAENRKGILAAAPYVSNQAL
                     LANAGEIRGVQIRGILPSEERKVVEYGDKMPAGKFEDLIPGEFDIILGIGLAEALGAE
                     VGDKVTVITPEGNVTPAGIVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLD
                     KEVAGLRLKLADPQNAPALTATLIPEAQRDTVWVRDWTYSNRSYFEAVELEKRMMFII
                     LTLIIAVAAFNLVSSLVMAVTEKQADIAILRTLGLSPAGVMKIFMVQGAFSGFFGTLA
                     GVVCGVLWGWNVGRVVAFFENLLGVHLINSQVYFIDYLPSDVDMGDVALIACISLGLS
                     FVATLYPSWRASKTQPAEALRYE"
     gene            764527..765222
                     /gene="lolD"
                     /locus_tag="NGO_RS03860"
                     /old_locus_tag="NGO0770"
                     /old_locus_tag="NGO_0770"
     CDS             764527..765222
                     /gene="lolD"
                     /locus_tag="NGO_RS03860"
                     /old_locus_tag="NGO0770"
                     /old_locus_tag="NGO_0770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003709970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein-releasing ABC transporter
                     ATP-binding protein LolD"
                     /protein_id="WP_003688655.1"
                     /translation="MSDLILKCEGVGKRYRDGGLDVPVLYGLDLEIRTGESTGIIGSS
                     GSGKSTLLHILGGLDMPSEGRVLLMGEDLRALNQRRLGDLRNRHLGFVYQFHHLLPEF
                     SALENVMMPLLIGKKSRKEAVETAMAMLDKVGLKHRSTHRAGELSGGERQRAAIARAL
                     VTQPKCLLADEPTGNLDRANARNVLDMMLELKTELGTGLVVVTHDDELAGRFERVMVM
                     KDGSLHPRQGANA"
     gene            765289..767034
                     /gene="recD"
                     /locus_tag="NGO_RS03865"
                     /old_locus_tag="NGO0771"
                     /old_locus_tag="NGO_0771"
     CDS             765289..767034
                     /gene="recD"
                     /locus_tag="NGO_RS03865"
                     /old_locus_tag="NGO0771"
                     /old_locus_tag="NGO_0771"
                     /EC_number="3.1.11.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014581068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit alpha"
                     /protein_id="WP_010358120.1"
                     /translation="MELQTDEFAQAAARAAIRFLERYAGSGNEVLANCTERLFQALQN
                     GHSFIRLSGDEADALSALAPVVGTSAAPLILEGRRLFLGRMWQLEYDLAAEIKRLAAA
                     GTSAPDAAGARQNLAKWFQGAGSEGQRDAAALALLQFFMVITGGPGTGKTTTVAKLLA
                     LICGENENLPHIALAAPTGKAAAHMARALHRSINGFDAPEAVRRHLLKLEGQTVHRLL
                     KLSPPKMQAAFDHIRPLPFDVLIVDEASMLDTALMLQLLKAVKTGARVILLGDENQLP
                     SVGIGAVLSVLSQKTVLDGETHQRLAGFLPEHGFSVSANPPVLAQNTAHLSFSHRFGD
                     NSGIGCLARAAVSGDEGAWALFDRFPDELEHSECSPNARVERLYRAHKAYWQAVKDGN
                     IEAAYAGISDIVVLAAWRQDAEDFNEAYCSYVRRKMNIPEHLAYFAGEPIMIRQNDYA
                     LELFNGDIGLIMEDVGRQGSLAAYFADADGFKKVAVSCLPEFEPAFAMTVHKSQGSEY
                     REVWLLPPSDAPSDEGDDALSGLSKELLYTAITRAREKFVFFGGKKTFCQAVNTVKVR
                     QTALGSMLERVFSQE"
     gene            complement(767106..>767753)
                     /locus_tag="NGO_RS03870"
                     /old_locus_tag="NGO_04090"
                     /pseudo
     CDS             complement(767106..>767753)
                     /locus_tag="NGO_RS03870"
                     /old_locus_tag="NGO_04090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003709966.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
     gene            767761..768723
                     /locus_tag="NGO_RS03875"
                     /old_locus_tag="NGO0773"
                     /old_locus_tag="NGO_0773"
     CDS             767761..768723
                     /locus_tag="NGO_RS03875"
