GenomeNet

Database: RefSeq
Entry: NC_003064
LinkDB: NC_003064
Original site: NC_003064 
LOCUS       NC_003064             542868 bp    DNA     circular CON 31-JUL-2020
DEFINITION  Agrobacterium fabrum str. C58 plasmid At, complete sequence.
ACCESSION   NC_003064 NZ_AE007873-NZ_AE007922 NZ_AE008687
            NZ_AE008926-NZ_AE008974
VERSION     NC_003064.2
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603108
            Assembly: GCF_000092025.1
KEYWORDS    RefSeq.
SOURCE      Agrobacterium fabrum str. C58
  ORGANISM  Agrobacterium fabrum str. C58
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium;
            Agrobacterium tumefaciens complex.
REFERENCE   1  (bases 1 to 542868)
  AUTHORS   Goodner,B., Hinkle,G., Gattung,S., Miller,N., Blanchard,M.,
            Qurollo,B., Goldman,B.S., Cao,Y., Askenazi,M., Halling,C.,
            Mullin,L., Houmiel,K., Gordon,J., Vaudin,M., Iartchouk,O., Epp,A.,
            Liu,F., Wollam,C., Allinger,M., Doughty,D., Scott,C., Lappas,C.,
            Markelz,B., Flanagan,C., Crowell,C., Gurson,J., Lomo,C., Sear,C.,
            Strub,G., Cielo,C. and Slater,S.
  TITLE     Genome sequence of the plant pathogen and biotechnology agent
            Agrobacterium tumefaciens C58
  JOURNAL   Science 294 (5550), 2323-2328 (2001)
   PUBMED   11743194
REFERENCE   2  (bases 1 to 542868)
  AUTHORS   Wood,D.W., Setubal,J.C., Kaul,R., Monks,D.E., Kitajima,J.P.,
            Okura,V.K., Zhou,Y., Chen,L., Wood,G.E., Almeida,N.F. Jr., Woo,L.,
            Chen,Y., Paulsen,I.T., Eisen,J.A., Karp,P.D., Bovee,D. Sr.,
            Chapman,P., Clendenning,J., Deatherage,G., Gillet,W., Grant,C.,
            Kutyavin,T., Levy,R., Li,M.J., McClelland,E., Palmieri,A.,
            Raymond,C., Rouse,G., Saenphimmachak,C., Wu,Z., Romero,P.,
            Gordon,D., Zhang,S., Yoo,H., Tao,Y., Biddle,P., Jung,M.,
            Krespan,W., Perry,M., Gordon-Kamm,B., Liao,L., Kim,S., Hendrick,C.,
            Zhao,Z.Y., Dolan,M., Chumley,F., Tingey,S.V., Tomb,J.F.,
            Gordon,M.P., Olson,M.V. and Nester,E.W.
  TITLE     The genome of the natural genetic engineer Agrobacterium
            tumefaciens C58
  JOURNAL   Science 294 (5550), 2317-2323 (2001)
   PUBMED   11743193
REFERENCE   3  (bases 1 to 542868)
  AUTHORS   Hinkle,G., Slater,S.C. and Goodner,B.
  TITLE     Complete Genome Sequence of Agrobacterium tumefaciens C58
            (Rhizobium radiobacter C58), the Causative Agent of Crown Gall
            Disease in Plants
  JOURNAL   Unpublished
REFERENCE   4  (bases 1 to 542868)
  AUTHORS   Slater,S.C., Setubal,J.C., Zhao,Y., Goodner,B., Houmiel,K., Sun,J.,
            Kaul,R., Goldman,B., Chen,Q., Huang,W.Mun., Casjens,S., Farrand,S.,
            Burr,T., Nester,E., Kadoi,R., Ostheimer,T., Pride,N., Sabo,A.,
            Henry,E., Telepak,E. and Wood,D.
  CONSRTM   agrobacterium.org
  TITLE     Direct Submission
  JOURNAL   Submitted (30-OCT-2007) Virginia Bioinformatics institute, Virginia
            Polytechnic Institute and State University, Washington Street Box
            0477, Blacksburg, VA 24060, USA
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 542868)
  AUTHORS   Hinkle,G., Slater,S.C. and Goodner,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-AUG-2001) Cereon Genomics, 45 Sidney Street,
            Cambridge, MA 02139, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            AE007872.
            On or before Nov 7, 2007 this sequence version replaced
            NC_003306.1, NC_003064.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 03/10/2020 10:53:47
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 5,322
            CDSs (total)                      :: 5,251
            Genes (coding)                    :: 5,160
            CDSs (with protein)               :: 5,160
            Genes (RNA)                       :: 71
            rRNAs                             :: 4, 4, 4 (5S, 16S, 23S)
            complete rRNAs                    :: 4, 4, 4 (5S, 16S, 23S)
            tRNAs                             :: 53
            ncRNAs                            :: 6
            Pseudo Genes (total)              :: 91
            CDSs (without protein)            :: 91
            Pseudo Genes (ambiguous residues) :: 0 of 91
            Pseudo Genes (frameshifted)       :: 38 of 91
            Pseudo Genes (incomplete)         :: 55 of 91
            Pseudo Genes (internal stop)      :: 20 of 91
            Pseudo Genes (multiple problems)  :: 18 of 91
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..542868
                     /organism="Agrobacterium fabrum str. C58"
                     /mol_type="genomic DNA"
                     /strain="C58"
                     /culture_collection="ATCC:33970"
                     /type_material="type strain of Agrobacterium fabrum"
                     /db_xref="taxon:176299"
                     /plasmid="At"
     gene            154..1377
                     /gene="repA"
                     /locus_tag="ATU_RS23950"
                     /old_locus_tag="AGR_pAT_1"
                     /old_locus_tag="Atu5000"
     CDS             154..1377
                     /gene="repA"
                     /locus_tag="ATU_RS23950"
                     /old_locus_tag="AGR_pAT_1"
                     /old_locus_tag="Atu5000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006699340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein RepA"
                     /protein_id="WP_162180348.1"
                     /translation="MAIAKQIEATIGQKEDAGGKIARHASLLSQQLQELRTRMYPPKS
                     EKSLRPFLTNEVSKLTSIPDSTLKLMSSEGRGPVPGRLENNHRVYTLAQINELREFFA
                     SQKPSEALRFLPRRREGEHLQVVAIANFKGGSAKTTTCVHLAHYLALQGYRVLALDLD
                     PQASLSALFGAQPEFDVGANETIYAALRYDDAERRPIRDIIRKTYFDGIDLIPGNLEV
                     MEYEHETPRVLAQKSGSGAIFFERLKLALSEVEQDYDIVILDTPPSLGFLTLSAIYAA
                     TSMIITVHPAMLDVASMSQFLLMMGDLISVLNESGAQLDQDFIRYLVTRHDPNDAPQS
                     QVVAMMRHLFGSDVLLPTLIESTAVEAAGLAKRSIYELEMGQIGRDTHKRAREAVDAV
                     NEAILKLINTSWGRT"
     gene            1374..2405
                     /gene="repB"
                     /locus_tag="ATU_RS23955"
                     /old_locus_tag="AGR_pAT_3"
                     /old_locus_tag="Atu5001"
     CDS             1374..2405
                     /gene="repB"
                     /locus_tag="ATU_RS23955"
                     /old_locus_tag="AGR_pAT_3"
                     /old_locus_tag="Atu5001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein RepB"
                     /protein_id="WP_010974268.1"
                     /translation="MTSKSSRKSIVANFGLLSAELENRLSTDNSATPQQSTAPARVGA
                     GVIGAAHRAIDDIKSERDRLKALVESGGGAIRELDPSKIDPSPFPDRLPDDNASDFET
                     FRNSIRSEGQKVPIQVRKSPSSPERYQVIYGHRRLRAAKDLGIPVKAIEVEISDVELV
                     IAQGIENADRQDLTWIERALFARRMDDADVKPRDIKAALSIDDPELARMRAVYRSVPF
                     EIIEAIGRATKVGRPRWAEFAKAFSEQADLHDELRKALSLASEKHLGSDQKFLAALNA
                     LKPAAPSQKAGGKKIAGAAGEQLGSFLRTTKDIRISVETPAGAEFLDFIEAELPTLVE
                     RFARKGSKT"
     gene            2606..3820
                     /locus_tag="ATU_RS23960"
                     /old_locus_tag="AGR_pAT_4"
                     /old_locus_tag="Atu5002"
     CDS             2606..3820
                     /locus_tag="ATU_RS23960"
                     /old_locus_tag="AGR_pAT_4"
                     /old_locus_tag="Atu5002"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein RepC"
                     /protein_id="WP_006313545.1"
                     /translation="MEGGQVTTPFGRRPVTLALVKRQIATTKIEEGKSADKWRVFRDA
                     SEAREVLGLQDRSLAVLDALLSFYPENELRQDAQLVVFPSNIQLSIRAHGIAGATLRR
                     HLALLVEAGLIIRKDSANGKRYARKDDEGSIEHAFGFDISPLLMRAEELACLAQQVAA
                     DRIAFRRAKESLTICRRDIRKLITAGVEEGASGDWSGLEERYLALVGQIPRNPTLNEL
                     SDLGAKMASLREDILKLLNSDDFSSEMTTNDAQIERHIQNSNTNHLNELEPSSGNEQG
                     AKPSQNKQAGHVPIKAFPIGLVLRACPEISNYGPEGQIGSWRELMTAAVVVRSMLGVS
                     PSAYQEACEIMGPENAAVTIACILERGGHINSPGGYLRDLTSKAKRGEFSLGPVLMAL
                     LRAGGHQVKATG"
     gene            complement(4153..5280)
                     /locus_tag="ATU_RS23965"
                     /old_locus_tag="AGR_pAT_5"
                     /old_locus_tag="Atu5003"
     CDS             complement(4153..5280)
                     /locus_tag="ATU_RS23965"
                     /old_locus_tag="AGR_pAT_5"
                     /old_locus_tag="Atu5003"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding oxidoreductase"
                     /protein_id="WP_010974269.1"
                     /translation="MTDNTISSAVIIGAGIFGVSTGVQLARRGIQVTILNDGPPANGA
                     SGRSLSWLNSARMRSEPYHQLRMAGIDRYRTLAAENPDVEWLRFDGGLTWDSDDERNE
                     IDAAYRHEVSLAYDAQRLSAGDVARVTPGIDAGAITPQGAIFNPGEGWVDLPTLIRVL
                     LEEFFALGGVLVTDQGAARVMLEGGRAVGAETAEGYLHRADAVVLATGPAVPKMVGES
                     GQIIGDGTPIALLVQTKPLAHPLRAVLNTPRVAVRPAPGGSFSLDADWAADEGVTVRA
                     DGTYEIDDTIVAELLVEAAKVMEGNPQLEVASIGVGGKPIPGDGEPVIGAIKAIPGYY
                     VAFSHSGATLGLIVGELLAFEIVTGTEHQMLATFRPERFSS"
     gene            complement(5325..6332)
                     /locus_tag="ATU_RS23970"
                     /old_locus_tag="AGR_pAT_7"
                     /old_locus_tag="Atu5004"
     CDS             complement(5325..6332)
                     /locus_tag="ATU_RS23970"
                     /old_locus_tag="AGR_pAT_7"
                     /old_locus_tag="Atu5004"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003504212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="WP_010974270.1"
                     /translation="MTRTIRWGVLGCAGIAAKAVIPAIQSSRLGRVVAIASRDAAKAK
                     EMTARFGIARSYGSYEDLLADPEIDAIYNPLPNHLHVPMTIKALEQGKPVLCEKPIAL
                     DAAQARELATAQKAASLPVAEAFMVRHHPQWKKAHALITEGRLGEVRAIQTIFSYYLD
                     DPGNVRNQVDIGGGGLFDVGCYAINTARFLFDAEPLRAIALMERDPVFGTDRLTSGLL
                     AFPEGKQLAFTCSTQLSLTQKVTVLGTRGRLEIPIPFNAPADEPTVLIFDDGRDLAGG
                     GREEIMIGPVDQYREQADAFAEAVLSGKPLETDLGDAIANTKAIDALFRSAASGRWEE
                     P"
     gene            complement(6352..7860)
                     /locus_tag="ATU_RS23975"
                     /old_locus_tag="AGR_pAT_9"
                     /old_locus_tag="Atu5005"
     CDS             complement(6352..7860)
                     /locus_tag="ATU_RS23975"
                     /old_locus_tag="AGR_pAT_9"
                     /old_locus_tag="Atu5005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003501617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease/ATP-binding
                     protein"
                     /protein_id="WP_010974271.1"
                     /translation="MNWLENLRRSFLDWNAMAEVLPTMITVGLKNTLILAATSTVLGV
                     AIGMMLAIMGISRSPWLRIPARLYTDIFRGLPAIVTILLIGQGFARIGRELFGPSPYP
                     LGILALSLIAGAYIGEIFRSGIQSVDRGQMEACRALSMSYGQGMRLIVVPQGVRRVLP
                     ALVNQFIGNVKDSSLVYFLGLLASEREIFRVGQDQAVVTGNLSPLLLAGVFYLIVTVP
                     LTHVVNAIDNRLRIGKQRPSVITSGLEEVSELDGAARASGVAFKGGSLDVRRLGMAYG
                     DLDVLKGVDLSVKPGSVTCIIGPSGSGKSTLLRGLNRLVEPKSGDILIDGESILAMKP
                     ETLRRRVGMVFQHFNLFPDHTALENVMLSLKKIKGLPAAEAERIAKAGLADVGLASRQ
                     HHRPGGLSGGQQQRVAIARALAMEPEVILFDEVTSALDPELVKGVLNLMAELGTRGMT
                     MVVVTHEMGFARRVADQVVFMDEGRVVEAGTPEAIFDNPQSPRLQRFLAEVL"
     gene            complement(7921..8754)
                     /locus_tag="ATU_RS23980"
                     /old_locus_tag="AGR_pAT_12"
                     /old_locus_tag="Atu5006"
     CDS             complement(7921..8754)
                     /locus_tag="ATU_RS23980"
                     /old_locus_tag="AGR_pAT_12"
                     /old_locus_tag="Atu5006"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020808214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_010974272.1"
                     /translation="MRFTEAFTSPFAKIRATAIAVTLGVLAGAATPALADNPLGLIDP
                     TTISVGTMGDAKPYAFTTADGNFTGFDIELFLNVAGRLGFKKEQVVFTGQEFSALMPS
                     VANGRFDVAAAAIGTTAKRKETVDFSDGYLAGFLSVLTSEAGITDAAGLKGKRLGVVQ
                     GTLQEIYAEKNFAGTDLVKFPDNNSAVSALNNGTVDAHFLDFEAAKDYSARYPALKIA
                     VNIPSFDAPAGFVIRKGNDALRNALDKGLKEAMQDGTWKKLHEKWFPGTPMPAAYLPK
                     Q"
     gene            8980..10044
                     /locus_tag="ATU_RS23985"
                     /old_locus_tag="AGR_pAT_13"
                     /old_locus_tag="Atu5007"
     CDS             8980..10044
                     /locus_tag="ATU_RS23985"
                     /old_locus_tag="AGR_pAT_13"
                     /old_locus_tag="Atu5007"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_010974273.1"
                     /translation="MDKSLSKSPSVTVADVARRAGVSKATAARVLGGYGTVSDRVREA
                     VTAAASSLDYRPNELARSMTTGRSGTIGVVVGDIENPFFSLAVRGITDVARQAGFTVI
                     LINSGEDAAAEKAAIRTLLAKRVDGLIVSPAKENDVEHLHEVIRSGLPLALLDRGSDT
                     LEVDTVLADDRYTAENVTSRLIALGHRRIAYLTACDTPDHRFRTPQDISTGSVRRRIE
                     GYLAVCREAGFIGMEDWVKVGAVTPERTHRIVIETLQSGHRPTAIIASDSIIGLEVFK
                     AHRELGLNIPGDLSLVSFHDADWTSVTTPPVTVVRQPVYELGATAARLLVERLNGEDR
                     AARKVVLKNEVVERASTRAI"
     gene            10306..10611
                     /locus_tag="ATU_RS23990"
                     /old_locus_tag="Atu8044"
     CDS             10306..10611
                     /locus_tag="ATU_RS23990"
                     /old_locus_tag="Atu8044"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018448464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974274.1"
                     /translation="MDQPNLWRHMASAPKDGNRILVTIRSSEQGPAQVDLVYWSNGDR
                     LGSEGWRASDSSPGRIIEYAEPELKCWMPIPSANVDGLSTPSPWQGDDDRELYGSGI"
     gene            complement(10667..11563)
                     /locus_tag="ATU_RS23995"
                     /old_locus_tag="AGR_pAT_14"
                     /old_locus_tag="Atu5008"
     CDS             complement(10667..11563)
                     /locus_tag="ATU_RS23995"
                     /old_locus_tag="AGR_pAT_14"
                     /old_locus_tag="Atu5008"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF72 domain-containing protein"
                     /protein_id="WP_162180349.1"
                     /translation="MRLKSFDVRPVPCLPKVTDKQIGNFRGASSLHTCKSKMEESDLP
                     IIATAAWSIPKKVASRFPEEGSGLQRYASVFDGVEINSTFYRRHKTSTFARWAGFVPD
                     GFRFSVKMPKEISHTRAMIDVAEPFCSFIEDIAPLGEKRGPLLCQLPPSLAFESRTFD
                     IAFKTMRNTDMGPIVIEARHKSWASLEASDLLKTYEIDRVLADPALVWPVEVFDTPPR
                     YIRLHGKPKIYYSVYSDEEIEFFFKNVAPDGWCVFDNTASGAAIENALSMLGSSHAPR
                     KTLRKGKRPPVAEDAAAKSENG"
     gene            <12538..12717
                     /locus_tag="ATU_RS24000"
                     /old_locus_tag="AGR_pAT_15"
                     /old_locus_tag="Atu5010"
                     /pseudo
     CDS             <12538..12717
                     /locus_tag="ATU_RS24000"
                     /old_locus_tag="AGR_pAT_15"
                     /old_locus_tag="Atu5010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013343496.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            13079..13723
                     /locus_tag="ATU_RS24005"
                     /old_locus_tag="AGR_pAT_16"
                     /old_locus_tag="Atu5011"
     CDS             13079..13723
                     /locus_tag="ATU_RS24005"
                     /old_locus_tag="AGR_pAT_16"
                     /old_locus_tag="Atu5011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020095754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DsbA family protein"
                     /protein_id="WP_035257857.1"
                     /translation="MMLKIDLYTEITCPWCIIGHHRLDKVLAGRFPELDADIRQHPDL
                     LLPDAPAEGLYIPDLLLSRYGVTDPKALFARPEAEARASGLDLDLSRQPWTYRTQAAH
                     GLIFAARARGTQHQLAVAITDAYFLEAKNISDADVLADIAVAYGFEREEARAIALDPE
                     QHRRVEQEAARSMAAGVRSVPYFVFGGRIAINGGRSEDEIASAIREAIGVAASA"
     gene            complement(13844..>14090)
                     /locus_tag="ATU_RS24010"
                     /old_locus_tag="AGR_pAT_19"
                     /old_locus_tag="Atu5012"
                     /pseudo
     CDS             complement(13844..>14090)
                     /locus_tag="ATU_RS24010"
                     /old_locus_tag="AGR_pAT_19"
                     /old_locus_tag="Atu5012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016737361.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
     gene            14416..14664
                     /locus_tag="ATU_RS24015"
                     /old_locus_tag="AGR_pAT_20"
                     /old_locus_tag="Atu5013"
     CDS             14416..14664
                     /locus_tag="ATU_RS24015"
                     /old_locus_tag="AGR_pAT_20"
                     /old_locus_tag="Atu5013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006699336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system VapB family
                     antitoxin"
                     /protein_id="WP_006313527.1"
                     /translation="MVTPQLSVRSSKARDLAHKLARRENRTIADIVERALETYEAREA
                     GREPAAKFYSRLSSQSGTDIDFDSIIDENRRAHKGVEL"
     gene            14661..15074
                     /locus_tag="ATU_RS24020"
                     /old_locus_tag="AGR_pAT_21"
                     /old_locus_tag="Atu5014"
     CDS             14661..15074
                     /locus_tag="ATU_RS24020"
                     /old_locus_tag="AGR_pAT_21"
                     /old_locus_tag="Atu5014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006325603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system VapC family
                     toxin"
                     /protein_id="WP_010974278.1"
                     /translation="MIFLDTNVMSETFKKAPDSAVIAWLVRHDAELALPTVAVAEIAF
                     GIQKIRPDQRADRLEEGLVSWRRRFSDKMFAFTEEAALAYGDIMGDAARQGRGMSAPD
                     GMIAAITRINGGRLATRNLKDFETTGLELISPWQF"
     gene            complement(15089..16237)
                     /locus_tag="ATU_RS24025"
                     /old_locus_tag="AGR_pAT_22"
                     /old_locus_tag="Atu5015"
     CDS             complement(15089..16237)
                     /locus_tag="ATU_RS24025"
                     /old_locus_tag="AGR_pAT_22"
                     /old_locus_tag="Atu5015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012760230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="WP_035257854.1"
                     /translation="MAKAKSSQTSVERRAEELDTIASVLPLERRDELAELLTDQDVET
                     LRHLVNQGMGDNTLRALTSDLAYLEAWGLATTGSSLPWPAPEALLLKFVAHHLWDPEK
                     RATDPDHGMPAAVDENLRRQGFLRSVGPHAPSTVRRRLANWSTLTRWRGLHGAFASPA
                     LKSAIRLAVRAVPRTRARKSAKAVTGDVLAKLLATCESDSLRDLRDKAILMVAFASGG
                     RRRSEIAGLRREQLTIEAPIETEGGPPLPSLAIHLGRTKTTSGEEDDTVFLTGRPVEA
                     LNAWLAAAKIDKGSVFRGIGRWGTVSRRALDPQSVNAILKQRAEMAGLEAGQFSAHGL
                     RSGYLTEAANRGIPLPEAMEQSRHRSVQQASSYYNSATRRSGRAARLL"
     gene            16428..17576
                     /locus_tag="ATU_RS24030"
                     /old_locus_tag="AGR_pAT_23"
                     /old_locus_tag="Atu5016"
     CDS             16428..17576
                     /locus_tag="ATU_RS24030"
                     /old_locus_tag="AGR_pAT_23"
                     /old_locus_tag="Atu5016"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018326374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1612 and helix-turn-helix domain-containing
                     protein"
                     /protein_id="WP_010974280.1"
                     /translation="MISMAYDLAKISTSDLMRPAFDAGVALTRLDERIARSPVGQGWI
                     ERTHFTEACASLWVDGELVHLEDLVLHDATRDIRTPTHELTIARDVLRTRRRIAAQPP
                     DWTLSADGLRTLRQTSEIASTGVGEAETAAAIRRVVVTDPEGEGDEVDSGENLPGVDL
                     EAIDAVLARSEAAIESATRPGRAGGSRATEKDPMVYDLDWDEEARLDEWRGVLRQAQE
                     LPAVLQAIVALDAWNELSVLQHAPWLGRLLAASILRHAGVTSGAHLAAINLGLKTIPV
                     DRRRHRDRESRLLAIAHGFLAAAEIGLKEHDRLILARTMVERKLDGRRTSSKLPELVE
                     LVMAKPLVSAGMVAKTLDVTPQAARRIVLELGLREMTGRGRFRAWGIL"
     gene            complement(17669..18334)
                     /locus_tag="ATU_RS24035"
                     /old_locus_tag="Atu5017"
     CDS             complement(17669..18334)
                     /locus_tag="ATU_RS24035"
                     /old_locus_tag="Atu5017"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162180339.1"
                     /translation="MPTEIETAVLLDSRRRCCICFALNRDTNVKPGQIAHLDGNNSNH
                     TIPNLAFLCLEHHDGYDTTTSQSKGFKIAEVKRYKEELMEWLGSALSQKVHYGVLELP
                     ASDPYAGQWVRMGSSENPAELQIIPLPDTIDGQARYFVSGVAYFGTSNRYGPNMGTLE
                     FFSQVIHESSLVFVRRSIVLQGEPAITEVIFTDDGHLKVREEDTGGQYGSGVTFDGLY
                     RRA"
     gene            complement(18384..19208)
                     /locus_tag="ATU_RS24040"
                     /old_locus_tag="AGR_pAT_24"
                     /old_locus_tag="Atu5018"
     CDS             complement(18384..19208)
                     /locus_tag="ATU_RS24040"
                     /old_locus_tag="AGR_pAT_24"
                     /old_locus_tag="Atu5018"
                     /inference="COORDINATES: protein motif:HMM:NF022633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2971 domain-containing protein"
                     /protein_id="WP_010974282.1"
                     /translation="MPEKAPVPPKRLSHYTTLEGLKGIVASGSLWASNASFLNDRAEL
                     IHALDASERAIGLLSSRKAQKAWAPMLREAFDELRDGRKADTFVACFCGDDDNLSQWR
                     GYGGNVQGVSVTFDREALAKRLEKDHAKLRKVIYARISTASRLKNELVGELAELAKLE
                     ESSPDRNDSLRYNELVSRVSGLLPRFKHWGFRDEREWRFVLQKKVLKEDLSFRISENK
                     MVPYIVIGNAEEPLPIKSVLVGPGSDQELTAKSIKAFLDAHGYNVKVRTSDVPFRP"
     gene            complement(19234..20004)
                     /locus_tag="ATU_RS24045"
                     /old_locus_tag="AGR_pAT_25"
                     /old_locus_tag="Atu5019"
     CDS             complement(19234..20004)
                     /locus_tag="ATU_RS24045"
                     /old_locus_tag="AGR_pAT_25"
                     /old_locus_tag="Atu5019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012329853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TatD family hydrolase"
                     /protein_id="WP_010974283.1"
                     /translation="MIDTHCHLDLYPKPGTVIAEADKRGMFVIAVTTTPKAFLGNIRM
                     TEGKKRIRVAVGLHPELVAERHREVEDVCKLMAKTKYVGEIGIDGSPPHKSSIKLQTE
                     VFARFLTRASELGGKVLSIHSRGAAALVLDEIERNGHGTLPILHWFSGSKQQVERAAK
                     LGCWFSVGPAMLRSRKGRELLASMPRHRLLTETDGPFATDVDRPLMPWDVSMALPAIA
                     DVWGTTPVGVDQVVSANFRELINATEQGRAAAKLVGNC"
     gene            complement(20001..21335)
                     /locus_tag="ATU_RS24050"
                     /old_locus_tag="AGR_pAT_26"
                     /old_locus_tag="Atu5020"
     CDS             complement(20001..21335)
                     /locus_tag="ATU_RS24050"
                     /old_locus_tag="AGR_pAT_26"
                     /old_locus_tag="Atu5020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003510076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974284.1"
                     /translation="MKIAALRPEQPTPSGVDHRISIFEGDLGALSRSSGHAGLSVSNE
                     LFKWAGRSPSTLAWDFTALALGVVGADRLVNRLQTSADGWTREIDLTVAVSDPGRWQS
                     LSDQIEQMLSFLTGDFWSLRFVEGGYHPRPPKQVIGSRPETCVALLSGGLDSLIGAID
                     MEADGLEKPVYVSNRVRGDVAKQEKFASRLGAGNRLLSLNADPRTSGATAEISQRPRS
                     IVFIAFAALAVTLLDRYNDGEVVDLHTPENGFISLNIPLTTLRRGSLSTRTTHPKFIE
                     MLQGLFDSLELRIRLRNHHQLKTKGTMMLGSKNQELLIELASESMSCGRAGRIYTHCG
                     RCLPCLVRRSSFLKWAGRLDADKTVYVHPKAEDLVHGRVNNDFHGKAFAEYDDVMQAL
                     TALNFVERNGPRRWTGAHITTSHLGIDAEAYRNVAVEGLKEIGDFLKLTGLR"
     gene            complement(21332..21877)
                     /locus_tag="ATU_RS24055"
     CDS             complement(21332..21877)
                     /locus_tag="ATU_RS24055"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_071241530.1"
                     /translation="MSKSSSAAGGVYNILSGGASAEADAADAPSLDVRTLAGLPHSEI
                     AERIADAVNPGDVSLDDAGVREAVAEAVSSVLSENETADITNLPSELIEECYVRTLAM
                     SAFNIIIADIGASLQRAAHGNAGLANDRLKEISDFMREAYRAQYTKFKERGGQVSRRT
                     AKSIAQSVTSQVMDIFESYLE"
     gene            complement(22228..24126)
                     /locus_tag="ATU_RS24060"
                     /old_locus_tag="AGR_pAT_30"
                     /old_locus_tag="Atu5022"
     CDS             complement(22228..24126)
                     /locus_tag="ATU_RS24060"
                     /old_locus_tag="AGR_pAT_30"
                     /old_locus_tag="Atu5022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003510072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974286.1"
                     /translation="MWADVETGRDFLNFNVMAKLISQMILDANGEALSIGISGGWGVG
                     KSSMVKLIEADLRTRIAQSQGHEAGSRSLLFVNFNAWLYQGHDDAKAALMEEIANALM
                     IRAKQQQTSVQKGMNLLKRIDVFRGIWMLGELAVTAYTGMPVGALARSGKNLFDRLTD
                     GDVSEDDVEAAKTAVKEQSGAAKGLLKPEERQTPPQMIHAIRQQFEELLEDLNLTLVV
                     FVDDLDRCLPPTVIGTLEAMRLFLFMKGTAFIIAADDKMIKEAVRVHFPGTKVDDDIV
                     ISYFDKLIQVPLRVPPLGTNEVKAYLMLLFVESSRIPPAEKEIIRIKVNEQLARSWQG
                     KAVDAEYVQKLIFNCPPALASELELADRLARQMIISPKVNGNPRLIKRFMNTLSIRRS
                     LAKVQNISVNDAMFAKMMLFERFASATSFNALAELISTAPDGKSDQLRDLETDVRAGN
                     VIDEKRWPTGWSEDAALIQDWLRLPPDIGGVDLRGALHVGRESAPILAAENKLSKAAT
                     ELLSQLSTLKIPATQAIKQAFTTVSPEERSVIMTSLLDKANSESEWGTPSILYALEAM
                     ADADATQAERLVNFLVERPSSALKTPIVPRLGAREWGEKAIVNLAKRTDLPLPFSKAL
                     NQEMKVKK"
     gene            24428..26161
                     /locus_tag="ATU_RS24065"
                     /old_locus_tag="AGR_pAT_32"
                     /old_locus_tag="Atu5023"
     CDS             24428..26161
                     /locus_tag="ATU_RS24065"
                     /old_locus_tag="AGR_pAT_32"
                     /old_locus_tag="Atu5023"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012078885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent endonuclease"
                     /protein_id="WP_010974287.1"
                     /translation="MHLASLKIKNFRRFSETTIKFKSGLNVIVGPNNIGKSAVVDALR
                     SLLAGADDPYPRFTVDDIHVPKLGEASGDIVFEFIFDDLDGNDEADFIHALREKPDNK
                     LEAVLNVAFGDADKSGRLRPRRWCGAFEEVSMSSSMLDNLRSVYLPPLRDAEQGLRPS
                     RNSQLSRLLHLLTDETGKEEVALHLKDLDAKLKELQVLKDAQSAVSGRHETMLGERLA
                     QVLNVGLTGSDFSKLAARLSLLVDTFEIERNGLGYNNLIFMAVVLSELSKNAEASFRS
                     LIVEEPEAHLHPQLQAVLLKYLSSIQNGVGERDVQVFVTSHSPNFASIADLNSIACLY
                     EVDDNVASFHPGSVNFAKGKKEKLKRYLDVTRAELFFARRVIFVEGAAELLMVNLLAT
                     KAGFDLRNHGISLISVEGLNFDSFMPLFGEAGIKIPVSVITDADPQIEDAGGKKTAHY
                     PSSTEAIIVSDNTKSMKALEDKYLKVFHGQKTFEYDFALEDQNRQAMLDALEDIHPVI
                     AKNLRDVVAAEPDDAAKAKALFRGMFEREQNNVQKGRFAQTLAAKIEDEGLPIVVPPY
                     IRFAVEHACQP"
     gene            26149..27891
                     /locus_tag="ATU_RS24070"
                     /old_locus_tag="AGR_pAT_35"
                     /old_locus_tag="Atu5024"
     CDS             26149..27891
                     /locus_tag="ATU_RS24070"
                     /old_locus_tag="AGR_pAT_35"
                     /old_locus_tag="Atu5024"
                     /inference="COORDINATES: protein motif:HMM:NF024642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="WP_035257825.1"
                     /translation="MSAVEELSKAQEEVVDLPAEPFVVSACAGSGKTKTAVHRVAAMQ
                     NRLTDRIGRILLLSFSNVAVETFQREYGMLVTNDKRRIGPIVEIDTVDGFLTKNLLRP
                     HGHRVMGCDRCPFLVDGREPFLKHFTVWDGSKPARTADLRITMDGGKFSFRVGKWAGT
                     AISRTPAVEALEKLGAVGAYTHESARYWAYRLLNEVPFVLRAIARRYSHILVDEAQDI
                     GTIHQALLEKISDAGAELSLIGDVNQGIFEFTGATGDFLGNYHSRAGVTAKELNRNFR
                     SVPSIVKIANQLSGRKDEPDRAAPDELSGAFYIAVDHDKRDEALLRFKKFLDKGSISQ
                     SKGVVVFRSSEVFNTWSGPGDPQGQGVIKSFVASARWRDQAKRFDQAFSQACAGIVGL
                     LDDGHGDLLSLIKGQAVSQELRGVRREIWNFVKNPATGLPASNLDAVKEWHPQLVVRV
                     KALLGRLEKQYGFVSGDNLGNRLKKTALPNGPLVEAPEGDEPQNLQFRLSTVHKVKGE
                     SLDGVMYVASRSNIEEFLAGTKTENGKIGYVALTRARNVFVLAVPSDAIAALKPLLDA
                     TGFQDGDVCALAGA"
     gene            complement(<28072..28239)
                     /locus_tag="ATU_RS24075"
                     /pseudo
     CDS             complement(<28072..28239)
                     /locus_tag="ATU_RS24075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017243910.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
     gene            complement(<28873..29753)
                     /locus_tag="ATU_RS24080"
                     /pseudo
     CDS             complement(<28873..29753)
                     /locus_tag="ATU_RS24080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_086558208.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            29924..30694
                     /locus_tag="ATU_RS24085"
                     /old_locus_tag="Atu5029"
     CDS             29924..30694
                     /locus_tag="ATU_RS24085"
                     /old_locus_tag="Atu5029"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974293.1"
                     /translation="MASALAEYFTLNYIGFTVGVLSALFSIYAYVRTRERFGMTYQAF
                     DETIVGGESPTLFDDRIEIRFDDMVIDRVNKTTFWIWNSGNKTINVSDIALHDPLVIA
                     LPHGSTILQMSTRSKTLANAVRVNLFASDRVFPTFDFLDPNQGFVCEILHTAEKNSLS
                     LQGTIKGGGKILNYKDRDSWLSILSTLPKVFVNFAGMGFTVLVANLITSPIPSNYELL
                     KPLLFVTMFIVLAGSFFAAVDRLLERRKKQVPPYSLND"
     gene            30855..31397
                     /locus_tag="ATU_RS24090"
                     /old_locus_tag="AGR_pAT_38"
                     /old_locus_tag="Atu5030"
     CDS             30855..31397
                     /locus_tag="ATU_RS24090"
                     /old_locus_tag="AGR_pAT_38"
                     /old_locus_tag="Atu5030"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974294.1"
                     /translation="MIPNAPTDNLYKFVTVLGVALMIFCAWSSTEVVKRVDEANVDQI
                     IREIRDGVDQAAAEVDAATLKEHASIPRDQLTAEQNTLINEALERTVERLGVLVKNMK
                     DDLRPTMRLQQSKSELLMYRIGAGLGAVIAAIGIAAWYFLHQRYQDAILRRQFATSSQ
                     AAIVEAERVHIAPVDHLNTR"
     gene            complement(31458..32576)
                     /locus_tag="ATU_RS24095"
                     /old_locus_tag="AGR_pAT_40"
                     /old_locus_tag="Atu5031"
     CDS             complement(31458..32576)
                     /locus_tag="ATU_RS24095"
                     /old_locus_tag="AGR_pAT_40"
                     /old_locus_tag="Atu5031"
                     /inference="COORDINATES: protein motif:HMM:NF016362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_010974295.1"
                     /translation="MQNITFYTRFEEIVERLYEANGNRLVEKAEDYRIHANDIFRSPD
                     FVMNDGREDIGVEVKFYRASTPSSRVMTGAVAQLTDALDKRRLSRGKLVLSIAVPKTL
                     RDQTLVDGRIEIVDIHDLLVLSAPFDAIYRDLIELMRVSRLETASPHSARENDPFNCS
                     PTPPSVSTIPPVEGVEIRNVEDTKRAHQKEYEQTTSRIRNLIERIEESRAGPKGARAY
                     ERLCLEAIKELFEEDFGEFKDQHRISDGFHRLDFIASIKSENPFWNSLRDDFRSRYVV
                     FEVKNYPRQISQSEIYSTEKYLFTNALRSVAILIARKGENKGALHARQGALREMGKLI
                     IMITQDELIKMLERKIANEEVISILAEKIDDFLTTLAR"
     gene            complement(32772..33533)
                     /locus_tag="ATU_RS24100"
                     /old_locus_tag="AGR_pAT_41"
                     /old_locus_tag="Atu5032"
     CDS             complement(32772..33533)
                     /locus_tag="ATU_RS24100"
                     /old_locus_tag="AGR_pAT_41"
                     /old_locus_tag="Atu5032"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974296.1"
                     /translation="MSDNTNSYGHVVGRKATIIGAVILIALILIVLRVVQLDTLQDIC
                     GDDGYSGILLKRLTDCAGLSTLGDFLAGVFAPLAFIGLAATYFLQREQLRLAIEDSRK
                     NEEARLKEAALNYASIQTNHKIALYDKRKLVFDRLMAAGEELMANVTDDTLVNLKLAF
                     YDAQFVYPDDVQEWILSLLETSFRLRMQLGFIAQNEPKRNRQSWSNQDENALLEAYDE
                     ETKCRVTLYENLRETPLYERFKSYLKLPDSIKVYG"
     gene            complement(33565..34740)
                     /locus_tag="ATU_RS24105"
                     /old_locus_tag="AGR_pAT_42"
                     /old_locus_tag="Atu5033"
     CDS             complement(33565..34740)
                     /locus_tag="ATU_RS24105"
                     /old_locus_tag="AGR_pAT_42"
                     /old_locus_tag="Atu5033"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_071241511.1"
                     /translation="MAFREKTTFVIGAGASAEFGLPVGSGLAAEIKKTAMFESDDRDN
                     PSHGLLRELLYTKCKVGAEESAAKKALHDIHEGIQTAVSIDAFIHRHGADANISYWGK
                     VLIALEVLKAERNSSLSTLTWPEFAGDPNLVLENAGKKLINPDYTWIGHFFRILSDGV
                     ADYNDLGKDITIICFNYDRCIEVYLAETIADAYRISIETALRVVKNNIKIIHPYGYLG
                     ELALVSGSPGKDRLGFGSALHQPKEISLIADHIHTYTEQAHDATKVWSIHEAIAECKN
                     LIFLGFGFNNQNLDLLRVKTRFNGSAHPKNIYATCFGLYPQIKETLTRRILDLFIDEP
                     EHRGWLSRVNLEFGVGCAELFRIHDMNFSSFIQRYIRLEQEMRGMVSKVERYSPYIK"
     gene            35532..36428
                     /locus_tag="ATU_RS24110"
                     /old_locus_tag="AGR_pAT_45"
                     /old_locus_tag="Atu5035"
     CDS             35532..36428
                     /locus_tag="ATU_RS24110"
                     /old_locus_tag="AGR_pAT_45"
                     /old_locus_tag="Atu5035"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974299.1"
                     /translation="MGSMQDAGHDGLLVHFACPNSDCLNVLEHHVTDAIFDFTVFDLS
                     LDRHSDGIGHAETKIVCEDCQQEIEVVVLATAVGKEVAVKGFPHILVEFADNTFEQKY
                     GDFLADYKPEDPFGVYNATVKELDDLHYGSTILPSAQRAFNKMISLQHVISLEAYLSD
                     RLIKIVTNDSDKLLALVGATPALRNNQPKLIDIAKDPNYVATASKNYLQRFSFHDLAS
                     VAVFYKAVLKMNLFESENHEKEMLDIITMRHDLVHRSGRDNDGKDVVIDDEHIVILKD
                     LMKAVVHRVEAAYTAYILDNKA"
     gene            36551..36865
                     /locus_tag="ATU_RS24115"
                     /old_locus_tag="AGR_pAT_46"
                     /old_locus_tag="Atu5036"
     CDS             36551..36865
                     /locus_tag="ATU_RS24115"
                     /old_locus_tag="AGR_pAT_46"
                     /old_locus_tag="Atu5036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013760954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035257820.1"
                     /translation="MTIFPRHIILLPAVALVIAIFPLPYGYYTLLRLVITAFAAFFAY
                     IEYGQHKAFTGWVFGFICVALLFNPLIPVHLSRSSWFILDLIAAGAFAAYWKFFDKIS
                     RA"
     gene            36918..37697
                     /locus_tag="ATU_RS24120"
                     /old_locus_tag="Atu5037"
     CDS             36918..37697
                     /locus_tag="ATU_RS24120"
                     /old_locus_tag="Atu5037"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974301.1"
                     /translation="MASGKCALTLKEGSFVDSHIIPRALTQTTNKEAGFVQVGGDAKG
                     KKRWSSWYDNKLCTAEGEKILSDLDDWAIKFLRSNRMVWSGWGPVQQLDDRIIAGPYG
                     VKSVEVAEPDRLRLFMISLLWRAAATRLQEFTDINVPDDDLETMRVALVNNTLPPVGF
                     YPASLSQLRTIGIKHNQSPTSGIKTLPDLEKEEMKNVPIFRFYFDGLIIHFHRTPSDP
                     DAQALGPLIVGNEKSLTISTIDYETSLQREILFNFIASTGI"
     gene            38022..>38725
                     /locus_tag="ATU_RS24125"
                     /old_locus_tag="AGR_pAT_47"
                     /old_locus_tag="Atu5038"
                     /pseudo
     CDS             38022..>38725
                     /locus_tag="ATU_RS24125"
                     /old_locus_tag="AGR_pAT_47"
                     /old_locus_tag="Atu5038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011982997.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4158 domain-containing protein"
     gene            39240..40421
                     /locus_tag="ATU_RS24130"
                     /old_locus_tag="AGR_pAT_51"
                     /old_locus_tag="Atu5039"
     CDS             39240..40421
                     /locus_tag="ATU_RS24130"
                     /old_locus_tag="AGR_pAT_51"
                     /old_locus_tag="Atu5039"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016446673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fic family protein"
                     /protein_id="WP_010974302.1"
                     /translation="MSDSESKNRLGRFVETVAASETVRAFVPPPLPPAPAIDVLSLLE
                     RLSLAERALGRLDGITMLLPRQELFLYMYVRKEAVLSSQIEGTQSTLSDLLRFETEAQ
                     AGQPVDDIREVSNYVDAMMYGLERLETLPMSLRLIREMHARLLHSGRGGTKDPGEFRR
                     SQNWIGGTRPGNALFVPPPVTEMAGCLDAFERFMHDDQSRLPALIKAGLLHVQFETIH
                     PFLDGNGRIGRLLVTLYLCMNGVLRKPLLYLSLYLKSHRREYYRLLQEVREHGNWEAW
                     LEFFLTGVADTANQAFEAATQIVDLFKEDRERITMESDRAGSALRIHELFQQNPFHTA
                     NQIVQVTGLSAPTVNAALADLERLGIVDEVTGRKRGRVFSYRRYLAILGEGTDPLPLN