                     /old_locus_tag="NGO0773"
                     /old_locus_tag="NGO_0773"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_157147402.1"
                     /translation="MRNAVGLDISKLTFDATAIVGNAEYSAKFDNDSKGLDQFSDRLK
                     SLGCQNLHICMEATGNYYEEVADYFAQYYSVYVVNPLKISKYAESRFKRTKTDKQDAK
                     LIAQYCRSAQESELVKRQKPTDEQYRLSRMTAAYAQIKSECAAMKNRHHAAKDEEAAK
                     AYAEIIKAMNEQLEVLKEKIKEQTEKPNCKEGVKRLETIPAIGRMTAAVLFHHLTSSK
                     FETSNKFAAFAGLSPQQKESGTSVRGKGKLTKFGNRKLRAVLFMPAMVAYRIRAFPDF
                     IKRLEEKKKPKKVIIAALMRKLAVIAYHVHKKGGDYDPSRYKSA"
     gene            complement(<768856..769311)
                     /locus_tag="NGO_RS03880"
                     /old_locus_tag="NGO_04100"
                     /pseudo
     CDS             complement(<768856..769311)
                     /locus_tag="NGO_RS03880"
                     /old_locus_tag="NGO_04100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003709966.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
     gene            769563..772025
                     /gene="lon"
                     /locus_tag="NGO_RS03885"
                     /old_locus_tag="NGO0775"
                     /old_locus_tag="NGO_0775"
     CDS             769563..772025
                     /gene="lon"
                     /locus_tag="NGO_RS03885"
                     /old_locus_tag="NGO0775"
                     /old_locus_tag="NGO_0775"
                     /EC_number="3.4.21.53"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002233897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endopeptidase La"
                     /protein_id="WP_003688644.1"
                     /translation="MTQKEKHFEEYAALATLPLRDVVVYPHMVLPLFVGRPKSIAALE
                     NAITREEPVFLLAQTDAAVEEPVATDLYQTGTVAQVLQVLKLPDGTVKVLVEGLYRGR
                     VLTIEDTGGLFVSHIEAVVEEDTGGNTDLEAVRRTLLAQFEQYAKLNKKIPAEIIGSI
                     NGIAENSRLTDTVAAHLQLKLAQRQQILEIPEIGKRMEFLLAKLESELDIMQAEKRIR
                     GRVKRQMEKSQREYYLNEQIKAIHKELGEEDENGELDALEAGIKKAGMTKEAEEKCLS
                     ELKKLKMMPPMSAESTVVRNYIDTLLGLPWKKKSRVSKDIAKAGLVLDADHYGLEKVK
                     ERILEYLAVQKRMDKLKGPILCLVGPPGVGKTSLGESIAKATGRKYVRMALGGVRDES
                     EIRGHRRTYIGSMPGKILQNMAKAGVRNPLFLLDEIDKLGSDFRGDPASALLEVLDHE
                     QNNKFADHYAEVDYDLSDVMFIATSNSLNIPTPLLDRMEIIRLSGYTEDEKINIAMQY
                     LVPKQMKRNGVKEGELVVEESAVRDIIRYYTREAGVRSLDREIAKICRKVVMQITLNE
                     DKKRLSETKKTSKAKPRAVKVNEKNLHDYLGVRRFDYGVAESENRIGQVTGLAWTEVG
                     GELLTVEAAALPGKGMIQCTGQLGDVMKESVSAAWSVVRSRAESVGLAPDFYEKKDIH
                     VHVPEGATPKDGPSAGIAMTLAMVSAFTKIPVRADVAMTGEITLRGEVLPIGGLKEKL
                     LAALRGGIKHVLIPKDNVKDLEEIPENVKTGLTIHPVKWIDEVLALGLESRPESWAEP
                     SAAEAAAESASKPKPRSRAIKH"
     gene            772207..772476
                     /locus_tag="NGO_RS03890"
                     /old_locus_tag="NGO0777"
                     /old_locus_tag="NGO_0777"
     CDS             772207..772476
                     /locus_tag="NGO_RS03890"
                     /old_locus_tag="NGO0777"
                     /old_locus_tag="NGO_0777"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007342959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HU family DNA-binding protein"
                     /protein_id="WP_003688640.1"
                     /translation="MNKSELIEAIAQEADISKAAAQKALDATTNAVTNALKQGDTVTL
                     VGFGTFYVGERAERQGRNPKTGEPLTIAAAKTLKFRAGKALKDAL"
     gene            complement(772652..773086)
                     /locus_tag="NGO_RS03895"
                     /old_locus_tag="NGO0778"
                     /old_locus_tag="NGO_0778"
     CDS             complement(772652..773086)
                     /locus_tag="NGO_RS03895"
                     /old_locus_tag="NGO0778"
                     /old_locus_tag="NGO_0778"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002235815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003688638.1"
                     /translation="MTEPKHETPTEEQVAARKKAKAKIRTIRIWAWVILALLASTALL
                     SQCAMSKPQAKQKIVESCMKNIPFAEKWQNDLKARGLDADNTRLAVDYCKCMWEQPLD
                     GLSEKQISSFGKLGAQEQLDLLGGANAFETRDKQCVADLKAD"
     gene            complement(773079..774386)
                     /locus_tag="NGO_RS03900"
                     /old_locus_tag="NGO0779"
                     /old_locus_tag="NGO_0779"
     CDS             complement(773079..774386)
                     /locus_tag="NGO_RS03900"
                     /old_locus_tag="NGO0779"
                     /old_locus_tag="NGO_0779"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004520380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine dehydrogenase"
                     /protein_id="WP_003695291.1"
                     /translation="MKPVNIGLLGLGTVGGGAAAVLRDNAEEISRRLGREIRISAMCD
                     LSEEKARQICPSAAFVKDPFELVARKDVDVVVELFGGTGIAKEAVLKAIENGKHIVTA
                     NKKLLAEYGNEIFPLAEKQNVIVQFEAAVAGGIPIIKALREGLAANRIKSIAGIINGT
                     SNFILSEMREKGSAFADVLKEAQALGYAEADPTFDIEGNDAGHKITIMSALAFGTPMN
                     FSACYLEGISKLDSRDIKYAEELGYRIKLLGVTRKTGKGIELRVHPTLIPESRLLANV
                     DGVMNAVRVNADMVGETLYYGAGAGALPTASAVVADIIDIARLVEADTAHRVPHLAFQ
                     PAQVQAQTILPMDEITSSYYLRVQAKDEPGTLGQIAALLAQENVSIEALIQKGVIDQT
                     TAEIVILTHSTVEKHIKSAIAAIEALDCVEKPITMIRMESLHD"
     gene            774582..774953
                     /locus_tag="NGO_RS03905"
                     /old_locus_tag="NGO0780"
                     /old_locus_tag="NGO_0780"
     CDS             774582..774953
                     /locus_tag="NGO_RS03905"
                     /old_locus_tag="NGO0780"
                     /old_locus_tag="NGO_0780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003714321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Mth938-like domain-containing protein"
                     /protein_id="WP_003688636.1"
                     /translation="MLFEENPIDGQFAEYECGAGGIRLAGQSFHKPVLVHKDSVCLPQ
                     CRTLSDLTPENLLSDIKPVDYPEILIIGTGAAQEFIHPKIMADFSRIGISVECMNTDS
                     AFRTLVFLHSEGRRAWAWLQP"
     gene            775030..776952
                     /locus_tag="NGO_RS03910"
                     /old_locus_tag="NGO0781"
                     /old_locus_tag="NGO_0781"
     CDS             775030..776952
                     /locus_tag="NGO_RS03910"
                     /old_locus_tag="NGO0781"
                     /old_locus_tag="NGO_0781"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003714320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_003691184.1"
                     /translation="MIEIKNLTLQRGLKVLLDKASAAVNPGQRVGLIGKNGTGKSSLF
                     ALIKGEITQDGGDISIPKNWRLASVSQETPDLDISALDYVLQGDAELQAFQTALRQAE
                     VQNDGMKQAEYHAKLEEIDAYTAPARAAKLLNGLGFSQEEHSRPVKSFSGGWRMRLNL
                     AQALICRADLLLLDEPTNHLDLETVLWLENHLASLPCTQIIISHDRDFLNAATTQTIE
                     LSQQKLTQYSGNYDFYQTERAQRLAQQQAAYVKQQAQIKHLQSFIDRFKAKATKAVQA
                     QSRMKALAKLERIAPAHLDSEFSFEFYNPDHLPNPLLKLEHADLGYEGKTVLHDITLS
                     LESGARYGLLGVNGSGKSTFIKALAGKIDLLSGSIVHSEKLNIGYFAQHQLDTIRADQ