                     S"
     gene            complement(40495..41397)
                     /locus_tag="ATU_RS24135"
                     /old_locus_tag="AGR_pAT_52"
                     /old_locus_tag="Atu5040"
     CDS             complement(40495..41397)
                     /locus_tag="ATU_RS24135"
                     /old_locus_tag="AGR_pAT_52"
                     /old_locus_tag="Atu5040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004615660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParB N-terminal domain-containing protein"
                     /protein_id="WP_010974303.1"
                     /translation="MSGPVRISFEQAIVELPMTAILPRKIITEAQKKTVKYKRIASSI
                     SEVGIVEPIVISRLEENEDKFMLLDGHIRFTIALDRGATTIRCLIANDDEGFTYNKRV
                     NRLATVQEHYMLIKALNSGVPEEKLAKTFDLDISMIKRRRTLLDGICPEVIELLKDKS
                     VNPVTFDVLRKMRPMRQIESAELMLTVHNWTSSYAKALLAATKQEDLAKPDRPKKIGG
                     LTREQMARMEREMASLHQDFKQIEESYGDDILHLVVASGYLSKLVGNSEIERFLTQRY
                     PEFLDEFRAIIVASSLDQTGLAAN"
     gene            complement(41394..42281)
                     /locus_tag="ATU_RS24140"
                     /old_locus_tag="AGR_pAT_53"
                     /old_locus_tag="Atu5041"
     CDS             complement(41394..42281)
                     /locus_tag="ATU_RS24140"
                     /old_locus_tag="AGR_pAT_53"
                     /old_locus_tag="Atu5041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009820574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParB N-terminal domain-containing protein"
                     /protein_id="WP_010974304.1"
                     /translation="MTDGLPEIKSIPIDAINVLNPRVRNKKIFNELVTSIAHLGLKRP
                     ITVSVRDDNSEYDLVCGQGRLEAFVSLGQTHIPAILVHASVEDCFVMSLVENLARRQH
                     SPLELVREIAVLRDRGYSLTEISTKTDFSEEYVYAVCYLLDHGEERLLAGVEKGIIPA
                     SIAMQISRAKDAEVQKALAEAYEQKSIPGNQVLAIRKIVEQRNLSGKTVSGAAYRGDS
                     PRKQVTAAALVRAYQKETERQKMLIKKATLAQSRLLFLVNALRRLIDDEHFTTLLRAE
                     AIKDMPKPLAERLGSGRLQ"
     gene            complement(42278..43771)
                     /locus_tag="ATU_RS24145"
                     /old_locus_tag="AGR_pAT_54"
                     /old_locus_tag="Atu5042"
     CDS             complement(42278..43771)
                     /locus_tag="ATU_RS24145"
                     /old_locus_tag="AGR_pAT_54"
                     /old_locus_tag="Atu5042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014241461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
                     /protein_id="WP_162180340.1"
                     /translation="MSTEHQKYSTENQAIEIAKYARENDYVIVKTYMDSGKSGLKLDG
                     RDALQSLIEDVSNGQTDFSIILVYDVSRWGRFQNADESAYLEYLCTRAGIAVEYCAEQ
                     FANDGSLTTTIIKNMKRAMAGEYSRDLSRKVFEGQRHLVELGYRQGGTAGFGLRRQLI
                     DERGEPKALLAHGERKSIQTDRVILVPGPATEVAVVDRIYRLFVEKGQNECSIAGILN
                     SENLFTDMGRPWTRGTVHQVLTNEKYVGNNVFNRISFKLKMRRVRNPPDAIIRASGVF
                     QPIVSKDLFQRAAAIIAERTVRLRDDEMLALLAQLLLKSGKLSAIIIDEQEGMPSSSI
                     YGSRFGSLLRAYKLIGYTPDRDYRYVEINRLLRSLFPDVLSGIIAAVEHAGGRIIRDA
                     ATDLLKVNGEFTVSVVVCRCIETPAGNLRWKIRLDNGLHPDLSIAVRMAPGNEKILDY
                     YLLPAIDFASANLAVAEDNAIGIDAYRCADLSRFIRLTERVPIRRAA"
     gene            43896..44303
                     /locus_tag="ATU_RS24150"
                     /old_locus_tag="AGR_pAT_56"
                     /old_locus_tag="Atu5043"
     CDS             43896..44303
                     /locus_tag="ATU_RS24150"
                     /old_locus_tag="AGR_pAT_56"
                     /old_locus_tag="Atu5043"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974306.1"
                     /translation="MSPTNKGRNIQSKKGQGFPSSTGGRLGAAAFASAIATALRNDFG
                     EGRSAVKTIAGLTLANERAVKNWFNGINGPSGEFLILLCRHSDTVLETFLMLAGHGEL
                     VKVKKFGDVKTKLNEMLLLLGDLEHLNDKPTIG"
     gene            complement(44352..45479)
                     /locus_tag="ATU_RS24155"
                     /old_locus_tag="AGR_pAT_58"
                     /old_locus_tag="Atu5044"
     CDS             complement(44352..45479)
                     /locus_tag="ATU_RS24155"
                     /old_locus_tag="AGR_pAT_58"
                     /old_locus_tag="Atu5044"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013913713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyl transferase AbiEii/AbiGii toxin
                     family protein"
                     /protein_id="WP_010974307.1"
                     /translation="MRQGFIDILRSSADERRALFSAAASDLETRAENIEKDLYVCWVL
                     DFFFNRRKDDAIGLYFKGGTSLSKAYGLIKRFSEDIDIGIYKADLKVPLEADIAALPS
                     VNQQQKALAEQVDEAARHYMSGPLKRLLDEEIAAVEGETGQSGHFSLDFGYDLYRKKE
                     ALDVLVLGYESVFDTSGGYVEAAVRIEGGARPDPVPAEKREIIPYVASEMPKGSDLTV
                     QNVTTVKPERTFWEKVLILHAMTEMTEKRSMSGNPSLKVPDLNRYSRHYYDVHQIWTD
                     PNYGKTTASMLDLAEACRWHKELMFRAPDHRYDRAVPGSFRLVPTPEMRKKLASDYER
                     MSAMIFGTPPEFGSVMASIEELESFLNSIADKPRFKGKCES"
     gene            complement(45460..46200)
                     /locus_tag="ATU_RS24160"
                     /old_locus_tag="AGR_pAT_59"
                     /old_locus_tag="Atu5045"
     CDS             complement(45460..46200)
                     /locus_tag="ATU_RS24160"
                     /old_locus_tag="AGR_pAT_59"
                     /old_locus_tag="Atu5045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018494349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974308.1"
                     /translation="MPDPTSDTLERIHQRIADAAPSGVWSRSDFLDIATPNAVEKALQ
                     RLTNRGDIRRPHRGLYDKPAVSQLTGKMVFPPRASFIDAIARRDKLRVCVDGMTAAND
                     LGLTTAVPARSTIYADTYPRTIEIEANAGDAEATKPVIYILDFKRISAKTAFWAGRPA
                     MRVIQALHWFRDERSNLETVVDGIVRYLARSPHRQPIVEDLRENIHAIPAWMYKAVET
                     ITAGPPPQADGGTSQGNEGKDEHAPGFH"
     gene            complement(46372..46638)
                     /locus_tag="ATU_RS24165"
     CDS             complement(46372..46638)
                     /locus_tag="ATU_RS24165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003526119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035257815.1"
                     /translation="MNNAADHPAAVEAIGNLTRTQEEALRAIAFFRRQRKVGRGWLVG
                     DKRLSEKLVERLEKMELVEESSIRGEPVLQLTTVGQAIKAQLLQ"
     gene            complement(46641..46889)
                     /locus_tag="ATU_RS24170"
     CDS             complement(46641..46889)
                     /locus_tag="ATU_RS24170"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_071241513.1"
                     /translation="MSARSENQERLFQQLDDAVAEIIDRFANEGHGTARVVKTLQDVL
                     AKRQLAYDRDPDPADEPIEEPANEWPAADNPSNRNGGR"
     gene            complement(46905..47141)
                     /locus_tag="ATU_RS24175"
                     /old_locus_tag="AGR_pAT_62"
                     /old_locus_tag="Atu5047"
     CDS             complement(46905..47141)
                     /locus_tag="ATU_RS24175"
                     /old_locus_tag="AGR_pAT_62"
                     /old_locus_tag="Atu5047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017957141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974310.1"
                     /translation="MQDFDAVEFADRLAAMTDEEVFGLMEELEEASESIRPEDRDDSD
                     VFAQIGLVETAIEDRFPGQLMAPYKDWQQRRVGG"
     gene            complement(47226..48002)
                     /gene="xth"
                     /locus_tag="ATU_RS24180"
                     /old_locus_tag="AGR_pAT_63"
                     /old_locus_tag="Atu5048"
     CDS             complement(47226..48002)
                     /gene="xth"
                     /locus_tag="ATU_RS24180"
                     /old_locus_tag="AGR_pAT_63"
                     /old_locus_tag="Atu5048"
                     /EC_number="3.1.11.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003575457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease III"
                     /protein_id="WP_010974311.1"
                     /translation="MKLATYNVNGINGRLEVLLRWLAEAKPDVVCLQELKAPNDKFPR
                     REIERAGYGAIWRGQKSWNGVAILARDQEPRETRRGLPGDPDDSHSRYIEAAIDGIVI
                     GCLYLPNGNPAPGPKFDYKLRWFERLYSYAAELFELDVPVALVGDFNVMPTDLDVYKP
                     ERWRDDALFRPEVRAAYAELIAMGWTDAVRLLHPEERIYTFWKYFRNAFARDAGLRID
                     HFLLSPSLRERLQTCGVDKFARAWEHTSDHAPVWIELDDE"
     gene            complement(48014..48190)
                     /locus_tag="ATU_RS26620"
                     /old_locus_tag="AGR_pAT_64"
                     /old_locus_tag="Atu8099"
     CDS             complement(48014..48190)
                     /locus_tag="ATU_RS26620"
                     /old_locus_tag="AGR_pAT_64"
                     /old_locus_tag="Atu8099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003528032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974312.1"
                     /translation="MSKRELIDTGTDKRYVRRDKEGKFKESVDVSRSLSADARHDAKH
                     DAKPGQGDKGDRKH"
     gene            48390..49286
                     /locus_tag="ATU_RS24185"
                     /old_locus_tag="AGR_pAT_65"
                     /old_locus_tag="Atu5049"
     CDS             48390..49286
                     /locus_tag="ATU_RS24185"
                     /old_locus_tag="AGR_pAT_65"
                     /old_locus_tag="Atu5049"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003526114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ku protein"
                     /protein_id="WP_010974313.1"
                     /translation="MVAPRANWKGFIKYGEVACPVALYTAASSSERIAFNTLNRKTGN
                     RVKREFVDSETGDPVERDEQVKGYEVENGQYIILEPEEVAAAVPDSDKTLKIDAFIPC
                     HEIDDVYFDKPYYLAPDKMGTDAFLLLRDGMKKAKVAAIARTVLFRRVRTVLIRPHGK
                     GLIATTLNFDYEVRSSQEAFEELPDLKIEGEMLELAEHIIGTKKGSFDASAFDDRYEA
                     AVAELVKAKIEGRALPKKKAPPASKPSDLLQALRESAGVVAKAASKRTAANVNKGTSR
                     QKVAKAAAAKTKSAASQTRRAG"
     gene            49299..50111
                     /locus_tag="ATU_RS24190"
                     /old_locus_tag="AGR_pAT_66"
                     /old_locus_tag="Atu5050"
     CDS             49299..50111
                     /locus_tag="ATU_RS24190"
                     /old_locus_tag="AGR_pAT_66"
                     /old_locus_tag="Atu5050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012490575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ku protein"
                     /protein_id="WP_010974314.1"
                     /translation="MAVRPYWKGYLKLSLVTCPVQMMPATSESEKVRFHTLNRETQNR
                     VVSHYVDSVTGKEVKDEDEVKGYQRGENEYIILEDEELENVALDSTKTIDISTFTPRD
                     SVEWIWLDTPYYLSPNDPVGQEAFSVIRDAMEAQNMVGISRLVISRRERAVMLEPRGK
                     GIVLWTLRYGDEVRDEDTYFAGIDDEETADREMMPLVQQLIKKQTKHWDAKMVIDPVQ
                     ERLLDIIAAKKKALKKSARAKPSAPAKSTPSNVINIMDALKKSVAAENRSSK"
     gene            50108..51145
                     /locus_tag="ATU_RS24195"
                     /old_locus_tag="AGR_pAT_68"
                     /old_locus_tag="Atu5051"
     CDS             50108..51145
                     /locus_tag="ATU_RS24195"
                     /old_locus_tag="AGR_pAT_68"
                     /old_locus_tag="Atu5051"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006699351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="non-homologous end-joining DNA ligase"
                     /protein_id="WP_010974315.1"
                     /translation="MRRRAKPLLQDDSLSTKSQPLRKRDPAQPNLPFDPMPDRVEPCL
                     AMLKPVPPTGPDWAYEIKWDGYRLAVHIEPKGVRIITRGGHDWTHRFPTIAAAAKRLG
                     IGTAILDGEAVVLNSEGRSDFGALQRSLGGRGGKRASSESILFAFDLLYFDGHDLTKT
                     ELSVRRHLLTDLLDGAVGAIQLSEEVAGEGAELLENARSLGLEGIIAKHRDSPYRPGR
                     TGDWLKIKCIQSESFMIVGYEQSAAARGGVGSLLLAARRDHDWVYVGAVGTGFKEKDA
                     AYLKKTLDTLKTRTPVVPLKGKNYVFAQPTLIAEIEFRGWTDDGNLRHASYKGLREIQ
                     DNAAVFELEWS"
     gene            51311..51787
                     /locus_tag="ATU_RS24200"
                     /old_locus_tag="AGR_pAT_69"
                     /old_locus_tag="Atu5052"
     CDS             51311..51787
                     /locus_tag="ATU_RS24200"
                     /old_locus_tag="AGR_pAT_69"
                     /old_locus_tag="Atu5052"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007758851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp20 family protein"
                     /protein_id="WP_010974316.1"
                     /translation="MATSYDYAPLFRSSVGFDRVFNLLENAQRARSISDWPPYDIVKT
                     GDDRYRIAIAVAGFEQGDLDITFQSNLLTVTGKEQETASEGYLHRGIAGRPFEHRFEL
                     ADHVRVNGADLKNGLLSIDLVREIPEALKPQKIDIQTNPALAQPVAPAQIEAQKAA"
     gene            51860..52159
                     /locus_tag="ATU_RS24205"
                     /old_locus_tag="AGR_pAT_72"
                     /old_locus_tag="Atu5053"
     CDS             51860..52159
                     /locus_tag="ATU_RS24205"
                     /old_locus_tag="AGR_pAT_72"
                     /old_locus_tag="Atu5053"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007758850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF982 domain-containing protein"
                     /protein_id="WP_010974317.1"
                     /translation="MKPDLFRRPVTILVGLGFPAEVRSVMDAYRHLAEWPASLRDTAH
                     SIALKACRAALRGEIEAETARGLFAAFAEKHDLLAPDTDVIAASSRRHDKDPHVR"
     gene            52169..52444
                     /locus_tag="ATU_RS24210"
                     /old_locus_tag="AGR_pAT_73"
                     /old_locus_tag="Atu5054"
     CDS             52169..52444
                     /locus_tag="ATU_RS24210"
                     /old_locus_tag="AGR_pAT_73"
                     /old_locus_tag="Atu5054"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006699354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974318.1"
                     /translation="MDQILQQAASNAAAVGPTILLQGMQIERPLDVVKATGLTVDDKR
                     TILAAWASDYYALDSTPAFRHIPGTPKPVSIDELQAALRELDRRYGF"
     gene            complement(52456..55110)
                     /gene="ligD"
                     /locus_tag="ATU_RS24215"
                     /old_locus_tag="AGR_pAT_74"
                     /old_locus_tag="Atu5055"
     CDS             complement(52456..55110)
                     /gene="ligD"
                     /locus_tag="ATU_RS24215"
                     /old_locus_tag="AGR_pAT_74"
                     /old_locus_tag="Atu5055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017956488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase D"
                     /protein_id="WP_010974319.1"
                     /translation="MASDKLSTYKQKRDFQKTQEPSGAAKLKASNRRRFVIQKHDATR
                     LHYDLRLELDGVFKSWAVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGT
                     VMLWDRGYWEPEGNKTPEQALAKGDFKFTLEGERLHGSFVLVRMRNDRDGGKRTNWLL
                     IKHRDDFSVEEKGAAVLDENDTSVASGRTMEAIAAGKGRKPKPFMVQSGDVQADAVWD
                     SNHGLAAEERASDTKAKRKPALKKPAKSTMPEFIPPQLCETLDRPPSAKGWIHEIKFD
                     GYRIQTRIENGEVTLKTRKGLDWTAKYPAIATSAANLPDAIIDGEICALDENGAPDFA
                     ALQAALSEGKTDELVYFAFDLLFEENEDLRQLPLTERKERLQTLLDDAGEDPRLRFVE
                     HFETGGDAVLKSACKLSLEGIVSKQADAPYQSGRTETWAKSKCRAGHEVVIGAYAKTN
                     GKFRSLLVGVFKGDHFVYVGRVGTGYGAKTVDTILPRLRELETSKSPFTGIGAPKKDP
                     NVVWVKPELVAEIQFAGWTADGLVRQAAFKGLREDKPAHEVEAEKPASPAKTDTPTPA
                     KSKPSRPARGKNAKAEVMGVMISSPDKALWPDANDGEPVTKEDLARYHEAVGPWLIDH
                     IKGRPCSIIRTPDGIGGEVFFQRHAMPGTSNLIELVKVFGDKKPYLQIDRVEGLAAIA
                     QIGGVELHPWNCEPGQPEVPGRLVFDLDPGPDVPFSTVVEAAREMRDRLEELGLVSFC
                     KTTGGKGLHVVTPLAVPKGKKLSWPEAKGFAHDVCMQMARETPELYLIKMAKNQRNGR
                     IFLDYLRNDRMATAVAPLSPRARAGAPVSMPLSWKQVKTDLDPKRFTIRTVPALLSKT
                     TAWQDYCDGQRSLEQAIKRLAKSMKQAA"
     gene            55384..56250
                     /locus_tag="ATU_RS24220"
                     /old_locus_tag="AGR_pAT_75"
                     /old_locus_tag="Atu5056"
     CDS             55384..56250
                     /locus_tag="ATU_RS24220"
                     /old_locus_tag="AGR_pAT_75"
                     /old_locus_tag="Atu5056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003587118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035257813.1"
                     /translation="MSDEQSTENVEAAAGETVSFPFDRMTVEQFRTRFPRARWSDTRK
                     AWFVPGKTAARRVVRWLAELEAEADAFADAKGRDAFEFDPIESCYLALGKAGFLIRTP
                     YSRTVVDEPREIPYSRWDGDQKIWHVPYRSYQELRSHWPAIEEAARRNEPEERRRRAE
                     ARKGSEEEAKSKRRSAERKRRRYPLASDDLPPLDRVVGIQYGLVIFTEITGELVDPEA
                     MAEFYPGVTEDHVWGLWRKPRLDELVRTRPAKVAHAEGAEWWQPTLEELRPVRRAARR
                     GEDRKLRNNGAP"
     gene            56286..56594
                     /locus_tag="ATU_RS24225"
                     /old_locus_tag="AGR_pAT_76"
                     /old_locus_tag="Atu5057"
     CDS             56286..56594
                     /locus_tag="ATU_RS24225"
                     /old_locus_tag="AGR_pAT_76"
                     /old_locus_tag="Atu5057"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974321.1"
                     /translation="MADDSTVTIRASFSTREAADLAVEHLVQKQGVSRPDIFIQSATD
                     ENTSGSRASGGDASHADGTRHDGALDGDVEVSVDIAADQIAAVQRIFGDVGAMRVSKG
                     "
     gene            56951..58210
                     /locus_tag="ATU_RS24230"
                     /old_locus_tag="AGR_pAT_77"
                     /old_locus_tag="Atu5058"
     CDS             56951..58210
                     /locus_tag="ATU_RS24230"
                     /old_locus_tag="AGR_pAT_77"
                     /old_locus_tag="Atu5058"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018096995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_010974322.1"
                     /translation="MLQKLQLALAASVLSLAAGVSSADAATTVRFWHSFNKSNGEALD
                     KIIAGFEAANPDTDIEAEYIGSYNDIIAKLQAAIPARRAPDAVILEVTRYGLFANNNL
                     LTDLTPYFDADPLKDDLYDYAREVGVINGKNYVVPFNSSTPVLYFNKDIFARAGLPAD
                     TPLKTFEDISTAAKTITEKLGSQGISGIAAPGQFARWGLVMANDSEMIDPKTGEIVLD
                     KPNTIEAYQWMASLVKDSKVASPDGVTEEDNGRDAFLARKVGIMMNSTGNYVGSKKAL
                     GGDLVVRPMPCNKTCSVPIGGAGIGIMSTSEKDVQDAAYKFISYAASPEANATWFAGT
                     GYLPINKKSADLPVSKEALATQPGIDVAIESLPVAHGRARTTVVTWMRTTEYKMWEAM
                     ALGQRDVDATMKDFAAQTRAEEKRVSN"
     gene            58269..59138
                     /locus_tag="ATU_RS24235"
                     /old_locus_tag="AGR_pAT_78"
                     /old_locus_tag="Atu5059"
     CDS             58269..59138
                     /locus_tag="ATU_RS24235"
                     /old_locus_tag="AGR_pAT_78"
                     /old_locus_tag="Atu5059"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018096994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_010974323.1"
                     /translation="MLRKLTPYLFVAPLMIFIALFTYIPILASLNLSFREWNFLSPNM
                     PFVGFRNYEQLLASRDLWNSLWVTTLFAVLSVPLRLGLALVIAAYLVRESVHVRLLRG
                     ALFLPSVTSTVSIAVVFSWVFSTDYGMANALLGTFGLGKVQWLQNPHLALWVLIFVNT
                     WKQIGYDIVIYIAGLQAIPRELYDAAAVDGGKRLHVFRRITMPLVMPTTYFLLVISVI
                     EAFQVFTIVNVMTKGGPAGATDMLVSLLYEIGFVLFDIGRGSALAVLLFILLVGLAIL
                     KSRIIGRKVHYEA"
     gene            59128..59937
                     /locus_tag="ATU_RS24240"
                     /old_locus_tag="AGR_pAT_79"
                     /old_locus_tag="Atu5060"
     CDS             59128..59937
                     /locus_tag="ATU_RS24240"
                     /old_locus_tag="AGR_pAT_79"
                     /old_locus_tag="Atu5060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018096993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="WP_010974324.1"
                     /translation="MKPENPLLAGLALVAGLLFLSPVLYSIWMSFQTVDAYYAGELGF
                     TLDNYARAVGQYNFARYLLNSLIVSAMVTLLGITFATMAAYAFARYSFKGGDFLFAAT
                     VATLMIPSHISLIPNYLTLAKVGLLDSYAGLILPAISNGFAAFFLRQYIRGIPKALDE
                     AAYMDGATSLQVLWRIIVPLSRPAIASMALYIFMTEWNNYIWPLVAVGKQDMYTLQIG
                     LARLYRINPGEGLIDWPLVMAASTITILPVLLGFLLVERHLVRGITMGAVK"
     gene            59954..60703
                     /locus_tag="ATU_RS24245"
                     /old_locus_tag="AGR_pAT_81"
                     /old_locus_tag="Atu5061"
     CDS             59954..60703
                     /locus_tag="ATU_RS24245"
                     /old_locus_tag="AGR_pAT_81"
                     /old_locus_tag="Atu5061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007823246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="WP_010974325.1"
                     /translation="MTRIASHRGGTLEFGDSTPHGFTATAAMALEEVEFDLHPTADGA
                     IVVHHDPTLDATTDMTGAIVDMTLAKVKTATIRYGAGSHPMTLEELCALYVDSHVNFR
                     CEIKPGVDGLPYEGFVALVIAGLERHSMLERTTFSSFLLASMDELWKATTRPRLWLVS
                     PSVLQQLGPGAVIETAIAHSIHEIGVHIDTADAGLMAQVQAAGLDFGCWAAHTPSQIT
                     KALDLGVKVFTTDRPTLAIALRTEHRMEASV"
     gene            60700..61743
                     /locus_tag="ATU_RS24250"
                     /old_locus_tag="AGR_pAT_82"
                     /old_locus_tag="Atu5062"
     CDS             60700..61743
                     /locus_tag="ATU_RS24250"
                     /old_locus_tag="AGR_pAT_82"
                     /old_locus_tag="Atu5062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018096991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010974326.1"
                     /translation="MSGISLRDIRKTYVNGPQVLHGVSFDIQQGEFVVIVGPSGCGKS
                     TLLRLIAGLDRCEDGTIEIGGRLANDLAPQHRDIAMIFQNYALYPHMTVRENIAFGLE
                     LRGMKKSERNERAQCVAKTLQLEAYLDRKPAALSGGQRQRVAMGRAMARNASIFLMDE
                     PLSNLDNALRITMRTEIKELHRQLGATMVYVTHDQTEALSLADRIAVMKDGHLLQFDR
                     PDVIYDRPANRFVASFLGSPPMNFVPADLLPGWIGLQGLTAGLRPEILSVHAEKPHGT
                     ALMARLLLCEMTGADVLLHCETPAGRLTVSAPRQDMPKDKGQFWIAFNLDRALFFDSR
                     SGERVDLSPANQA"
     gene            61763..62641
                     /locus_tag="ATU_RS24255"
                     /old_locus_tag="AGR_pAT_84"
                     /old_locus_tag="Atu5063"
     CDS             61763..62641
                     /locus_tag="ATU_RS24255"
                     /old_locus_tag="AGR_pAT_84"
                     /old_locus_tag="Atu5063"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018096990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MurR/RpiR family transcriptional regulator"
                     /protein_id="WP_010974327.1"
                     /translation="MDKQDAPLALSDLISRHSTRLTDADTRLLDVLIKDPIRAAMENG
                     KDVSSRAGVHPASAVRLARRLGFKGYPEFRVFLQSNLREGGGDFENPAARMAARLMRA
                     EDNGLLASVLDSEIAALQQARNSVSDADIRAFSTSLRDSRRIFIFGRGHFAALSSLIA
                     LRLSRSGYEAIDLASQMHQLVEVLATLTAEDVVLFLAFRRAPPLLQEVREIAGRRGAK
                     TLAVTDVGGTRIDPAPHHQILVSRGDPGESQSLVVPMTIANAIILDLASIDNGRSLQS
                     LSEFKSFRSSSRLTVC"
     gene            complement(62887..63339)
                     /locus_tag="ATU_RS24260"
                     /old_locus_tag="AGR_pAT_85"
                     /old_locus_tag="Atu5064"
     CDS             complement(62887..63339)
                     /locus_tag="ATU_RS24260"
                     /old_locus_tag="AGR_pAT_85"
                     /old_locus_tag="Atu5064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011473609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_010974328.1"
                     /translation="MTTVPSNTETSLTDVSGMLCFSLYSAGHAFTQLYRPLLHKVGLT
                     YPQYLVMVTLWHRDGQTVRELGKTLFLDSSTLTPLLKRLEAAGLITRTRNRSDEREVL
                     IHLTEKGGALRAHAADIMRCIEEAVGVDAEALRAIKQSLDTIRDKIKT"
     gene            63472..64293
                     /locus_tag="ATU_RS24265"
                     /old_locus_tag="AGR_pAT_86"
                     /old_locus_tag="Atu5065"
     CDS             63472..64293
                     /locus_tag="ATU_RS24265"
                     /old_locus_tag="AGR_pAT_86"
                     /old_locus_tag="Atu5065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014884108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_010974329.1"
                     /translation="MSRFTTTDGTRLFYKDWGAGQPILFAHGWPLSSDAWDQQMLFFS
                     QNGFRVIAHDRRSHGRSDQTFDGNNMDQYADDLAELINALDLSDLILVGHSTGGGEVS
                     HYVGRHGTARVAKVVLVGAVPPVMLKTVDNPNGTPMEVFDSIRENTAKNRSQFFFDLT
                     VPFYGFNREGVATNDGMRENFRRIGLQGGVKGQYDCIREFSEVDYTRDLKSIDRPTLI
                     IHGDDDQIVPIDASAHRAADLVADATLKIYSGGSHGLAETEADRFNADVLAFIHG"
     gene            64366..65133
                     /locus_tag="ATU_RS24270"
                     /old_locus_tag="AGR_pAT_89"
                     /old_locus_tag="Atu5066"
     CDS             64366..65133
                     /locus_tag="ATU_RS24270"
                     /old_locus_tag="AGR_pAT_89"
                     /old_locus_tag="Atu5066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020050724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_010974330.1"
                     /translation="MSTFVASLAVAGALLSGNAVAQPAKPTVVLVHGAFADSSSWNGV
                     TRILQKDGYRVVAAANPLRSVSSDAAYISDIVASIAEPVVLVGHSYGGQVITSAANGR
                     DNVKTLVYVAAFAPDEGEAAADLAGKFPGGTLGQALAAPVKLADGSTDLSIDQEKFHD
                     QFAHDVGVDNAALMAAGQRPITEAALTEKSGKPAWKALPSYFVYGDGDKNIPAEALAF
                     MAERAGSKHTVVAKGASHVVMVSQPEVVAALIEEAAN"
     gene            complement(65432..66325)
                     /locus_tag="ATU_RS24275"
                     /old_locus_tag="AGR_pAT_90"
                     /old_locus_tag="Atu5067"
     CDS             complement(65432..66325)
                     /locus_tag="ATU_RS24275"
                     /old_locus_tag="AGR_pAT_90"
                     /old_locus_tag="Atu5067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013761902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase family protein"
                     /protein_id="WP_010974331.1"
                     /translation="MTKKAFVAIVTCFNDDETINYEATRAQVRRQVTAGNNIMCAGTN
                     GDFTALTHSEKIRILEEVVDEVGGKVDVIVNAGMPATFETLQLAKEFDRIGVKGIAVI
                     TPFFIACTQDGLIRHFSTVADEVNTPVYLYDIPARTQNHIEPETARKLATHGNIAGIK
                     DSGGAQETLEAYLQVSKEVDGFEVYSGPDHLVLWALQNGAAGCISGLGNAMPDVLAGI
                     VNGFNSGDITYAERQQSVYTAFRTDLYAHGFPPAMVKRALYLQDPSVGASRQPALLPD
                     AEQDQKIEEILRKYGLLVTKA"
     gene            complement(66348..67967)
                     /locus_tag="ATU_RS24280"
                     /old_locus_tag="AGR_pAT_93"
                     /old_locus_tag="Atu5068"
     CDS             complement(66348..67967)
                     /locus_tag="ATU_RS24280"
                     /old_locus_tag="AGR_pAT_93"
                     /old_locus_tag="Atu5068"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017956548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010974332.1"
                     /translation="MADHLLEVRNLSVDFYTATGTVKAVRNISYHVDRGETLAILGES
                     GSGKSVSSSAIMNLIDMPPGKISSGEILLNGKDLLKMSADDRRAVNGRLIAMIFQDPL
                     SHLNPVYTVGWQMREALRTHGIDNRQAQVEALRLFKRVALPEPEKAVDKYPHEFSGGQ
                     RQRVMIAMALALKPNLLIADEPTTALDVTVQAEVLALLKELQRETGMGVLIITHDLGV
                     VSEVADRVVVMEKGVLVESGTVREVYRNPQHPYTKKLIAAAPGKGQLHEPSTDGEPIL
                     KVRNARKSYGGFEALKGISFDLKAGETVAVVGESGSGKSTLARILLRLDDPDSGTAHW
                     KGQDLFTLSPSELFKLRRDLQMVFQDPTQSLNPRMTVYQLISEAWVIHPEILPKAKWR
                     ARAAELLERVGLSPEHMGRYPHQFSGGQRQRIAIARALALEPQLIVCDEAVSALDVSV
                     QAQVVRLLDKLRREMGIAFIFIAHDLPLVRDFADYVMVMQKGEVVEFGTVAQVFDNPQ
                     QRYTQALISATLDPDPDVQAANRNARLASIS"
     gene            complement(67960..68907)
                     /locus_tag="ATU_RS24285"
                     /old_locus_tag="AGR_pAT_94"
                     /old_locus_tag="Atu5069"
     CDS             complement(67960..68907)
                     /locus_tag="ATU_RS24285"
                     /old_locus_tag="AGR_pAT_94"
                     /old_locus_tag="Atu5069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017956547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974333.1"
                     /translation="MAIQSPNTVDNSAAKEPVIEEASAFVRMARMLWADKFALCAAIF
                     LILVIILAIIGPTLLNELATKQNLRGRNLAPFDFSREWFMWLGADALGRPLWPRIIVA
                     TQNTIMVAAGAVFISAVVGTLLGLIAGFSSQRTSQIIMRLADVIMSFPSLLVAVIVLY
                     ILGSSILNLMLVLSITRIPVYLRTTRAEVMEIRSRMFVQAARVMGASSKRILFRHILP
                     VVLPTLTTLATLDFAYVMLAESALSFLGIGIQPPEITWGLMISQGRQYLTNAWWLSFW
                     PGLAIILTTLSLNLLSNWLRIALDPVQRWRLEMKGPKNG"
     gene            complement(68922..69836)
                     /locus_tag="ATU_RS24290"
                     /old_locus_tag="AGR_pAT_96"
                     /old_locus_tag="Atu5070"
     CDS             complement(68922..69836)
                     /locus_tag="ATU_RS24290"
                     /old_locus_tag="AGR_pAT_96"
                     /old_locus_tag="Atu5070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020009124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974334.1"
                     /translation="MLRFIRKRALASLISLIGLLIMVFFLSRLTGDPASLFLPVEASA
                     EMKAEFRALHGLDQPLLVQFVQYVGNVMTGDLGESLRKARPALDVVLEAFTWTLWLAV
                     ITMTLVTICAIVVGSLAAFRTGGFFDRFSSMVSLIGASVPDFWLAIVAIVVFAIQLSW
                     LPTSGTGTLSHWILPICVLFVRPFGIIVQVVRGSMISALSSAYVKTARAKGVKSGPII
                     FIHALRNAMLPVITVIGDQAASLLNGAVVIETIFGFPGVGKLMIDSILQRDFNVVLAA
                     ILVTAFAIFLMNLVIDLAYALLDPRIRY"
     gene            complement(70032..71549)
                     /locus_tag="ATU_RS24295"
                     /old_locus_tag="AGR_pAT_98"
                     /old_locus_tag="Atu5071"
     CDS             complement(70032..71549)
                     /locus_tag="ATU_RS24295"
                     /old_locus_tag="AGR_pAT_98"
                     /old_locus_tag="Atu5071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013761906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_010974335.1"
                     /translation="MKTSRLFGAILGSVLAFGSGIAPANAASTDIKIVLPEEADLLEP
                     CMATRSNIGRVIMENVSETLTELDVRGKQGVMPRLAEKWEQTGDSAWRFHLRQGVKFS
                     DGKTFGAKDVKYSFDRIFSDKNICESRRYFGGMKFDVKVVDDNTIDFKVDPVQPILPL
                     LLSLVTIVPDGTPLAFVREPIGTGPYKLSNWTPGQQIVLDARDDYWGKKPAVTKATYL
                     FRADPAVRAAMVQAGEADLAPSISQVDATNDKTDFSYLDSETVYLRLDGNIAPLNDVR
                     VRKALNLAIDRQAFIGTLVPQDAVLATALVPPTTLGWNPDVKVFPYDPDQAKKLLEEA
                     KAGGVPVDNPITIIARTANFPNVTEIMEAVQAQLQDVGFKVELRFVEVAEHEVYYSKP
                     FKEGRGPQIVAAMHDNSKGDPSFTMFFKYDTNGTQSGFSDKNVDDLIKRASAATGDER
                     AKLWSQLIAYVHDDLVADVLLFHMVGYSRVSERLDFKPTIATNSMLQLSEIGFKQ"
     gene            71901..73091
                     /locus_tag="ATU_RS24300"
                     /old_locus_tag="AGR_pAT_102"
                     /old_locus_tag="Atu5072"
     CDS             71901..73091
                     /locus_tag="ATU_RS24300"
                     /old_locus_tag="AGR_pAT_102"
                     /old_locus_tag="Atu5072"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020009127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exo-alpha-sialidase"
                     /protein_id="WP_010974337.1"
                     /translation="MTPEQIATVMTGKVEAAGKGRHEAVLASPMIQNHAPFLHLADDG
                     ALICAWFGGTLEGKSDISIFTSVLAAGSNKWGEPQRLSFDPDHSEQNPVLFAAPGNTL
                     LLFHTSQPSGNQDECRIRMAEVSRDASDPTRLTAGEGLYLDLPRGCFVRAPLTVRADG
                     AWLLPIFRCIQRPGQKWNGSHDRAAVGISEDCGKSWRLEDIDQSTGCVHMSPLVIGDE
                     KLAAVFRRRQADFVYRTESADGGRTWSAPQATDVPNNNSSIAAIRLNDGRIAMICNPT
                     NAAMSSDRRASLYDELGEDDDRPDANPDGGCVPIWGVPRAPVTVCISEDGAKSFPQRI
                     TIEDGPGTCLSNNSIDGHNKEMSYPWLLEGADGSLHIAYTYYRRAIKYVRLAPGWARA
                     ADGR"
     gene            73095..74060
                     /gene="pdxA"
                     /locus_tag="ATU_RS24305"
                     /old_locus_tag="AGR_pAT_104"
                     /old_locus_tag="Atu5073"
     CDS             73095..74060
                     /gene="pdxA"
                     /locus_tag="ATU_RS24305"
                     /old_locus_tag="AGR_pAT_104"
                     /old_locus_tag="Atu5073"
                     /EC_number="1.1.1.262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011969613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase
                     PdxA"
                     /protein_id="WP_010974338.1"
                     /translation="MSNIIGITMGDPCGVGPEITVRALAEMDEADRAATRIYGNLPTL
                     EAARKALNVDIDLAPYVVDLPIEDAPLAWGQLSPVAGDAAFRFIEKAVRDAEAGTIGC
                     IVTAPINKEALNLAGHHYDGHTGMLRSLTKSAAAYMLLASEKLKVIHVSTHVSLQEAI
                     RRATSERVLATIKAGNDHLKRTGYERPRIAVAGINPHCGENGLFGTEDDDQIAPAVAA
                     ARAEGIDAYGPISADTVFHRAYSGGFDLVVAQYHDQGHIPIKLVAFDTAVNVSVDLTI
                     DRTSVDHGTAFDIAGKGIANHGNMLSAIAYARKLVAGGASKGAQA"
     gene            74057..75178
                     /locus_tag="ATU_RS24310"
                     /old_locus_tag="AGR_pAT_105"
                     /old_locus_tag="Atu5074"
     CDS             74057..75178
                     /locus_tag="ATU_RS24310"
                     /old_locus_tag="AGR_pAT_105"
                     /old_locus_tag="Atu5074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017956541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-containing alcohol dehydrogenase"
                     /protein_id="WP_010974339.1"
                     /translation="MTSTPTITLHQPKRLIVGAGTIGDVANWVGEVSSTLVIASPITG
                     RFVDRMKLPGKVALFDAIPGEPEISTLDAALAAARVAKPDVVIGLGGGSVMDVAKLVA
                     ALWDGEQTLADVAGPNKVAGRRTRLAQIATTAGTGSEAGIRSLITDPIKGNKIAVESP
                     HLIADLAVLDPELTYSVPPTVTAATGVDAMAHCVEAFTSKRSHPMIDGFARMGFHLVG
                     KFLGRAVRDGSDREAREGLMLASYYGGICLGPVNTAAGHAIAYPLGTLLHLPHGLANA
                     IVFPHVLAFNQPVVSAKTAEVAEALGLGAGLSQTQLQDSARGFCSDLGIEMSLAKHGA
                     AEADLSRYAADAHAIRRLMDNNPADMSVDDVLDVYKASF"
     gene            complement(75239..75943)
                     /locus_tag="ATU_RS24315"
                     /old_locus_tag="AGR_pAT_108"
                     /old_locus_tag="Atu5075"
     CDS             complement(75239..75943)
                     /locus_tag="ATU_RS24315"
                     /old_locus_tag="AGR_pAT_108"
                     /old_locus_tag="Atu5075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017956540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FadR family transcriptional regulator"
                     /protein_id="WP_010974340.1"
                     /translation="MGLEAGIARKGLADIVFERMLRAIKSGAYNPDERLPTEHELAAE
                     FEVSRPVIREALKRLRDQGLIYSRRGAGSFVRSVGLRQPLGFGQLENVADLLNCYEFR
                     LTLEPAAAAAAATRHDADSLKAIRQALELLRDATNRQSHREDADFQFHLAIARAAQNT
                     YFSTAMEALKDHIAVGMKFHGASIRREATGLTRVFAEHEAIAKAIADGQEDDARRLMF
                     EHLQESRGRLFQASQK"
     gene            complement(75947..76975)
                     /locus_tag="ATU_RS24320"
                     /old_locus_tag="AGR_pAT_109"
                     /old_locus_tag="Atu5076"
     CDS             complement(75947..76975)
                     /locus_tag="ATU_RS24320"
                     /old_locus_tag="AGR_pAT_109"
                     /old_locus_tag="Atu5076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017272545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="four-carbon acid sugar kinase family protein"
                     /protein_id="WP_010974341.1"
                     /translation="MLAILADDLTGALDSAAPFAARGLRADIALDLEAVAQIVTDKPD
                     IISINLNTREIGSDEARTATAAAISFLPSKTRLFKKVDSRLKGNIVAEIDAIPYSRAL
                     VAPAIPTFDRIVELGYVAGHGIDKPISIAERFGSHLVRINAPDTRTHIDMENALAAAE
                     RDGTDLLIGARGLAEALAGRMTNGALSKVAIIPAGSAIFVIGSRDPITLEQIDILRAA
                     IDLHYVAAPNGHVNAALEADAALTLIQATPGSHGVSPQAVADALGEGLKGDLSRHSDT
                     LLLSGGATAEAVMRSLGVSRLHLHGECLPGLSVASANGRTIIAKSGGFGHPDTLKIVA
                     DMVLRKAS"
     gene            <77234..>77364
                     /locus_tag="ATU_RS24325"
                     /pseudo
     CDS             <77234..>77364
                     /locus_tag="ATU_RS24325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012650068.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus and C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS5/IS1182 family transposase"
     gene            78507..79568
                     /locus_tag="ATU_RS24330"
                     /old_locus_tag="AGR_pAT_111"
                     /old_locus_tag="Atu5078"
     CDS             78507..79568
                     /locus_tag="ATU_RS24330"
                     /old_locus_tag="AGR_pAT_111"
                     /old_locus_tag="Atu5078"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013530527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_010974344.1"
                     /translation="MQDAKNSIIDVPVAARATIKDVAFAAGVSISTASKALNERGRMA