                     SPVWHIQQLSPEVREQEIRNFLGGFDFVGDMALQKTEPFSGGEKARLALAMIIWQKPN
                     LLLLDEPTNHLDLDMRHALTLALQSFQGALIVVSHDRSLLEATTDSFLLIDKGRLKNF
                     DGDLNDYRQWRLAQENAATAPAASTQSQNRKDTKRIEAQIRQEKARRSKPIQQKIDKA
                     EKEMVQLSEIQTGCEAFLTQEDAYLEANKEKLQNTLSELAKVKTQLAQIEETWLACQE
                     ELERIETEIEKQFAER"
     gene            776939..777334
                     /locus_tag="NGO_RS03915"
                     /old_locus_tag="NGO0782"
                     /old_locus_tag="NGO_0782"
     CDS             776939..777334
                     /locus_tag="NGO_RS03915"
                     /old_locus_tag="NGO0782"
                     /old_locus_tag="NGO_0782"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014582015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010358122.1"
                     /translation="MPSDKEARAGCLSLPANNGIIRTLPPPFYFTGINIRLFAALGLL
                     SLSGAAAQASIYHCNSNGKSVYTSDPSGSCADADLPKISSHQGGGYRLKIKKLSQEAK
                     IHTGNKKKNKKHAGKKNRQAAKAPKENQK"
     gene            777425..777937
                     /locus_tag="NGO_RS03920"
                     /old_locus_tag="NGO0783"
                     /old_locus_tag="NGO_0783"
     CDS             777425..777937
                     /locus_tag="NGO_RS03920"
                     /old_locus_tag="NGO0783"
                     /old_locus_tag="NGO_0783"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002236996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003688633.1"
                     /translation="MKSKLPLILINLSLISSPLGANAAKIYTCTINGETVYTTKPSKS
                     CHSTDLPPIGNYSSERYILPQTPEPAPSPSNGGQAVKYKAPVKTVSKPAKSNTPPQQA
                     PVNNSRRSILEAELSNERKALTEAQKMLSQARLAKGGNINHQKINALQSNVLDRQQNI
                     QALQRELGRM"
     gene            complement(778313..778495)
                     /locus_tag="NGO_RS03925"
     CDS             complement(778313..778495)
                     /locus_tag="NGO_RS03925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003704052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003704052.1"
                     /translation="MGVCPDARCSAAGIARQIGNGGGIHGTLAFSLLFLSLGHIGMVA
                     YHHIKGESVLPLFLLI"
     gene            complement(<778599..778685)
                     /locus_tag="NGO_RS03930"
                     /pseudo
     CDS             complement(<778599..778685)
                     /locus_tag="NGO_RS03930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003823631.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
     gene            complement(778867..779526)
                     /gene="ung"
                     /locus_tag="NGO_RS03935"
                     /old_locus_tag="NGO0786"
                     /old_locus_tag="NGO_0786"
     CDS             complement(778867..779526)
                     /gene="ung"
                     /locus_tag="NGO_RS03935"
                     /old_locus_tag="NGO0786"
                     /old_locus_tag="NGO_0786"
                     /EC_number="3.2.2.27"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013448910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-DNA glycosylase"
                     /protein_id="WP_003688628.1"
                     /translation="MDTWHDALGGEKQQPYFQEILNAVRQERLSGQIIYPPEADVFNA
                     FRLTAFDRVKVVILGQDPYHGVGQAHGLAFSVRQGVRIPPSLLNIYKELETDIEGFSI
                     PAHGCLTAWAEQGILLLNTVLTVRAGQAHSHALLGWERFTDTVIRQLATHRKHLVFML
                     WGGYAQQKGRLIDSQNHLILTAPHPSPLSAYRGFFGCRHFSQANSYLSQHGIEPINWK
                     L"
     gene            779607..780014
                     /locus_tag="NGO_RS03940"
                     /old_locus_tag="NGO0787"