                     AETRERIQSVAQQLGFRPNAMARALVGQRSFTLGLLTNDTYGRFTLPIAAGLSAAMAD
                     RGVSVFLCAIDDEPERVRLSLEAMEDKRVDGLVVSGKRIDRVLPVDIPTVHMPVVYVN
                     AACPEGAIGFVPDDEGGAHAAVSHLVGLGRKRIAHVTGPRSFSAVSLREKGWRRALSE
                     AALPCFGDVLSGEWSEAFGYAAGQRFVASPISERPDAVFCGNDQIARGVIDALALSGI
                     RVPEDIAVVGFDNWEIFATATRPPLTTVDMALKELGRQAGLTLLDMIDGKPVETGQRR
                     LPCRLKVRESCGSPAPWAE"
     gene            79614..80860
                     /locus_tag="ATU_RS24335"
                     /old_locus_tag="Atu5079"
                     /pseudo
     CDS             79614..80860
                     /locus_tag="ATU_RS24335"
                     /old_locus_tag="Atu5079"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010910772.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
     gene            80926..81861
                     /locus_tag="ATU_RS24340"
                     /old_locus_tag="AGR_pAT_117"
                     /old_locus_tag="Atu5080"
     CDS             80926..81861
                     /locus_tag="ATU_RS24340"
                     /old_locus_tag="AGR_pAT_117"
                     /old_locus_tag="Atu5080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019952111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_010974345.1"
                     /translation="MSVQKLAPVRGAPNAPLRPLRKPRRDWMGLLYVAPALLLVLVFF
                     LVPLGMTAWMSLHNWPLIGMPRWIGFANYKVLWNDINFWNALAFTIRYTVAATVGLML
                     AGFGLALLIERPRPFANLYRNAFFLPVVIGFASASLLWSWLSNVDSGLFSPLAETLGL
                     TDGRVNLLATFAPSFWSVTAMVIWKMAGFYMVILMSGLQAIPTDFIEAARIDGANALQ
                     RFRFITLPLVRRSFALALILCISGSMLAFDQFYIILAGGPQNKTITAVYWIFSQSFVS
                     FRLGYGAALSMVLLAILVVLSIVQLRLLGDKEPTQ"
     gene            81858..82736
                     /locus_tag="ATU_RS24345"
                     /old_locus_tag="AGR_pAT_119"
                     /old_locus_tag="Atu5081"
     CDS             81858..82736
                     /locus_tag="ATU_RS24345"
                     /old_locus_tag="AGR_pAT_119"
                     /old_locus_tag="Atu5081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018062969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="WP_010974346.1"
                     /translation="MTLALTSATTQPKKRRGRRIGLYVILFHITCILVGLLFLAPIVL
                     VLLASFRPPAMASSGLFSVQGLGFGNYGRLEDFGAGILHYAGNSLFVALATAAFTILV
                     SVFAGYGFSRFRFPFKLVAFVLILSTIMVPFQSILTPLFLILPKLGLQNTLSGLVFIY
                     VTLQLPFSIFMMRNAFDAVPKEIEEAARIDGVKGLRALVYVLGPLVFPGIVSVGLFAF
                     LNAWNEFLGALVLLTDQDRYTLPVLVTAVRSGRYGSIDWGAVQAGVTVMMIPCLILFV
                     TLQRFYIRGLTAGAVK"
     gene            82765..84716
                     /locus_tag="ATU_RS24350"
                     /old_locus_tag="AGR_pAT_121"
                     /old_locus_tag="Atu5082"
                     /pseudo
     CDS             82765..84716
                     /locus_tag="ATU_RS24350"
                     /old_locus_tag="AGR_pAT_121"
                     /old_locus_tag="Atu5082"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018183357.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 127 protein"
     gene            84749..85864
                     /locus_tag="ATU_RS24355"
                     /old_locus_tag="AGR_pAT_124"
                     /old_locus_tag="Atu5083"
     CDS             84749..85864
                     /locus_tag="ATU_RS24355"
                     /old_locus_tag="AGR_pAT_124"
                     /old_locus_tag="Atu5083"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018896629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010974348.1"
                     /translation="MSGVELKGVSKSFGAVDVIHDIDLSITAGEFVVFVGPSGCGKST
                     LLRLIAGLEETSRGEILIGGRDVTDADPSDRGIAMVFQSYALYPHMTVAQNMGFGLRM
                     AHRPKEEVTAMVRHAAEILHLTPLLDRRPGQLSGGQRQRVAIGRAIVRNPEVFLFDEP
                     LSNLDAELRVGMRIEIARLHKQLGNTMIYVTHDQTEAMTLADKIVVLRAGRIEQIGSP
                     FELYSDPDNLFVAGFIGSPKMNFVPAGHEAGALVVAGHRLTFAAPAGLPTNCQLQLGI
                     RPENLTLTRDGERGLAVTVGFTEFLGGTTYLYGHIEPGMPLIVQGEAGPAPLVGQTVF
                     VTSIRQMPDFSMPRGCVFVMLRNVPKPFQAISFQTAV"
     gene            complement(85878..86831)
                     /locus_tag="ATU_RS24360"
                     /old_locus_tag="AGR_pAT_125"
                     /old_locus_tag="Atu5084"
     CDS             complement(85878..86831)
                     /locus_tag="ATU_RS24360"
                     /old_locus_tag="AGR_pAT_125"
                     /old_locus_tag="Atu5084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013845919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974349.1"
                     /translation="MQVIDHFNLRSFDLNLLVAFDAMMEEMSVTRAARRLKIQQPAMS
                     HNISTLRTLFQDELFIRVGQIMKPTARALNLSGPVRQALRQAQAAVLMADAFEPATEQ
                     RTFRLGLSSEVELLLLPDLTARLRDIAPGIRILARGGDATEVNAMLDAGVIDMSVGCS
                     YLPDSRHHSEPLYQSSVLCCFNPQLLKVSNPVSLDAYMAAQHAVISQTDSLHGCVKDA
                     LEHAGAELEVVAAAPDFMSVLATARSSAVIATVSSRIARRYGPLLGLEVSPVPLALSF
                     PPVAMVWPLHMDSDLGCAWLREQIREAMLSENQDRIAEVAA"
     gene            86925..87884
                     /locus_tag="ATU_RS24365"
                     /old_locus_tag="AGR_pAT_127"
                     /old_locus_tag="Atu5085"
     CDS             86925..87884
                     /locus_tag="ATU_RS24365"
                     /old_locus_tag="AGR_pAT_127"
                     /old_locus_tag="Atu5085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018325498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_010974350.1"
                     /translation="MPSRRSILKSALTGLVAAPFVAPSLTFAKAPYAVVQAPGFYRLK
                     IGSVEVTALSDGTIPLPLSKLYTNTSQQHAQSVLSDAFLPASVPTSVNAFLVNTGDRL
                     VLIDAGTGTYIGPSLGKLAANIEASGYKVDDIDDVVLTHIHTDHSGGLVSNGKRSFPN
                     ATLRVNEREAKFWLSADNANAATGIVKQQFAEADQCVTPYVKAEKFETFADNAAPVPG
                     LGSILYAGHTPGHSAITLESEGQKIVFWGDITHGDILQFDEPGVAIEFDIDQKAAVAA
                     RDIAFKQAVEGRYLVGGAHIAFPGIGHVRKDSTNYDWLPINYA"
     gene            88566..90008
                     /locus_tag="ATU_RS24370"
                     /old_locus_tag="AGR_pAT_129"
                     /old_locus_tag="Atu5086"
     CDS             88566..90008
                     /locus_tag="ATU_RS24370"
                     /old_locus_tag="AGR_pAT_129"
                     /old_locus_tag="Atu5086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017991796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_010974352.1"
                     /translation="MPKPKMPSVATTGIAGLDEILRGGLPASNLYILQGAPGSGKTTA
                     ALQFLRAGVAAGESCIYVTLSQTAAELKAIAVSHGWTLDGIRIEELATSGSVNEADDQ
                     SIFMTSDLRLDETRKAIEAAIEEHKPRRLVYDSLLEIRLITGDSPRFRRELIAFKAFL
                     AKQDVVALLLDTQSSDFDRSGEEMEGLAHGVIRFDKSLEEYGGVRRRVEISKMRSVPI
                     ADGYHDMAIREGEGVVIFPRIMPSAASDTGKPQLIKSGVAELDEMFGGGQEAGTTTLV
                     IGQAGTGKSTMSSLYATAALERGENVALFLFEERLETFFRRSEGLGMQLRQFHKDGRL
                     ILRDFNPNEISPGEFGQIVRDAVTQNKSKVVVIDSLTGYLNSLPHRDKAVRDIQSLLK
                     YLARSGVLTMLIVAQHGLLGQNVGIDVDVSFLGDTVLLLRIMEHEGRLRRNITVVKKR
                     HGPHDLDVRELIIESGNVSVVAYNPLPDPK"
     gene            90005..91057
                     /locus_tag="ATU_RS24375"
                     /old_locus_tag="AGR_pAT_130"
                     /old_locus_tag="Atu5087"
     CDS             90005..91057
                     /locus_tag="ATU_RS24375"
                     /old_locus_tag="AGR_pAT_130"
                     /old_locus_tag="Atu5087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003555123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_010974353.1"
                     /translation="MSGLPRENEVDWVLVLAPFRKDADYIAALLQDQKVGMVSAKVDD
                     DLEGLLCSSPDIIIVTHEALTPSVLTKLSDHLKAQPDWSEIPIIVLLEKAAPVQDIRD
                     RLQAAWPKSRLLFHLRPIAPLELANAVQLNLLVRLRQRQVRDSIERERELRLELNHRV
                     KNILATVTSIFQMTRRGAASVEELAGDFGARLQALSGVHSAVFEAGGEEVGLSLIMAT
                     TVAPYNGDGSSRIAVSGPDIVVSRDAGTTIALCVHELTTNAIKYGALSVPEGNVEVIW
                     EVTDGNDPLFSMNWIERGGPPAVTPSRQGYGTRYIRSALGSLLGTAPQLQFDTQGFRC
                     RIAGPVSQLRTERQPG"
     gene            92157..93263
                     /locus_tag="ATU_RS24380"
                     /old_locus_tag="AGR_pAT_131"
                     /old_locus_tag="Atu5089"
     CDS             92157..93263
                     /locus_tag="ATU_RS24380"
                     /old_locus_tag="AGR_pAT_131"
                     /old_locus_tag="Atu5089"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162180338.1"
                     /translation="MIKEPKSRLPSLTAVTAGFMFACILVGVAIVFKVVDDRMLGFQE
                     ASLRTAVETRARGVQTAFAASLYREWINLETLGSSLAVSQPEDIQDDLSTLVGSGRVV
                     SWAGYAGNDGKVRVASNGLLVGTDVSSRPWFQRGLQGNFAGDAHEAVLLAAKLPAPES
                     GEPLRFLDLAAPVTGVGQSVTGVLGLHLNLEWAKAYISELSDALDVDVLIVNPEGRAV
                     ISSSNESPSNLDVPSFRRARTGATGVSLELWPDGENYFVATLPEASYQSLPRFGWSIV
                     ARIDANASRNPASSFSSGLLLSLSLLTMALLLLMSLFIVSFIRPFHHLAVNAKAVADG
                     QNVYPYESKRTSELATIGSAISRLQANADRQDNE"
     gene            complement(93278..95251)
                     /locus_tag="ATU_RS24385"
                     /old_locus_tag="AGR_pAT_132"
                     /old_locus_tag="Atu5090"
     CDS             complement(93278..95251)
                     /locus_tag="ATU_RS24385"
                     /old_locus_tag="AGR_pAT_132"
                     /old_locus_tag="Atu5090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007121174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_010974356.1"
                     /translation="MDSFLYLSELQSSFAHLALAFGCALVLPYLLNNRNWTHRTFLFA
                     IGMALAVRYIWWRGTQTLAPPGFTLDCLFSWSFFALEALSVLSSLSAFTILTRTTDRS
                     PEVEENKSWWKPDPPPKVAILIATYNEEQAVLERTIVGAKASDHPDVQVLVLDDGRRD
                     WLRDFCEEHDVRYLRRPDNKGSKAGNINHALGVLAQDDQPPDFIAVLDADFVPHTDFV
                     SRALALFHDQEVGLVQTPQHFFNPDPIQHNLGLSRSYPDEQRFFFDHLQPSRDGWGIA
                     FCCGTSSVIRWRAVQASGGFPTDSITEDFMLTLQLQEYGYRTVYLNEALTEGLAPEGL
                     KEYVTQRARWCLGLMQIARGRLGPFSRNNLRLRDRWSVVDSVFFWLTTFTFRIASMTF
                     PLFYWFFNITVVNASVPDVISYFGAYMVWILFVLNFISSGMVIPIVNDVSQLLGALPI
                     SRAAIVGLVKPKGHPFSVTAKGGDRTKVVVQWRLMRPFLLLTFLTVAGVLIGLVSDRF
                     AFNDAGDGKVVILFWTVYNLVILAVTLLVCVELPRREKHYADRPERVVISLGGALKRV
                     WMTDLTQETARLRGVDAPIATQVIMKLKEIGDFTATVLDRTDDGLVVALGLDETQYQL
                     LLKRLYAGGSVPSVTSTRLSAIIRDATTRFARR"
     gene            complement(95255..96448)
                     /locus_tag="ATU_RS24390"
                     /old_locus_tag="AGR_pAT_134"
                     /old_locus_tag="Atu5091"
     CDS             complement(95255..96448)
                     /locus_tag="ATU_RS24390"
                     /old_locus_tag="AGR_pAT_134"
                     /old_locus_tag="Atu5091"
                     /inference="COORDINATES: protein motif:HMM:NF024829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family efflux transporter periplasmic
                     adaptor subunit"
                     /protein_id="WP_010974357.1"
                     /translation="MKLIKIGFGLLLICGALYVVLGEQLSGASANAFINARLTTIRAP
                     IAGKIELISRPLGAQVARGDPLGSLEDPLVDGIRLLDLELQQADAQTEIKRLETVVTS
                     FDESIDQLQTRAAIYREERKRQLAAQAQSADASRAASEARLKYAELSRERSSRLSGQG
                     ISTAQSLEQAQSLSEVSALEVANAKAQAAEIVVAQKAAERGVFLGDGFNDAPYSEQRI
                     SEIDVQRLELKAQLEAKKLALTAISDRLANERLRVNRLSSSDLAANVNGALWEYLSAS
                     GETVQRGQDLMRLIDCDSAIVTLSVSESVYNSLRVGAPATFRLNRSRQVLQGSVIRLA
                     GSGAATIYENMAIAPSQRHLQRYDVALDVPALRDDPDLRCLAGRTGRVFFETRAFDWL
                     RGLWR"
     gene            complement(<96841..97449)
                     /locus_tag="ATU_RS24395"
                     /old_locus_tag="AGR_pAT_136"
                     /old_locus_tag="Atu5092"
                     /pseudo
     CDS             complement(<96841..97449)
                     /locus_tag="ATU_RS24395"
                     /old_locus_tag="AGR_pAT_136"
                     /old_locus_tag="Atu5092"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012553159.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(97491..>97823)
                     /locus_tag="ATU_RS24400"
                     /old_locus_tag="AGR_pAT_137"
                     /old_locus_tag="Atu5093"
                     /pseudo
     CDS             complement(97491..>97823)
                     /locus_tag="ATU_RS24400"
                     /old_locus_tag="AGR_pAT_137"
                     /old_locus_tag="Atu5093"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010972061.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            98238..99791
                     /locus_tag="ATU_RS24405"
                     /old_locus_tag="AGR_pAT_139"
                     /old_locus_tag="Atu5094"
     CDS             98238..99791
                     /locus_tag="ATU_RS24405"
                     /old_locus_tag="AGR_pAT_139"
                     /old_locus_tag="Atu5094"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015951948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ISL3 family transposase"
                     /protein_id="WP_010974358.1"
                     /translation="MSTKFRASDLVPAGFTAERITHIDDETRIVLSRAVASAACPACG
                     RMSRTVRSRYCRQVADLPLSGKRVRLLVQTRRFACDAVLCGRQIFAERFGEVLLPYAR
                     RTGRLEHLVHHLALALGGRPAARFAQRLMLPVSNDTLLRVIRRQGLPPSTPPSVIGID
                     DWAWRRNHRYGTIVCDLERRRPVSLLPDREPATAEAWLRGNPQIEIIARDRGGAYGLA
                     AAKALPDAVQVADRWHLMENASRAFLDAVRKSMRQIRKTLKATRVNPKLLTAAERLQY
                     EGYLRREQTNAAIIALAKDGIMIKEIVRRTGHSRGLVRQVLRGQRNDVFRSRESSLES
                     YFEWLDAQWAAGKRNATELWRRLRTQGFRGSRRVVSEWATRRKRADKADAESLTRIPS
                     ARTIARLLTNSRDNLTKSETVTIAAIESGVPLLIAARDIITDFHLMIRRKAENQLTSW
                     IDRARDSLVSSFGNGVVKDIQAVRAAIVSPWSNGQTEGQITKLKLVKRQMYGRGKLDL
                     LQARLIGAT"
     gene            complement(100310..101083)
                     /locus_tag="ATU_RS24410"
                     /old_locus_tag="AGR_pAT_140"
                     /old_locus_tag="Atu5096"
     CDS             complement(100310..101083)
                     /locus_tag="ATU_RS24410"
                     /old_locus_tag="AGR_pAT_140"
                     /old_locus_tag="Atu5096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020048036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SOS response-associated peptidase"
                     /protein_id="WP_010974360.1"
                     /translation="MCNLYRMEDKDWVSKWAQDAESLINLMPAYQMNPDQMGPIVRNT
                     ADGKKQLVHARWGLPSPIFVQKKAAEARADKLKAKGKAFDINELIRMEPDRGVTNVRK
                     LNLPHWTRWFGVEHRCLVPVTSFAEPDPASKQEGGNVPNAWFARDEAKSLMFFAGIHV
                     PQWKSVRKVRDGLTTDDLYGFLTTDPNDLVKPIHEKAMPVLLLTREETEIWMRAPWDE
                     AKHLARPLPNDALIILSREPYGSSIVSKSGESEEQGRLL"
     gene            complement(101139..102191)
                     /locus_tag="ATU_RS24415"
                     /old_locus_tag="AGR_pAT_142"
                     /old_locus_tag="Atu5097"
     CDS             complement(101139..102191)
                     /locus_tag="ATU_RS24415"
                     /old_locus_tag="AGR_pAT_142"
                     /old_locus_tag="Atu5097"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="non-homologous end-joining DNA ligase"
                     /protein_id="WP_010974361.1"
                     /translation="MTKPPRSKPLLRDTEAPIRSKPRRKRNPAQPQLLFNPMPDRVEP
                     ALEQLKAHPPQGDQWSWELKWDGYRLAVHIEPTGVRILTRGGHDWTHRFPAIAEAARA
                     LGPATMIIDGEAVVLDDEGRPDFGLLQKSLGASGKAAGNRASDAILYAFDLMYLDGHD
                     LREMEYRSRRHLLEDTIKANDGAIRLSETLDADPNVLLEHIRSLGLEGIVGKHLDQPY
                     RSGRAGDWVKVKCIESEAFMVVGYEPSMASPAGFASLVVAAYRGDELIHVGNVGTGFK
                     EAEMIGLRKMLDKLRWKRKPPPVPFTEKTDIVWVEPTLIAEIEFRAWTADGKLRHASY
                     KGLRERQDNADVYRLE"
     gene            102464..103216
                     /locus_tag="ATU_RS24420"
                     /old_locus_tag="AGR_pAT_143"
                     /old_locus_tag="Atu5098"
     CDS             102464..103216
                     /locus_tag="ATU_RS24420"
                     /old_locus_tag="AGR_pAT_143"
                     /old_locus_tag="Atu5098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ImuA family protein"
                     /protein_id="WP_010974362.1"
                     /translation="MTAAHQRVICDLRERIASMEGGSAKRAGTLAFDVPEIDAALPGG
                     GLAYGALHEFAGGGSGTVDGAAAALCVAGIAARTKGPVVWCLTRPDLFFPGLAEVGLH
                     PNRVIFVESDREEDVLANMEEGLSFGGIGAVVGELVRLPMVSSRRLQLAAERTGSMAL
                     AVRRWRRQSEANDFGQPTASTTRWRVSVMPSEELPVPGVGRPQWFLELMRVKAGECAE
                     FLVRACDDKGRIHLSSGSADGSNTSGRSLHSA"
     gene            103137..104648
                     /locus_tag="ATU_RS24425"
                     /old_locus_tag="AGR_pAT_144"
                     /old_locus_tag="Atu5099"
     CDS             103137..104648
                     /locus_tag="ATU_RS24425"
                     /old_locus_tag="AGR_pAT_144"
                     /old_locus_tag="Atu5099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019565689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase Y family protein"
                     /protein_id="WP_035257800.1"
                     /translation="MTRVVSIYLPDLPTDRIRRADPSIPPEQPIAVIARSGSKRWVSA
                     ADASARKAGVHVGMAAAKAQSLFQGLMLIDADPEADRVALERITLWALMIYSPIVAVD
                     GIDGIVMDTEGAEHLQGGELPMVTKIANQFLGRKLTARVAVADSWGAAHACARAISRE
                     TIVIPPGETVRAVEKLSISLLRLPAKIVSDLRILGFQTVGELANTPRAPLTLRFGPEI
                     GRRLDQMLCRIAEPIEPIRTPELVEVSRAFAEPIGAAETIDKYVGRLVVQQVDALQKR
                     GHGVRRADLIVEKVDGTRQAIRAGTAKPARDIAWLTKLFRDRTEKIEPGFGIEKLTLV
                     AVMTEPLEEAQKASALIGDDVTDVTPLIDIYGNRGQRVYRVAPVASDVPERSVQRISP
                     VAEPIAVAWVSHWRRPVRLLPRPELIEAIALMPDRPPVSIVWRGRRRKVKRADGPERI
                     FGEWWQRDAEMDAVRDYFVIEDEAGERLWVFRSGDGVDPDTGSHRWFCHGIFA"
     gene            104645..107902
                     /gene="dnaE"
                     /locus_tag="ATU_RS24430"
                     /old_locus_tag="AGR_pAT_bx5"
                     /old_locus_tag="Atu5100"
     CDS             104645..107902
                     /gene="dnaE"
                     /locus_tag="ATU_RS24430"
                     /old_locus_tag="AGR_pAT_bx5"
                     /old_locus_tag="Atu5100"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="error-prone DNA polymerase"
                     /protein_id="WP_010974364.1"
                     /translation="MSYAELQVTTHFSFLRGASSAQELFETAKALGIQAIGVVDRNSL
                     AGIVRALEASRATDIRLVVGCRLDLTDGMSLLVYPTDRAAYSRLTRLITLGKSRGGKN
                     NCILHWDDVIAYSRGMIGVLVPDLPDATCAAQLRRIAEAFGDRAYVSLCLRRRQNDQM
                     RLHEISNLAARFKVKTVVTNDVLFHEPGRRQLQDIVTCIRHNTTIDDVGFERERHADR
                     YLKPPEEMERLFSRYSEALARTLEIVRRCKFSLEELTYQYPEEAIVPGKDAQASLEHY
                     VWECAPDRYPEGLPQDVLKTVRHELDLIRTMKYAPYFLTVFSIVRFARSQGILCQGRG
                     SAANSAVCYILGITSIDPSTNDLLFERFVSQERDEPPDIDVDFEHERREEVIQWIYKT
                     YTKDKAALCATVTRYRAKGAIRDVGKALGLPEDVIKALSSGMWSWSEEVPDRNIRELN
                     LNPDDRRLALTLKLAQQLMGAPRHLGQHPGGFVLTHDRLDDLVPIEPATMKDRQIIEW
                     DKDDVEALKFMKVDVLALGMLTCMAKAFDLIREHKGQQLDLSNIEQEDAATYAMIRKA
                     DTLGTFQIESRAQMAMLPRLKPRTFYDLVVQVAIVRPGPIQGDMVHPYLRRREGKEPV
                     EYPTPELEAVLGKTLGVPLFQESAMRVAMVCAGFTGGEADQLRKSMATFKFTGGVSRF
                     KDKLVSGMVKNGYSPEFAEKTFSQLEGFGSYGFPESHAASFALIAYASNYIKCHYPDV
                     FCAALLNSQPMGFYAPAQIVGDAIKHGVEVRPVCVNRSRWDCTLERIEGSDRHAVRLG
                     FRQVKGLAVADAARIVAARMNNPFASVDDMWRRSSVPTEALVQLAEADAFLPSLKLER
                     RDALWAIKALRDEPLPLFAAAAEREATAIAEQQEPEVALRQMTDGHNVIEDYSHTGLT
                     LRQHPVAFLRRDLSARNIIPCAEAMNARDGRWVYTAGLVLVRQKPGSAKGVMFITIED
                     ETGPANIVVWPSLFEKRRSVVLGSSMMAINGRIQREGEVVHLVAQQLFDLSADLVGLA
                     DRDTGFRLPAGRGDEFAHGGGGPDSRDRQKPVVPRDMFTPDLHIDTLKIKSRNFQ"
     gene            107993..108391
                     /locus_tag="ATU_RS24435"
                     /old_locus_tag="AGR_pAT_147"
                     /old_locus_tag="Atu5101"
                     /pseudo
     CDS             107993..108391
                     /locus_tag="ATU_RS24435"
                     /old_locus_tag="AGR_pAT_147"
                     /old_locus_tag="Atu5101"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517407.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1419 domain-containing protein"
     gene            108897..109496
                     /locus_tag="ATU_RS24440"
                     /old_locus_tag="AGR_pAT_149"
                     /old_locus_tag="Atu5102"
     CDS             108897..109496
                     /locus_tag="ATU_RS24440"
                     /old_locus_tag="AGR_pAT_149"
                     /old_locus_tag="Atu5102"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974366.1"
                     /translation="MAKSATQSRQSIRQSARVVPLRRGATLEMVRLSCPDETQALRIA
                     ESFGIAIVDSDGIRGMHERLIVETATALSDGLGDRAMQIHLQRIVGAYVGSAHGAGQF
                     YSRAVTEARNATAKSAADARDEDLDGPVGYESAAQRKREFAADMGIQAHALRMAAVGS
                     VAAYEQVVGETWKPFDRPVENPGQTLDRKAAAVQLSAFE"
     gene            109929..110861
                     /locus_tag="ATU_RS24445"
                     /old_locus_tag="AGR_pAT_151"
                     /old_locus_tag="Atu5103"
     CDS             109929..110861
                     /locus_tag="ATU_RS24445"
                     /old_locus_tag="AGR_pAT_151"
                     /old_locus_tag="Atu5103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019565693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArdC family protein"
                     /protein_id="WP_010974367.1"
                     /translation="MKRKGQGERADLYARITDRIVADLEKGVRPWMKPWSAANTTGQI
                     TRPLRHNGEAYSGLNVLLLWSESTARGYVSPTWMTFKQALQLDGAVRKGETGTTVIYA
                     SRFTKSETDSNGGEVERDIPFLKSYTVFNVAQIDGLPDHYHGVPEPLLSPIERIGHAD
                     EFFRNTGAVIRHGGKQAYYSPAMDYIQMPPFEAFRDAAGYAAVLSHEATHWTAAEHRV
                     GRDLSRYAKDRTERAREELIAELGSCFLCADLGIAPELEPRPDHASYLQSWLSVLAND
                     KRAIFQAAAHAQRAVNYLHGLQPRADACATREAV"
     gene            111452..111763
                     /locus_tag="ATU_RS24450"
     CDS             111452..111763
                     /locus_tag="ATU_RS24450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF736 domain-containing protein"
                     /protein_id="WP_035257795.1"
                     /translation="MAIIGEFTTNGNTILGHVRTLTVSMKARLNPIERTSRDAPDFRI
                     MSEAAEVGAAWSQVSGDGEPYISVKLDDPSFPAPINAALWPTEREGDYTLVWNRPKRD
                     A"
     gene            112083..112244
                     /locus_tag="ATU_RS26625"
     CDS             112083..112244
                     /locus_tag="ATU_RS26625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006699032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_019565695.1"
                     /translation="MLLEQHIEELRAEMNHCHPDERRQIAAELELALAELAVIMAEQD
                     GSVDAVPPF"
     gene            complement(112394..112672)
                     /locus_tag="ATU_RS24455"
                     /old_locus_tag="AGR_pAT_bx237"
                     /old_locus_tag="Atu5106"
                     /pseudo
     CDS             complement(112394..112672)
                     /locus_tag="ATU_RS24455"
                     /old_locus_tag="AGR_pAT_bx237"
                     /old_locus_tag="Atu5106"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003594536.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="HU family DNA-binding protein"
     gene            complement(112706..113017)
                     /locus_tag="ATU_RS24460"
                     /old_locus_tag="AGR_pAT_bx353"
                     /old_locus_tag="Atu5107"
     CDS             complement(112706..113017)
                     /locus_tag="ATU_RS24460"
                     /old_locus_tag="AGR_pAT_bx353"
                     /old_locus_tag="Atu5107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WGR domain-containing protein"
                     /protein_id="WP_010974371.1"
                     /translation="MGTHHYQLYCQRIDANRNMARYYALAIRPTLFGEIAVVRSWGRI
                     GKAGGEMTEVFGNDNDAISRFLELVLQKRKRGYQPARSCGNPCRSASVRTTPHDNVTI
                     A"
     gene            complement(113538..115457)
                     /gene="traG"
                     /locus_tag="ATU_RS24465"
                     /old_locus_tag="AGR_pAT_160"
                     /old_locus_tag="Atu5108"
     CDS             complement(113538..115457)
                     /gene="traG"
                     /locus_tag="ATU_RS24465"
                     /old_locus_tag="AGR_pAT_160"
                     /old_locus_tag="Atu5108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020811900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ti-type conjugative transfer system protein
                     TraG"
                     /protein_id="WP_010974372.1"
                     /translation="MKGKAKQHPSLLLITIPIAVTGFSFYVAHWRWPELAAGITGKTQ
                     YWFLRASPLPVLLFGPLAGLLAVWALPLHRRRPVALASFLCFFLVAGFYGMREFGRLQ
                     PLVESGVLTWDQALSFVDMIAVVGAAMGFMAAAVAARISSVVPEQVTRARRGTFGDAD
                     WLPMSAAARLFPDDGEIVIGERYRVDKELIHELPFDPNDPATWGRGGKAPLLTYAQDF
                     DSTHMLFFAGSGGFKTTSNVVPTALRYTGPLICLDPSTEVAPMVVDHRRDKLDREVVV
                     LDPANPVMGFNVLDGIEHSLKKEEDIVGIAHMLLSESVRFESSTGSYFQSQAHNLLTG
                     LLAHVMLSPEYAGQRNLRSLRQIVSEPENSVLAMLRDVQEHSASAFIRETLGVFVNMT
                     EQTFSGVYSTASKDTQWLSLDNYAALVCGNTFKSSEIAGGKKDVFINIPASILRSYPG
                     IGRVIIGSLINAMIEADGAFTRRALFILDEVDLLGYMRVLEEARDRGRKYGVSMMLMY
                     QSVGQLERHFGKDGAVSWIDGCAFASYAAIKALDTARNVSAQCGEMTVEVKGSSRNLG
                     WGTKNSASRKSENINFQRRPLIMPHEITQSMRKDEQIIIVQGHSPIRCGRAIYFRRKD
                     MDMHARPNRFAKLGP"
     gene            complement(115454..115687)
                     /locus_tag="ATU_RS24470"
                     /old_locus_tag="AGR_pAT_161"
                     /old_locus_tag="Atu5109"
     CDS             complement(115454..115687)
                     /locus_tag="ATU_RS24470"
                     /old_locus_tag="AGR_pAT_161"
                     /old_locus_tag="Atu5109"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020811899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraD"
                     /protein_id="WP_010974373.1"
                     /translation="MTSDRKKGAREKFLLGDIVVRAGLSDADRAFLLGGLLEMKRVVQ
                     GTPEHRRLCDIGELAFRDAASNGGLERFLKVVE"
     gene            complement(115677..115964)
                     /locus_tag="ATU_RS24475"
                     /old_locus_tag="AGR_pAT_162"
                     /old_locus_tag="Atu5110"
     CDS             complement(115677..115964)
                     /locus_tag="ATU_RS24475"
                     /old_locus_tag="AGR_pAT_162"
                     /old_locus_tag="Atu5110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TraC family protein"
                     /protein_id="WP_010974374.1"
                     /translation="MATKPALMDIDAQIEKLRERRKTLIVKSADRFARAATKSGLAEM
                     EIADEEVDRIFDEIAARFRNGEKKQAAGSPASPRGQANGATGSETEVPHDI"
     gene            116187..120815
                     /gene="traA"
                     /locus_tag="ATU_RS24480"
                     /old_locus_tag="AGR_pAT_164"
                     /old_locus_tag="Atu5111"
     CDS             116187..120815
                     /gene="traA"
                     /locus_tag="ATU_RS24480"
                     /old_locus_tag="AGR_pAT_164"
                     /old_locus_tag="Atu5111"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ti-type conjugative transfer relaxase TraA"
                     /protein_id="WP_010974375.1"
                     /translation="MAIMFVRAQVISRGAGRSIVSAAAYRHRARMVDEQAGTSFSYRG
                     GGAELKHEELVLPDQVPAWLRAAIDGKSVVAASEALWNAVDAFETRADAQLARELIIA
                     LPEELTRSENIALVREFVRDNLTSKGMIADWVYHDRQGNPHIHLMTALRPLTEQGFGP
                     KKVPVLGADGEPLRVVTPDRPKGKIVYRLWAGDKETMKAWKIAWADTANRHLALAGQE
                     IRLDGRSYAEQGLDGIAQKHLGPEKAALARKGVAMYFAPADLARRQEMADRLLADPYL
                     LLKQLGNERSTFDERDIAKALHRYVDDPADFANIRSKLMASNDLVLLKPQQANLQTGK
                     VAELAVFTTRDILRTEYDMAQSAEVLARRKGSGVANAKIAAAVRTIETGNPENPFTLD
                     REQVEAVHHVAGDTGIAAVVGHAGAGKSTLLAAARVAWESDNHRVFGAALAGKAAEGL
                     EDSSGIRSRTLASWELAWENGRDLLDRRDIFVIDEAGMVSSQQMARVLKRAEEAGAKV
                     VLVGDAMQLQPIQAGAAFRAISERIGFAELAGVRRQREEWAREASRLFACGKVEEGLD
                     AYAQRGRIVEAESRAEAVERIVADWTSARRELIQQHADKEQPVRLRGDELLVLAYTND
                     DVRRLNEALRNVMKDEGALTVSREFQTERGVREFAVGDRIIFLENARFLEPRAQRLGP
                     QYVKNGMLGTVVSTGDTHGGPLLSVRLDNGRDVVISEDSYRNVDHGYAATIHKSQGAT
                     VDRTFVLATGMMDQHLTYVSMTRHRDRADLYAAREDFEPKPGWGKRSRVDHAAGVTGE
                     LVGTGNAKFRPQDEDTDKSPYADVKTDDGTVHRLWGVSLPKALEEGGVSEGDTVTLRK
                     DGVERVTVTVSVIDEKTGEKRFEERTVDRNVWTAKRIETAEVRRQRIEEESHRPEQFK
                     QLVERLGRSGAKTTTLDFESEAGYHAHARDFAKRRGIDTLSGVAAWMEDGAGRQLAWL
                     AQKREQVAKLWERASVALGFAIESEKRVSYSEERAETRTAKIPTDRQYLIPPTTLFSR
                     GVGEDARRAQLRSDHWKERDAILRPVLQQIYRDPEGALARLNTLASDARIAPRELADD
                     LEASPQRLGRLHGSDLLVDGRAARSQREAALSALSELLPLARAHATEFRRQVERFGMR
                     EEQRRAHMAVSVPALSKPAMARLAEIEAVRERGGKDAYKTAFAYAAEDRLFVQEVRGV
                     NDALNARFGWSAFTDKADTVAQRNMIERMPDDLDLDRREKLNRLFAAIRRFAEEQHLA
                     ERKDRSRIVTGASVVPGKETVPVLPMLAAVTEFETPIDHEARERARAVPHYSQNRAAL
                     ANAAARIWRDPAGAVGKIEDLILKGFAGERIAAAISNDPAAYGALRGSGRIMDKLLAV
                     GQERKEAFRAVPEAASRVRLLATSFRAAFDAEREAITEERQRMSIAIPGLSPSAEDAL
                     RELSVAMKKKNGRLDVAAGSLDPAISKEFATVSRALDERFGRNAILRGELDVINRVPP
                     AQRRAFEVMREQLKVLQQVVRMQASQNIVAERHRLVLDRARGVILFNQ"
     gene            121018..122340
                     /locus_tag="ATU_RS24485"
                     /old_locus_tag="AGR_pAT_166"
                     /old_locus_tag="Atu5112"
     CDS             121018..122340
                     /locus_tag="ATU_RS24485"
                     /old_locus_tag="AGR_pAT_166"
                     /old_locus_tag="Atu5112"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system HipA family
                     toxin"
                     /protein_id="WP_010974376.1"
                     /translation="MRLTLQTHFYGQWHHAATLELKDDAAGFQGASIVDYDLDYFVTV
                     ASAEFAGGKTVRDHRALSVRYPVDLENRYSRSWPPFLLDLMPQGHARRKLAEHLSLAE
                     GSRASDLPLLLRSATGGIGNIRIKEAAEAETERLRGVERQGVTEAEILERSDRFMEVA
                     DRFGMLASGSSGLQGEWPKVSMTQAKDGLYYPDSFVTDDEAVRHVIVKLVRSNEPVDR
                     LILEGEALYSRIAQEIGLNVHEPSTYAESVLIIPRFDRKKKEGGGTVRLGQESLVSAI
                     GVADFGHVGSHEAYIDVLRQYSANPFADIVEYLKRDIANLALGNPDNHGRNSALSKHQ
                     DGTIRLSPLFDFAPMRIAKEGIVRSTRWAMMRDGGRDHLPDWKRICAELIPDPDEQNA
                     LAAELSVFAEYLRQTPAMAKDMGGSPEILERAIGRCIEIAESVLAACQ"
     gene            122358..122636
                     /locus_tag="ATU_RS24490"
                     /old_locus_tag="Atu5113"
     CDS             122358..122636
                     /locus_tag="ATU_RS24490"
                     /old_locus_tag="Atu5113"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_010974377.1"
                     /translation="MARWRKPTKEEILENRRTLAERARTGDLRLPEAVVEIRRGLGLT
                     QDEFAKTLSLTRRQVAEIEAGTANPTLETLGKVGRLFGFTVGFIPKAQ"
     gene            122633..>122915
                     /locus_tag="ATU_RS24495"
                     /pseudo
     CDS             122633..>122915
                     /locus_tag="ATU_RS24495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018095604.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit R"
     gene            123115..123273
                     /locus_tag="ATU_RS24500"
     CDS             123115..123273
                     /locus_tag="ATU_RS24500"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_155276036.1"
                     /translation="MKASNFSDAQKSFIFKQGDDGVPVAEICRKAGKGNFTNLSAMPL
                     TRLSFRES"
     gene            complement(123338..123649)
                     /locus_tag="ATU_RS24505"
                     /old_locus_tag="AGR_pAT_169"
                     /old_locus_tag="Atu5116"
     CDS             complement(123338..123649)
                     /locus_tag="ATU_RS24505"
                     /old_locus_tag="AGR_pAT_169"
                     /old_locus_tag="Atu5116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2218 domain-containing protein"
                     /protein_id="WP_010974380.1"
                     /translation="MAKHISETFVSIPNSDRTIDLLCAALRCWSFSTTTNHSERLLTF
                     DDGRVIITNLDGSLHLRVEAEDPLILLGMRSVLQAALYKVATSMLPNVEWHRADGEPL
                     E"
     gene            complement(123961..124902)
                     /locus_tag="ATU_RS24510"
                     /old_locus_tag="AGR_pAT_170"
                     /old_locus_tag="Atu5117"
     CDS             complement(123961..124902)
                     /locus_tag="ATU_RS24510"
                     /old_locus_tag="AGR_pAT_170"
                     /old_locus_tag="Atu5117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HEPN domain-containing protein"
                     /protein_id="WP_010974381.1"
                     /translation="MKTSLDHIPPQIQTELQRALEIIHEEFEDALEGGTAKFKKRGRI
                     LKIILFGSYARGTQVDEPFTSKGYRSDFDLLVIVNNRKLTDFAEYWYKAADRLIRDKM
                     IKRPVQIIVHSLREVNTSLQESQHFFSDIRKEGIALYELDDKPLAEPKTLTPEEQLRV
                     AKEHFEKRFGAGRNFAALSDAALQKGMISEAAFLLHQAIEQAYASVLLTLTNYTPASH
                     NLKVLRSFAEERDRRLIEAFPRDHHRERAWFNTINEAYVKARYSSQYKISQEALDWIG
                     ERATLLLSLVGEVCRDHISALERDAGREIAEQGAAEE"
     gene            complement(125065..126306)
                     /locus_tag="ATU_RS24515"
                     /old_locus_tag="AGR_pAT_173"
                     /old_locus_tag="Atu5118"
     CDS             complement(125065..126306)
                     /locus_tag="ATU_RS24515"
                     /old_locus_tag="AGR_pAT_173"
                     /old_locus_tag="Atu5118"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class I/II-fold pyridoxal
                     phosphate-dependent enzyme"
                     /protein_id="WP_010974382.1"
                     /translation="MSTDKTQQHASRNTGGLIDHAQDYFNAAHQQGLMALYARPRAAR
                     QVDIVFDGFPSQRITDFVRCSYLGLDNHPLIIDGAIKAIEEYRALHWSCARTRLNFAI
                     LRDLENSLSDLFQARVITYTTVLAANMGALPIVASGHLTGGIRPMMVFDRHAHATLAF
                     HKGTIALETQVRTLAHNDLDALEELCRSNRAVAYVCDGVYSMGGNAPIRDLRYLQDRY
                     GLFLYIDDAHGVSICGKNGEGFVRSQYGNELGERTIIAASLGKGFGASGGMLMLGTAR
                     QEELFRRFAVAHAFSASLNVAAIGAVSGSLTIHRSDELLRRQLALSSNIALLDSMLVT
                     EQSGAPLPIRTVNLGTEERAVNGTRALLDRGIYGSAIFFPTVAKGKAGIRVCVTSDHT
                     PEEITGLCTALSEIMDDQAIS"
     gene            complement(126432..127157)
                     /locus_tag="ATU_RS24520"
                     /old_locus_tag="AGR_pAT_174"
                     /old_locus_tag="Atu5119"
     CDS             complement(126432..127157)
                     /locus_tag="ATU_RS24520"
                     /old_locus_tag="AGR_pAT_174"
                     /old_locus_tag="Atu5119"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_010974383.1"
                     /translation="MQHGIETKAAVAILTENADYYAMLKHILSTEGTRAVLCDRNEIG
                     DKVAQPDIVGLILDVDRDHHGAAIICQRIKSCDKTEKLPVLAIIPNGDTEAYMELMRA
                     GADQCLIRPFWPPHLLGFLEGINPVRQQPVATTSQNASLKLGEIELWPERKRVLVSGV
                     ELTLGPIEFKLLEHLLTAPGRVFSRDELITAAWPNEVYVQPRTVDVHIGRIRRHLKKA
                     AGFDIIRTARSSGYAIDVAAQPA"
     gene            127478..127693
                     /locus_tag="ATU_RS24525"
                     /old_locus_tag="AGR_pAT_176"
                     /old_locus_tag="Atu5120"
     CDS             127478..127693
                     /locus_tag="ATU_RS24525"
                     /old_locus_tag="AGR_pAT_176"
                     /old_locus_tag="Atu5120"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974384.1"
                     /translation="MRSWKSTGIAHSAGDDILTSCDEADATAIARVIFGTDAALAVAF
                     SAIDARLDGRDRDFLFWARVFRSLADV"
     gene            complement(127712..128380)
                     /locus_tag="ATU_RS24530"
                     /old_locus_tag="AGR_pAT_177"
                     /old_locus_tag="Atu5121"
     CDS             complement(127712..128380)
                     /locus_tag="ATU_RS24530"
                     /old_locus_tag="AGR_pAT_177"
                     /old_locus_tag="Atu5121"
                     /inference="COORDINATES: protein motif:HMM:NF012698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_162180317.1"
                     /translation="MRHSILIHTTDPELYLILRYILEQAGHDVDLLPSLDMFLPDEAN
                     SQPHRRTVLICLAMDDLLRSAVLIKKEQPDIRVVGFPLDNKKMGGVQSSVFDYLVRRP
                     FDPGNLLEFLKFGLRCNTTAPTDVSVFLDDVEINVASVRVRRGETHISLSPLHFRILL
                     YLARNTDRVVSRDELIRNCWPEDADVEPRTVDIHIGKIRRSLNRHGHNVIRTVRSAGY
                     SATK"
     gene            complement(128425..129204)
                     /locus_tag="ATU_RS24535"
                     /old_locus_tag="AGR_pAT_178"
                     /old_locus_tag="Atu5122"
     CDS             complement(128425..129204)
                     /locus_tag="ATU_RS24535"
                     /old_locus_tag="AGR_pAT_178"
                     /old_locus_tag="Atu5122"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_010974386.1"
                     /translation="MTRDRQSRVAVVAGGTSGIGLSVARHLLGIGHKVAVFGQTESAA
                     KAARSSFEAEITSNQLLVGCCDVRNPGEVADFFRDVETLWSSTALLVYCAGISPKATD
                     GVAKRFTSVDLDEWNDVLDVNLTGAMLCCQAALPGMVDKGFGRIVLIGSLAGRTRPMI
                     AGAAYAASKAGLAGLARALVSEFSADGITINVAAPGRILTPMAGTAATSVNLEAVKRI
                     PTRRLGEAEEVARLVGFLVSDEAAFINGAIIDINGGEYTPA"
     gene            complement(129201..130916)
                     /locus_tag="ATU_RS24540"
                     /old_locus_tag="AGR_pAT_179"
                     /old_locus_tag="Atu5123"
     CDS             complement(129201..130916)
                     /locus_tag="ATU_RS24540"
                     /old_locus_tag="AGR_pAT_179"
                     /old_locus_tag="Atu5123"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637369.1"
                     /note="catalyzes the formation of 2-acetolactate from
                     pyruvate, leucine sensitive; catalytic; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase"
                     /protein_id="WP_010974387.1"
                     /translation="MDTAVHETTVAERIAKALRRHDVEVIFGQSLPSAVILAAEKIGI
                     TQIAYRQENMGGAMADGYARRSGKIGIVAAQNGPAAALLVAPLAEALKASVPVVALVQ
                     DVERDQTDRNAFQDLDHIGLFQSCTKWVRRVSVEERIDDYIDAAFTAASSGRAGPAVL
                     LLPADLLRSVSTTPSRRRTNNLGHWPLDRSRPADKDLDIAAKAIANARAPVVIAGGGI
                     HASGAAQQLRLLQDECSIPVFTTNMGKGSVDEWHPLSGGVLASLVGPKSLGRHTVEIV
                     READLVVLIGTRTNQNGTDNWRQYSPDAQIIHIDTDPQEVGRNFEAIRLVGDARETLA
                     GLRERIRLCDLHLRTVSREAVCNRLRESWRKFNDDRRGYYSSEASPLRPERIMAELQG
                     VIDENTTVVADASYSSMWVLGQLRISSERTRVLTPRGLAGLGWGVPLAIGAKVAAPES
                     DVVALVGDGGFAHSWAELETLVRMQIPITIIVLNNGILGFQRDAETVKFGKYTTACHF
                     AEVDHVKIAHACGCDAVRVTQPQDLKAHMQKVKKRKLPLLIEAMTDPEAHPALSLFAQ
                     MDSAA"
     gene            complement(130916..132250)
                     /locus_tag="ATU_RS24545"
                     /old_locus_tag="AGR_pAT_182"
                     /old_locus_tag="Atu5124"
     CDS             complement(130916..132250)
                     /locus_tag="ATU_RS24545"
                     /old_locus_tag="AGR_pAT_182"
                     /old_locus_tag="Atu5124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="WP_010974388.1"
                     /translation="MLSSSNTPLTGPNDRQTSIAFFERASTVFPGGVTRATIELDPHP
                     IFVAYGEGAFVTDVDGHRMLDLNNNFTTLIHGHAYPPITEAIAGLLRTGSCFANPMNH
                     EIDLAELLVGRIPAVEQVRFVASGTEAVMFAIKAARATTGRVAIARVEGAYHGAYDWA
                     EAGQHASSNTPCAAYPGMPASVIDDVVLLQFNCPAELEQQIAMNAGRLAAILIDPMPS
                     RAGLIEPTEEFIATINKVAKQHGIVIIADEVLNLRQGFAGASARYGLKPDLVTMGKII
                     GGGFPIGAVGGRREIMSAFGKQGSKAPLTQGGTFAANPVSMVAGRLAMEALTQDAFQR
                     LEHMGNLVREGLRSRIERHGANLSVTGAASLFRIHAKKVAPVSYQDSIPTASEDVVLK
                     LLRRHFANNGILMPYGAAASLSTPMTDNDMGDIVSVFDDFLVNLDRHAWEAA"
     gene            complement(132365..133054)
                     /locus_tag="ATU_RS24550"
                     /old_locus_tag="AGR_pAT_183"
                     /old_locus_tag="Atu5125"
     CDS             complement(132365..133054)
                     /locus_tag="ATU_RS24550"
                     /old_locus_tag="AGR_pAT_183"
                     /old_locus_tag="Atu5125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_010974389.1"
                     /translation="MIDILRDESDTGAQGQRMGSMVYDVLRERMIRGSYPPGHKFTVR
                     GIASELDVSTTPARDALNRLTTESVLVFSGPKTLIVPTLTKAELRDITVTRIALEGTA
                     AEYGARNPDEATNRKLIDIQRVINENLAAGRYHDALWHNKEFHFAIYNLSGLTGLLSM
                     IETLWARIGPTLLNLYPEYAQNRQGVHNHMVAIEALIDKDPAGVRAAIENDIREGYRK
                     LRNAVSVTDEL"
     gene            133260..134372
                     /locus_tag="ATU_RS24555"
                     /old_locus_tag="AGR_pAT_185"
                     /old_locus_tag="Atu5126"
     CDS             133260..134372
                     /locus_tag="ATU_RS24555"
                     /old_locus_tag="AGR_pAT_185"
                     /old_locus_tag="Atu5126"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010974390.1"
                     /translation="MIGETLNLDGLAKSYGNVVAVAGVDVRVEPGEFVSVLGPSGSGK
                     TSVLTMIAGFERPTAGRIVIGDRDVTDLAPNKRNIGMVFQKYALFPHLTVRQNIAFPL
                     KLRSRWRSGWRQRADDMLDLVHLAGFADRFPSELSGGQQQRVAVARALAFEPPVMLMD
                     EPLGALDKKLREAMQFEIKRIQRQVGATVLYVTHDQEEALTMSDRVAIMQGGNIVQIG
                     APSSLYHAPATRFVADFVGKMSFVGGEIVSFEDDGMLVRLADDVFVRTASVDAARAAL
                     RLGDEVILAMRPERIALKKRGPRGFGAIPAQIESLAFVGSFHAYMVRLDLPGSPLVEV
                     QVVTGSEVNFRAGDTVDLVPDPQAVSFFSKEETSAA"
     gene            134369..135271
                     /locus_tag="ATU_RS24560"
                     /old_locus_tag="AGR_pAT_188"
                     /old_locus_tag="Atu5127"
     CDS             134369..135271
                     /locus_tag="ATU_RS24560"
                     /old_locus_tag="AGR_pAT_188"
                     /old_locus_tag="Atu5127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974391.1"
                     /translation="MSASSLASRAIANLQSVMFSTPSAKTYSHAGALLLLLPAALMLL
                     TGFVYPLARLVALSMPDMSLELYIRIFRDPLYLNVLFSTTVVALAVMCCCLLLGFPVA
                     NAMVRLKHPWTLILTGCVLIPLWTSVLVRSYAWIVLLQRTGIINQALLSTKLIDEPLR
                     MIYTQGAVIVAMTHVLLPFMIMPIFAALRAIPPEYVQAAMNLGSTRLHAFRAIIVPLS
                     LPGIFAGCVISFVLALGFYVTPALVGGAGSLMVATLIGQQTTVLLDWPFAAALSTSLL
                     VVTLAVVIIFRRTLSLSKGLNSGI"
     gene            135351..136118
                     /locus_tag="ATU_RS24565"
                     /old_locus_tag="AGR_pAT_189"
                     /old_locus_tag="Atu5128"
     CDS             135351..136118
                     /locus_tag="ATU_RS24565"
                     /old_locus_tag="AGR_pAT_189"
                     /old_locus_tag="Atu5128"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008529720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease subunit"
                     /protein_id="WP_162854814.1"
                     /translation="MYTAGFFVFLITVFLILPTFLVVPMSLNDGSYLAFPPQGLTLKW
                     YRAYFSDPDWMSATLFSLQVAFATAIVATTIGTTAALALAKSRLPFKGLLQSLALGPM
                     IVPHVVLGVSLYLVFSPWRVTGTFAGFVLAHTVLAIPYVMIVVGAAVQKFDPSLELAA
                     LNCGANRFQSFFLVMLPNIGPSVAAASVFAFLASFDDATVSFFISDIGGKSIGRKMFE
                     DIDFNLTPVIAAASTVLVAISLVLMTAAQLLTTRSRH"
     gene            136146..137228
                     /locus_tag="ATU_RS24570"
                     /old_locus_tag="AGR_pAT_190"
                     /old_locus_tag="Atu5129"
     CDS             136146..137228
                     /locus_tag="ATU_RS24570"
                     /old_locus_tag="AGR_pAT_190"
                     /old_locus_tag="Atu5129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_010974393.1"
                     /translation="MIRSDQTPKACLKSAFYVFVAFALMFALGLEKASAEQRVVIATT
                     GGTYEKALREAWFEPFTKATGIKVVTVSGTDAEKRAKVTAMVQTGNVTWDLYLDGEIQ
                     AGSDAHFAITEDLSDFCMQFINSTDLLADSCTRGGAKLQSTSTLLAYKLNENGSNPQT
                     WADMWDLAKFPGARSFPNFDDPWRVLAAALLADGVPREKLFPLDVDRAFRKLDELRDS
                     VQVWWRTGDQSVQAFRNDEYRVGQIWLTRAKALKAEGYKIGWSYDGAFLVGDRIALVR
                     GAPNRENALKLIEFWLRNPAAQAKACETLSCTPPSQKAISQMSSEARATLPSAADVEN
                     RIIVPDAQWINANMGMLVQRWNSWIR"
     gene            137714..138373
                     /locus_tag="ATU_RS24575"
                     /old_locus_tag="AGR_pAT_191"
                     /old_locus_tag="Atu5131"
     CDS             137714..138373
                     /locus_tag="ATU_RS24575"
                     /old_locus_tag="AGR_pAT_191"
                     /old_locus_tag="Atu5131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_035256994.1"
                     /translation="MVLSLSGIKKSYQTAEGNIPVLNGVDLSLEAGESLALTGESGSG
                     KSTLLHLAGGLDLPDSGIITVRGRKITDLDEAGRASFRRREVGLIFQQFNLIPSLDVG
                     SNISFHARLAGRFDPVWEKSLVEALGIGELLARYPEQLSGGQQQRVAIGRTLAARPPL
                     ILADEPTGNLDETTADIVIDLMLRLTKSAQITLLLVTHSSRLAVKLDRRLALSGGKVS
                     Q"
     gene            138370..140777
                     /locus_tag="ATU_RS24580"
                     /pseudo
     CDS             138370..140777
                     /locus_tag="ATU_RS24580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517321.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
     gene            140767..141834
                     /locus_tag="ATU_RS24585"
                     /old_locus_tag="AGR_pAT_195"
                     /old_locus_tag="Atu5134"
     CDS             140767..141834
                     /locus_tag="ATU_RS24585"
                     /old_locus_tag="AGR_pAT_195"
                     /old_locus_tag="Atu5134"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_010974398.1"
                     /translation="MNAKAILLLLCASCTSLPTPVMGQGFAGLGSNAEGFSIPTRGVE
                     LVFPKDHKPHPGFKIEWWYVTANLQTADGQRMGVQWTLFRSALEPVERPGWSDPQIWI
                     GHAAVTTASRHHVAERLARGGVGQAGVKGEPFDAWIDNWQMKAGTDDARDDLDQIDLN
                     ANGESFRYRLKLQAHGPLVRQGDNGYSVKSAEGQASYYYSQPFYSVSGSVFLDGETHE
                     VTGEAWLDREWSSQPLASSQTGWDWFSLHLASGEKLMAFRLRDDKSGYISANWISADG
                     RASPVDPDDVLLSPLRTADINGKSVPVEWSVKIPSRGLDIKTKPLNEKAWMATSTPYW
                     EGPIEFDGSTSGQGYLEMTGY"
     gene            complement(142352..143143)
                     /locus_tag="ATU_RS24590"
                     /old_locus_tag="AGR_pAT_196"
                     /old_locus_tag="Atu5136"
     CDS             complement(142352..143143)
                     /locus_tag="ATU_RS24590"
                     /old_locus_tag="AGR_pAT_196"
                     /old_locus_tag="Atu5136"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator BlcR"
                     /protein_id="WP_035256997.1"
                     /translation="MAEDQQSSQISDTVPALRRAVRILDLVAGSPRDLTAAELTRILD
                     LPKSSAHGLLAVMTELDLLARSADGTLRIGPHSLRWANGFLSHLDIVSTFNDHLAQRH
                     DLDPYTVTLTVREGGEVVYIGCRNSAQPLGHTFRIGMRLPAPFTATGKILLSDLGPGE
                     LRMLFSQFPQPLTSRSVAGLSQLEEELALTRARGYSIDDGQIREGMLCIGAAIRDYSG
                     AASAGIAISLIRSEASDEKIASLGEELRTTANALSEKLGYRSQKD"
     gene            143235..144689
                     /locus_tag="ATU_RS24595"
                     /old_locus_tag="AGR_pAT_197"
                     /old_locus_tag="Atu5137"
     CDS             143235..144689
                     /locus_tag="ATU_RS24595"
                     /old_locus_tag="AGR_pAT_197"
                     /old_locus_tag="Atu5137"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020811857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent succinate-semialdehyde
                     dehydrogenase"
                     /protein_id="WP_010974400.1"
                     /translation="MIKLKNAALLRDACLVNGRWLKAADGKTIAVENPANSMIIGHVP
                     SLSADEVKAAVESAGKAFSEWSRRSAKDRAAILRRWFDLMVANADDLGALMTAEQGKP
                     FAEAKGEALYAASFVEWFAEEAKRVYGDTIPSPTTDKRITILKQPIGVCAAITPWNFP
                     AAMITRKAAPALAAGCAMIVKPAEQTPLTALALGVLAEEAGVPAGVFQVVTGAARDIG
                     KVFTESDTVRKISFTGSTEVGRLLMAQSAPTIKKLSLELGGNAPFIVFDDADLDAAVE
                     GAIVSKYRNAGQTCVCSNRIYVQDGVYDAFAEKLVKRVESLSVGEGTEPGVLIGPLID
                     QEAVAKVEDHVADALGKGAKIVIGGKRHALGGTFYEPTVLTGATQAMKVAREETFGPV
                     APLFRFGTEDEAVAMANDTEFGLAAYFYTENVRRTWRVAEALEYGMVGHNTGLISNEV
                     APFGGVKQSGLGREGSHYGIDEYLEIKYLCSAIG"
     gene            144710..145870
                     /locus_tag="ATU_RS24600"
                     /old_locus_tag="AGR_pAT_199"
                     /old_locus_tag="Atu5138"
     CDS             144710..145870
                     /locus_tag="ATU_RS24600"
                     /old_locus_tag="AGR_pAT_199"
                     /old_locus_tag="Atu5138"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020811856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-containing alcohol dehydrogenase"
                     /protein_id="WP_010974401.1"
                     /translation="MTINPFEFRTVPSMQVAWGGAHRLGEILSGRFQARKALLITDAG
                     LIKAGLIKPIADALAASGFNVTIFDKVVADPPEHIVADCVESARQIGVDIVIGLGGGS
                     SLDIAKLVAVLLVSDQTLADMYGIGNVKGSRLPLVLVPTTAGTGSEVTNISIITTGET
                     TKMGVVSPQLYADFVLLDAELTVGLPQVHTAATGIDAMVHAIEAYTSKHKKNPLSDAL
                     AREALRLLGANLIAACRNGADRKAREGMLLGATLAGQAFANSPVAAVHALAYPLGGHY
                     HVPHGLSNALMLGPVLRFNAKAAASLYAELADVLGVPGEGDAATRSDAFVQHMETLMD
                     ESGAPRRLRDVGVTDNTLAMLASDAMKQSRLLVNNPVEVREEDALALYREAF"
     gene            145916..146707
                     /locus_tag="ATU_RS24605"
                     /old_locus_tag="AGR_pAT_200"
                     /old_locus_tag="Atu5139"
     CDS             145916..146707
                     /locus_tag="ATU_RS24605"
                     /old_locus_tag="AGR_pAT_200"
                     /old_locus_tag="Atu5139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acyl homoserine lactonase family protein"
                     /protein_id="WP_019565706.1"
                     /translation="MTDIRLYMLQSGTLKCKVHNIKMNQGNGADYEIPVPFFLITHPA
                     GHTVIDGGNAIEVATDPRGHWGGICDVYWPVLDKDQGCVDQIKALGFDPADVKYVVQS
                     HLHLDHTGAIGRFPNATHIVQRSEYEYAFTPDWFAGGGYIRKDFDKPGLKWQFLNGAQ
                     DDYYDVYGDGTLTTIFTPGHAPGHQSFLVRLPNSKPLLLTIDAAYTLDHWEEKALPGF
                     LASTVDTVRSVQKLRTYAEKHDATVVTGHDPDAWANFKKAPEFYA"
     gene            complement(147042..147758)
                     /locus_tag="ATU_RS24610"
                     /old_locus_tag="AGR_pAT_202"
                     /old_locus_tag="Atu5140"
     CDS             complement(147042..147758)
                     /locus_tag="ATU_RS24610"
                     /old_locus_tag="AGR_pAT_202"
                     /old_locus_tag="Atu5140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019565707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_010974403.1"
                     /translation="MTQDFAAKFDASRAGEYARQSRIALAGYDACHELSACMLSAALG
                     EGTAARVLVVGAGGTAGEIIAAARLEPQWSFVAVDPSAPMLNLARDHLVRAEVSDRVE
                     TVLGTVSDLDRAPSFDAAIMIGVLHHLPGNAAKQDVLAQIAMRLYPDAPLIVAGNYRA
                     YASQPLLMAAWAARWRMNGAGPEEVQAKMGKILQGAEPPRSEDEVISLLEGVGFNEPL
                     RFFAGLFWGAWLARHVGNAK"
     gene            147842..148606
                     /locus_tag="ATU_RS24615"
                     /old_locus_tag="AGR_pAT_203"
                     /old_locus_tag="Atu5141"
     CDS             147842..148606
                     /locus_tag="ATU_RS24615"
                     /old_locus_tag="AGR_pAT_203"
                     /old_locus_tag="Atu5141"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_010974404.1"
                     /translation="MTESSDSGRKHDRLTAFLKAFHLGASRCDCAEAANLLIINVHGA
                     GEPTHLLYRARSTASLPDGAAICAGATVDFGGSANPLVGALPDELCLSLANEPELRGL
                     CQLMVAEVEVARCGGGTIEARLCEIIVVLAIRKAIAIGTVDAGLLAGLAHPGLHPSLV
                     AIHDNPARNWRIADLAAIADMSRGQFISTFTQTVAQSPIAYLNGWRLALGRAELRAGR
                     SVKSVATGVGFGSAAAFSRAYSRKFGSPPAQSKPRP"
     gene            148603..148796
                     /locus_tag="ATU_RS26630"
                     /pseudo
     CDS             148603..148796
                     /locus_tag="ATU_RS26630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517301.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            149482..150114
                     /locus_tag="ATU_RS24620"
                     /old_locus_tag="AGR_pAT_204"
                     /old_locus_tag="Atu5143"
     CDS             149482..150114
                     /locus_tag="ATU_RS24620"
                     /old_locus_tag="AGR_pAT_204"
                     /old_locus_tag="Atu5143"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CatB-related O-acetyltransferase"
                     /protein_id="WP_019565710.1"
                     /translation="MSLLDPDAIHPITLPDGRVYSDTVYLKNVVDHPRIEVGEYSYFT
                     HSGTPEETAQILAPYLGHTCRERLLIGKFVQIAKGCYFITSSANHPMTGFTTYPFRIF
                     KPETFGYKELPVKDTVVGHDVWIGHNAAIMPGVRIGAGAIVAAASVVARDIPPYAVVG
                     GNPATVIRMRYPAEVIDVLLHIAWWDWPIEKIEANLASLSNGDLDALKIA"
     gene            150245..151000
                     /locus_tag="ATU_RS24625"
                     /old_locus_tag="AGR_pAT_205"
                     /old_locus_tag="Atu5144"
     CDS             150245..151000
                     /locus_tag="ATU_RS24625"
                     /old_locus_tag="AGR_pAT_205"
                     /old_locus_tag="Atu5144"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S9 family peptidase"
                     /protein_id="WP_003517297.1"
                     /translation="MAEVTEHTIDRGDGARVQLFQARASDRRNGAILFVHGNQGGLLL
                     GGQEAVEDGSLVRFSSRLGITAAAVSQPGFGTSDGPADFCGPSTQKAIVAALDFLKRQ
                     PSVDPERIVLYGNSRGAVASAMVATKVADLKAIILTGGVYDLRDAYKTSARGLQEAIR
                     NEAGISDEAFLDRSALYHAHSIRSETLLLHGKYDDRASVDQAERFSEALARSGVPVRF
                     HALDGGHRLPRDQVTPILRDFLTRVFAPMATIH"
     gene            complement(151070..151498)
                     /locus_tag="ATU_RS24630"
                     /old_locus_tag="AGR_pAT_bx82"
                     /old_locus_tag="Atu5145"
     CDS             complement(151070..151498)
                     /locus_tag="ATU_RS24630"
                     /old_locus_tag="AGR_pAT_bx82"
                     /old_locus_tag="Atu5145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_026330850.1"
                     /translation="MEQSQYSTASRLPTVEEYLHLRSVAGLSAFSPEAARLGLTGTVY
                     SVVVMHRGAAIGMGRLIGDGGCFFQVVDIAVHPDHQGRGLGKTIMQTIMSYVSRKLPV
                     SAYVSLIADVPANKLYEKFGFKETAPRSLGMAYRVTSAEP"
     gene            151911..152411
                     /locus_tag="ATU_RS24635"
                     /old_locus_tag="AGR_pAT_bx97"
                     /old_locus_tag="Atu5147"
     CDS             151911..152411
                     /locus_tag="ATU_RS24635"
                     /old_locus_tag="AGR_pAT_bx97"
                     /old_locus_tag="Atu5147"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012207634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MgtC/SapB family protein"
                     /protein_id="WP_026330851.1"
                     /translation="MGDEVWGTLVKEFSDVPDASAITRITVRLVIAAVLGGVLGFERE
                     SKGRSAGLRTHMLVAVGAALFVLGPLQSGMQIGDLSRVLQGVVQGIGFLGAGAIIIRS
                     AQREVEGLTTAASIWATAAIGVMAGLGMEVTAVLSTAIVLVILAAVPHILPTPSETDS
                     KSIGDD"
     gene            complement(152495..152899)
                     /locus_tag="ATU_RS24640"
                     /old_locus_tag="AGR_pAT_208"
                     /old_locus_tag="Atu5148"
     CDS             complement(152495..152899)
                     /locus_tag="ATU_RS24640"
                     /old_locus_tag="AGR_pAT_208"
                     /old_locus_tag="Atu5148"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC family protein"
                     /protein_id="WP_010974410.1"
                     /translation="MVRSVIELRNVAGTEAAMGWAGGHTVVIDRPEGKAGGLGLGFNG
                     GQMLALAIGGCYCNDLRYVAHERGVKIEQIAVTATLDLEGVPLVATKAVLSVKCETSD
                     GSDPKALIDHAWSVCTVANSLNRGIPTIIQVA"
     gene            complement(153120..153662)
                     /locus_tag="ATU_RS24645"
                     /old_locus_tag="AGR_pAT_bx76"
                     /old_locus_tag="Atu5149"
     CDS             complement(153120..153662)
                     /locus_tag="ATU_RS24645"
                     /old_locus_tag="AGR_pAT_bx76"
                     /old_locus_tag="Atu5149"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_010974411.1"
                     /translation="MLTEVFCHTVLAAIADECSHKVSQMQIRNASKEDALRCVELVEA
                     RRKEYENYEPRFWKKAANSAASTLSWFEKLFSDEHNVSLVAVENTLIVGFLIAREFPT
                     PQVYDPGGATALIDDFCVAAKDRWHDAGAALLQRAKSELNRRGFAQVVVVGAQRDAAK
                     TALLSQANLSLASTWWTSEV"
     gene            complement(153739..154374)
                     /locus_tag="ATU_RS24650"
                     /old_locus_tag="AGR_pAT_209"
                     /old_locus_tag="Atu5150"
     CDS             complement(153739..154374)
                     /locus_tag="ATU_RS24650"
                     /old_locus_tag="AGR_pAT_209"
                     /old_locus_tag="Atu5150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase family protein"
                     /protein_id="WP_003517288.1"
                     /translation="MKLYYMPAACSLSPHIVANELELDIEFVRVNFKDHKTEGGQDYY
                     DINPNGYIPALDVGNGAMLFEGPAIVQYMADLKPQSGLAPANGTFERYKLQEMLSFLS
                     TEIHKGFIPLLYAKQAGAYLETATPKLEKRYAWIDNLLASQRFLMGENFTVADAYLFA
                     LTSWGQASWLKSYYGADIHFDDLLNLRGWYERVKERDAVKQSILEEGLSLS"
     gene            154517..154840
                     /locus_tag="ATU_RS24655"
                     /old_locus_tag="AGR_pAT_210"
                     /old_locus_tag="Atu5151"
     CDS             154517..154840
                     /locus_tag="ATU_RS24655"
                     /old_locus_tag="AGR_pAT_210"
                     /old_locus_tag="Atu5151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008003162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_003517287.1"
                     /translation="MKDTVTGCSVELAMHLLGGRWRLLIASYLIDGPKRFNELRRLIP
                     GISQRMLSLDLRALEDASLIARTVYPTVPVKVEYALTEEGRRLGKVVAVVQEFGLWLK
                     DRNAS"
     gene            155467..155979
                     /locus_tag="ATU_RS24660"
                     /old_locus_tag="AGR_pAT_212"
                     /old_locus_tag="Atu5154"
                     /pseudo
     CDS             155467..155979
                     /locus_tag="ATU_RS24660"
                     /old_locus_tag="AGR_pAT_212"
                     /old_locus_tag="Atu5154"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517283.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
     gene            156102..156536
                     /locus_tag="ATU_RS24665"
                     /old_locus_tag="AGR_pAT_213"
                     /old_locus_tag="Atu5155"
     CDS             156102..156536
                     /locus_tag="ATU_RS24665"
                     /old_locus_tag="AGR_pAT_213"
                     /old_locus_tag="Atu5155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /protein_id="WP_010974414.1"
                     /translation="MTEPTPEQIEKLATAFERFTRRFKVAEAAAVMQNSLNPLDIQAL
                     LFIDEHPECNLGDVARHLQVALTTMSSSADRLVRREMIERQRPEANRRSVALTITDKG
                     QQVVAGYIDGYRASCKAMLRALDTVDQTEFLRITQQIAKYEG"
     gene            156573..157337
                     /locus_tag="ATU_RS24670"
                     /old_locus_tag="AGR_pAT_214"
                     /old_locus_tag="Atu5156"
     CDS             156573..157337
                     /locus_tag="ATU_RS24670"
                     /old_locus_tag="AGR_pAT_214"
                     /old_locus_tag="Atu5156"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_035257007.1"
                     /translation="MIRDVIMTHTPPTALVTGANKGIGLAIARQLGAAGHTVWLGCRD
                     MSRGEMAAFELRENGVDARAVQLDVTDDASASSAAKTIESEVGHLDVLVNNAGLMFGS
                     PPSLAEESIDEIQQMFNTNVFGVMRVTQAFLPLLRKSKAARIVMMSSGLSSLTDALDM
                     RSETWTVGFGGYCASKTALNMLTVKLAKELDREGIKVNAVDPGLTSTDMTGNGPGHSP
                     EDGARPAFALATTHAYGPTAGFYACAPSGELVQKSW"
     gene            complement(157500..157887)
                     /locus_tag="ATU_RS24675"
                     /old_locus_tag="AGR_pAT_bx154"
                     /old_locus_tag="Atu5157"
                     /pseudo
     CDS             complement(157500..157887)
                     /locus_tag="ATU_RS24675"
                     /old_locus_tag="AGR_pAT_bx154"
                     /old_locus_tag="Atu5157"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315829.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(158745..159149)
                     /locus_tag="ATU_RS24680"
                     /old_locus_tag="AGR_pAT_216"
                     /old_locus_tag="Atu5159"
     CDS             complement(158745..159149)
                     /locus_tag="ATU_RS24680"
                     /old_locus_tag="AGR_pAT_216"
                     /old_locus_tag="Atu5159"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011662090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="host attachment protein"
                     /protein_id="WP_010974418.1"
                     /translation="MNLPQNTVVAVADGEKLSLFRNDGDAATVNLTALPDPAIDSSKI
                     SSGARHSRSSANPDDSQQDEDGFGAGVTDMLNKQVLEGKIKSLVIIAAPRTLGEMRKG
                     YHKSLSEVLIGELDKDLTGHSVQDIEKALAVA"
     gene            complement(159510..159872)
                     /locus_tag="ATU_RS24685"
                     /old_locus_tag="AGR_pAT_217"
                     /old_locus_tag="Atu5160"
     CDS             complement(159510..159872)
                     /locus_tag="ATU_RS24685"
                     /old_locus_tag="AGR_pAT_217"
                     /old_locus_tag="Atu5160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_010974419.1"
                     /translation="MASNLSERWQSQALSVFAVREILEKPIDGESAQSRIKQIGMMNI
                     LYLMHQAHQKLTLSNVIDITGMTRGGVIETIELLVRRGILTETLGRNSMGRGTARQFE
                     FSPQVFAALGGTTATGNA"
     gene            159966..160505
                     /locus_tag="ATU_RS26635"
                     /old_locus_tag="Atu5161"
     CDS             159966..160505
                     /locus_tag="ATU_RS26635"
                     /old_locus_tag="Atu5161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007823585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974420.1"
                     /translation="MKGLFFRMIIAASGSISLYTISERSARADEWGCQVILCLSNPGG
                     PTQYGECKPPVEKLWRWLAKGRPFPTCAGVGFQTSRPLYEPYYCNAGYRLSAGYGPRG
                     RDATCISTSLQAVSDSFCRRDRDGGDPNKGSVTSPRWQRVNGRYQCLANTVARPLVRE
                     KPRYVDLTIEGVATQRVWF"
     gene            160508..161194
                     /locus_tag="ATU_RS24690"
                     /old_locus_tag="AGR_pAT_218"
                     /old_locus_tag="Atu5162"
     CDS             160508..161194
                     /locus_tag="ATU_RS24690"
                     /old_locus_tag="AGR_pAT_218"
                     /old_locus_tag="Atu5162"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020811843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein AvhB1"
                     /protein_id="WP_010974421.1"
                     /translation="MPVVFSDFCQTFEPFLASDAVPGVAGFKSQLSPLDIRSDSSAPL
                     GRPETKPEVIKVATSFPVERREMHIGVEGIGPQELRRLNPSIPEAIELRLDQTSTGTQ
                     LDACFRVAVKVEAHPASGEQVPQSRRGRDDPSVGGVVNYGDQVRREIERLGPTVARFT
                     IGDTGKGLQTNVSANSSQADVVAEVVAENTPGEAHAISAASAWDVFKTRSRSSVLVFQ
                     DNQLELEQSE"
     gene            161191..161490
                     /locus_tag="ATU_RS24695"
                     /old_locus_tag="AGR_pAT_220"
                     /old_locus_tag="Atu5163"
     CDS             161191..161490
                     /locus_tag="ATU_RS24695"
                     /old_locus_tag="AGR_pAT_220"
                     /old_locus_tag="Atu5163"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018245406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TrbC/VIRB2 family protein"
                     /protein_id="WP_010974422.1"
                     /translation="MIISSRIRPVVASSVMAVAIIVTMVEPAFAQSAGIETVLQNIVD
                     MLTGNIAKLLAVIAVIVICIAWMFGYMDLRRAGFWIIGIGGIFGATELVNTIVGA"
     gene            161493..161834
                     /locus_tag="ATU_RS24700"
                     /old_locus_tag="AGR_pAT_222"
                     /old_locus_tag="Atu5164"
     CDS             161493..161834
                     /locus_tag="ATU_RS24700"
                     /old_locus_tag="AGR_pAT_222"
                     /old_locus_tag="Atu5164"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB3"
                     /protein_id="WP_010974423.1"
                     /translation="MVGGQTVFEEDTLFVACTRPAMIAGVTMEAMGFNIMVTTILYII
                     AGSIAYAFVGIVFHLIFKALVKHDHNMFRILLAWVETRGRSRNGAYWGGATLSPLRLT
                     RRFDERDIGIA"
     gene            161827..164208
                     /locus_tag="ATU_RS24705"
                     /old_locus_tag="AGR_pAT_223"
                     /old_locus_tag="Atu5165"
     CDS             161827..164208
                     /locus_tag="ATU_RS24705"
                     /old_locus_tag="AGR_pAT_223"
                     /old_locus_tag="Atu5165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014857962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VirB4 family type IV secretion/conjugal transfer
                     ATPase"
                     /protein_id="WP_035257085.1"
                     /translation="MPDIATLRSRELTPEAFIPYVRHIDETTIALESRTLMVMVALAG
                     VSFETADLLDINALHRDLNTLYRNIADERLAIWTHLIRRRDSDYPGGTFATPFSASLN
                     EKYRERMAREHLFRNDLYLTVLWSPARSPADKAGKLLSYLRRSKRLDTELDEEALKEL
                     KDKVVIVMAGLRSFEPRLLSLYEQEGMLFSEPSEVLHQLVGGRRERVPLTEGRVASAI
                     YSDRVIIGRETIEIRHEAESRFAGMLSFKEYPARTRTGMLDGVLNSPFELILSQSFCF
                     VSKADARVIMGRKQNQLVSSGDKAASQIDELDDAMDDLESNRFVLGEHHLTLSVFATT
                     LKELTDNLAKVRASLTNGGAVVAREDLGLEAAWWAQLPGNFRYRARSGAISSKNFAAL
                     SPFHSYPIGQKDGNEWGPAVALLKTASGSPYYFNLHYGDLGNTFMCGPSGAGKTVIVN
                     FMLSQLEKHDPHVVFFDKDRGADLYVRAAGGTYLPLKNGVPTGCAPLKALNLTPENKV
                     FLARWIGKLVGSGARELTVTELRDISGAIDGLADLPAERRTIGALRAFLNNTDPEGIA
                     ARLRRWEEGGPLGWVFDNVIEDIGFGDFGGSGKFIGYDMTDFLDNEEIRIPLMAYLFH
                     RVEQVIDGRRIIIVIDEFWKALQDEGFRDLAQNKLKTIRKQNGLMLFATQSPRDALNS
                     PIAHTIIEQCPTQIFLPNSRGNHADYVDGFKLTEREYELIARELSVESRRFVLKQGHN
                     SVVAELDLNGFDDELAILSGRTANVELLDAIRAEVGDDVENWLPIFQQRRSAS"
     gene            164208..164906
                     /gene="virB5"
                     /locus_tag="ATU_RS24710"
                     /old_locus_tag="AGR_pAT_224"
                     /old_locus_tag="Atu5166"
     CDS             164208..164906
                     /gene="virB5"
                     /locus_tag="ATU_RS24710"
                     /old_locus_tag="AGR_pAT_224"
                     /old_locus_tag="Atu5166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006472539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type DNA transfer protein VirB5"
                     /protein_id="WP_010974425.1"
                     /translation="MTSYRLHGVLLSAVLMLAAEGVSGQGIPVNDQAAIAKQIESIAQ
                     LKSQLDALNEQIGQARQLYGSLNKLTDMADVAEVLNDPAIRKALPFDFAAIEGLLKGN
                     GTGVFGDSASRFLEGNSTYRTDADDFYARELSRLQNKNAGQMSVGEQIYDAGTKRIDG
                     IDQLRGKISTAGDAKEIADLQARLQVEQAFLQTDVLRMEGLRMVQEAQNQVDEQRKAE
                     DWRQRMDNMKAALQ"
     gene            164903..165136
                     /locus_tag="ATU_RS24715"
     CDS             164903..165136
                     /locus_tag="ATU_RS24715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EexN family lipoprotein"
                     /protein_id="WP_003517253.1"
                     /translation="MKCTLIVLSLVLLSACSQEAERTHTVDEFVADTELLSRTITECR
                     NNPGALRQTPNCQNAEAAEVKLRLQNMRKALGG"
     gene            165141..166076
                     /locus_tag="ATU_RS24720"
                     /old_locus_tag="AGR_pAT_226"
                     /old_locus_tag="Atu5167"
     CDS             165141..166076
                     /locus_tag="ATU_RS24720"
                     /old_locus_tag="AGR_pAT_226"
                     /old_locus_tag="Atu5167"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein"
                     /protein_id="WP_010974426.1"
                     /translation="MYQVFEFIDGQFKRPLEIFVSDGTSNIAEWVAGPLTVAVTLYVV
                     LYGYLILRGSVQEPILDFAFRAMKLAIIVMLVKNAGEYQTYVTNIFFDVLPREIAQAL
                     NAGTAPSASTFDSLLDKGQASATDIWTRASWPIDIVTGVGGIMVIGVSFLVAGIGYVV
                     SLYARLALAIVLAIGPIFIALAMFQSTRRFTESWIGQLANFVILQVLVVAVGSLLISC
                     LDSTFTAIDSYSDVLMRPIAFCAIGIAALYIFYQLPGIASALASGGASLVYGYTTARD
                     AHEGMLARAASHTGRMIGRGARFARRAFGSRNAGV"
     gene            166112..166378
                     /locus_tag="ATU_RS24725"
                     /old_locus_tag="AGR_pAT_227"
                     /old_locus_tag="Atu5168"
     CDS             166112..166378
                     /locus_tag="ATU_RS24725"
                     /old_locus_tag="AGR_pAT_227"
                     /old_locus_tag="Atu5168"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020810109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974427.1"
                     /translation="MIKPALLIIFSATLVGCASMTYPLPNCDGYSRRPLNRPMWDWEG
                     GSKLQQQQSNTSSSTSLTPFVKEASETSAFAHLDIDGSYRRCEG"
     gene            166382..167053
                     /locus_tag="ATU_RS24730"
                     /old_locus_tag="AGR_pAT_228"
                     /old_locus_tag="Atu5169"
     CDS             166382..167053
                     /locus_tag="ATU_RS24730"
                     /old_locus_tag="AGR_pAT_228"
                     /old_locus_tag="Atu5169"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virB8 family protein"
                     /protein_id="WP_010974428.1"
                     /translation="MATTDNLKSYFDKARRFDQDRMIQVERSKRIAWSIAIVSGIVAA
                     VAVFAVACLTPLKTVEPFVVRVDNSTGIVDVVSALTSTAGTYDEAVTKYFAAKYVRAR
                     EGYVWSEAQENFRTIALLSTQAEQTRFAALYRGSNPQSPQNTYGRGATARIDIASISL
                     INQNVVSVRYMRTITRGEEVRTTHWVASITYSYANAPMSSTDRLVNPLGFVVSEYRAD
                     PEEVR"
     gene            167050..167904
                     /gene="virB9"
                     /locus_tag="ATU_RS24735"
                     /old_locus_tag="AGR_pAT_229"
                     /old_locus_tag="Atu5170"
     CDS             167050..167904
                     /gene="virB9"
                     /locus_tag="ATU_RS24735"
                     /old_locus_tag="AGR_pAT_229"
                     /old_locus_tag="Atu5170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019565728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type conjugative transfer protein VirB9"
                     /protein_id="WP_162180318.1"
                     /translation="MMRIPRIPALIVTLSMSPAFALEIPRGASQDSRIRFVNYQPYNI
                     TRVVGTLRSSVQVEFAADEEIAHVALGNSVAWEVAPAGNILFLKPRESQPVTNISVVT
                     TRRDGSTRSYQMELTARDGSVEAGQNTYFYVKYRYPGDDAELRRQQAASRALAAQAKD
                     ADNVLALHEAYGPRNWRYSSQGSQALEPQSVYDNGKITTFAFVGNQEMPAIYMENSDG
                     SESLVPKSVDGDLVMVHAISRKFILRRGKDVLCVFNEAYDRVGINPDTNTTSPSVERV
                     VKRDVTGQ"
     gene            167919..169091
                     /locus_tag="ATU_RS24740"
                     /old_locus_tag="AGR_pAT_231"
                     /old_locus_tag="Atu5171"
     CDS             167919..169091
                     /locus_tag="ATU_RS24740"
                     /old_locus_tag="AGR_pAT_231"
                     /old_locus_tag="Atu5171"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007597894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB10"
                     /protein_id="WP_010974430.1"
                     /translation="MAQEDEDRIPGERAETVTSRQIDNSPLLKRGAVAIAIIAFVSFA
                     LWSTTGKKGRDENVQPERIIIRQTTPFEAAKEKVEPDQALPEVKLPTPVVEPVIEEQD
                     KLLDSARRAPVMAFSGGQRNRKELREGDSSYPSDNSNFVPLDNNMSVQNQQNNEQQSF
                     DGLLRPTRLEGSRAGTLGNRNFIVAMGTTIPCVLETALASDQPGFTTCVINRDVLSDN
                     GRVVLMEKGTQVVGEYRGGLQRGQERLFILWNRAKTPKGVIVTLASPATDALGRAGVD
                     GHVDTHWWERFGSALLLSIVGDATNYASSRLQDSDVDAQKTTSASQQAAAIAVEQSIN
                     IPPTLNKHQGEPVSIFVARDLDFSGIYGLRVTEPRNRVFDRAVLGDFAPRSTLLTK"
     gene            169100..170110
                     /gene="virB11"
                     /locus_tag="ATU_RS24745"
                     /old_locus_tag="AGR_pAT_bx65"
                     /old_locus_tag="Atu5172"
     CDS             169100..170110
                     /gene="virB11"
                     /locus_tag="ATU_RS24745"
                     /old_locus_tag="AGR_pAT_bx65"
                     /old_locus_tag="Atu5172"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type DNA transfer ATPase VirB11"
                     /protein_id="WP_010974431.1"
                     /translation="MSERQESAVVSELLKPFSTFLQDKSLLEVIVNRPGQVLTEGPGG
                     WRTYEMPELTFEKLMRLARAVASFSHQSIDETRPILSATLPGNERIQIVIPPATINDT