                     /old_locus_tag="NGO_0787"
     CDS             779607..780014
                     /locus_tag="NGO_RS03940"
                     /old_locus_tag="NGO0787"
                     /old_locus_tag="NGO_0787"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NfeD family protein"
                     /protein_id="WP_003704054.1"
                     /translation="MTVWFVAAVAVLIIELLTGTVYLLVVSAALAGSGIAYGLTGSTP
                     AAVLTAALLSALGIWFVHAKTAVGKVETDSYQDLDTGKYAEILRYTGGNRYEVFYRGT
                     HWQAQNTGQEVFEPGTRALIVRKEGNLLIIANP"
     gene            780029..780976
                     /locus_tag="NGO_RS03945"
                     /old_locus_tag="NGO0788"
                     /old_locus_tag="NGO_0788"
     CDS             780029..780976
                     /locus_tag="NGO_RS03945"
                     /old_locus_tag="NGO0788"
                     /old_locus_tag="NGO_0788"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003752410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="paraslipin"
                     /protein_id="WP_003688626.1"
                     /translation="MEFFIILLAAVAVFGFKSFVVIPQQEVHVVERLGRFHRALTAGL
                     NILIPFIDRVAYRHSLKEIPLDVPSQVCITRDNTQLTVDGIIYFQVTDPKLASYGSSN
                     YIMAITQLAQTTLRSVIGRMELDKTFEERDEINSTVVSALDEAAGAWGVKVLRYEIKD
                     LVPPQEILRAMQAQITAEREKRARIAESEGRKIEQINLASGQREAEIQQSEGEAQAAV
                     NASNAEKIARINRAKGEAESLRLVAEANAEAIRQIAAALQTQGGADAVNLKIAEQYVA
                     AFNNLAKESNTLIMPANVADIGSLISAGMKIIDSSKTAK"
     gene            complement(781083..782153)
                     /locus_tag="NGO_RS03950"
                     /old_locus_tag="NGO0789"
                     /old_locus_tag="NGO_0789"
     CDS             complement(781083..782153)
                     /locus_tag="NGO_RS03950"
                     /old_locus_tag="NGO0789"
                     /old_locus_tag="NGO_0789"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003697066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AI-2E family transporter"
                     /protein_id="WP_003697066.1"
                     /translation="MYRRKGRGIKPWMGAGAAFAALVWLVYALGDTLTPFAVAAVLAY
                     VLDPLVEWLQKKGLNRASASMSVMVFSLILLLALLLIIVPMLVGQFNNLASRLPQLIG
                     FMQNTLLPWLKNTIGGYVEIDQASIIAWFQAHTGELSNALKAWFPVLMKQGGNIVSSI
                     GNLLLPPLLLYYFLLDWQRWSCGIAKLVPRRFAGAYTRITGNLNEVLGEFLRGQLLVM
                     LIMGLVYGLGLMLVGLDSGFAIGMVAGILVFVPYLGAFTGLLLATVAALLQFGSWNGI
                     LAVWAVFAVGQFLESFFITPKIVGDRIGLSPFWVIFSLMAFGELMGFVGMLAGLPLAA
                     VTLVLLREGAQKYFAGSFYRGR"
     gene            782338..782613
                     /locus_tag="NGO_RS03955"
                     /old_locus_tag="NGO0791"
                     /old_locus_tag="NGO_0791"
     CDS             782338..782613
                     /locus_tag="NGO_RS03955"
                     /old_locus_tag="NGO0791"
                     /old_locus_tag="NGO_0791"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003675413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YbeD family protein"
                     /protein_id="WP_002237935.1"
                     /translation="MTEQENKTSLIEFPCTFPLKVMGAVHPEFEQAVLETVRLHAPDT
                     QAHHITTRPSSKGNYTGATVQVKVENQEQLDNIYRALTSHELVKVVL"
     gene            782615..783238
                     /gene="lipB"
                     /locus_tag="NGO_RS03960"
                     /old_locus_tag="NGO0792"
                     /old_locus_tag="NGO_0792"
     CDS             782615..783238
                     /gene="lipB"
                     /locus_tag="NGO_RS03960"