                     VSMTIRKPSSVDFSLDDLEEKGFFQTACAATSTSSSAQDEELCETYRAGRFKDFLRQA
                     VIARKNIIISGATGSAKTTLSKALIKHIPENERVISIEDTPELVISQPNHVRLFYSKG
                     RQGLSRAGPKELLESCLRMRPDRILLQELRDGTAFYYIRNVNSGHPGSITTVHANSAE
                     LAFEQLVLLVKESEGVAGLDRADIVALLKASIDIVAQCRRNKGNFRLSEVYFRCERKA
                     KD"
     gene            <170141..170715
                     /locus_tag="ATU_RS24750"
                     /old_locus_tag="AGR_pAT_234"
                     /old_locus_tag="Atu5173"
                     /pseudo
     CDS             <170141..170715
                     /locus_tag="ATU_RS24750"
                     /old_locus_tag="AGR_pAT_234"
                     /old_locus_tag="Atu5173"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006699133.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-binding protein"
     gene            171061..171345
                     /locus_tag="ATU_RS24755"
                     /old_locus_tag="AGR_pAT_235"
                     /old_locus_tag="Atu8203"
     CDS             171061..171345
                     /locus_tag="ATU_RS24755"
                     /old_locus_tag="AGR_pAT_235"
                     /old_locus_tag="Atu8203"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3824 domain-containing protein"
                     /protein_id="WP_010974433.1"
                     /translation="MKKIISGVLVCVALTACSQTEKGAGIGAASGAIIGGLASGTWEG
                     AAVGAAAGGAGGAVIGNISERQDRNRRDRWEQRDRRDYNCRYRDYYGRCR"
     gene            171553..172227
                     /locus_tag="ATU_RS24760"
                     /old_locus_tag="AGR_pAT_bx228"
                     /old_locus_tag="Atu5175"
     CDS             171553..172227
                     /locus_tag="ATU_RS24760"
                     /old_locus_tag="AGR_pAT_bx228"
                     /old_locus_tag="Atu5175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020008963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_010974434.1"
                     /translation="MKLLLIEDDPEMTDALKVALSQHGIVLDAVGDLATAREAIIMAD
                     YDIVLIDRQLPDGDGSTFLADLRRAGSNTRSIIISALRSTDERISGLNDGADDYLPKP
                     FEIPELVARMSAVLRRAPTTGPFVLSAGNVTYDRVSCDVHVNGIRLALTRRELLIIET
                     LLRNRGRTVLRSSLEGQVYSFDDEIQSNSLESNMSRLRRKLGEAEADIVIKNIRGIGY
                     YLHEQK"
     gene            172229..173578
                     /locus_tag="ATU_RS24765"
                     /old_locus_tag="AGR_pAT_241"
                     /old_locus_tag="Atu5176"
     CDS             172229..173578
                     /locus_tag="ATU_RS24765"
                     /old_locus_tag="AGR_pAT_241"
                     /old_locus_tag="Atu5176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003524014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAMP domain-containing histidine kinase"
                     /protein_id="WP_010974435.1"
                     /translation="MTSTSLRWRFTFGFIVLQLCAVIASLSLVFYLLSGLKPDVAITS
                     IWLSQEIADSVRLEPNGRASLMPTAELKEIMEDSPNLWFVADLGKDIVLAHGTPPGKI
                     ADNMPFLRTFRSVEIHGDLDDPLSVGRVERFDTRAGEATIFAGGVPMSQYGVTVLLGN
                     LAIGIPALILIAISLIGAPVVTRWALRSFSDLTTRLDRIDLDTRGALVEERGLPTEVL
                     RLVRDINRALRRLDNGFEATERFFVNAAHELRTPIAVLQVRIDTLSPSSDKTHLQTAI
                     KRLTAIANQLLDTEKYRQKPQQNAPVDLNSVVSKVVADLAPLAIAEGYEISFDSDAQD
                     VFVPGDAESLERAFVNLVRNAVQYGGGRGQISVGIEADGSVTVADQGCGIAGDKHSRI
                     FEPFYRVNPHGSGAGLGLSMVNEIVTRHGGYVELSSAPGKGSTFVVRWREMRVFKQR"
     gene            173825..175018
                     /locus_tag="ATU_RS24770"
                     /old_locus_tag="AGR_pAT_244"
                     /old_locus_tag="Atu5177"
     CDS             173825..175018
                     /locus_tag="ATU_RS24770"
                     /old_locus_tag="AGR_pAT_244"
                     /old_locus_tag="Atu5177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter periplasmic adaptor
                     subunit"
                     /protein_id="WP_010974436.1"
                     /translation="MTRHITRKRFILAAATLVGLLGVWLLFLRPPAKLELVTAQARTG
                     DIEEVVLATGVLEPLELVRVGAQASGRVERLSVEVGDVVEAGQLVAEIDSQTRRNTLR
                     DREAALANIRAVHAARMAGLVKARKDFERERELLAGGSIPRAQYDAAVATLDSARAEV
                     QALDAQITQAQVALASADIELGYTRITAPIAGTVVAIVTEEGQTVNALQTAPTIVMIA
                     RLDRMKVRADISEADVVRVRRGMPVWFSILGDPKRRFDGELRQVEPAPASIANDGSSA
                     ARELGSTKGAVYYTGLIDVANADGVLRPSMTAQVSIVLSRVSGAVLAPLSAVEGAPRA
                     GDTARIRVLDAASEVQIRQVQVGVDNGADIQILSGLQAGETIVLGASTDERTDGQAQL
                     AAAKR"
     gene            175028..176974
                     /gene="macB"
                     /locus_tag="ATU_RS24775"
                     /old_locus_tag="AGR_pAT_247"
                     /old_locus_tag="Atu5178"
     CDS             175028..176974
                     /gene="macB"
                     /locus_tag="ATU_RS24775"
                     /old_locus_tag="AGR_pAT_247"
                     /old_locus_tag="Atu5178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MacB family efflux pump subunit"
                     /protein_id="WP_010974437.1"
                     /translation="MTEPLIRVRGVSRAFPAGDEMVRVLKDVDLDIEAGEMMAIIGAS
                     GSGKSTLMNILGCLDRPTTGSYWIEGRETSKMAVDELAALRRERFGFIFQRYHLLGDL
                     SAASNVEVPAIYAGRSRSDRHKRAISLLTRLGLAERTGNIPSKLSGGQQQRVSIARAL
                     MNGGEIILADEPTGALDTHSGAEVMKILRELHAEGHTIILVTHDKKIAEHADRVVEIS
                     DGVIISDERNVSRSTTARPIREHGPSAGWRGAIDRMTEALRMAGAAIWAHKMRSLLTM
                     LGIIIGIASVAAISALGAGSQQQILSSISSLGTNTIEVRAGKGFGDLEAGKIRTLVPA
                     DAEALVNQPYVDSVTPTVTTSVTVKRAAVAVNASVTGVGADFFRVRGLELAHGQLFDA
                     QDVIAYSQNVVIDASAARDLFPDRVNPVGQVILLGTMPARVVGVTKRENSFGPAVDTL
                     TVYAPYTTVMGRMLGRPNVDGITVRIRDDVDPGNVEAAVTRLIERRHGAKDFFLTNSA
                     TIRETIETTTQTLTLLISSVAVISLIVGGIGVMNIMLVSVTERTKEIGVRVAVGARRS
                     DILSQFLIEAVMVCLVGGLMGIMLALGISALFNLLSPDFKMIFSPGSIIVAFACSTLI
                     GIVFGFLPARNAAKLDPIEALARD"
     gene            complement(177752..177967)
                     /locus_tag="ATU_RS24780"
                     /old_locus_tag="Atu5180"
     CDS             complement(177752..177967)
                     /locus_tag="ATU_RS24780"
                     /old_locus_tag="Atu5180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018497240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_080728799.1"
                     /translation="MREQLGRHNASIRELAAKFHISLTGMKKHVGVLKQAGLVTTEKV
                     GRLRICKSGLLGLEEEGMSRKAICRDS"
     gene            complement(178200..178937)
                     /locus_tag="ATU_RS24785"
                     /old_locus_tag="AGR_pAT_252"
                     /old_locus_tag="Atu5181"
     CDS             complement(178200..178937)
                     /locus_tag="ATU_RS24785"
                     /old_locus_tag="AGR_pAT_252"
                     /old_locus_tag="Atu5181"
                     /EC_number="1.1.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018244579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose 1-dehydrogenase"
                     /protein_id="WP_010974439.1"
                     /translation="MSELAGKRALVTGASRGIGAAIAIALAEKGADVAITYERAADRA
                     AQVVATIEGKGRKALAIQADSMDPEAVKRSVDQAAQALGGLDILVNNAAIAIYKDVAD
                     FTVAEIDALFAVNARSPILASQAAMPYLGKGGRIVTIGSAGAERIVGPSTVYSMTKSA
                     LQSFTRGLARELGPRDITVNLIQPGSTNTEMNPAEGEFGDFQRALIPLGRYGEPEDVA
                     AAVAFLASGAARQITGTILTVDGGTLT"
     gene            complement(179033..179968)
                     /locus_tag="ATU_RS24790"
                     /old_locus_tag="AGR_pAT_254"
                     /old_locus_tag="Atu5182"
     CDS             complement(179033..179968)
                     /locus_tag="ATU_RS24790"
                     /old_locus_tag="AGR_pAT_254"
                     /old_locus_tag="Atu5182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017957046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding dehydrogenase"
                     /protein_id="WP_010974440.1"
                     /translation="MQSAGGPSVLQVIKQDLHAPRAGEVRLIQDAIGLNFVDTMIRKG
                     QYPMALPAVPGFEAAGTITEVGSGVEGLSVGDRVAYFFSEGAYATERVIPTAPLIRLP
                     ADISNETAATFLAKGATAWMGIRGLHDLKSADTVMVLGASGSVGAILSRWARSLGATV
                     IGVAGSPGKFDKVAAGSTHAFHAGEPDIAAKIRAIAPDGVDVVYDLVGRATFALAASS
                     VRDGGVIAAIGAATGQPAPAPDLVRRGVDVRSGGTPQYVRGPAVENATSQLWDALRSG
                     VFDDLETTRYPFDEIARAHDDVDNRRLSGLPVLIA"
     gene            complement(180054..180650)
                     /locus_tag="ATU_RS24795"
                     /old_locus_tag="AGR_pAT_255"
                     /old_locus_tag="Atu5183"
     CDS             complement(180054..180650)
                     /locus_tag="ATU_RS24795"
                     /old_locus_tag="AGR_pAT_255"
                     /old_locus_tag="Atu5183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent F420 reductase"
                     /protein_id="WP_010974441.1"
                     /translation="MTVGIIGAGNIGGAFATALGKAGIEAVIANSRGPESLTALVSKL
                     GSTIRAGSVPEAAAQAIVLVAVPWSKIPGALAGLNFGDRIVIDANNSIEAPLYRPADL
                     GGRTSTDIFTALVPGARVVKAFNHLTPKQLSGDPHSEGGRRVLFYSGDDMRAKAEVGA
                     IIDRIGFFGIDLGGLPVGSQLLQFPGGPLPALNLVKFD"
     gene            180842..181771
                     /locus_tag="ATU_RS24800"
                     /old_locus_tag="AGR_pAT_256"
                     /old_locus_tag="Atu5184"
     CDS             180842..181771
                     /locus_tag="ATU_RS24800"
                     /old_locus_tag="AGR_pAT_256"
                     /old_locus_tag="Atu5184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011483842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974442.1"
                     /translation="METLANLEAFVRSAEASSFSGAARRLSITPAAVSRNVAMLERNL
                     GIRLFHRSTRKLTLTEAGESFLASIGDSLNHLQGAIDGASQTKGEPVGVLKLSMSLSF
                     AMGYVLPALPDFLARYPGVRPDWHFDSRKVDLIAEGFDAAIGGGFELNPGIVSTTLAP
                     VHVIAVASPSYFAARRRPTSPVDLADHAGILMRSSNSGRIRQWMMRDAQGREERALLN
                     ETIVMSDAAPMVQAAIAGLGIALLAVPDVLPHMESGALERILPKWYADAGSISLYYSG
                     RVLQPLKTRAFIDFYTEYFRRERLSARFAGSLG"
     gene            181939..182703
                     /locus_tag="ATU_RS24805"
                     /old_locus_tag="AGR_pAT_258"
                     /old_locus_tag="Atu5185"
     CDS             181939..182703
                     /locus_tag="ATU_RS24805"
                     /old_locus_tag="AGR_pAT_258"
                     /old_locus_tag="Atu5185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017957050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase FabG"
                     /protein_id="WP_010974443.1"
                     /translation="MIDLTSSRYLPLNGKIALVTGGSRSIGASIAQRLAADGAQVAFT
                     YRGSPAKAEEVAVAIEKTGARALAIAADAADPDAIRAAVAATVDKFGGLDILVNNAGI
                     AFAGPIDEIAFDDYQAMLAINVTGVFVATQEAVRHMKDGGRIIHIGSSITKYAGVPGL
                     SAYGLTKGAVAGFNRSLAHDLGPRGITVNTVHPGPTDTDMNPVDGEFAAMQISRIAAG
                     RYGKPREIANVVAFLASPEASFVTGADIRADGGFTS"
     gene            complement(182976..183902)
                     /locus_tag="ATU_RS24810"
                     /old_locus_tag="AGR_pAT_261"
                     /old_locus_tag="Atu5187"
     CDS             complement(182976..183902)
                     /locus_tag="ATU_RS24810"
                     /old_locus_tag="AGR_pAT_261"
                     /old_locus_tag="Atu5187"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017956998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974445.1"
                     /translation="MDVDELNLFVRIAQLRSISAAARDLGLTPAGASAKLLVLERKLS
                     ARLVHRTTRQATLTEDGLAFLPHAEHIVVAAEAARAALGREQAAPRGTLRIAAPASFA
                     RMHIVPGLADFCRQYPDLALDLRISDSIVDLVEGAFDVAVRYTELSDSSFVARRLAPD
                     NRVLVASPEYLEKHGRPSTPDDLAEHTCLVVGALDLWTFRGKGSVVIERRVTPSLRIN
                     DGTAVRDAASAGLGIALMATWCASEELQSGALVPVLPEYPLISTQTLWALYPSSRELA
                     PKVRVFIDWLVNRFGNQPYWDKGLENILNHRG"
     gene            184097..185083
                     /locus_tag="ATU_RS24815"
                     /old_locus_tag="AGR_pAT_262"
                     /old_locus_tag="Atu5188"
     CDS             184097..185083
                     /locus_tag="ATU_RS24815"
                     /old_locus_tag="AGR_pAT_262"
                     /old_locus_tag="Atu5188"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013393179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-dependent alcohol dehydrogenase family
                     protein"
                     /protein_id="WP_010974446.1"
                     /translation="MKAMSLKSFGGPEAFDLVEVPKPLPKAGQVLVRVHATSINPLDY
                     QVRRGDYRDLVPLPAITGHDVSGVVEATGPGVTMFAPGDEVWYTPQIFDGPGSYAEYH
                     VANENIIGRKPSSLTHLEAASLSLVGGTAWEALVSRAALRVGESILIHGGAGGVGHVA
                     IQVAKAIGAKVYTTVREENFEFARSVGADVVIDYRKEDYVAAIMRETEGLGVDVVFDT
                     LGGETLSHSPKVLAQFGRVVSIVDIARPQNLIEAWGRNASYHFVFTRQNQGKLNELNV
                     LVERGQLRPHVGAVYSLADLPLAHALLEKPNNGLRGKIAIAIDPQAETKVQS"
     gene            185080..185412
                     /locus_tag="ATU_RS24820"
                     /old_locus_tag="AGR_pAT_263"
                     /old_locus_tag="Atu5189"
     CDS             185080..185412
                     /locus_tag="ATU_RS24820"
                     /old_locus_tag="AGR_pAT_263"
                     /old_locus_tag="Atu5189"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016976412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_010974447.1"
                     /translation="MIYEIAMLPVQKDKISEFRQAFGDVVPLLKRARGYRGHVLAQGV
                     ETPEVFNLIVRWRSLNDHTPGFEASEDHEQFMEGIQDYFSGEPTVYHLEGDNSGWSDY
                     RHGKSGAA"
     gene            185527..186249
                     /locus_tag="ATU_RS24825"
                     /old_locus_tag="AGR_pAT_264"
                     /old_locus_tag="Atu5190"
     CDS             185527..186249
                     /locus_tag="ATU_RS24825"
                     /old_locus_tag="AGR_pAT_264"
                     /old_locus_tag="Atu5190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003977849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_010974448.1"
                     /translation="MPAVLVHGVPDTHRLWDTVRSHLERSDIITIDLPGFGNPLPSDF
                     RSTKEEYLDWLINRIDEIGEPVDLVGHDWGCLLTGRLTSIRPDLVRTWTGISGPIDPE
                     YPWHYLAKIWQTPGEGEQWMKDLDLEEFAAKLIEAQMPKDAADESVRHLDATMRASIL
                     ALYRSAIGVGAEWKPGLSSITAPALVIWGLDDPFLPHRFADELGNATHARAVVKLRTS
                     HWPMIERPADVARELEAHWAHG"
     gene            186410..187534
                     /locus_tag="ATU_RS24830"
                     /old_locus_tag="AGR_pAT_265"
                     /old_locus_tag="Atu5191"
     CDS             186410..187534
                     /locus_tag="ATU_RS24830"
                     /old_locus_tag="AGR_pAT_265"
                     /old_locus_tag="Atu5191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003977850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="WP_010974449.1"
                     /translation="MTNSANSRIGVGIVGASADRGWGGIAHVPALRALDAFQIRAVST
                     TRMESASRLGADLAFDTHQALVVRPEVDLVVVAVKVPDHKQIVSDALAAGKMVYCEWP
                     LARNLSEAEALEGLARERRLRTVIGLQGGLHPPIRYLHDLVRQGVIGRPLSTSIRAHL
                     NDDMWVGRYDPPFEYMARAENGATLQSIMLGHALQPLAHVLGGFESLSAIVANQRGDG
                     VRLSDGSSHPKDAPDEIIVAGVLKGGIVTSLHYSAGQSVGLVWEIQGTEGSLRVETAS
                     GYIHFGDMTITLRRGSEPVRHLRVPTAYAAPDLQLEAPAAGVARLYAQLAADLRDGTA
                     DAPDFAVALDRHRVLEAITQANLTGHRQHLSLRVTGNPNP"
     gene            188429..190330
                     /locus_tag="ATU_RS24835"
                     /old_locus_tag="AGR_pAT_267"
                     /old_locus_tag="Atu5193"
     CDS             188429..190330
                     /locus_tag="ATU_RS24835"
                     /old_locus_tag="AGR_pAT_267"
                     /old_locus_tag="Atu5193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010240931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S9 family peptidase"
                     /protein_id="WP_010974451.1"
                     /translation="MTAPDLIPIETLFGMPEFSRAQISPDGRLVAYLAPWRGRLNIWV
                     RPVGQGTARRLTGDDTRNIDGFSWTRDTRYLLFIQDTQGDENWHLHRVEVDGAEAVGG
                     KARTVDLTPYSGVRVMGLELSAAFPSKAFVQMNLRTPDLIDLYEVDIESAETRVAALN
                     PGRFVRWIVTPNGPMHAFIINDVGDHELARYENGVFTTLAKLSGRDQPIGPMPLMVAA
                     DGESVLVGCNAGSDHTYLAAIDLATGKCRVIDSQPDCSLDTPRPEADPRFPSSLITNP
                     VTGELLAVRYLGKRQQIRPLNLRFAAVLNSLQRLSDGEIGYISCDAGGRQWVAEFWDD
                     RHPGTTWFYEHESGEAHVLGERFSALSAERLVSVRPIDVISRDGLTLPCHVTLPVGFD
                     AKDEPRALPTVLLVHGGPWYRDACVYDPEVQFLANRGYAVLQVNFRGSTGYGKAFMQA
                     AIGEFSGRMHDDLIDGLDWLIGQGIADPARVAIYGCSYGGYAALVGASFTPERFTATI
                     SYSGISDLRMLVNGVVPFVQPTLINTYLSYMGDPDIETQNRDMLARSPVSRLDCISKP
                     LLVVHGANDVRVAKAQADMVVERVRANGVEVDYLLNEREGHWFINEDSNIELYRKIER
                     FLARHLRGE"
     gene            190343..191092
                     /locus_tag="ATU_RS24840"
                     /old_locus_tag="AGR_pAT_269"
                     /old_locus_tag="Atu5194"
     CDS             190343..191092
                     /locus_tag="ATU_RS24840"
                     /old_locus_tag="AGR_pAT_269"
                     /old_locus_tag="Atu5194"
                     /inference="COORDINATES: protein motif:HMM:NF024803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_010974452.1"
                     /translation="MRSKEIAGLARVSIRTLRHYHQIGLLPEPPRQNNGYRIYSVPHL
                     IRLLRIGQLTALGFSLSQIPAFLDGRAEMSGDSLDALLEGLTRQIELLERQRRTVTAL
                     RDGKGHPDMAPEFAASLMALEVGREPKAVRAGREQSVLLSHLLNEEQRAELARLYDEL
                     ADIEHGVTPRELGHRFDALGPGSDDVEISALAEDYIAHLGSWMRDFDNALSGGRRHQA
                     ATLLWLHALENTNNQQKRLLVEINSGLVSER"
     gene            191259..192176
                     /locus_tag="ATU_RS24845"
                     /old_locus_tag="AGR_pAT_270"
                     /old_locus_tag="Atu5195"
     CDS             191259..192176
                     /locus_tag="ATU_RS24845"
                     /old_locus_tag="AGR_pAT_270"
                     /old_locus_tag="Atu5195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974453.1"
                     /translation="MDINVALKAFIRTVEKGSITAAARDLGVTQPAVTKHISNLERHV
                     QARLLERSSKIVRPTAHGLELYEASRIAIASIDAALEGVRINTGEIEGNLRIHAPSCI
                     GVGHLERIVGEFQDEYCGISVELALDERTVDLVYDNFDLSVHYGKIEDQDVIARRIGW
                     VERFLVASPLYLEQVGQINDTGRLSELEVIGTPKMLAQRNTISLLGPSARAEDVAVRP
                     LLITNNAHVMIAALLRGRGVGLVQKNLVLDLLASGELVRVLPEYWLRSTEAFLAYPST
                     KFMRPVVRAFTDFVMPRLRNIDGISPEQR"
     gene            192304..193017
                     /locus_tag="ATU_RS24850"
                     /old_locus_tag="AGR_pAT_272"
                     /old_locus_tag="Atu5196"
     CDS             192304..193017
                     /locus_tag="ATU_RS24850"
                     /old_locus_tag="AGR_pAT_272"
                     /old_locus_tag="Atu5196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010976165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L,D-transpeptidase"
                     /protein_id="WP_035257091.1"
                     /translation="MQNRNSFISRRTFIVGSLAAPVILGGCTTVQERSASSQPIATPQ
                     PSPVGPDLASRYAAFEDGGHFVPAVPFERMNPEYLRQRVADPTGEAPGTVVVDTPRRF
                     LYLVENGGTALRYGVGIGRDGFSWEGNGYIHWRQHWPRWKPPSEMIARQPELEKYSVA
                     NGGMDPGLHNPLGARALYIFQNGEDTLYRLHGNPEWQSIGKAVSSGCVRLMNQDIVDL
                     YDRVPFHAPIVVHQTPMAV"
     gene            complement(193078..194034)
                     /locus_tag="ATU_RS24855"
                     /old_locus_tag="AGR_pAT_273"
                     /old_locus_tag="Atu5197"
     CDS             complement(193078..194034)
                     /locus_tag="ATU_RS24855"
                     /old_locus_tag="AGR_pAT_273"
                     /old_locus_tag="Atu5197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018899477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_035257020.1"
                     /translation="MNLHGIDLNLLVAFDALNSERNVTRAGSRIGRTQPAMSAALSRL
                     RFLLRDELFVRGPNGLQPTPRAVELAEPISLALREIQRTLQFTQGFDPDKSTISFSIA
                     VSAHAGSVILPRLLSLLEEKAPGIDIKVRDYSSRDDAVSLLDSGGVDLTVGIPPTPTS
                     RILSARLFQERFVCILRKDHPILGRPFDPETFLSLTHILVAPDNEGLDVADAALASKN
                     FRRRAAVTIPHMHVAPALVASSDMVATVIESVVAHSGFAERLAVFDFPLPLNPVPFVL
                     SWHRRNDGHPAQQWLRNGLLAAFPHVWLSSENICSDLAPQYY"
     gene            complement(194086..195102)
                     /locus_tag="ATU_RS24860"
                     /old_locus_tag="AGR_pAT_274"
                     /old_locus_tag="Atu5198"
     CDS             complement(194086..195102)
                     /locus_tag="ATU_RS24860"
                     /old_locus_tag="AGR_pAT_274"
                     /old_locus_tag="Atu5198"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002640120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="WP_010974456.1"
                     /translation="MQMRKLGESGLFVSELCFGAMTFGGTDGLWGKVGRLDQEDADAL
                     VKAALEAGINLFDTANVYAHGRSEEILGRSLKNLGVSRSDVVIATKVASAMGDGPNHR
                     GASRGHIISECRASLGRLGLDHIDLYQIHAFDSATPIEETLEALDTLVRAGDVRYIGL
                     SNWAAWQIMKAIGITRARALAPITSLQAYYTLVGRDLEREIGPLLSSERVGLMVWSPL
                     AGGYLTGKYSAGGNAAGGRQTELDFPPIDRIRGEPLIAVLKAVAEKHGSSPAQIAIAW
                     LLKQKVVSTVIIGAKRVEQLQENIRSASIELDDNDMAKLDEVSRLPVEYPGWLLNDGN
                     GHSR"
     gene            complement(195232..196332)
                     /locus_tag="ATU_RS24865"
                     /old_locus_tag="AGR_pAT_276"
                     /old_locus_tag="Atu5199"
     CDS             complement(195232..196332)
                     /locus_tag="ATU_RS24865"
                     /old_locus_tag="AGR_pAT_276"
                     /old_locus_tag="Atu5199"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019608468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="WP_010974457.1"
                     /translation="MSDKKFRVGIIGADTHASWAGASHVPALASQAHLTLAAVATRRE
                     ESARAAAEAFGAELWFADPYAMISDKTIDVITVAVKVPAHKNLVMAALHAGKAVYCEA
                     PLGATLAETNEMAAAVGSLHTAIGLQGRHNPAVRRAAELVASGKLGRLMSARVGATTF
                     GYGPQSPSMYDYFNKAASGASFMTITAGHVLDVIEAVLGNITEVDARTELLWPEIEIV
                     DTGETSQREIPDHLDLIAKTASGAPVSVQVLAGVPADEASVVFEIRGSRGWLKLTGNH
                     LAGVQVGDILLSSSVEFAAPDRPVANGVGPTAAEFWSGAAINVGEVYASLGRDLRNGT
                     YTTPGFDHARHNSRLIAAVELAARTGERQHLV"
     gene            complement(196454..198129)
                     /locus_tag="ATU_RS24870"
                     /old_locus_tag="AGR_pAT_277"
                     /old_locus_tag="Atu5200"
                     /pseudo
     CDS             complement(196454..198129)
                     /locus_tag="ATU_RS24870"
                     /old_locus_tag="AGR_pAT_277"
                     /old_locus_tag="Atu5200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010160604.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
     gene            198330..199184
                     /locus_tag="ATU_RS24875"
                     /old_locus_tag="AGR_pAT_278"
                     /old_locus_tag="Atu5201"
     CDS             198330..199184
                     /locus_tag="ATU_RS24875"
                     /old_locus_tag="AGR_pAT_278"
                     /old_locus_tag="Atu5201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin family protein"
                     /protein_id="WP_010974459.1"
                     /translation="MFQRSIDSITTTPPLGPGFAGERHKAALVVAPGNFSATDPFFLM
                     ADDHVTGEGQFGEAHPHAGLETVTFMLHGTMEDAGGRLGEGDVEWMTAGSGIVHSEDA
                     QVSTGMRLFQLWLVLPEWDRNMAPRVQILRRDEMPVHCGVGFEATVYSGRSAGIIAST
                     KNAVPVTLVEIRLEAGAEFEQVLPSSYNGFVVVIAGEIEAGTGATALTTDKVGWTSPL
                     AVHGDSFMRLRAGKDGARVLLYAGQPQNIHVVAQGPFIAGSKEELAGYYAAYRQGKFP
                     NAGTMRPV"
     gene            199446..200564
                     /locus_tag="ATU_RS24880"
                     /old_locus_tag="AGR_pAT_280"
                     /old_locus_tag="Atu5202"
     CDS             199446..200564
                     /locus_tag="ATU_RS24880"
                     /old_locus_tag="AGR_pAT_280"
                     /old_locus_tag="Atu5202"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012378121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent alcohol dehydrogenase"
                     /protein_id="WP_010974460.1"
                     /translation="MTQPATAAVLEEKNGRFILREVKLEAPRPDEVLIRMVATGICAT
                     DAHVRQQLMPTPLPAILGHEGAGIVERVGSTVSHLKPGDHVVLSYHSCGHCKPCMSSH
                     AAYCDHVWETNFAGARLDGTIGVAAPDGNTLHAHFFGQSSFSTYALAHQRNAVKVPDD
                     VPLELLGPLGCGFQTGAGSVLNALKVPVGASIAIFGVGAVGLSAIMAAKVADAAVIIA
                     IDVNTERLKLASELGATHCVNPREQADVASAIRDIAPRGVEYVLDTSGRKENLDGGIG
                     ALAPMGQFGFVAFNDHSGAVVDASRLTVGQSLIGIIQGDAISGLMIPELVGLYRSGRF
                     PFDRLLTFYDFADINEAFDDVAAGRVIKAVLRFPPQAA"
     gene            200670..201692
                     /locus_tag="ATU_RS24885"
                     /old_locus_tag="AGR_pAT_282"
                     /old_locus_tag="Atu5203"
     CDS             200670..201692
                     /locus_tag="ATU_RS24885"
                     /old_locus_tag="AGR_pAT_282"
                     /old_locus_tag="Atu5203"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016325577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_046033422.1"
                     /translation="MDHYGFPEAGEHPADPPGYYPEYFSSERFQRLGYHVEELRGGFY
                     WVTSGGYDAAFVVTSDGVVAIDAPPTIGENMLAAIEDVTDKPVTHLIYSHWHTDHIGA
                     ASVFGPNVEIVAHDITKELLERFPDPNRPVPTVTFDKDHLLVVGGVTLELSYKGENHC
                     PGNIFIYAPAQKVLTVIDIVSPGSATFMHCDASQNITGWYEAQKQLMEYEFDFLVAGH
                     HMKYGTPETVAASIEYFQDVLDGAQAAVDRFSRSDALVSILEGAGWDQVFSGTENWIN
                     SMANFATKYVLEKKSSNGQLWSERLAGVTTQTKYHAYTVLESIRLERPRPNYRLRGEN
                     PPPFLT"
     gene            201811..203265
                     /locus_tag="ATU_RS24890"
                     /old_locus_tag="AGR_pAT_283"
                     /old_locus_tag="Atu5204"
     CDS             201811..203265
                     /locus_tag="ATU_RS24890"
                     /old_locus_tag="AGR_pAT_283"
                     /old_locus_tag="Atu5204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013741981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase family protein"
                     /protein_id="WP_010974462.1"
                     /translation="MTTFSASNWIDGTFVSSSKRGRSIDPATYETIGDYPDDGGAAAQ
                     SAIEAAKRAFRGTAWRDDAELRARVLDQMASAIERNRERLIDILSLENGKLLGEAALE
                     IDGSPSKLRYWAAMARTEAGRAKSPKPGSLSVILRQPMGVAGIIVPWNSPVILSVRSF
                     APALAAGCTVVVKMPGQTAQVGSVITEVLAEATDLPEGVVNMFVESGADGAALLVESP
                     DVPTISFTGSTQTGRTIGAIGAKRMKRFGLELGGKTPMIVFDDADLEAMLPVLEKALT
                     IFAGQFCMTGSRLLVHSSIYELVRDRLAERLRAVKVGPASDPASDMGPLIDKENVARV
                     DSVVKDALSKGATVVVRGGPVPEGPLAKGAFFRPSMLEVFDNSLPIVQQETFGPVITI
                     QRFSDEREAVVLANDNDYGLSASVWTRDLDRSLRVAQALEAGSVFVNDWAKVYDGTEE
                     GGFKQSGLGRLNGVAAIEDFIEYKQVALKPGLLR"
     gene            203834..204022
                     /locus_tag="ATU_RS24895"
     CDS             203834..204022
                     /locus_tag="ATU_RS24895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008124033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_052706866.1"
                     /translation="MATDTAIRALIEHASISDPDLRARLLATIEERFSTADPLSQVHH
                     EFADLAKVSLARLIGKVT"
     gene            complement(204297..205196)
                     /locus_tag="ATU_RS24900"
                     /old_locus_tag="AGR_pAT_286"
                     /old_locus_tag="Atu5206"
     CDS             complement(204297..205196)
                     /locus_tag="ATU_RS24900"
                     /old_locus_tag="AGR_pAT_286"
                     /old_locus_tag="Atu5206"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002640116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974464.1"
                     /translation="MAEPESVEILDLISFIRVVETGSIAGAASRLGIAKSIVSRRISR
                     LENFLGATLLTRSQKGTALTDVGREYHLRAASGLAELESAQEMVVRSTTEASGQVRVS
                     VPVAFGEFCLAPLLAEFALLHPRIHFDVRFEDRQPDLVAEAYDLAVRIGSIPDSVLIT
                     RKLAKVRWAVVASPSYLEARGRPSKPSELAAHNAILYSFDTFGWRFQGPDGWEQVRVN
                     SQFRSDNGQMMLSAARAGLGIVVLPVFMVQESLASGDLEEVVPGYSHAGADLHILMPP
                     ARAGIARVRALVNFLYEKFEREI"
     gene            205621..206214
                     /locus_tag="ATU_RS24905"
                     /old_locus_tag="AGR_pAT_287"
                     /old_locus_tag="Atu5207"
     CDS             205621..206214
                     /locus_tag="ATU_RS24905"
                     /old_locus_tag="AGR_pAT_287"
                     /old_locus_tag="Atu5207"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007879201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase family protein"
                     /protein_id="WP_035257092.1"
                     /translation="MVAQLLAKRRTQYSLGKNIVLPDEEIDALIREAVRLSPSAFNSQ
                     SSRVVILHRDENQKLWDIVKSELSHIVEGEAKKHSFRKIDSFAAGAGAVLFFEDRNVI
                     RILQDQWPLYADHFPDWSEQASGMAQLSVWIALAGIGIGASLQHYNPLVDAKIKRHWN
                     IPDTWRLRAQMPFGSNEAPFPPKTIISDGDRFRSFFR"
     gene            complement(206378..207277)
                     /locus_tag="ATU_RS24910"
                     /old_locus_tag="AGR_pAT_289"
                     /old_locus_tag="Atu5208"
     CDS             complement(206378..207277)
                     /locus_tag="ATU_RS24910"
                     /old_locus_tag="AGR_pAT_289"
                     /old_locus_tag="Atu5208"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006203596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974466.1"
                     /translation="MTRSVLVDLDAVLSIARLGSFRAAALDLGMSTTALSNAIAKLEQ
                     RLGVRLFNRTTRSVSLTDAGKTFAERVGPAMMDIHDAMLSVQSLQETPAGTLRINAFA
                     TAAREVMEPLILSFMQRYPQVHIDLVTEGRIVDIVAAGFDLGLRPADLVPADMIAVSL
                     GLKRSNAVVASPDFLRIHGIPTVPADLYRFRCIRARLPNNALFRWKFEKDGDAMQIDV
                     QGSITLDESSLVRIAAQNGVGLGYVMEADVREDIAAGRLVRVLEDWTPALAPLALYYP
                     GRKNPPAAFSAFIQAARNFANGG"
     gene            207416..207745
                     /locus_tag="ATU_RS24915"
                     /old_locus_tag="AGR_pAT_291"
                     /old_locus_tag="Atu5209"
     CDS             207416..207745
                     /locus_tag="ATU_RS24915"
                     /old_locus_tag="AGR_pAT_291"
                     /old_locus_tag="Atu5209"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007597724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclear transport factor 2 family protein"
                     /protein_id="WP_010974467.1"
                     /translation="MTLNLPKAIEAYFEADRTSSPDAIAATFTENGIVKDKGKTHRGR
                     AAILAWMADEAQQYSYTVEPFLMTTKNGKTQVTAHAAGDFPGSPIDLRFFFVLAGEKV
                     AELEITV"
     gene            207742..208521
                     /locus_tag="ATU_RS24920"
                     /old_locus_tag="AGR_pAT_293"
                     /old_locus_tag="Atu5210"
     CDS             207742..208521
                     /locus_tag="ATU_RS24920"
                     /old_locus_tag="AGR_pAT_293"
                     /old_locus_tag="Atu5210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_010974468.1"
                     /translation="MTQFLTLQGRRALITGGTSGAGAATVALFKDLGASVLTTARKKP
                     ADFAGAAFVEADLTTTAGVKTVVDAVQRELGGLDILVNVLGGSSAPSGGFAALTDEEW
                     EKEFNLNFFPAVRLDRALVPGMIAQGSGVVIHVTSIQRNLPLPEATTGYASAKGALNT
                     YSKSVSKEVSPKGVRVVRVSPGWIADPGANGLALRIAEEAGIDYAAAVQVIMNSLGGI
                     PLGRPAKPEEVADLIAFLASDRAASITGTEHVIDGGTVPTA"
     gene            complement(208547..209014)
                     /locus_tag="ATU_RS24925"
                     /old_locus_tag="AGR_pAT_294"
                     /old_locus_tag="Atu5211"
     CDS             complement(208547..209014)
                     /locus_tag="ATU_RS24925"
                     /old_locus_tag="AGR_pAT_294"
                     /old_locus_tag="Atu5211"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011974574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_010974469.1"
                     /translation="MTKRDNDPPPLRDQLCYAIYTAGIAIQRAYKPLLDELGLTYPQY
                     LVLNVLWAEDEQTVVSIADQLALESSTLTPLLKRLEAAGHLSRTRNLNNERQVLVALT
                     DQGRALQHKAGCLSDTLLAASTQTPPELAALNRDVRHLRDAIYSQIGGWDAPA"
     gene            209159..209956
                     /locus_tag="ATU_RS24930"
                     /old_locus_tag="AGR_pAT_295"
                     /old_locus_tag="Atu5212"
     CDS             209159..209956
                     /locus_tag="ATU_RS24930"
                     /old_locus_tag="AGR_pAT_295"
                     /old_locus_tag="Atu5212"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017957411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_035257024.1"
                     /translation="MSRKSITTISAIATAASLSVALPAANAADTIPKDQAVKNVVLVH
                     GAFADGSGWKGVYDNLTKRGYRVTVVQNPLTSLADDVAATKRALERQDGPVILVGHSW
                     GGTVITEAGSDEKVAGLVYVSALSPDAGETTAQQYEGFAPASEFVIETTKDGFGYVSP
                     AKFKSGFAHDVSDADVAFMSSSQVPINMSAFGTKLENAAWRTKPSWAVIATEDKAFDQ
                     AMLIHMAERIKAKITKVSASHALFMTQPAVIADTIDKAAKTVSAKKQ"
     gene            complement(210448..211449)
                     /locus_tag="ATU_RS24935"
                     /old_locus_tag="AGR_pAT_298"
                     /old_locus_tag="Atu5213"
     CDS             complement(210448..211449)
                     /locus_tag="ATU_RS24935"
                     /old_locus_tag="AGR_pAT_298"
                     /old_locus_tag="Atu5213"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding dehydrogenase"
                     /protein_id="WP_010974471.1"
                     /translation="MRAAVYFKHGRPEDVLQAVEVEDLKRPAHNEVLIRVLLRPVHHG
                     DLLGISGRYQPGAVVSREGVRVGFEGYGLVEEAGDGVDLRQGTRVAFFPGRGAWSEKA
                     IVSAEYVTEIPDKVSDEAAAQLHINPLTAALLLRAVEASGAKPGRDVVVLTAAGSAVA
                     RLVIGLLLDRGFDVVGIVRREAGVNEINVVFPDLPVVSTDKPGWQDKVVAAADGHPIG
                     VVLDPVGGETASAVIGLLAQGGSLVSYGDLSGQPISVPALYFSTRDIRLSGVTVGRWA
                     GLPVEIRKADIKLALELAASRPELFQVEQAFDLADVGKAAALVERPGKSGTILIASR"
     gene            complement(211503..212258)
                     /locus_tag="ATU_RS24940"
                     /old_locus_tag="AGR_pAT_300"
                     /old_locus_tag="Atu5214"
     CDS             complement(211503..212258)
                     /locus_tag="ATU_RS24940"
                     /old_locus_tag="AGR_pAT_300"
                     /old_locus_tag="Atu5214"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018897868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_010974472.1"
                     /translation="MTNRLQNKIAVVTGATSGIGLATAKLFAVEGARVYITGRRKDAL
                     DKAVAEIGHGAVGVQADSASNENLDKLFAQVKAEQGRLDALVVNAGGGSMLPLGQITE
                     EQIDHTFGRNVKAVIFTVQKALPLMGKGASIVLTGSTAGTEGTAAFSVYSASKAAVRN
                     LARSWALDLKGTGIRVNVVSPGATRTPGLVELAGDDKEQQQGLLDYLASRIPLGRVGE
                     SEEIAKATLFLASDDASFVNGAELFADGGQAQV"
     gene            complement(212426..213367)
                     /locus_tag="ATU_RS24945"
                     /old_locus_tag="AGR_pAT_302"
                     /old_locus_tag="Atu5215"
     CDS             complement(212426..213367)
                     /locus_tag="ATU_RS24945"
                     /old_locus_tag="AGR_pAT_302"
                     /old_locus_tag="Atu5215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974473.1"
                     /translation="MDQILAIRTFVRVAEAGSFAKAADTLNLPRSSVSKLVQDLESHL
                     GTKLVERTTRSVTMTTEGIAYHERALKLLADLDDMDGTVAGSRSAPKGKLRVDIGSVL
                     ANQILIPALPDFQHQYPDIDLMLGVSDRPADLISEGIDCVIRGGALGDSSMKARKLCE
                     LDYVICASPTYLDGLQLPERPDDIEKFRIVSYFSASSGKRFPLRFQRGAERSEYFPTS
                     GGVSVNESTAHLNALLSGLGIGQSFGFLARPHFKSGALVELLPDWTPDNHPLHLVYPA
                     DRFPNPRLRAFTEWAAKIFEAVDARRDVKMRTIHPHG"
     gene            214275..215417
                     /locus_tag="ATU_RS24950"
                     /old_locus_tag="AGR_pAT_303"
                     /old_locus_tag="Atu5218"
     CDS             214275..215417
                     /locus_tag="ATU_RS24950"
                     /old_locus_tag="AGR_pAT_303"
                     /old_locus_tag="Atu5218"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010172865.1"
                     /note="Members of the family are the ATP-binding subunit
                     of ABC transporters for substrates such as betaine,
                     L-proline or other amino acids, choline, carnitine, etc.
                     The substrate specificity is best determined from the
                     substrate-binding subunit, rather than this subunit, as it
                     interacts with the permease subunit and not with substrate
                     directly; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="betaine/proline/choline family ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_162180324.1"
                     /translation="MDLLKAGAGKEQVLAETMAVVGLNDVSLSVPAGAMYMIMGLSGS
                     GKSTLARCINRLNEPTAGKILLDGRDIVPLKPAELRDIRRRRVSMVFQHFALLPNKTV
                     IENAEFGLKMRGVPLQQRRERAEEILSIVGLAKWAKHYPHELSGGMRQRVGLARALAT
                     DADLLIMDEAFSALDPLIRSEMQDELLRLQRTLNKTIVFITHDFQEALKLGTRIAIMK
                     DGAVVREGTPQAIVADPRNDYVSAFTRDIDRSRVFEARAVMQHCEALGRSGEIQIVGQ
                     TAGKTKRAGFALDPSGRVVGLLDQAALLQLDSGSSCESLMSRDFVKIRENTKLIDAAR
                     MNRPQQPMAVVDEDDRFVGLLESDQILACIASSSSPAASAHGEKNV"
     gene            215410..216333
                     /locus_tag="ATU_RS24955"
                     /old_locus_tag="AGR_pAT_304"
                     /old_locus_tag="Atu5219"
     CDS             215410..216333
                     /locus_tag="ATU_RS24955"
                     /old_locus_tag="AGR_pAT_304"
                     /old_locus_tag="Atu5219"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012314182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline/glycine betaine ABC transporter
                     permease"
                     /protein_id="WP_010974477.1"
                     /translation="MFDANDLAVFPIDAWIADGVQWIALNLRPLFVAIKWPIENLLAF
                     NDHILHAIPFPIFLVLSFLIAYRLASLGIAIFTAISFVVIASLGVWDESMTTLSLIST
                     AIVISTVIGIPVGIWCAINNSVWQVVRPVLDIMQTTPTFVYLVPVVMLFGVGTVPGEV
                     AVVIAAAPPLIRFTNLGIRMVETEMVEAGLAFGADRRQLLWEIQFPLAIPTILGGLNQ
                     TVLTAMVMSVVVAMIGAEGLGLVVLQGLGRLDVGRAAVGGIAIILLAMILDRITQKLA
                     MPATSKAKRSFRTTLSTVLMGARSKPSAGTA"
     gene            216481..217518
                     /gene="proX"
                     /locus_tag="ATU_RS24960"
                     /old_locus_tag="AGR_pAT_305"
                     /old_locus_tag="Atu5220"
     CDS             216481..217518
                     /gene="proX"
                     /locus_tag="ATU_RS24960"
                     /old_locus_tag="AGR_pAT_305"
                     /old_locus_tag="Atu5220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011581856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine betaine/L-proline ABC transporter
                     substrate-binding protein ProX"
                     /protein_id="WP_010974478.1"
                     /translation="MTLNFKSFALLASTIVAASLPVLSSASAAELPGDGKTIRFAQSD
                     SLGANYVVAKIVTKGFEALGYKVKLSTVNTTLFFQAVAQGDLDIATDINFPQREPGFR
                     KVADKADMIGKGLIEGGGINGYLIDKKTADAYNIKTLDQMKDPKIAALFGTDGKADLI
                     NCDPGWSCGDVVEYQLDKFGLKDTVKSVRGKYEALMVEAVARAKRGEPVFFYAWSPSW
                     MNKALQPGKDVVWLPTPFDALPPSVPSSGTNAVANVEGCAGAANPCRMAMAAWNWTAV
                     GNKEFLKENPEVKSFVENMSFPLSTWSSWEQAISQKGGSDATVRGLSDAWLSENKALL
                     DGWITAAKSAN"
     gene            complement(218275..219201)
                     /locus_tag="ATU_RS24965"
                     /old_locus_tag="AGR_pAT_311"
                     /old_locus_tag="Atu5222"
     CDS             complement(218275..219201)
                     /locus_tag="ATU_RS24965"
                     /old_locus_tag="AGR_pAT_311"
                     /old_locus_tag="Atu5222"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013591607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxylate/hydroxypyruvate reductase A"
                     /protein_id="WP_010974480.1"
                     /translation="MTLLYHADPERGAEWAQLFAERAPEIPFEYRPDAIAPDAVRFLA
                     VWHPPAGMLQRYSNLEVLFSLGAGVDQFDLGDIPQDLPLVRMIEPGIAEGMAEYVSLS
                     VMLLHRHFLDYVGQQRAEVWKLKRFHPSSRLRVGFLGAGMLAQAAIARLWPFGFTLSA
                     WSRSEKTIEGVTCYHGEDGLNAFLPQCDILVCLLPLTPETRGMLNDALFSKLPKGAAL
                     INCGRGQHLVHNDLLAALATGQLSRAILDVTEPEPLEPGHPFWRNEKIFLTPHTASMT
                     QPDTAVDAIIDNIRRHRAGKTMVGLVDRNSLY"
     gene            complement(219276..219875)
                     /locus_tag="ATU_RS24970"
                     /old_locus_tag="AGR_pAT_313"
                     /old_locus_tag="Atu5223"
     CDS             complement(219276..219875)
                     /locus_tag="ATU_RS24970"
                     /old_locus_tag="AGR_pAT_313"
                     /old_locus_tag="Atu5223"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013790211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid synthesis family protein"
                     /protein_id="WP_162180319.1"
                     /translation="MVELNVRKYATFVEETLIEGGKAADRPIRSVVVAAVLRNPWAGR
                     GWVENLRPEILSLAPPLGRELTDRLTALMSADQVEAYGKAAVVGVNGEIEHASGLIHT
                     LRFGNMFREAVNGTAFLSFTNIRTAPGALVSLPMIHKSETGKRSHFLTATFQMVDAPA
                     PDEILVAIGASDGSRAHPRISDRFQDMEEMAKDAAAKAS"
     gene            complement(219946..220260)
                     /locus_tag="ATU_RS24975"
                     /old_locus_tag="AGR_pAT_315"
                     /old_locus_tag="Atu5224"
     CDS             complement(219946..220260)
                     /locus_tag="ATU_RS24975"
                     /old_locus_tag="AGR_pAT_315"
                     /old_locus_tag="Atu5224"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013690834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NIPSNAP family protein"
                     /protein_id="WP_010974482.1"
                     /translation="MIVEERIYRIRGGKMQEYLKLVREEGIAIQAPILGNLIGYFVTD
                     IGPLSQVIHMWGYASLDDRAERRGKLAEDQRWQAFIPRLSVLIESSENRILLPTDFSP
                     LR"
     gene            complement(220257..220646)
                     /locus_tag="ATU_RS24980"
                     /old_locus_tag="AGR_pAT_316"
                     /old_locus_tag="Atu5225"
     CDS             complement(220257..220646)
                     /locus_tag="ATU_RS24980"
                     /old_locus_tag="AGR_pAT_316"
                     /old_locus_tag="Atu5225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003591467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxymuconolactone decarboxylase family
                     protein"
                     /protein_id="WP_010974483.1"
                     /translation="MDKPLQQAGEAVRRKVLGDSYVDRALEKADDFSRPFQDILNEYC
                     WGMAWTDDALDLKQRSLLNLGMLAALGRMHEFRIHFRGALRNGLTEAELRAALTQIAV
                     YCGIPAGVEAFRAAQEVRAEMQKEAQA"
     gene            complement(220639..221451)
                     /locus_tag="ATU_RS24985"
                     /old_locus_tag="AGR_pAT_317"
                     /old_locus_tag="Atu5226"
     CDS             complement(220639..221451)
                     /locus_tag="ATU_RS24985"
                     /old_locus_tag="AGR_pAT_317"
                     /old_locus_tag="Atu5226"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011581851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta fold hydrolase"
                     /protein_id="WP_010974484.1"
                     /translation="MGYVGTLKVGEVQLAYRLDGEGSRPLICIHGVGSYKEAWDGVVD
                     PLKNDFTILTFDLRGHGASSRIKGRYEIEDFVREVIALANHVGFKTFSLAGFSLGGLI
                     AQKLALTHQERVDHLILLSTVAGRTQEEKDRVAGRLAALTAGEPGSHYDASLSRWLTE
                     EFQQNNPDKIARLRARNAENDPDCYAAAYRVLAETDLGEELSQIGVPTLIATGEDDSG
                     SNPRMAGFLHSKIANSMLRILPGLRHSILTEAPELVASIMRDFLNKTRKAHG"
     gene            complement(221454..222530)
                     /locus_tag="ATU_RS24990"
                     /old_locus_tag="AGR_pAT_318"
                     /old_locus_tag="Atu5227"
     CDS             complement(221454..222530)
                     /locus_tag="ATU_RS24990"
                     /old_locus_tag="AGR_pAT_318"
                     /old_locus_tag="Atu5227"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003591463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LLM class flavin-dependent oxidoreductase"
                     /protein_id="WP_010974485.1"
                     /translation="MKFAVAISMERGSPDASMHTVKNNMLEIAKMADEGGFETLWTSE
                     HHTIEATIAPNPFQTLVWLGQHTDRIRLGTGTLAAAYWNPIRLAGESAFCDHLIGGRL
                     EFGIARGAYQYEFDRMLPGIQQQEGVGYMKELVPAVQKLWQGDYAHDGHYWKFPKTAA
                     VPKPLQKQLPPIWVAARDPGTFDWAVSIGANIMSTPLSSPAAEIYVLAEKFRKAISDH
                     PEVPRPRFMMQRRTSVYAKADDWEIPVRHSIDYGRTFENLMQNIGTVKDGFPEAVPYE
                     LVRNKDNYNPESIRKNLMFGTPDEVIEKLMDYEAAGVDQYCLGLSFNQPFELQRQTLR
                     LFIDEVMPVFAAREKEMKRTASVG"
     gene            complement(222561..224072)
                     /locus_tag="ATU_RS24995"
                     /old_locus_tag="AGR_pAT_320"
                     /old_locus_tag="Atu5228"
     CDS             complement(222561..224072)
                     /locus_tag="ATU_RS24995"
                     /old_locus_tag="AGR_pAT_320"
                     /old_locus_tag="Atu5228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013690837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_010974486.1"
                     /translation="MQTTAEAIKGKRLGLFIDGRFVEPRSGKFVDSYDPTTGEAWYQF
                     AEGGADDVDLAISSAQRAFRDPSWRRMTQTARGKLVRRLADLVLEHAEDLALLETRDN
                     GKLIKEMRAQMRAIPDSYLYFAGMADKLQGDTIPVNKLDQLNFNMREPLGVIGMVTPW
                     NSPLMLLTGTLAPCLAIGNTVVIKPSEHATASTLALAELIVEAGFPAGVVNVVTGGGA
                     VTGEALTRHNGIAKFVFTGSTATGRRIAANAAANLVPCQMELGGKSPHVVFSDVDIEK
                     TVNGVVSGVFAAAGQTCVAGSRCFVEANIYDRFIEALVERTRNIKLGDPMDDATDIGP
                     LALESQLSKLEGYVASGVREGSRIAIGGKRPQSEELSRGWYFEPTVMADATNDMSFMR
                     HELFGPMVGVMPFSSEEEMISLANDTNYGLASGIWTQNIDRAMRFANQIDAGTVWINT
                     YRSAAYMSANGGFKESGYGRRGGFDVMREFSRAKNVVIDYSGAMQDPFVIRLR"
     gene            complement(224094..225065)
                     /locus_tag="ATU_RS25000"
                     /old_locus_tag="AGR_pAT_322"
                     /old_locus_tag="Atu5229"
     CDS             complement(224094..225065)
                     /locus_tag="ATU_RS25000"
                     /old_locus_tag="AGR_pAT_322"
                     /old_locus_tag="Atu5229"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019169959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavin reductase"
                     /protein_id="WP_010974487.1"
                     /translation="MTETHPAIDPIALRKAFGTFVTGVTIVTTYDADGNPRGMTANSF
                     TSVSLDPPLLLICVGKSAASYEAFCQTESFAVNFLHEGQVDVSGIFASKTADKFGSVR
                     HHRVHTGAPILADSLSWFDCTVFNRVEAGDHVILIGEVRAFGTSPQAPLGFCRGRYAS
                     VKDPLPEGWLEAQGMVIGYLVEANNSVLLRADGKGGWVLPVGRKRKADTELKLREDSA
                     ISLHPDATFLYSVYDVADTDPGHLIYRAELSSHTSVPELPEGYRFFPIDEIPYDLIPT
                     RELQAVLRRYTRERQDRSFGIYMDSGDGGRFATIDGQARPWSNAINK"
     gene            225619..227424
                     /locus_tag="ATU_RS25005"
                     /old_locus_tag="AGR_pAT_324"
                     /old_locus_tag="Atu5230"
     CDS             225619..227424
                     /locus_tag="ATU_RS25005"
                     /old_locus_tag="AGR_pAT_324"
                     /old_locus_tag="Atu5230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016558185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_010974489.1"
                     /translation="MDQKSKILSLREVASQINSGGDIVTILTELVAASCRHGNWTLGS
                     IMGIDAANGYAYVIARHDPGIIPRNLTERWELATSPSLIALQRNEPVYIRDVRESEEF
                     PGYRKESFERDYRTVLVMPMNCIDEQNRPMVLSVVSRSITEITEEELAFMGTIVHLGA
                     IAVEKQRRLAAEEKTAGRLDRALAAHTSMLEHVLSDGSVSSLASMAGRLLPDPLIVVD
                     FTTNQIIAGRSPLPDTIDDDAWQAAASGAFAKALTKAARESLSTVASQMVPILLDTGS
                     IRLKVAARMETLMVDKQHVGALIIFSNPATSGELDQIMLDSAKFALSVQMMRSFLRFR
                     FETRTQSELFFEVVERRWRDPADISQRATRLGLDFSSSQQMIVVDFPQKAKAFGGGSV
                     DVQHTISRVMQQVGLAANLVAIEGGLVCLMPYETTRRREKTGKIMQRIADELKRYFEE
                     APIVVASTRCAGLDDYPSAWDRCNRMISIGRSFGLTGAVSTQDFGPLPMLVSAADVSD
                     VRSFVRESIGAMAEHDREHQTPYLETLSVYLQESCRAQACADRMGLHVTTLRYRLARI
                     QELFGIDVETPDKRFAVELAIRLHRVIDNPVFGEK"
     gene            227580..228488
                     /locus_tag="ATU_RS25010"
                     /old_locus_tag="AGR_pAT_325"
                     /old_locus_tag="Atu5231"
     CDS             227580..228488
                     /locus_tag="ATU_RS25010"
                     /old_locus_tag="AGR_pAT_325"
                     /old_locus_tag="Atu5231"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019860264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_035257094.1"
                     /translation="MRVDEILKPGERIQIDAFAMQLGDVAGADLEQLHALSISVGWPH
                     RAEDWQFLRNVGNGVVATDDIGRIMSSAMWFRQSPELATIGMVITSPRLQTHGTGLWL
                     MEHALRELEGVNLRLNATRAAQRLYLSLNFMPEKTVYQCQGIVTEAPNERDLSGELRV
                     LGPDDLIAVTALDTAAFGVVRAVVIEKLMSTSRGYGLFRDGVLKAFALCRRFGRGHVV
                     GPIVASDDEEAIAVLSPHIRDRQGRFLRLDTHFETGDFALFVLRNGLTVYDTVLTMSR
                     GKRLADFATGETRAPLTYSLASQTLG"
     gene            complement(228771..229163)
                     /locus_tag="ATU_RS25015"
                     /old_locus_tag="AGR_pAT_326"
                     /old_locus_tag="Atu5232"
     CDS             complement(228771..229163)
                     /locus_tag="ATU_RS25015"
                     /old_locus_tag="AGR_pAT_326"
                     /old_locus_tag="Atu5232"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004110878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RidA family protein"
                     /protein_id="WP_010974491.1"
                     /translation="MNCEKLIRYAVADAQAGGQRRPFAKAVRAGDFVYVSGQVPTFDG
                     EIIVGNIVAQTERVIANIIEVLALAECTLADVVKVNAWLDDARDFSSFNAVFQKHFID
                     HPPARSTVQSPMMVDVKVEMDVIAYKPI"
     gene            229296..230567
                     /locus_tag="ATU_RS25020"
                     /old_locus_tag="AGR_pAT_328"
                     /old_locus_tag="Atu5233"
     CDS             229296..230567
                     /locus_tag="ATU_RS25020"
                     /old_locus_tag="AGR_pAT_328"
                     /old_locus_tag="Atu5233"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid deaminase"
                     /protein_id="WP_010974492.1"
                     /translation="MQSSSALRQSTGDQSEYHAQSNMIGSSPADGLLALPLLTVDLAV
                     YRGNRDRFLALVSAHGAKAAPHAKTPMCPEIAIDLIEAGAWGATVADLFQAEVLLKAG
                     VSNILIANQIGGLTSARRLRMLADAFPKAEIICCVDSVQASANLVQAFQGRVDAPFKV
                     FIEVGVGRTGARTLNVAKDIIDTISTSAEIVLAGVSTYEGSVSGETSEALDANMAALF
                     DLLTDSLASIREKDPGRPLTVSAGGSIHFDRVLAALVPVCEADGNATLLLRSGAIFFS
                     DHGVYQRGFQAVDARNLLASGKVVFKASEAFQPSMRIWAEVISVPEPGLAIVGMGMRD
                     VSFDQDLPVALRLHRDGHLVEADLSSSAKVGKLNDQHAFLSFGNGSSLAIGDVIEFGI
                     SHPCTCFDRWRVFHGIDGSGRIQRIYTTFFH"
     gene            230576..231244
                     /locus_tag="ATU_RS25025"
                     /old_locus_tag="AGR_pAT_329"
                     /old_locus_tag="Atu5234"
     CDS             230576..231244
                     /locus_tag="ATU_RS25025"
                     /old_locus_tag="AGR_pAT_329"
                     /old_locus_tag="Atu5234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019994506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_010974493.1"
                     /translation="MPSFNFRPLWRYEDQFIDGVLTTLLLTVSATAIGLIIGIIGAVV
                     LRSGPKPARIGVRAYIEIIRNTPALLQIFIIFFVLPTIGLKFSPIHASIVALSIYFGA
                     YASEILRSGLNSIPPSQIEAGVCLGLTRWQVLSRIVLPPAIRNIYPSMTSQFVLLLLG
                     TSIASQVSTDELFHAAGFIDSRTYRSFEVYALTCGIYFTLVVFFKIVFALVGRAVFRW
                     PTRR"
     gene            231254..231904
                     /locus_tag="ATU_RS25030"
                     /old_locus_tag="AGR_pAT_330"
                     /old_locus_tag="Atu5235"
     CDS             231254..231904
                     /locus_tag="ATU_RS25030"
                     /old_locus_tag="AGR_pAT_330"
                     /old_locus_tag="Atu5235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014495918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_010974494.1"
                     /translation="MRQFSFSDLLFLATALEWTFLMAAIALAFGVPLGLALAIARTSG
                     STVLRVIASAFVELIQGIPLLGLLMFFYFGIPVLAGKDVPTVVAVGAAYTIYTAVFLG
                     DIWRGGIQAVRQAQWEAGACLGLSWLQQFVHIIGPQAFRIALPATVGFLVQLIKNTSL
                     ASVVGLVELARAGQMISAGTFQPLLVYTLVAAIYFTICFPLTTWSRTLEARLNGAR"
     gene            231891..232622
                     /locus_tag="ATU_RS25035"
                     /old_locus_tag="AGR_pAT_331"
                     /old_locus_tag="Atu5236"
     CDS             231891..232622
                     /locus_tag="ATU_RS25035"
                     /old_locus_tag="AGR_pAT_331"
                     /old_locus_tag="Atu5236"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019994508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_010974495.1"
                     /translation="MALVEIKNVRKNYGPLEVLKGVSLDVEKGEIVTIIGRSGSGKST
                     LLRCINALETINSGEILLEGQPVSANMDGLRQMRQKVGIVFQAFNLFPHMTIEKNVTL
                     APVLTGRTDKRGARELALSVLERVGLADKLKAYPEQLSGGQQQRVAIARCLAMSPHLM
                     LFDEVTSALDPELVGEVLKVMEEMAAQGMTMVLVTHEMSFARNVATKLVFMHQGRVWE
                     QGDPKRLFADPQTPELKSFIGHHAR"
     gene            232662..233441
                     /locus_tag="ATU_RS25040"
                     /old_locus_tag="AGR_pAT_333"
                     /old_locus_tag="Atu5237"
     CDS             232662..233441
                     /locus_tag="ATU_RS25040"
                     /old_locus_tag="AGR_pAT_333"
                     /old_locus_tag="Atu5237"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011086754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="WP_010974496.1"
                     /translation="MKLFKRIIAAATIAAALSAPAFADTLADVTSNGKLRVGVLLDAA
                     PWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTGASRIPSLLADKVDVLIAAAGA
                     TPERAQQVMFSQPYAAVSLGVFGGDGEKIDDVSGLAGKQIAVAKGSTLDTWLTDNAPE
                     VKLVRFEDTPSAIAAFLAGQADYFAENSAIAVKVADDNPGKNVAIVYRIRLSPAHVGV
                     KQGEQNFLNWINTFLFFHNMNGDLAKLQMTFFKEKQTLPHM"
     gene            233536..234543
                     /locus_tag="ATU_RS25045"
                     /old_locus_tag="AGR_pAT_335"
                     /old_locus_tag="Atu5238"
     CDS             233536..234543
                     /locus_tag="ATU_RS25045"
                     /old_locus_tag="AGR_pAT_335"
                     /old_locus_tag="Atu5238"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014495922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinylglutamate desuccinylase/aspartoacylase
                     family protein"
                     /protein_id="WP_010974497.1"
                     /translation="MHTGLFHSIDFNAEGKQFGWLSAPFSVDRSPYFHVRTPICTIRN
                     GDGPSILLMAGNHGDEYEGEINLKRLIRSIEPADITGRLTIIPFANMPAVMAARRCSP
                     LDGGNLNRAFPGSMEGNPTSRIANFLERELFPGYDIVFDMHSGGTSMAHLATGLIEEN
                     DDPERHAKAVALLNALGMPYAFIARNGIDAPTSMAAVARAGAIGISGEFGGGGSVTPE
                     TMSITALAINNLLIASGMATKPLLPSKSKSQKTRLLSLNSHDQAIYATRTGWFEPAVD
                     IGIEVQAGDIAGWYHNFEQLTETEEELRFAVPGVVISRRLHTQSQNGDCLIQVGRLIR
                     D"
     gene            234576..235679
                     /locus_tag="ATU_RS25050"
                     /old_locus_tag="AGR_pAT_336"
                     /old_locus_tag="Atu5239"
     CDS             234576..235679
                     /locus_tag="ATU_RS25050"
                     /old_locus_tag="AGR_pAT_336"
                     /old_locus_tag="Atu5239"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019402576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_162180320.1"
                     /translation="MAKAAENETGGIIYDEVVRIPARSPRAAATALLEDNAPLETASI
                     GDVARLAGVAPITVSRALRNPEKVSAEKRARIEAAVERTGYRVNPFASALKSGRSNVV
                     MAFASNMFSEQFALALHACANVLEEAGYLFLVGQTSYSYDRETAAIRSLQALKPAAVM
                     FTGVIELEQNRETLRNLGIPIMETWAFPRDPIDMLVGFSNTEAGRLAAEALADGGYKK
                     VGFIGRRGGRGALRLKGFRDSCRDLGLEFVGEFLSDEVAGPSDGRRCLSTLLESGASV
                     DAVFCANDLLALGTLMEARRRKLSIPKDFGVIGFGESDIAAEIPPGLTTVGIDSAQLG
                     KIVGEMLLNRLSKGEIAAPIRRVDLLVTHRGSV"
     gene            complement(236265..237287)
                     /locus_tag="ATU_RS25055"
                     /old_locus_tag="AGR_pAT_339"
                     /old_locus_tag="Atu5240"
     CDS             complement(236265..237287)
                     /locus_tag="ATU_RS25055"
                     /old_locus_tag="AGR_pAT_339"
                     /old_locus_tag="Atu5240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020497501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase catalytic
                     domain-containing protein"
                     /protein_id="WP_010974500.1"
                     /translation="MKAVVMTGANQPWEVQEVPVPKAEPGLVLVKIHASGMCYTDVWA
                     TQGAGGDIYPQTPGHEVVGEIIEVGAGVHTRKVGDRVGTTWVQSSCGRCSYCRQNRPL
                     TGQTAMNCDSPRTTGFATQGGHAEYIAISAEGTVLLPDGLDYTDAAPMMCAGYTTWSG
                     LRDAEPKPGDRIAVLGIGGLGHVAVQFSKALGFETIAITHSPDKHKLATDLGADIVVA
                     DGKELLEAGGADVLLVTTNDFDTAEKAMAGVRPDGRIVLCALDFSKPFSIPSDGKPFH
                     MMRQRVVGSTHGGQHYLAEILDLAAKGKVKPIVETFALEQATEAYERLSTGKMRFRGV
                     FLPHGA"
     gene            237445..238386
                     /locus_tag="ATU_RS25060"
                     /old_locus_tag="AGR_pAT_bx130"
                     /old_locus_tag="Atu5241"
     CDS             237445..238386
                     /locus_tag="ATU_RS25060"
                     /old_locus_tag="AGR_pAT_bx130"
                     /old_locus_tag="Atu5241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003501240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974501.1"
                     /translation="MMKAIHQSKGNDLAAFSAFLAVATHRSFRSAADELNMTPSAISH
                     SIKVLEERLNVRLFNRTTRSVSLTEAGERLASKLKPAMASIEEAVQELEGNGPVPSGT
                     VRINASEGAIRLVLRPVLAPFLREYPQVHLDIVSDGRLSDIVADGFDAGIRLAEAVPK
                     DMVAIPVMGEVRFAAVASPEYFERRGYPLIPQDLHSHDCIRFRFESGAIYRWEFERMG
                     ASERINVSGPLTLSDQPLMVEAAIDGIGIAFVPDHLATEALEHGRLERVLEDWCPALP
                     GLCLYYSGRRHVSSGLRALINMLTHRPMIPRSGSTPC"
     gene            complement(238670..239824)
                     /locus_tag="ATU_RS25065"
                     /old_locus_tag="AGR_pAT_343"
                     /old_locus_tag="Atu5242"
     CDS             complement(238670..239824)
                     /locus_tag="ATU_RS25065"
                     /old_locus_tag="AGR_pAT_343"
                     /old_locus_tag="Atu5242"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018431051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P1 family peptidase"
                     /protein_id="WP_010974502.1"
                     /translation="MINETNKACQKRARDFGIAFDGMPGPLNAITDIAGIHVGVSTIR
                     EEVPRPGRKLPVRTGVTAILPHATASEPVPVFAGIHRFNGNGEMTGSHWIDDGGYFVG
                     PVLITNTHSVGIAHHSAARWMIDRYSATYEGDEQLWIMPVVAETYDGLLNDINGQHVT
                     VDHVFEALNGANTGPVAEGSVGGGTGMIAYGFKGGTGTASRRIAVGGEEFTVAALVQA
                     NHGQRDWLSIGGLPVGKLLQQTDPDLSERGSIIVVIATDVPLAPHQLQKLARRGAIGI
                     GRNGTVGGSNSGDIFLAFSTANPHPMRHKAGPLLSIVMVNDDVLDPVYQAVVQSVEEA
                     VVNAMIAAETTGGTPYDRYRIEAIDGNEVARLLAAVTALHRGSQAPRRDI"
     gene            complement(239853..240614)
                     /locus_tag="ATU_RS25070"
                     /old_locus_tag="AGR_pAT_346"
                     /old_locus_tag="Atu5243"
     CDS             complement(239853..240614)
                     /locus_tag="ATU_RS25070"
                     /old_locus_tag="AGR_pAT_346"
                     /old_locus_tag="Atu5243"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR/GlpR transcriptional regulator"
                     /protein_id="WP_010974503.1"
                     /translation="MKKPKSVRQERILTELNQAPSLRVAELARRLDVSTETIRRDLDE
                     MTEQGLLNRTYGGAVRSLSTEPSVTERHTLFVGERERIAKAAVQILKGAQVLMIGSGS
                     TTVHTARRIAVEMKNITVLTHSFGVATVLAINPTIKVVMLPGDYHATEGATVGAHAVS
                     FLNSFYADFTILGASGLGPDGPSDALLECGAVYSAMVSRAARTIVVADHSKHDRLFPA
                     RYAPWRDIAHVVTDKAPGEDLTESLDSSGVKLTVC"
     gene            complement(240611..241090)
                     /locus_tag="ATU_RS25075"
                     /old_locus_tag="AGR_pAT_347"
                     /old_locus_tag="Atu5244"
     CDS             complement(240611..241090)
                     /locus_tag="ATU_RS25075"
                     /old_locus_tag="AGR_pAT_347"
                     /old_locus_tag="Atu5244"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_071241518.1"
                     /translation="MDCSLDLFARNVPDTTWPMKAPEVLCLDKSPGVRFAAKQAVLSW
                     SLTRPGFVRADTAVWLEVSDADPPIDIAPVDLPRAGLTWADYGEAAQLMTLRDVTKNH
                     PPNGNAATPLLSASRPLTLPMPAVGADTPRLGQSGTMAGGRAWMAEQTCTSQGSQER"
     gene            complement(241102..241803)
                     /locus_tag="ATU_RS25080"
                     /old_locus_tag="AGR_pAT_348"
                     /old_locus_tag="Atu5245"
     CDS             complement(241102..241803)
                     /locus_tag="ATU_RS25080"
                     /old_locus_tag="AGR_pAT_348"
                     /old_locus_tag="Atu5245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013653843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine hydrolase"
                     /protein_id="WP_010974505.1"
                     /translation="MNWKTERRSFYYQGAPEPEDPVLEKGKVALLVIDMQNTYLDRPD
                     PDALSGNDLVRYHAWAPFHERMHGTVIPNTQHLLERFRALGLDVFFARIACLRADGRD
                     RSLSQRKPGWNNLLLPKDEEASQILPQIAPRDGEIVVTKTTDSALTGTNLRLLLANMG
                     ITHVVCVGIFTDQCVSSTVRSLADESFDVIVVDDACAAGSVDLHESELQRLHMIYANV
                     MTTDEVIGYLPLTGA"
     gene            complement(241814..242620)
                     /locus_tag="ATU_RS25085"
                     /old_locus_tag="AGR_pAT_349"
                     /old_locus_tag="Atu5246"
     CDS             complement(241814..242620)
                     /locus_tag="ATU_RS25085"
                     /old_locus_tag="AGR_pAT_349"
                     /old_locus_tag="Atu5246"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974506.1"
                     /translation="METRSQIRARAFVKAWTAFVVLAVYLPILCGALAGLSKGRYFGF
                     PIRVFSTEWWGKTLASLEIQTLVQNSILIAFIVTLVSVILAFFGALAFARYEWKGRKL
                     FQKAILLPVFFPQPVLGLALLLWFNALGINPSWQTAVVAHLVWIVPVVTLVIAIQVYS
                     FDPTLEEAARDLGASRWFILREITLPILWPGIWSGALFAFLLSWGNFPLSLYTAGVDS
                     TIPKWLYSKMVAGYSPMVPALGTMSTLSAAALLLAGGLTIMLVRRRQADA"
     gene            complement(242624..243520)
                     /locus_tag="ATU_RS25090"
                     /old_locus_tag="AGR_pAT_352"
                     /old_locus_tag="Atu5247"
     CDS             complement(242624..243520)
                     /locus_tag="ATU_RS25090"
                     /old_locus_tag="AGR_pAT_352"
                     /old_locus_tag="Atu5247"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974507.1"
                     /translation="MATMTHAETAGGKSPLPSLSAGLRAAAPVTILLLLGFLAPLLTV
                     AAYAFATPKSFTVFRSFTFANFAVIFDASNTVWMSFAWSIAYALATVILLAVIAYPIA
                     YGLNRMFGRWSGLVGVLFVFPLFVSENVRLYGWVLFFIKNGVLDGGLKWLGFSGGPEL
                     LYTPGAILFGMIYVYLPFMLFPMSLGIAMIPRDLVDAARDLGADRLMIWREIELPLAM
                     PGILIGMLLTFVLGAGAIAESKILGGQSVITIAQDIEIAFTYAQNWPLGSALALLLVA
                     IVSGLALYVLSKLDLDRILGKK"
     gene            complement(243522..244652)
                     /locus_tag="ATU_RS25095"
                     /old_locus_tag="AGR_pAT_353"
                     /old_locus_tag="Atu5248"
     CDS             complement(243522..244652)
                     /locus_tag="ATU_RS25095"
                     /old_locus_tag="AGR_pAT_353"
                     /old_locus_tag="Atu5248"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010974508.1"
                     /translation="MSLAMISPSLPDTSSTIQAQVQPAPKPVLQLVDVRKIFGDFAAV
                     DGISVDIKEGEFVTIVGPSGSGKTTLLRMLAGMESPSEGYITLRGEVINSVPADKRPT
                     CLVFQSLALFPHKTVGENIEFPLKVRKMPAAERRIRALEFMRMVRLPESYYSKNVMRC
                     SGGEKQRVALARAFAYDPDVLFFDEPLSALDYKLKKVLEKELKDLHRESGKTFVYITH
                     SLEEAMVMSDRVGVMSRGHLVQIGTPEEIYTKPATRFVAEFFGEVNSFEVKRKGEGAW
                     TLADGKPITVAPVAEAIGETATVIVRPETMRFITGASSADNLISGTIYNEYSLGSRMQ
                     YQVHSGDRIYLVEAARSAVSGVSSGDLVTIGWDASDAIVVGD"
     gene            complement(244682..245821)
                     /locus_tag="ATU_RS25100"
                     /old_locus_tag="AGR_pAT_354"
                     /old_locus_tag="Atu5249"
     CDS             complement(244682..245821)
                     /locus_tag="ATU_RS25100"
                     /old_locus_tag="AGR_pAT_354"
                     /old_locus_tag="Atu5249"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013653847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="WP_010974509.1"
                     /translation="MMKISRRNMMQMMGAAAFAGPLASATRAFAAREKELNILCWEGY
                     NSAQVLDPFRSSESATVKAESLTNDPTMINRLRAGETKIWDLINVNNPWARKVMGPAG
                     LIKPLPRAEFEPYFDAMLPNFKAPYRWAMSDDGGDLLGMAQRFGPYSFVVNTDKISKS
                     TAEEQGWDLFNDASLAGKYGIQESDDWNVFNIFLIAGIDPFKEHTQEQFKVFAETAEK
                     VFKGAKMVGDMASLNQALVSGEIDLYMTGGTYSVSPARADGYTNLRAITPLRGPMDGK
                     GGISWIEITSTVNNPELSPLAVEFLKYVQDPKVAHTVAFAEGTFNPVTQMGNPKCFEL
                     FTKDEMEAIQWDTVEEDMARSAQYDIVPDYDKALELMTAAKRLRG"
     gene            246126..246899
                     /gene="fabG"
                     /locus_tag="ATU_RS25105"
                     /old_locus_tag="AGR_pAT_355"
                     /old_locus_tag="Atu5250"
     CDS             246126..246899
                     /gene="fabG"
                     /locus_tag="ATU_RS25105"
                     /old_locus_tag="AGR_pAT_355"
                     /old_locus_tag="Atu5250"
                     /EC_number="1.1.1.100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018388759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase FabG"
                     /protein_id="WP_010974510.1"
                     /translation="MLKSLQGKTVIVTGASRGIGKGIALRFGEAGLNVLVVSRSQVDA
                     DRVASEIGVNGSGFAADVSTEEGCKAMVDAAVTRYGGVNVLCANAGIFPAAKLGEMSA
                     ADFDHVISTNLKSTFLSVSAVLPAMTSAGAGRIIITSSITGPITGYPGWSHYGASKAG
                     QLGFMRTAAIELAPKNITVNAVMPGNIMTEGLEGNGPDYIATMEASVPLRRLGMPADI
                     ANAALFFASEEAAYITGQSIVVDGGQILPESLGALEVMG"
     gene            complement(246949..248286)
                     /locus_tag="ATU_RS25110"
                     /old_locus_tag="AGR_pAT_358"
                     /old_locus_tag="Atu5251"
     CDS             complement(246949..248286)
                     /locus_tag="ATU_RS25110"
                     /old_locus_tag="AGR_pAT_358"
                     /old_locus_tag="Atu5251"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013653849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="WP_010974511.1"
                     /translation="MSATTKEILDLNRFDASRTEGFPAELAERVAKRQATFGASSVLF
                     YEQPIEMVSAQGAYLYDAGGRKYLDVYNNVPSVGHCHPRVVEAIARQVGELNIHTRYL
                     NRVVEAYTENLLSKFPAGLSNVVLTCTGSESNDLALRIARIGTGAEGFIVTEAAYHGN
                     TALVTEVSPSSLRKRKPAAFVAIIPAPAARDGMSVASNFAASVEQAINELNSRGIKFA
                     ALIVDTIFSSDGIYADPAGFLKEAVDVVHRAGGLLIADEVQPGFGRTGGSLWGFERHG
                     VTPDIVTMGKPMGNGFPMGGVVTRPDLLQRFCEETGYFNTFGGNPVAAAAGHAVLRVI
                     EEEGLIERSATVGGYFKQSLQALQSRHSEIGDVRGAGLFIGLDFVDPATGEPDSTRAT
                     HAINQLRHNSILIGAAGKYGATLKIRPPLCFSNEDVDLFTGTLDIILQARRAA"
     gene            complement(248297..249286)
                     /locus_tag="ATU_RS25115"
                     /old_locus_tag="AGR_pAT_360"
                     /old_locus_tag="Atu5252"
     CDS             complement(248297..249286)
                     /locus_tag="ATU_RS25115"
                     /old_locus_tag="AGR_pAT_360"
                     /old_locus_tag="Atu5252"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase enzyme family protein"
                     /protein_id="WP_010974512.1"
                     /translation="MLYNTDFLSRLTQGVKYLSSAWGLSSEAKLTLLTISENATFRIA
                     DENSGRNLIVRVHRPDYHTEAEILSELAWIDALRQDGVVVTPRPISANDGSLLQIFSD
                     GETMRHAVAFEYMAGKEPDAESDLVHWYRTLGEINAKLHAHSRRWTRPENFIRKTWNF
                     NRILGNGAYWGDWRDALGLKPDGKSVLERTHALLETQTSAYGYGEERFGLVHCDMRAA
                     NLLVDGDRLGVIDFDDCGLSWFAYDFAAAISFMEHEPFIPDLMAAWLEGYRRVAPLDA
                     QHEAALPMFIMLRRMQLTAWIASHAETPTAQSMGTAYTDGTVALAECYLAEHR"
     gene            250092..251651
                     /locus_tag="ATU_RS25120"
                     /old_locus_tag="AGR_pAT_361"
                     /old_locus_tag="Atu5253"
     CDS             250092..251651