                     /old_locus_tag="NGO0792"
                     /old_locus_tag="NGO_0792"
                     /EC_number="2.3.1.181"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013448905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoyl(octanoyl) transferase LipB"
                     /protein_id="WP_003688623.1"
                     /translation="MKIIHKGLVEYLPTFEAMKTFNAGRNADTEDELWVVEHPPVFTQ
                     GLAGKPEHLLIRDDIPVVQIDRGGQITYHGPGQLVVYTMIDFKRRKTSVRNIVSALEN
                     SIIATLAEYGIEAAADPKRPGIYVGERKIASLGLRIKNGSVYHGLALNVNMDLSPFTQ
                     INPCGYAGMEMTQIADFVQPCPAPDEVASKLTAHLETQLTPKADNNE"
     gene            783231..784214
                     /gene="lipA"
                     /locus_tag="NGO_RS03965"
                     /old_locus_tag="NGO0793"
                     /old_locus_tag="NGO_0793"
     CDS             783231..784214
                     /gene="lipA"
                     /locus_tag="NGO_RS03965"
                     /old_locus_tag="NGO0793"
                     /old_locus_tag="NGO_0793"
                     /EC_number="2.8.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002239803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoyl synthase"
                     /protein_id="WP_003688622.1"
                     /translation="MSEIKTDDPKRGIKLRGADKTARIPIKVVPLQEKLKKPEWIRAK
                     LPSRKFFEIKDILREQKMHTVCEEASCPNIGECFSKGTATFMIMGDICTRRCPFCDVG
                     HGRPNMLDPDEPKNLAESVKAMNLRYVVITSVDRDDLRDGGAQHFADCIKAIRETSPN
                     TKIEILVPDFRGRLDIALKILAETPPDVMNHNLETHPSLYRKARPGANYQHSLDLLKR
                     YKEMMPHIPTKSGIMVGLGETDEDVREIMRDMRAHNIEMITIGQYLQPSDGHLPVLRY
                     VTPEQFKIFEKEAYELGFTNAAIGAMVRSSYHADEQAAEALRESHGGCGHH"
     gene            784689..785153
                     /gene="bfr"
                     /locus_tag="NGO_RS03970"
                     /old_locus_tag="NGO0794"
                     /old_locus_tag="NGO_0794"
     CDS             784689..785153
                     /gene="bfr"
                     /locus_tag="NGO_RS03970"
                     /old_locus_tag="NGO0794"
                     /old_locus_tag="NGO_0794"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003675404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin"
                     /protein_id="WP_003688620.1"
                     /translation="MQGNQAVVDYMNELLSGELAARDQYFIHSRLYSEWGYTKLFERL
                     NHEMEEETTHAEDFIRRILMLGGTPKMARSELNIGTDVVSCLKADLQTEYEVRDALKK
                     GIKLCEEAQDYVTRDLMVAQLKDTEEDHAHWLEQQLRLIELIGEGNYYQSQL"
     gene            785181..785654
                     /gene="bfr"
                     /locus_tag="NGO_RS03975"
                     /old_locus_tag="NGO0795"
                     /old_locus_tag="NGO_0795"
     CDS             785181..785654
                     /gene="bfr"
                     /locus_tag="NGO_RS03975"
                     /old_locus_tag="NGO0795"
                     /old_locus_tag="NGO_0795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016687569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin"
                     /protein_id="WP_002213535.1"
                     /translation="MKGDRLVIRELNKNLGLLLVTINQYFLHARILKNWGFEELGEHF
                     FKQSIVEMKAADDLIERILFLEGLPNLQELGKLLIGESTEEIIACDLTKEQEKHEALL
                     AAIATAEAQQDYVSRDLLEKQKDTNEEHIDWLETQQELIGKIGLPNYLQTAAQED"
     gene            785985..786302
                     /locus_tag="NGO_RS03980"
                     /old_locus_tag="NGO0797"
                     /old_locus_tag="NGO_0797"
     CDS             785985..786302
                     /locus_tag="NG