                     /locus_tag="ATU_RS25120"
                     /old_locus_tag="AGR_pAT_361"
                     /old_locus_tag="Atu5253"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007434549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_010974513.1"
                     /translation="MMKTGVLLLTSLIGLVAQPVMAKNLTIGLSGTVTSIDPHFYNAS
                     PNNAIAMQIFDRLTERTAEGRLVEGLATKWDTVSETKWRFALRDGVKWHDGKPFTSDD
                     VIFTLDRAGSVPNSPGGFGGFMRNIASVEADGDNAVIISTKAPAPTLPGDLANIAIVS
                     RHAGEGADTADYNSGKAAIGTGAFRLTTFKQGIEVGLERNPDWWGKKVAWDHATYRMI
                     SSASARTTAALAGDVDVIDAPAATDIARFKTTANLSFVSTPGLRVIYLAPSTSGDAWK
                     AFVKGPKGEALDNNPLADPRVRNALSEAINREGIVDKIMEGTATASGQWLPKGAFSYT
                     PDIQPPKPDAAGAKKLLADAGYPDGFQLTVHVPNDRYPNAPAVVQAVAQMWTRIGVKT
                     NVEALPWTTFSSRKSEFAMKLLGLGNATYDASSMLVNVLGTVDPKRGLGAANDSGYSN
                     PALDDLVSKAMMIYDDKAREAALIEAVKVAITDGAIIPLYQQSNAWVLRKGLNYAPRI
                     DERTLAKDVSE"
     gene            251803..252774
                     /locus_tag="ATU_RS25125"
                     /old_locus_tag="AGR_pAT_363"
                     /old_locus_tag="Atu5254"
     CDS             251803..252774
                     /locus_tag="ATU_RS25125"
                     /old_locus_tag="AGR_pAT_363"
                     /old_locus_tag="Atu5254"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019013526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_035257039.1"
                     /translation="MTLWIVQRLMQAILVALAMALIVFVGLHLIGSPIETLLPPEATY
                     DDRLRLIADLGLDRPLYEQFFLFLKGLLQGNLGVSYVYKEPAVELILSRLPATLELAF
                     AAVLLSLIVGVPLGLAAGWKPESPLARIIMIGSIFGFSLPIFWIAVLLIMIFSVQLGW
                     LPSSGRGATEILFGIPWSFVTLDGLRHMLLPAISLSLFNISMVTRLTEAGVREAMSSE
                     YVRFARAKGLSPKRILSVHVLKNVMIPVVTVVGLDIGQTIAFSVVTETIFAWPGVGKI
                     IIDSIAALDRPVIVAYLMLVVVMFVIINLVVDVTYRLLDPRIRLQGE"
     gene            252788..253675
                     /locus_tag="ATU_RS25130"
                     /old_locus_tag="AGR_pAT_365"
                     /old_locus_tag="Atu5255"
     CDS             252788..253675
                     /locus_tag="ATU_RS25130"
                     /old_locus_tag="AGR_pAT_365"
                     /old_locus_tag="Atu5255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007004432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974515.1"
                     /translation="MNSSTLRTGLLFMRQFARSPLAVMGLALIFLIVLMAVFAPYLSP
                     QNPYDLMQLDIMDGRMAPGTESSTGFTFLFGSDDQGRDMLSAILYGLRISLIVGLGSA
                     ALAFIIGTAFGLTAAYVGGRVETAMMRLVDLQLSFPTILSALLILALLGKSVGNVVFA
                     IVLVEWATYARTARGAALTELRREYVEAARSLRLPHRNILFRQLLPNCLSPLVVLLTM
                     QVARAITLEATLSFLGLGVPVTEPSLGLLISSGYEFILSGTYWIALFPGIALLVTIFA
                     INLVGDRLRQLVDPKAARR"
     gene            253672..254646
                     /locus_tag="ATU_RS25135"
                     /old_locus_tag="AGR_pAT_366"
                     /old_locus_tag="Atu5256"
     CDS             253672..254646
                     /locus_tag="ATU_RS25135"
                     /old_locus_tag="AGR_pAT_366"
                     /old_locus_tag="Atu5256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016832914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010974516.1"
                     /translation="MSAMLEIKGLKTEVVTDEGNITLIDDITLSLAAGEVMGLVGESG
                     SGKSVTGLSIMGLLDKPVQMTGGKILFKGRDLRSASQKELRSIRGNRIAMIFQDPMST
                     LNPVLRIDTQMMEVVHAHENVSKQVARERARDALGMVGIPSPEERLSAYPHQFSGGMR
                     QRVAIAIALLMSPDVIIADEPTTALDVTIQAQILSIVQKLAREKGTALIWVTHDLSVV
                     AGLAEKLSVMYAGRIVEQGLTADLLRRPLHPYTNGLIASLPAHNKRGERLRQISGTTP
                     SVANMPKGCAFHPRCSFATEICLNSPALEPTEGRLLRCFHPVMEGAPS"
     gene            254724..255632
                     /locus_tag="ATU_RS25140"
                     /old_locus_tag="AGR_pAT_367"
                     /old_locus_tag="Atu5257"
     CDS             254724..255632
                     /locus_tag="ATU_RS25140"
                     /old_locus_tag="AGR_pAT_367"
                     /old_locus_tag="Atu5257"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007009983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_162180325.1"
                     /translation="MGLKAPNPVVGALDDVSLTVSEREVVGIVGESGCGKSTLGRVVA
                     GLLQASEGSVLFRGKQLAEMDGKAAEDARLKVQMIFQDPSSSLNPRQRVREIIGAAPL
                     HHKMTSARELDDYVSQQMERSGLDPSMASWFPHQFSGGQRQRIGIARALAVQPDMLIC
                     DESVAALDVSIQAQILNLFLDLREQLDLTYLFISHDLSVVEHISDRVVVMYLGRVVEE
                     APVAELFAHPNHPYTRALLQERPSLDPVQRRFSSIEGEIPSPLSPPSGCHFHPRCPFA
                     MERCRVERPELRTIGSGHKGACHLND"
     gene            255668..256747
                     /locus_tag="ATU_RS25145"
                     /old_locus_tag="AGR_pAT_368"
                     /old_locus_tag="Atu5258"
     CDS             255668..256747
                     /locus_tag="ATU_RS25145"
                     /old_locus_tag="AGR_pAT_368"
                     /old_locus_tag="Atu5258"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005854931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydrolase"
                     /protein_id="WP_010974518.1"
                     /translation="MSVSAPLEHQQLTISQEFPTKEWANVTSPEKYGLSAEVRERVDA
                     MLDGLSTTSFMAVAAGKALYTYGDVSEVSYLASTRKSILSMLFGKAVAEGKIDLDLTM
                     ADLNIDEDHGLLPIEKTATLRNLLISSSGVYHQPGSPGSNTKNIPERGSKKPGDYFHY
                     NNWDFNVLGAAFEQLTGRSVFEAFEEDFAGPMGLQDFDPSRQRMMGYDGASRYLAYHF
                     FLSGRDMARLGLSMVRNGRWGDEQIIPADWVAESTRIRVPAGKMNESEKSRIAGYSYL
                     WWIPVVTKDTPEWDGAFVAAGHFGQFILGMPALDMVLVNRRAIPDDLAIARNDGSFKE
                     ELPAVTMEQFLSVADQLITAKLSVR"
     gene            complement(256758..257708)
                     /locus_tag="ATU_RS25150"
                     /old_locus_tag="AGR_pAT_370"
                     /old_locus_tag="Atu5259"
     CDS             complement(256758..257708)
                     /locus_tag="ATU_RS25150"
                     /old_locus_tag="AGR_pAT_370"
                     /old_locus_tag="Atu5259"
                     /inference="COORDINATES: protein
                     motif:HMM:NF012354.1,HMM:NF015431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974519.1"
                     /translation="MQRFQLGSVDLNLLKVIYALVVKGNMTAAGEYIGLSQPAMSHAL
                     KRVRAITGDELFKKTSRGFVMTRFCTEIFPAVRRIIEDTETVMLQRLAFDPATSHRAF
                     RIGMNDYFSVVLMPRLVERVRSEAEHCVLEVIHMPRTGISHNRDFMPVVQEHLNEGTI
                     DVAVMTAENFPARYRCASLFTERRVCIMSANNPAAKEPLTLDALLSLGHVKVTSSPSR
                     RGWIDERLDAMGLERRVVAVVPHFSAAVAIVSRSDLVAMMPESVAKLFERSHELLLLE
                     SPFEEEKQSTSMIWLAEKERDPASLWLREQISACFTDDLH"
     gene            complement(257898..259019)
                     /locus_tag="ATU_RS25155"
                     /old_locus_tag="AGR_pAT_373"
                     /old_locus_tag="Atu5260"
     CDS             complement(257898..259019)
                     /locus_tag="ATU_RS25155"
                     /old_locus_tag="AGR_pAT_373"
                     /old_locus_tag="Atu5260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009493852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydrolase"
                     /protein_id="WP_010974520.1"
                     /translation="MTAGPTLSRRAVLAASAASTFAAVSLVGKTVSAVDTTPYVANGK
                     PWKTAGDVAAAGWSSAKLAEMEAKLYPMATTSMMVAQGGEIVYRYGNLSDVSYLASAR
                     KSILSMLFGRYVAEGKIDLDMTIGEIGIEEDDGLLPLEKTAKLKDLLTSSSGVYHAAG
                     SPGGSENTPERGKTKTGTVFLYNNWDFNVLGAIFENRTGKTVFQALKEDLADPLGFED
                     FDINRQRMMGYENQSRYLAYHLFLSARDMARLGQLMLKGGKWGGKTIVPESWIAESTK
                     MRFTPEQTKSKEGLGYAYLWWIPTSSDPAFKGAYLMNGNFGQFVLCLPAIDTVIVHRR
                     AVTDEFAIARNQGKTTYEPTKVSAGDFMKIAESVVAART"
     gene            complement(259067..260716)
                     /locus_tag="ATU_RS25160"
                     /old_locus_tag="AGR_pAT_374"
                     /old_locus_tag="Atu5261"
     CDS             complement(259067..260716)
                     /locus_tag="ATU_RS25160"
                     /old_locus_tag="AGR_pAT_374"
                     /old_locus_tag="Atu5261"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009493853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tannase/feruloyl esterase family alpha/beta
                     hydrolase"
                     /protein_id="WP_010974521.1"
                     /translation="MTSLLVATSRVVVTISLAYVPVKSAFAAPQNAAGLCSAIAASSI
                     PASRISLPTTGAKIQSATLIGGSDPANQNGEYCKVIGQIKPVDPKAPDIIWQVNLPSV
                     WNGKMLQYGGGGYNGSIPPTTDKTTLGLDVVPTPLTQGYVTFGSDSGHQAPNADDASF
                     AKNDEAMLNYGYMHIKKVLDVAKVLVTERYEKPVTRVYFQGGSTGGREGLTAASRWPE
                     SYDGILTNYPTANFVGLRLWGAGLARAVYDDKSAGWIPPKLVERISKEALKSCDGLDG
                     VEDGLVGNMQQCRAQSAVLVQSLACKSDVTGNPDDCLTQAQIERTLKIYHEGYSLPYQ
                     LANGINTYPGYNSLEGIMMQLGSEPQMRTPPVSGPNAHHSSRSFEFLQNFVQRDQPLN
                     LLSFDIREPGKLKDRIVELSDVIGATRTDWSTFSDRGGKIIWLQGNDDPSVSPLGNAK
                     LFESIVAKMGADKVKGFMRFFLVPGLAHGGGRFSPTWDNLAALDNWVEHDVPPSNPVV
                     VDATKSSTKGRSRPLCEYPSWPKYKGDGDVAIASSFSCADD"
     gene            complement(261387..262265)
                     /locus_tag="ATU_RS25165"
                     /old_locus_tag="AGR_pAT_376"
                     /old_locus_tag="Atu5263"
     CDS             complement(261387..262265)
                     /locus_tag="ATU_RS25165"
                     /old_locus_tag="AGR_pAT_376"
                     /old_locus_tag="Atu5263"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="WP_006315888.1"
                     /translation="MQAGQRKSLAFLIGNYVLMLAFAAIFILPLLFMGFSSLKPNDQL
                     LSDATSIRAFLPVGYLSLENYTAAFVRAPIATFIFNSVLVTVVTVFLALLFGSLAAFA
                     FTFLNWRGKDVLFSIILATLIIPFETIAVPLLLEVNNLPWIGSGGFTWGWLNSWHVQI
                     IPWIADGLTIFLFVQYFKDLPKELLEAARIDGASWLRIYTQVVMPLSGPVIATAAILK
                     FLVMYSQQYLWPLLVTQSEAYRPVMVGLQYFFQLNTPWGEVMAYLTIITLPVLIFYLC
                     LQRLFISSIAASGIKG"
     gene            complement(262265..263353)
                     /locus_tag="ATU_RS25170"
                     /old_locus_tag="AGR_pAT_377"
                     /old_locus_tag="Atu5264"
     CDS             complement(262265..263353)
                     /locus_tag="ATU_RS25170"
                     /old_locus_tag="AGR_pAT_377"
                     /old_locus_tag="Atu5264"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003510215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_006315886.1"
                     /translation="MAFFSSKEKLTRDGVTGWLMAAPAMVLIGLFLITPFLLGLGFSF
                     TNQRLTSPNPTEFVGVENYTRLLGIGVLTLQPEKEADGSISRDADGSVSYPRIRNFTR
                     NNPDYPHLEGMREYKSFNWGEHQIIILARDVVFLTALVNTLSFVVVVAPVQAALALFL
                     ALLVNQKIPGVTIFRAIYFMPVVLSVVVVALLWRFIYAADNGLLNSLLSYMSFGLFQP
                     IDWLGRTDTALWAILVMSVWQGVGFHMVIWLSGLQTISPDLYEAADIEGASRWQRFSM
                     ITWPLLRNTAVLIVIVITMQAFALFAQIDVMTKGGPRDSTQSIVYQAVERGYRQQDIA
                     AGSAISVVLFLLVLCISLTQRYMTREKQ"
     gene            complement(263366..264634)
                     /locus_tag="ATU_RS25175"
                     /old_locus_tag="AGR_pAT_379"
                     /old_locus_tag="Atu5265"
     CDS             complement(263366..264634)
                     /locus_tag="ATU_RS25175"
                     /old_locus_tag="AGR_pAT_379"
                     /old_locus_tag="Atu5265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020009002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="WP_010974524.1"
                     /translation="MTNKAIFAGAFTALSMFFSTAALAQTDLTMWYHGAGNVEERKIL
                     AGIIEDFNSSQSDWRVSLQEFPQSAYNESVTAAALSNKLPDILDVDGPNMPNWAWSGY
                     LQPLQIDEANLENFLPGAVGKWGDKLYSVGLWDAAVAVFARKSVLDENGIRIPTLEQP
                     WTGEEFNAALEKIAAGGKFEYAIDLGMADKTEWYSYAFSPFLESFGGSLIDKKDYQTA
                     ENFLNGDSAVKFGEWWQSLFEKKLAPGTSQSPADHETGFLEGRHALQWMGNWVAVKAL
                     EKYGDDLLFLPSPDFGQGPKIGAGSWQFGVSATSKHPQGASAFIEFAIQDKYLAQFSD
                     AVGLIPATSSAAQMTKNYRQGGPLEVFFELSKRQGTLRPVTPAYAFISPVFSKALSDI
                     ANGADVADTLDNATDEINNNIERNSGYQPK"
     gene            265057..266454
                     /locus_tag="ATU_RS25180"
                     /old_locus_tag="AGR_pAT_381"
                     /old_locus_tag="Atu5266"
     CDS             265057..266454
                     /locus_tag="ATU_RS25180"
                     /old_locus_tag="AGR_pAT_381"
                     /old_locus_tag="Atu5266"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cache domain-containing protein"
                     /protein_id="WP_010974525.1"
                     /translation="MRLRNQILALAIGPLVLAIIIITALITWQSMTLARTSIDAFERN
                     MLAAKEAELLNLTNLALSAIRSVYDKAGPDDEAAKKEVKRILMDLDYGTDGYFFVYDY
                     DGLNVVHPRQNFRPGNNWLDLYDPDGNRVIYDLIVKAKEGGGLVQYKWEKPSTRKIAD
                     KLSFAAGLDKWRWMIGTGVYLDDVFAATAAAKEELRHSITWNFLIVALFAVPAVLLVF
                     ATCMLLNLRQQRLADGRLKELMQRVIDTQDEERLRIARELHDGISQNLVGVRFAIDLA
                     RRKVTPDNVGAVEAIGKGASALTEAIKEVRRISHDLRPRVLDDLGLTAALEALISSFS
                     ERTGIAATLESVAFKHMLVPEARVALYRVAQEALTNIERHSDATRVTIRFSSRDERVQ
                     MVVSDNGRGFPATRTENEMPADKGLGLRNMQERMTHFGGRLDVESSAKGTVLRAVLPM
                     TAMKDHGPRLQEAAE"
     gene            266451..267083
                     /locus_tag="ATU_RS25185"
                     /old_locus_tag="AGR_pAT_383"
                     /old_locus_tag="Atu5267"
     CDS             266451..267083
                     /locus_tag="ATU_RS25185"
                     /old_locus_tag="AGR_pAT_383"
                     /old_locus_tag="Atu5267"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_010974526.1"
                     /translation="MTGHPIRVLLVDNHPLVLDGLKAVLETYEHIAVVGTAVSAMAGI
                     DAAVATKPHVVLMDINMPQINGIDALELFKERQLSARVLMLSMHDSREYISTSVMYGA
                     AGYILKDVATEEIVAAIDTVAAGGTYFSSGVRDVLMESSTGRLKELTTREQDVLLLIA
                     RGKSNRDAALALDIAERTMETHRKNIKRKLDIATTAGLIRYAIDHGLIKA"
     gene            complement(267150..268262)
                     /locus_tag="ATU_RS25190"
                     /old_locus_tag="AGR_pAT_385"
                     /old_locus_tag="Atu5268"
     CDS             complement(267150..268262)
                     /locus_tag="ATU_RS25190"
                     /old_locus_tag="AGR_pAT_385"
                     /old_locus_tag="Atu5268"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008935341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP transporter substrate-binding protein"
                     /protein_id="WP_010974527.1"
                     /translation="MKDNPGRRQFLSGGVLAGAAAAASTLATPAIAQSSPSVRWRLTS
                     GFPNNLDTIYGGAVVMANALRAMTGGKFDIQVFQAGEIVPGAQAIDAVKANTVEISHT
                     CGYYFTGKDPTFAIGSTIPFGLNARQQNAWLYHGGGNGAYNEFLSDYGVIGIPGGATG
                     AQMGGWYRKEIKGIEDIKGLKMRIAGVAGQVLAKLGAVPQQLPGGDIYPALERGTIDA
                     AEWVGPYDDEKLGFYQIAPYYYYPAFWEGGLTIHFFVNKDQYAALPDEYKAALDTACK
                     AANINMQALYDVKNKDAIRSLVSKGTQLRPLPRDVLDAAYKATFELYDEYTQKYPAWA
                     KIYPGWKTFRDESYEWFRVAEYTYDSYGYAMQTAGK"
     gene            complement(268325..269833)
                     /locus_tag="ATU_RS25195"
                     /old_locus_tag="AGR_pAT_387"
                     /old_locus_tag="Atu5269"
     CDS             complement(268325..269833)
                     /locus_tag="ATU_RS25195"
                     /old_locus_tag="AGR_pAT_387"
                     /old_locus_tag="Atu5269"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008508027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP transporter large permease subunit"
                     /protein_id="WP_046033417.1"
                     /translation="MMAFLAENLAPIMFAALIIVLLLGYPVAFALAFVGFFFGFIGIE
                     LGLLPATLFQAIPDRIFGQMSNETLLAIPFFTFMGLILEKSGMAEDLLDTIGQLFGPV
                     RGGIAFAVIFVGAILAATTGVVAASVISMGLISLPIMLRYGYDRKIAAGTIAASGTLA
                     QIIPPSLVLIVLADQLGRSVGDMYKGALIPGLMLVGAYTLYIVVTSIISPAKVPALPS
                     EARTLRGSKLLLKVITSLVPPLVLIFLVLGTIFLGIATPTEGGAMGAVGALALALANR
                     KLNLGLIQQSLYATAKLSSFVLLILLGARVFSLTFYGVNGHVWVEHLMTSVPGGEIGF
                     LIVANLLVFFLAFFLDYFELAFIIIPLLAPVADALGIDLIWFGVMLAVNMQTSFMHPP
                     FGFSLFFLRSVAPTRAYRDRITGQTIQPITSSQIYLGAIPYLFIQLAMVIIIIAFPGI
                     VMHYKSGAKVADPSAVHINVPMPGAGTDADPFANPFLAPGNTAPSFGKPSTP"
     gene            complement(269848..270396)
                     /locus_tag="ATU_RS25200"
                     /old_locus_tag="AGR_pAT_389"
                     /old_locus_tag="Atu5270"
     CDS             complement(269848..270396)
                     /locus_tag="ATU_RS25200"
                     /old_locus_tag="AGR_pAT_389"
                     /old_locus_tag="Atu5270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004682938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP transporter small permease subunit"
                     /protein_id="WP_010974529.1"
                     /translation="MKFLLAVSRAIDAANSAIGKCISWLLLAAIFISAINAAMRKAFS
                     MSSNAWLESQWYLFSAVFLIAAAYTLLNNEHVKVDLIYGGLPRKGQLWVDILGTIFFL
                     MPFCLITVYLSWPVFLQKFASGEVSNNTGGLIQWPVWALIPIGFTLLSLQGVSELIKR
                     VAILRGDIPDPVAAADAEAAML"
     gene            complement(271308..272027)
                     /locus_tag="ATU_RS25205"
                     /old_locus_tag="AGR_pAT_393"
                     /old_locus_tag="Atu5271"
     CDS             complement(271308..272027)
                     /locus_tag="ATU_RS25205"
                     /old_locus_tag="AGR_pAT_393"
                     /old_locus_tag="Atu5271"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YafY family transcriptional regulator"
                     /protein_id="WP_006315869.1"
                     /translation="MARSDRLFRLLQALRTLPSPVTAARLAEETDVSLRSLYRDIESL
                     RAAGAVIDGERGFGYRLTEDIALPPQTFTRLEIEALVLGLAEVRHMGEPALAAAAGAV
                     LSKVTATLPDRLQRQTLHAASQVYRFERRDPPLANVGLLREACWQERAVVISYVDAEQ
                     RRTDRQVLPLAIVYLERTLVLLAWCCLRQDFRKFRVDRIADINMTEESFRPRRVQLLR
                     DFVAILNAGAPETSKMILASQ"
     gene            272122..272733
                     /locus_tag="ATU_RS25210"
                     /old_locus_tag="AGR_pAT_394"
                     /old_locus_tag="Atu5272"
     CDS             272122..272733
                     /locus_tag="ATU_RS25210"
                     /old_locus_tag="AGR_pAT_394"
                     /old_locus_tag="Atu5272"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase family protein"
                     /protein_id="WP_010974531.1"
                     /translation="MLTLFHAPRSRSTRIVTLLRELDAIDKVAIKIVDITRGDGSGRK
                     DPKNLHPEGKVPLLDHDGVVIWESIAIIQYLTDLFPEKKMAPVAGDPQRGRYLSWLAW
                     YAGVVEPVLIMQAAGISHPFVDFTFRSPAELAARLETALKDCPYLMGERYTAVDLLLH
                     SPFAWCPAATPESDVVKAWIERCGERPSLQWTANYDACTVVAA"
     gene            complement(272865..273266)
                     /locus_tag="ATU_RS25215"
                     /old_locus_tag="AGR_pAT_395"
                     /old_locus_tag="Atu5273"
     CDS             complement(272865..273266)
                     /locus_tag="ATU_RS25215"
                     /old_locus_tag="AGR_pAT_395"
                     /old_locus_tag="Atu5273"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014884107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_046033418.1"
                     /translation="MLCFSLYSAGHAFTQLYRPLLDKVGLTCPQYLVMVTLWHRDGQT
                     VRELGKTLFLDSSTLTPLLKRLEAAGLITRTRNRIDEREVLIHLTEKGGALRARAADI
                     MRCIDEAVGVDAEALRAIKQSLDTIRDKIKT"
     gene            complement(273401..274300)
                     /locus_tag="ATU_RS25220"
                     /old_locus_tag="AGR_pAT_396"
                     /old_locus_tag="Atu5274"
     CDS             complement(273401..274300)
                     /locus_tag="ATU_RS25220"
                     /old_locus_tag="AGR_pAT_396"
                     /old_locus_tag="Atu5274"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_010974533.1"
                     /translation="MTDPIAEVVSLLKPSPSISKLVTGGGRWRVERTELGSPFYCAVV
                     EGRCLLTVAGKAPIVLTTGDFVLVPEIFSFTMSSIEPPPRGALLQRLETSPGVFRLGD
                     PDAPVEIKAMVGHCLFGSDDKTLLVSLLPEIIHVRGEQRLALLVQMINDETGAERTAR
                     EMVLGRLLEVLLIEVLRSTGGASAPPGLLRGMADPQLAPTLRRIHEDPGRNMTVEGLA
                     QFAAMSRSTFFERFRREVGVAPMEYATGWRMALAKELLRKDVATAEIAQRVGYGSASA
                     FSVAFSRHVGQTPGAYSRAASNG"
     gene            274423..275367
                     /locus_tag="ATU_RS25225"
                     /old_locus_tag="AGR_pAT_397"
                     /old_locus_tag="Atu5275"
     CDS             274423..275367
                     /locus_tag="ATU_RS25225"
                     /old_locus_tag="AGR_pAT_397"
                     /old_locus_tag="Atu5275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase"
                     /protein_id="WP_010974534.1"
                     /translation="MNNLIDLARHIPAPEPSLTVAYTPIKLQMDGRQPLELRLTAPST
                     GAKLPIVLLSHGYGPSNYIPSKDGYAHLAQFWAECGFAVIQPTHASSRVGGLPADAAG
                     APFFWRDRVEEIRILIDQLAQIESQAPAIAGRLDHQKIATAGHSFGGHTVSLLLGAQL
                     HGEDFSDARISAGILMAAPGRGGKDMTAESAARFPFFDLDFSKIVTRCLVVCGDADNP
                     HFTTRGSEWHTDAFHDAPGAEALLMLHGAGHGLGGIAGLDAKETETELPDVLEATKRV
                     TLAWLHTALATEPHAWNRACSALKGPSFSLGHVTLKTS"
     gene            complement(275487..276278)
                     /locus_tag="ATU_RS25230"
                     /old_locus_tag="AGR_pAT_398"
                     /old_locus_tag="Atu5276"
     CDS             complement(275487..276278)
                     /locus_tag="ATU_RS25230"
                     /old_locus_tag="AGR_pAT_398"
                     /old_locus_tag="Atu5276"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_010974535.1"
                     /translation="MKPIPDHGEQSYVGDGKLKGRVALITGADSGIGKAVAIAFAREG
                     ADIVISYLNEDDDARDTAKWVKEAGQGALLVPGDIKSEEHCKNLVHRAVNELGAVDIL
                     VNNAAFQRTYDDIADITAEEWDETFRTNIYAPFFLSKAAAPHMKPGSSIINTTSIQSR
                     QPSPQLLAYASTKGAISNFTAGLAEMLAEKGIRVNAVAPGPIWTPLIPSTMPAEKAAK
                     FGENTLIGRAGQPAELAGAYVLLASDLGSYMTGAVIPVTGGEIMI"
     gene            276650..277057
                     /locus_tag="ATU_RS25235"
                     /old_locus_tag="AGR_pAT_399"
                     /old_locus_tag="Atu5277"
     CDS             276650..277057
                     /locus_tag="ATU_RS25235"
                     /old_locus_tag="AGR_pAT_399"
                     /old_locus_tag="Atu5277"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006700451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low affinity iron permease family protein"
                     /protein_id="WP_010974536.1"
                     /translation="MNKFFTLFASRTASFAGSSTAFVVAFGTVIAWGISGPFFGFSEV
                     WQLVINTGTTIVTFLMIFLVQNSQNRDSAAMEAKLDELLRAVEQARADFIGIEHLTAQ
                     EIEDIRARLEKENGHGGEKPSPHHAMARLLSRR"
     gene            277424..277924
                     /locus_tag="ATU_RS25240"
                     /old_locus_tag="AGR_pAT_401"
                     /old_locus_tag="Atu5278"
     CDS             277424..277924
                     /locus_tag="ATU_RS25240"
                     /old_locus_tag="AGR_pAT_401"
                     /old_locus_tag="Atu5278"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020808138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin-like domain-containing protein"
                     /protein_id="WP_010974537.1"
                     /translation="MAEKTLKDLFLDTVKDIYFAERQILKALPKMARAAQSADLKAAF
                     EKHRDETEVHVERLQNVFEFLGKPARGRTCEAIQGIIAEGEEIMEEFKGSSALDAGLI
                     SSAQAVEHYEITRYGTLKTWAVELGMKEAAKLFEQTLGEESATDTALSSLAQARANIK
                     GKSKAA"
     gene            277999..278658
                     /locus_tag="ATU_RS25245"
                     /old_locus_tag="AGR_pAT_402"
                     /old_locus_tag="Atu5279"
     CDS             277999..278658
                     /locus_tag="ATU_RS25245"
                     /old_locus_tag="AGR_pAT_402"
                     /old_locus_tag="Atu5279"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013762431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035257054.1"
                     /translation="MRLVRDNGLTIVLVLTSLLTIGGMLATGWAVYNKELVQHHATPL
                     TLFSYARSGHFLSALFENWESEFLQMSAYVMLTAFLFQRGSSESKNPDEPSSQDEDPA
                     QKADDTEAPWAVRAGGFIRAIYSYSLGLALFFLFVVSFVLHLKYNADAAALETAMHGN
                     PETTLFSHLGSTEFWFESFQNWQSEFLSTAVLVVLSIFLRFRGSPESKPVAAPHSETG
                     G"
     gene            278671..279297
                     /locus_tag="ATU_RS25250"
                     /old_locus_tag="AGR_pAT_403"
                     /old_locus_tag="Atu5280"
     CDS             278671..279297
                     /locus_tag="ATU_RS25250"
                     /old_locus_tag="AGR_pAT_403"
                     /old_locus_tag="Atu5280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine hydrolase"
                     /protein_id="WP_035257059.1"
                     /translation="MIEFSAEGDWRHLCVDMQRVFAEDTPWHVEWMDRISEEVEVVVA
                     SDPARCIFTCFVPPRSVGEARGAWRAYYEKWPMMTQQALAPELIEVIPSLSRYIPPAR
                     IFRKSVYSPWQHGGLGEILRQEQVSTLVITGGETDVCVLATVLGAIDQGFYVILVEDA
                     LCSGRDATHDAAMKLLSGRFSTQLQVCDTATLLQALPPKKGARLPEIS"
     gene            complement(279477..279707)
                     /locus_tag="ATU_RS25255"
                     /old_locus_tag="AGR_pAT_404"
                     /old_locus_tag="Atu5281"
     CDS             complement(279477..279707)
                     /locus_tag="ATU_RS25255"
                     /old_locus_tag="AGR_pAT_404"
                     /old_locus_tag="Atu5281"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020808134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974540.1"
                     /translation="MNKDEKLKQIHKDSEPQFARGKKTSDNNGVVSAKPRVITGSDDA
                     TANKLPPGAKKPEKDWDLNYDERDADEGDFRG"
     gene            279790..280029
                     /locus_tag="ATU_RS25260"
                     /old_locus_tag="Atu5282"
     CDS             279790..280029
                     /locus_tag="ATU_RS25260"
                     /old_locus_tag="Atu5282"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006315858.1"
                     /translation="MPQLDRRMNPFIPRSPSGDEAMNQPDEDIKPEPGTDDAFYRNGH
                     ESCQDREQRRKNAELMIDQRPQRLSAGGAENADQL"
     gene            280160..280683
                     /locus_tag="ATU_RS25265"
                     /old_locus_tag="AGR_pAT_407"
                     /old_locus_tag="Atu5283"
                     /pseudo
     CDS             280160..280683
                     /locus_tag="ATU_RS25265"
                     /old_locus_tag="AGR_pAT_407"
                     /old_locus_tag="Atu5283"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013762435.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
     gene            complement(280768..282552)
                     /gene="treZ"
                     /locus_tag="ATU_RS25270"
                     /old_locus_tag="AGR_pAT_409"
                     /old_locus_tag="Atu5284"
     CDS             complement(280768..282552)
                     /gene="treZ"
                     /locus_tag="ATU_RS25270"
                     /old_locus_tag="AGR_pAT_409"
                     /old_locus_tag="Atu5284"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malto-oligosyltrehalose trehalohydrolase"
                     /protein_id="WP_010974542.1"
                     /translation="MNAANYRKWGAQRHQSGDTDFSIWAPASATVKLWLNDAEFDMHT
                     AGDGWHDITKPALPGDRYGFVLADRTRVADPASNRQQEGPRGPSLIVNHDFAWKNPNW
                     KGRPWHEAVVYELHIGTFTPEGTFAAAAEKLEYLADVGITTIELMPLATFAGSRGWGY
                     DGVLQFSPQRDYGTPDELKAFIDQAHGHGIMVLLDVVYNHFGPAGNTLQAYAPAFFKK
                     HETPWGPAPDFNRAEVRSFFLQNAFYWLETYRFDGLRIDAADHLAGGDGEVDFLIEMA
                     REVKRTIRNRHVHLVIEDARNAASPMTPMADGAILVDAQWNDDFHHVIHVATTNEEGG
                     IYEDFASRPYENLRRSLATGFVYQGEPRPSRNFAASGEPSGHLPPHRFVNFLHNHDQA
                     GNRLRGERLRALIPPPLFGTLEAILLLCPQTPLVFMGDEHGSANPFFFFSDHPDHNRE
                     QEIRNRLKQAESFQGELPPDASQMVMDPNDQHTMQLSTLKWTHAETTEGRQSRADMAA
                     LLAKRRGHIWPLLCSHFEKGISLDCEPRCLAIDWHFKAGRLEMRANLSENMCELPAVK
                     GEILHRNGSVGNTRYEGYAAQFAIYAGR"
     gene            complement(282579..284108)
                     /gene="glgA"
                     /locus_tag="ATU_RS25275"
                     /old_locus_tag="AGR_pAT_410"
                     /old_locus_tag="Atu5285"
     CDS             complement(282579..284108)
                     /gene="glgA"
                     /locus_tag="ATU_RS25275"
                     /old_locus_tag="AGR_pAT_410"
                     /old_locus_tag="Atu5285"
                     /EC_number="2.4.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019567399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen synthase GlgA"
                     /protein_id="WP_010974543.1"
                     /translation="MRILAVTAEMFPFVKTGGLADATSALPQALERKGADVRTLLPLY
                     RGLTPLVRGRKPVLVANILEQPVSVYYVVSDGHKLLLLEAASLFDRDGHPYGVKGEPF
                     ADNDLRFAVLSKVAAEIALGAIDGWQPDVVHVHDWHAALTCVYLADSTPSVASVLTLH
                     NLAFQGQYPLERAGMLGLPSHLCTVDCLEYYDDMSFLKGGLTTASAVTTVSPTYAREI
                     LTPEMGMGMHGVLARRRGDLRGIVNGVDHDVWNPATDPYILANFTAATATRRSLNKYA
                     LLQALGLAPTQGPVFGVVSRLTWQKGIDLLPHVVPLIIERKGRLIVHGEGDTALEDSL
                     QALAKRYPELVCAHIGYDERLAHMIQAGSDFIIQPSRFEPCGLTQLYALRYGALPIVS
                     RTGGLAETIIDANDAAIEAGVATGFQFEPANEDDLRAALERAISAYNDRELFRRLQTQ
                     AMQANFSWDKSAAQYMALFESLVGNSTRETDAVADIRTETFAKIRADRRLAGTPGSPT
                     G"
     gene            complement(285106..285705)
                     /locus_tag="ATU_RS25280"
                     /old_locus_tag="AGR_pAT_413"
                     /old_locus_tag="Atu5287"
     CDS             complement(285106..285705)
                     /locus_tag="ATU_RS25280"
                     /old_locus_tag="AGR_pAT_413"
                     /old_locus_tag="Atu5287"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974545.1"
                     /translation="MRTVTGLFDDYSDASAAVSALESAGVRSDDISIVSNNADKRHGD
                     SNAAEGAGTGAGIGAVVGGAGGLLTGLGLMAIPGVGPVVAAGWLAATAAGAAAGAVAG
                     GATGGIIGAMTSSGVSEHDAHVYAEGVRRGGTLVTAKVDDALVSEAEAILKRSNWVDP
                     AARRVAYEEQGWTRFDDALDPYDAAQIEQERLRYRRAGL"
     gene            complement(285721..286038)
                     /locus_tag="ATU_RS25285"
                     /old_locus_tag="AGR_pAT_414"
                     /old_locus_tag="Atu5288"
     CDS             complement(285721..286038)
                     /locus_tag="ATU_RS25285"
                     /old_locus_tag="AGR_pAT_414"
                     /old_locus_tag="Atu5288"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003591967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035257065.1"
                     /translation="MKNAIFAAALFSATSISAFAQTAPTANNNGDTPAVATPDTKNPT
                     APVEGANSFTEAQAKDRIEKAGYSDVKDLKKDDKGIWNAAGMKDGKAVSIALDYQGNV
                     VAK"
     gene            complement(286361..286984)
                     /locus_tag="ATU_RS25290"
                     /old_locus_tag="AGR_pAT_416"
                     /old_locus_tag="Atu5289"
     CDS             complement(286361..286984)
                     /locus_tag="ATU_RS25290"
                     /old_locus_tag="AGR_pAT_416"
                     /old_locus_tag="Atu5289"
                     /inference="COORDINATES: protein
                     motif:HMM:NF012655.1,HMM:NF037625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_010974547.1"
                     /translation="MKNSESHGEADGGLRERKKRETKKRLTEKGIALFLERGFDNTTL
                     DEIASAAGISRRTFFYYFKSKDEILLSLQSGIGEMLADAVRRAPSSSTPIEVVRDAAI
                     GVCKVIPTNDMIEMDRLMRTSPSVQARKQVSYVQQEGEIYEALSERWPEPERSTALRV
                     VAMLSVGAMRIAGDIFSQEKGVRPMVDLLEEAFGSLIQEVRSGDPRV"
     gene            287062..287967
                     /locus_tag="ATU_RS25295"
                     /old_locus_tag="AGR_pAT_417"
                     /old_locus_tag="Atu5290"
     CDS             287062..287967
                     /locus_tag="ATU_RS25295"
                     /old_locus_tag="AGR_pAT_417"
                     /old_locus_tag="Atu5290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015242293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_010974548.1"
                     /translation="MTKWTEANIPNQRGRSAVVTGTGGLGLETALALARAGCDVTIAG
                     RNPEKGSDAVSRIQRAAPHVTVSFEKLDLADLTSIALFAQRMENDRESLDLLVNNAGI
                     MVPPKRQETRDGFELQFGTNYLGHFALTAHLMPLLKKGTDARVVTVSSVAARAGKINF
                     ADINSEKNYHPMRAYSQSKLACLMFALELQDRSRAAGWGVSSIAAHPGVSRTDLLHNA
                     PGRNSLQGLARTFLWFLFQPVAQGALPQLFSATSKEVKSGGYYGPDRLGETRGHPQPA
                     RIPPEALDRVAGKQLWEISQRMTGL"
     gene            288139..288771
                     /locus_tag="ATU_RS25300"
                     /old_locus_tag="AGR_pAT_419"
                     /old_locus_tag="Atu5291"
     CDS             288139..288771
                     /locus_tag="ATU_RS25300"
                     /old_locus_tag="AGR_pAT_419"
                     /old_locus_tag="Atu5291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015247474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_010974549.1"
                     /translation="MSSINTKAKILHIGIDQLSVSGLAGVTVGQLANASALSKSGLFA
                     HFKSKEQLQIELLSEAARIAKLTIVEPAMKADQGLSRLRAVVELWFGWSRRAGLQGGC
                     PLAAALFELDDDVGDVRDHAAQLTVRWRNLLTMLVGESVTAGHLSAATDVAQFIWELN
                     GIYLNHHVSTRFFREKEADARATYAFEALIARHRPESGSAVTAWKECTDG"
     gene            288764..289126
                     /locus_tag="ATU_RS25305"
                     /old_locus_tag="AGR_pAT_420"
                     /old_locus_tag="Atu5292"
     CDS             288764..289126
                     /locus_tag="ATU_RS25305"
                     /old_locus_tag="AGR_pAT_420"
                     /old_locus_tag="Atu5292"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006052695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3817 domain-containing protein"
                     /protein_id="WP_010974550.1"
                     /translation="MDEGAEADAESALVELQQLRRLEMASIAEATTLVLLVGLAVPAK
                     HIFNWPEGSKYLGPIHGIAFLTYMWITLQTLAGGGWRRRDAARLFAAAFIPFAGYFNI
                     QWLRRRTILMATNIGDGT"
     gene            289123..289542
                     /locus_tag="ATU_RS25310"
                     /old_locus_tag="Atu5293"
     CDS             289123..289542
                     /locus_tag="ATU_RS25310"
                     /old_locus_tag="Atu5293"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012249002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CopD family protein"
                     /protein_id="WP_010974551.1"
                     /translation="MNELYPYIVAAHVTSVVFLVGGMLMHERLVREIALLPASNQSRM
                     LGAVLRLDRQVISPALLSTWTFGLILAFWLGWFSSPWLQVKLVVVTALSALHGIQSGR
                     LRRWVRDGSAARSTRGAGAGIVIAMAAIALLAIVKPF"
     gene            complement(290044..290630)
                     /locus_tag="ATU_RS25315"
                     /old_locus_tag="Atu5295"
                     /pseudo
     CDS             complement(290044..290630)
                     /locus_tag="ATU_RS25315"
                     /old_locus_tag="Atu5295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006699087.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
     gene            290716..291624
                     /locus_tag="ATU_RS25320"
                     /old_locus_tag="AGR_pAT_424"
                     /old_locus_tag="Atu5296"
     CDS             290716..291624
                     /locus_tag="ATU_RS25320"
                     /old_locus_tag="AGR_pAT_424"
                     /old_locus_tag="Atu5296"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016568456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_010974553.1"
                     /translation="MVEYRFVRTARHVFAAVVLLAASAAAAADKEYTVQSSDGVVIAV
                     EETGNPTGQPIVFVHGLLGSRINWDKQTTDPDLQKFRLITYDLRGHGLSGKPDDAEAY
                     KDGHRWVDDLAAVLKESKAKNPVLVGWSLGGVVLSNYLAAHGDAGIGGLIYVDGVIEI
                     KPDLITPHPEVYAGLASKDLRTHLDAVRTFLALCFQTQPDRSTFERLLSNAATASWVM
                     TRTVPSMTVQAAEGLPKAKVPVLLIYGGKDDLVRPAPSIARAKSFNGQIKSKIYDDSG
                     HAPFLEEAARFNKDLIDFTTSTQGGK"
     gene            291725..292648
                     /locus_tag="ATU_RS25325"
                     /old_locus_tag="AGR_pAT_427"
                     /old_locus_tag="Atu5297"
     CDS             291725..292648
                     /locus_tag="ATU_RS25325"
                     /old_locus_tag="AGR_pAT_427"
                     /old_locus_tag="Atu5297"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013690698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_010974554.1"
                     /translation="MRDSDNVGDSIFYPGWRPFEMEADGVQFSGVIGGSGPPLLLLHG
                     FPETHIAWRRMAPALSREYSLVIPDLPGYGRSLILDHSERFTKRRAARAVSSLMTAFG
                     HKTFGVIGHDRGARVGYRLALDHPDRVRGFASLTVIPTLDALASVDHEFALKNFHWFL
                     FAQPDDLAEHLLDLDPRGYLERVLARMTEGRDFLKREATEAYHEAFSRPSVREAIIED
                     YRSALREDLEHDRADRRDGRKLRCPVFVSWPERGSRSDRGSPIEVWRRWADEVTGGAT
                     SGGHLQPEDAPDEVLAMLIPFLSKSFLPGRA"
     gene            292847..293941
                     /locus_tag="ATU_RS25330"
                     /old_locus_tag="AGR_pAT_430"
                     /old_locus_tag="Atu5299"
     CDS             292847..293941
                     /locus_tag="ATU_RS25330"
                     /old_locus_tag="AGR_pAT_430"
                     /old_locus_tag="Atu5299"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003590941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974555.1"
                     /translation="MKSVDLMYQTMLAELGQRSLDAAWTADFPPEGRFTPANIKGRKY
                     WYFDIPDGHGGTKRRYVGPADDPDIAQRVSDHKRDKDDLRARRRLVNTLTREGGMISP
                     DAMSGDIVEALANGGLFRRRGVLIGTVAFQCYSGLLGVRLPMAAILTGDADIAQDYAI
                     SREVEDCLPPIVELLQEVDASFRPVPHRSGAAASSAFQNADGYRVEFLTSNRGSDDYI
                     DQPAKMPALGGASADPLRFLDFLIREPVRTILLHRSGIPVVVPDPTRYAVHKLIVASR
                     RHIDGQGSAKREKDIRQAALLFEALQQTRRSADLALVYNEAWERGPAWQEAIRVGAGM
                     LPAPDADRFKTVLIGGAKKNREDIELPFSE"
     gene            complement(<294223..294644)
                     /locus_tag="ATU_RS25335"
                     /old_locus_tag="Atu5300"
                     /pseudo
     CDS             complement(<294223..294644)
                     /locus_tag="ATU_RS25335"
                     /old_locus_tag="Atu5300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016737454.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="PIN domain-containing protein"
     gene            complement(294634..>294777)
                     /locus_tag="ATU_RS25340"
                     /pseudo
     CDS             complement(294634..>294777)
                     /locus_tag="ATU_RS25340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008536011.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
     gene            complement(295017..295199)
                     /locus_tag="ATU_RS25345"
                     /old_locus_tag="AGR_pAT_434"
                     /old_locus_tag="Atu5301"
     CDS             complement(295017..295199)
                     /locus_tag="ATU_RS25345"
                     /old_locus_tag="AGR_pAT_434"
                     /old_locus_tag="Atu5301"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_071241520.1"
                     /translation="MDGNLRLAVLVLLFPMLPPMNLILLQQLYSSRRDLVMRAAGRRE
                     GQFGLPVLPLVAIAMD"
     gene            complement(295402..296709)
                     /locus_tag="ATU_RS25350"
                     /old_locus_tag="AGR_pAT_435"
                     /old_locus_tag="Atu5302"
     CDS             complement(295402..296709)
                     /locus_tag="ATU_RS25350"
                     /old_locus_tag="AGR_pAT_435"
                     /old_locus_tag="Atu5302"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019646159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="WP_010974558.1"
                     /translation="MSLNNEQSFWNQANRHLTRYGPSFESIIVERASGSYVYDANDRP
                     ILDFTSGQMSALLGHTHPDIVATVDRQMRSVAHLFSGMLSRPVVELASRLAALAPGLD
                     RVQLLTTGAESNEAAIRMAKLVTGGHEVVAFAQSWHGMTGAAAAATYSAGRRGYGPVA
                     AGSLVIPAPNSYRPRFAKPDGTNDWQTELDDAFALIDNQSTGSLAAFIAEPILSSGGI
                     LELPAGYLAALKLKCEERGMLLILDEAQTGVGRTGHMFAFQRDGVTPDILTLSKTLGA
                     GLPLAAVMTTEAIEQKAFEKGYLFYTTHVSDPLLAAVGVTVLDVVEREGLLAAAIGRG
                     ARLRAGLVSLQQRFECVGDVRGRGLLMGLEIVADRQTKAPGFALGAKIMEEAMRRGLS
                     MNIVKLPGMGGVFRIAPPLTVSDEEIDHGIEIMSDSIQAASGA"
     gene            296811..297656
                     /locus_tag="ATU_RS25355"
                     /old_locus_tag="AGR_pAT_436"
                     /old_locus_tag="Atu5303"
     CDS             296811..297656
                     /locus_tag="ATU_RS25355"
                     /old_locus_tag="AGR_pAT_436"
                     /old_locus_tag="Atu5303"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018387770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974559.1"
                     /translation="MTLDLSVLRNFAVVARAGSISVASQQVGRTQSTLSMQMQRLEEM
                     IGQILLHRSGSGVRLTSAGEKLLMHAEALLAQHDELLADMNGATLQGSVSLGCPEDYS
                     IAFLPSILKGFFERHPDVELRMVCAPTTELRPMLRRRQIDLGIVSLSELASPEIIRRE
                     DFVWVANSSRPAILDRPVLPLALSAPATLDYRAACDVMGASNRRYRVAFASNSLAGLT
                     AIARSGHAISVFTRTAVPPDLFVITDGLPTLPTIGLAVELGESRPSLIAKALAKHVRS
                     TLPRL"
     gene            complement(297836..297976)
                     /locus_tag="ATU_RS25360"
     CDS             complement(297836..297976)
                     /locus_tag="ATU_RS25360"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162180322.1"
                     /translation="MARRMTEIAMVRVIAYRPDMSPTDFEVRPMCRNRYSWHADHRRD
                     HQ"
     gene            complement(299436..300536)
                     /locus_tag="ATU_RS25365"
                     /old_locus_tag="AGR_pAT_439"
                     /old_locus_tag="Atu5306"
     CDS             complement(299436..300536)
                     /locus_tag="ATU_RS25365"
                     /old_locus_tag="AGR_pAT_439"
                     /old_locus_tag="Atu5306"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007816570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate synthase/methylcitrate synthase"
                     /protein_id="WP_010974562.1"
                     /translation="MSATPALVGKNPAPGLDDVVAAETMLSHVDGQAGELVVRGHHLA
                     ELADWSFEQVLELLWSGQTATKITAEDIRSQLGKARLRAFELMQLLFPGLAALTSVEA
                     LRLLLSWLPDDETTPHHLVAVAAVPVFATAIIRNRQGFAPIAPDASLTHSADFLRMLS
                     GTLPSTEKVRALDTYLTTVADHGLNASTFTARVIASTGAGLFSSVVGALCALKGPLHG
                     GAPGPVLDMLDAIGAEAEIEPWLLDALGRGERLMGFGHRIYRVRDPRADVLKHAVSTL
                     KEGSDRIAFAGKVEEAALALLKEKKPLRPLQTNVEFYTALVLEAVGFPRDSFTNVFAA
                     GRMAGWTAHVLEQERTGRLIRPQSHYIGPHPR"
     gene            300652..301812
                     /locus_tag="ATU_RS25370"
                     /old_locus_tag="AGR_pAT_441"
                     /old_locus_tag="Atu5307"
     CDS             300652..301812
                     /locus_tag="ATU_RS25370"
                     /old_locus_tag="AGR_pAT_441"
                     /old_locus_tag="Atu5307"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019401735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_164927885.1"
                     /translation="MTADRAAAELGISRATLYAYVSRGMIHTSDAADDPRRRLYSAHD
                     IEALKKRKNVGRRPRQVAAAALDWGLPVLESAITEIAEGQLRYRGQDALALSQAASLE
                     DVARLLWDCGEVDPFDDLKAAPTPWPQPVLDYVRDLPLTERCQALLPLLEAGRVTTWR
                     RDNRRLWPGAAALLRGIAGACISSQPKTQAVHLSLADAWQTDAAGADLIRRALVLQAD
                     HELNTSAFAVRVVASTGASLGACLNAGLSALSGPLHGGMTSLVEILFDELDRYGDVER
                     VIDERLRRGEAIPGFRHPLYPDGDPRATGLLLYLPPDAQRDELLQMMNDTTGQLPTCD
                     VALVSLRRSLKLPRGAALALFAVARTVGWVAHALEQKLDDKLIRPRARYIGR"
     gene            302140..302478
                     /locus_tag="ATU_RS25375"
                     /old_locus_tag="Atu5308"
     CDS             302140..302478
                     /locus_tag="ATU_RS25375"
                     /old_locus_tag="Atu5308"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974564.1"
                     /translation="MEYDAVTFDTQKVRTNGFNFNTGLLNELKKLRHDRFQVIVSDII
                     RSDILKQLSEYTQQVTIQLNTAIKKANELGIASINNQQKVDPRHVATSQLRKYFVSLG
                     ALVVLVPPIL"
     gene            302720..303229
                     /locus_tag="ATU_RS25380"
                     /old_locus_tag="AGR_pAT_442"
                     /old_locus_tag="Atu5309"
     CDS             302720..303229
                     /locus_tag="ATU_RS25380"
                     /old_locus_tag="AGR_pAT_442"
                     /old_locus_tag="Atu5309"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008593623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="WP_010974565.1"
                     /translation="MASYDDELVAAFSRNERRIKRYLISRTRSQADSDDLAQEAWIKL
                     ARNGAAALAAPVPYLMRIARSLAVDHDRGQKRKLTSNDIDVLMSVADEQPGPEKQFED
                     RDQVRCLIEIIDELPERQRKMLVACRLDQRRHADIAAEFGVSIRTVELEVRKAVDYCR
                     ERLETINRA"
     gene            303316..304251
                     /locus_tag="ATU_RS25385"
                     /old_locus_tag="AGR_pAT_bx251"
                     /old_locus_tag="Atu5310"
     CDS             303316..304251
                     /locus_tag="ATU_RS25385"
                     /old_locus_tag="AGR_pAT_bx251"
                     /old_locus_tag="Atu5310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003499719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FecR family protein"
                     /protein_id="WP_010974566.1"
                     /translation="MLDENFEALRREATAWIVRITSGTATTEDAEALLRWRSRSDAHE
                     QAFQQSARLWKNLGSALGETRKTSASTVTRRSFIAAGSVAAGAAGVGVVLSELGFLPS
                     VDAMLADYATGVGEQRTVELVDGSTAILDGGTTLSLDYSPSSRHLVLTSGAAVFDVVH
                     DAARPFVVTAANGDTTATGTSFSVKHGEEDVSIECLEGHITVQCLGDSQLNGGEGISY
                     SRAGLGKKVAADIETAAAWRRGLLIFEDRPLADVVSDLNRHRRGRVVIASSDLRSRRM
                     SGVFHLNRPDEILAHLEETLQVRPVSLVGGIVLLR"
     gene            304372..306831
                     /locus_tag="ATU_RS25390"
                     /old_locus_tag="AGR_pAT_446"
                     /old_locus_tag="Atu5311"
     CDS             304372..306831
                     /locus_tag="ATU_RS25390"
                     /old_locus_tag="AGR_pAT_446"
                     /old_locus_tag="Atu5311"
                     /inference="COORDINATES: protein
                     motif:HMM:NF019283.1,HMM:TIGR01783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="WP_010974567.1"
                     /translation="MGQFNVGKQGREGKAINKWRIAHLSASIAFSALAMTSSTVFAQQ
                     SVSYSIPAGSLERGLIRFGAASGIQVLYNSAVANGRDTAGISGPLSPEAALQGLLANT
                     GLTYRFTGPKSVTVADPAPAPGAVTDESATILQTITVQGAESAYGHVDGIVASRSATG
                     TKTDTPLIEVPQSISVITADEVKARGAETIKEAVNYTAGVHVGGSSASTRAFDNIEIR
                     GFAPTPLYLDGTYLPYIGDLGGSPQIDPYLLERIEVLKGPSSVLYGQNYPGGMINMVS
                     KRPTDKPFNEVVAGTGTDGRAYGAFDFSGPVAGNDAFLYRLTGVATRTGTNIDYTKDE
                     RFMLAPSFALKPDEDTTFTFLSHYQKDNGVPDYQPLPYIGTVKAGPYGAINRDFFTGE
                     PAYNGYDRGQAVLGYEFKHQFDDVWSIRHNAKYISVDDSYRTFFSGGYVETGGVTDYT
                     KMRRNAIDYSSNNQVFATDTNLQAEFSTGEVGHTVIVGTDYKWFRNDYTGRYGFGNTP
                     LDVFNPRYGSYREPTVGARWDNRISQLGLYAQDQIKWDNWILTLGGRYDWALQTDNDI
                     LSSTIGKKTDTAFTGRAGLIYLFDNGFAPYVSYSTSFMPYSGFDGQNNPFKPTTGEQW
                     EVGLKYEPVGYDALITVSAFDLKQKNVPTYDEFTYLPAQTGEIHVQGIEIEGKATVFD
                     SLDLIAAASYTDSVYSKADDGTQGNKVRFMPPVNVSLWGKYRIEDGPLEGLGFGAGVR
                     HSSSGYGDAANSFKYPAYTVVDAALSYDFGKQNPKLEGLELNVTAQNLFDKTYVSGCS
                     NINSCFYGKSRAVYANLSYKW"
     gene            306844..307812
                     /locus_tag="ATU_RS25395"
                     /old_locus_tag="AGR_pAT_447"
                     /old_locus_tag="Atu5312"
     CDS             306844..307812
                     /locus_tag="ATU_RS25395"
                     /old_locus_tag="AGR_pAT_447"
                     /old_locus_tag="Atu5312"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007881518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-siderophore ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_162180369.1"
                     /translation="MFSPLKIAILLSAVLLLIGGPVRSEDGFPRTVQHALGKTAIPSD
                     PERIVTLGWSGEDAVLALGKTPVGMPRYRFFESGIFPWNEQRLDAIRPYLFEGDIDYE
                     AIAALRPDLILGIYSGVDDLAYKRLSSIAPTVVYRSAPWSADWKEQTEMVGQALGRSD
                     EAKALIEKTASTLKAMGDSWPVLRGKTFTFGTYFPGGSGLVVYLPEDPRVAALLELGL
                     KPSAGVLSLSAAKPGQGSVTVGMEQVDSLDADILIMWYGEGARIAAEAQPLFMRLPAI
                     KHSRYVALEDPVSVWSTSALSVLSIPYGFPRFLPRLAAVAERAGKE"
     gene            307812..308618
                     /locus_tag="ATU_RS25400"
                     /old_locus_tag="AGR_pAT_448"
                     /old_locus_tag="Atu5313"
     CDS             307812..308618
                     /locus_tag="ATU_RS25400"
                     /old_locus_tag="AGR_pAT_448"
                     /old_locus_tag="Atu5313"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007881516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="siderophore-interacting protein"
                     /protein_id="WP_010974569.1"
                     /translation="MMSHDNVHEPYVEDYFLCEVTTVTQLTPSMTRVALQVEGGERLI
                     STGHPDEWVRLALRPDPHTPVTLPVLMGNGEWGRPDGSQHCPNRPYTVRRWDAERREM
                     LIDLVAHAGGVAASWAMGARVGDVVGICNPEGRFEPPEDTDWMLLVTDITGLPAVGRI
                     LEELGKTERAIVHVEIPSPADRQVINSDGDVSINWYETYGPSTGRDGYTQLPQIAGAI
                     DILPEGPGYIYIAGEARAASECRKHFRDRLGFDKTRIDAIGYWIEGQARV"
     gene            308750..309700
                     /locus_tag="ATU_RS25405"
                     /old_locus_tag="AGR_pAT_449"
                     /old_locus_tag="Atu5314"
     CDS             308750..309700
                     /locus_tag="ATU_RS25405"
                     /old_locus_tag="AGR_pAT_449"
                     /old_locus_tag="Atu5314"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007881515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron chelate uptake ABC transporter family
                     permease subunit"
                     /protein_id="WP_162854822.1"
                     /translation="MLLFIASLLTGARAIAPSTGFYALFAYDPASAEHIIIRDYRLPR
                     TLLGLLCGAAFGVSGALIQAITRNPLADPGILGVNAGAAFFVTLAVGLLGFHAISSYL
                     WFAFLGAVAVTLIVYSVGSRGRDGASPARLVLSGVALSAVLGGIGSAITLLDPRTFDG
                     LRVWSIGSLSGRNMDVVLTVAPFIIFGLVLSLCVAPSLNAVALGDDPSRALGVNLVRT
                     RILVVIAVTLLAGAATAAAGPIGFIGLMVPHVVRWLSGPDQRRIIAFTILCSPILLLT
                     ADIAGRLVLFSGELEAGIVTAFIGAPVLIVLALRRRASGL"
     gene            309697..310803
                     /locus_tag="ATU_RS25410"
                     /old_locus_tag="AGR_pAT_451"
                     /old_locus_tag="Atu5315"
     CDS             309697..310803
                     /locus_tag="ATU_RS25410"
                     /old_locus_tag="AGR_pAT_451"
                     /old_locus_tag="Atu5315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012039617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron chelate uptake ABC transporter family
                     permease subunit"
                     /protein_id="WP_162180368.1"
                     /translation="MSGHHPDPSKAGARRLAVSSSSQIDFGRRAALIRLFGGRLSMRF
                     DPRSLFVGVILLSLTVMIGAASLASGKFPVPSADVFKALLGAADSTMNMVVMEWRLPR
                     LFLAFLLGGALGLSGAIFQSLTHNPLGSPDIIGFSAGSYTGALVVIFVCSGGYYETAA
                     GALAGGVVTAAAIYLLAYRGGLQSFRLIVVGIGISAMLNALNAWMIRQADLKVAMSAA
                     IWGAGSLNGLGFEQVWQVLLMLATIIPCVLALARPMRQLELGDDMATASGIHVNRLRL
                     ILMICGVALTAIVTAAAGPIAFVSLAAPQIARRLSGSGGVTLLPSALTGGLLLIAADW
                     AAQHAFGAQLPVGIMTVSVGGFYFLWLLIREARQ"
     gene            310800..311645
                     /locus_tag="ATU_RS25415"
                     /old_locus_tag="AGR_pAT_452"
                     /old_locus_tag="Atu5316"
     CDS             310800..311645
                     /locus_tag="ATU_RS25415"
                     /old_locus_tag="AGR_pAT_452"
                     /old_locus_tag="Atu5316"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019965434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010974572.1"
                     /translation="MTDRPDTRIERLEVQNATLRYNQRIIAEDLSVKIPDGSFTVIVG
                     PNACGKSTLLRALSRLLTPSAGEVILDGKAIAGYPAKQLARAIGLLPQSSIAPDGITV
                     AELVARGRYPHQSLFRQWSSEDEAAVALAMAATQTTQLSTRLVDELSGGQRQRVWVAM
                     VLAQETPILLLDEPTTFLDIAHQIDLLDLCQELNAAGRTIVAVLHDLNHACRYATNII
                     AMRDGAIIAHGSPPTTVTERLVEDVFGLPCMIIPDPVSGTPLIVPKVKVRAACIPITP
                     DIPEH"
     gene            312090..313004
                     /locus_tag="ATU_RS25420"
                     /old_locus_tag="Atu5318"
                     /pseudo
     CDS             312090..313004
                     /locus_tag="ATU_RS25420"
                     /old_locus_tag="Atu5318"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003539440.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
     gene            313150..313960
                     /locus_tag="ATU_RS25425"
                     /old_locus_tag="Atu5320"
                     /pseudo
     CDS             313150..313960
                     /locus_tag="ATU_RS25425"
                     /old_locus_tag="Atu5320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003592117.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="HAD hydrolase-like protein"
     gene            313965..314324
                     /locus_tag="ATU_RS25430"
                     /old_locus_tag="AGR_pAT_461"
                     /old_locus_tag="Atu5321"
     CDS             313965..314324
                     /locus_tag="ATU_RS25430"
                     /old_locus_tag="AGR_pAT_461"
                     /old_locus_tag="Atu5321"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003590969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /protein_id="WP_010974575.1"
                     /translation="MDERQALTSFAALSQETRLHIVRILVVAGPDGMAAGAVAERAKV
                     SPSNVSFHLKELERAGLIKQKREARSIIYTANYHCLGALIRFLMEDCCAGHPEICAQA
                     VEVAACGVQTAEAKRVV"
     gene            314299..315024
                     /gene="arsH"
                     /locus_tag="ATU_RS25435"
                     /old_locus_tag="AGR_pAT_462"
                     /old_locus_tag="Atu5322"
     CDS             314299..315024
                     /gene="arsH"
                     /locus_tag="ATU_RS25435"
                     /old_locus_tag="AGR_pAT_462"
                     /old_locus_tag="Atu5322"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020050408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenical resistance protein ArsH"
                     /protein_id="WP_046033440.1"
                     /translation="MRRPSALFDLPAAYAAHLRQPDQDALRPSFSTHKPRILILYGSL
                     RHVSYSRLLAQEAARLLEHFGCEVRIVDPAGLPLPDAGPVSHPKVQELRDLSAWSEGQ
                     VWVSPERHGAMTGIMKAQIDWIPLSVGSVRPTQGKTLAVMQVSGGSQSFNAINQLRLL
                     GRWMRMITIPNQSSVAKAFQEFDADGRMKPSSYYDRVVDVCEELVKFTLLTRDASSYL
                     TDRYSERKEEAEKLEQRVSLKSI"
     gene            315021..316274
                     /gene="arsK"
                     /locus_tag="ATU_RS25440"
                     /old_locus_tag="AGR_pAT_464"
                     /old_locus_tag="Atu5323"
     CDS             315021..316274
                     /gene="arsK"
                     /locus_tag="ATU_RS25440"
                     /old_locus_tag="AGR_pAT_464"
                     /old_locus_tag="Atu5323"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007532100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenite efflux MFS transporter ArsK"
                     /protein_id="WP_010974577.1"
                     /translation="MSERVPIAAIVALGVTQNIGYGTLYYSFSILAPDMATHFAWSTE
                     WIFGALSIALLIGGLTAPWLGRLFDRISAGRVMTIGSAVAAASLVACAYAPGKASYVA
                     ALIVIEVSANLVQYGAAFALLVQLRPQVASRSITYLTLIAGFASTMFWPITTTLHAQM
                     SWQNVYLVFAALNLLICLPVHAWLSHAAIQRKANAKTAPSNVPGVLAPERRRLGFLLM
                     VIGCSLMSLVGAALLVHLVPLLSGLGLGATAALVSTLFGPSQVTSRLINMAFGKRVAA
                     LHLAVIAAVLIPAGVLILLLTAPSTMGAMAFAVVFGMGNGLLSIVTGTLPLHLFGSAG
                     YGQLQGKMMAARLILSALAPFALALSIARLGIATSLVICTVLGISAVVTLLRIFPLVR
                     SNDAPPPSSLPKPSGCEAIGPEEIR"
     gene            complement(316278..317294)
                     /locus_tag="ATU_RS25445"
                     /old_locus_tag="AGR_pAT_466"
                     /old_locus_tag="Atu5324"
     CDS             complement(316278..317294)
                     /locus_tag="ATU_RS25445"
                     /old_locus_tag="AGR_pAT_466"
                     /old_locus_tag="Atu5324"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012555712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent oxidoreductase"
                     /protein_id="WP_010974578.1"
                     /translation="MIEMMKAVRLHEFGGPEVLSYEEAPRPVAASGEVLVRVHAAGIN
                     PPDLYLRDGYRTLPPEWQPEPTFPLILGTDVSGVVAAIGDGVSAFSVGDEVFAMVRFP
                     EDLMQGSGAYAEYVTVPASELALKPAGIDHIQAAGAPMSLLTAWQFLVDLGHDAPNPF
                     QSFRHSPIPLQGKTVLVNGAGGGVGHLAIQLAKWRGAHVIAVASGKHEALLRALGADQ
                     IIDYTKTAAETAAEDVDLVIDAVGGSNMERFLNVVRPGGALFLVNPLGFSAHKDAARC
                     GITVSSTQVRSNGAQLAEAGRLLNDGSIRVVIDSTSPLAEAAAAHERASGGGIQGKIV
                     LFAG"
     gene            317396..318286
                     /locus_tag="ATU_RS25450"
                     /old_locus_tag="AGR_pAT_467"
                     /old_locus_tag="Atu5325"
     CDS             317396..318286
                     /locus_tag="ATU_RS25450"
                     /old_locus_tag="AGR_pAT_467"
                     /old_locus_tag="Atu5325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003592072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_035258745.1"
                     /translation="MGFERLTGLIAFARAGSLGSYTAAARSLSVSPSAISKSIQRLEA
                     HLGVSLFTRTTRSLTLTAEGRDIHGRALRLLRDAEAIEQAAKTARAEPTGMLRIATSM
                     AIGLHVIAPALAKFRKLHPKVAFDLRLSDHRVDLVEEGIDLAVRIGDLPDSRLLSRRL
                     SPHRLCCYASPDYLAMHGTPKHPDDLEAHETVNLRYQSTGQVFRWPFRIGDRDVEIVP
                     SSGIIVDASEAVMATIATDGGIGMAASFMARPWVNRGELVPVLSDFAVERNNITAVWP
                     ESRRSNPAVRAFLKTLIELF"
     gene            complement(318758..319639)
                     /locus_tag="ATU_RS25455"
                     /old_locus_tag="AGR_pAT_469"
                     /old_locus_tag="Atu5327"
     CDS             complement(318758..319639)
                     /locus_tag="ATU_RS25455"
                     /old_locus_tag="AGR_pAT_469"
                     /old_locus_tag="Atu5327"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974581.1"
                     /translation="MDIRQLKTFIAIAEHGTFAKAADAVGLTPSAVSQQIQALESEVR
                     GELFDRATRPIMLNGHGLQMLEAARTLVRDADNIIDAISGRAVSGTFTIGSVRSSALS
                     LLPLSIVALKADYPDLRIKLQVANTDELLKDVMSGRLDCAMVAEYSGIPSALRWQPFI
                     NEPLLVIGPNGTPKMSGFDMLSKLPYVRFNSKFRLAQIIETELAKTRIVPNLIAEIDT
                     IASVVSCVIHGLGVSVVPWIALRDIAAPIVAVQFGEPQILRPIGLLERRSGTRAQIID
                     RLHQNLARLSDPYGIPR"
     gene            319822..320814
                     /locus_tag="ATU_RS25460"
                     /old_locus_tag="AGR_pAT_470"
                     /old_locus_tag="Atu5328"
     CDS             319822..320814
                     /locus_tag="ATU_RS25460"
                     /old_locus_tag="AGR_pAT_470"
                     /old_locus_tag="Atu5328"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007798605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyacid dehydrogenase"
                     /protein_id="WP_035258743.1"
                     /translation="MGSRNILVTGPAINEQAVKLITDNGYQVSYVPPYTSEADLVRIV
                     TELDPVGVVVRMGRFSEAAIKAAPSLRVLSKHGVGVDNIDVDAASRREIPVVVAAGAN
                     ALSVAEHAITLLFAVVKRIVPLDSGIRAGRWEKAGYSGKELAGMIIGLVGFGAIARQT
                     AVFARGFGLKVQAYDPFTDETAFVEAGVHRVADVDDLISSSDILSLHCPLTPDTRNLL
                     DDRRLGMMKPGSFIINTARGGLIDEDALLRAVESGHIAGAGLDTFQIEPPAANHPFWQ
                     NQKIVVTPHIGGVTQEANVRVGVDAVEGIFAIVEGRHLGRERIVNHRALAKTPA"
     gene            320851..321534
                     /locus_tag="ATU_RS25465"
                     /old_locus_tag="AGR_pAT_472"
                     /old_locus_tag="Atu5329"
     CDS             320851..321534
                     /locus_tag="ATU_RS25465"
                     /old_locus_tag="AGR_pAT_472"
                     /old_locus_tag="Atu5329"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RraA family protein"
                     /protein_id="WP_035258731.1"
                     /translation="MTIGFRVRNRDRIVDQEWIDKFRELPVANISDSMHRMYAGGAEL
                     RPMHRDGKLVGRALTVKAPPGDNLMLHKAMDMAVDGDVIVMDAAGDVTHALMGEMMLD
                     YAHRRGVVGFVLNGAIRDADAFLEMNIPAFAVGVTHRGPYKNGPGEINTPIAIGGMVI
                     TPGDLIVGDADGVVVVPIDDVAEVYERTVAKHAAELKQIENIKAGTHKPTWFNDALVK
                     AGCELPSTN"
     gene            321624..322580
                     /locus_tag="ATU_RS25470"
                     /old_locus_tag="AGR_pAT_473"
                     /old_locus_tag="Atu5330"
     CDS             321624..322580
                     /locus_tag="ATU_RS25470"
                     /old_locus_tag="AGR_pAT_473"
                     /old_locus_tag="Atu5330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_010974584.1"
                     /translation="MKHLIRNTALVTTLFLGAGVAHADWPTDRPIEFIVAFAPGGGTD
                     VMNRTLAPYVEKELGAKITVLNRPGASGEIAYTAMTQARPDGYTVSSLNTPGYLTMQM
                     DRKVRFDPAKLCLVARIVEDPGSFIVQSSSKFITLKDLVAFAKENPGAVTVGTTGLGT
                     DEHLAMLQLEKAAGIDLTAVTFNGANEARTALLGGHVDTIGINVGEFVGSDHSAFKNL
                     GQFAEDRASIAPDLPTAKEQGFEVLMSSERGIAMSCDVPDEIRTKFSGAIKKALENPD
                     FQAKAKQMSLALSYRSSEDWNKELPVRGERLSAIWKLAKEQK"
     gene            322580..323044
                     /locus_tag="ATU_RS25475"
                     /old_locus_tag="AGR_pAT_474"
                     /old_locus_tag="Atu5331"
     CDS             322580..323044
                     /locus_tag="ATU_RS25475"
                     /old_locus_tag="AGR_pAT_474"
                     /old_locus_tag="Atu5331"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter TctB
                     family protein"
                     /protein_id="WP_010974585.1"
                     /translation="MATPRKVRGTGDRPDLFTAAIFIGFGALGLWAGRDLTMGTASAM
                     GPGYLPRIVCWLLIIIGAVIGGFGAVRARVGIAKPKLWPLVIILAAVVGFAFIAEFFG
                     FVAASVWLLLVGSIADRDSRLREVILLTAGLTAFGALVFIVGLGVQMPIWPF"
     gene            323056..324564
                     /locus_tag="ATU_RS25480"
                     /old_locus_tag="AGR_pAT_475"
                     /old_locus_tag="Atu5332"
     CDS             323056..324564
                     /locus_tag="ATU_RS25480"
                     /old_locus_tag="AGR_pAT_475"
                     /old_locus_tag="Atu5332"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter permease"
                     /protein_id="WP_010974586.1"
                     /translation="MNFVDLLMLGFSEALTPTNLGFCLLGALLGTLIGVLPGIGPTAT
                     IAVLLPITFYLPPLAGLIMLSGIYYGAQYGGSTTAILVNLPGEASSVVTAVDGYKMAQ
                     QGRAGSALAVAALGSFFAGTVATFGIAIAGPTLSSFALSFGPAEYVSLMLFGLLAATI
                     LARGSVLKAIGMILLGLLLGMVGIDASSGEERLTFNAVELFDGIDFVVIAIGLFGFSE
                     IVENLENVEARGVLVSKLSRLWPTREDFRRAWPAVLRGTGVGTFLGVLPGGGATLASF
                     CAYSVEKKVSKRPNEFGEGAVEGVAGPEAANNAGAQSSFIPLLTLGIPSNNMMAMMLS
                     AFIIHGITPGPTVLATQPEIFWGLVASMWIGNLMLVVINLPLIGVWVKLLTVPYRLLY
                     PAILLFCCVGVYSINNRIFDVALAAGFGLLGYAFRKAKCEPGPLLLGFVLGPLLETNI
                     RRALTISHGNPSVFVERPISLVLLIATTGVLLLMILPSFRKTREEAFQEEEA"
     gene            324634..325614
                     /locus_tag="ATU_RS25485"
                     /old_locus_tag="AGR_pAT_476"
                     /old_locus_tag="Atu5333"
     CDS             324634..325614
                     /locus_tag="ATU_RS25485"
                     /old_locus_tag="AGR_pAT_476"
                     /old_locus_tag="Atu5333"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-2-hydroxyacid dehydrogenase"
                     /protein_id="WP_010974587.1"
                     /translation="MSDAASKPLRVVLLDRKTLPDDIRFRAFSFANELVAFDQTAPDE
                     VSERIKDADIVITNKAPVRGPAIASAPRLKLVAVAATGTDVVDVAACAQRGVAVSNIR
                     NYAVNTVPEHTFAMILALRRSLLGYRKSVKAGRWQEVNQFCYFDFPINDLAGSTLGII
                     GDGALGRSVADLGRAFGMKVLFSDYKGTKGMGPLYTPFEKVLEASDVITLHSPLMSST
                     RNMISTAEFAQMTKRPLLINTARGGLVDEAALEVALRSGQISGAGFDVVTTEPPAADH
                     PLMRLLDLPNFILTPHVAWASREAVQSLVDQLIDNVEAFERGARTNIVAA"
     gene            325617..326882
                     /locus_tag="ATU_RS25490"
                     /old_locus_tag="AGR_pAT_bx66"
                     /old_locus_tag="Atu5334"
     CDS             325617..326882
                     /locus_tag="ATU_RS25490"
                     /old_locus_tag="AGR_pAT_bx66"
                     /old_locus_tag="Atu5334"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006466116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate kinase"
                     /protein_id="WP_010974588.1"
                     /translation="MGAVADTRVFLSELFRAAVAAADPYEAIKANLPREPKGRTVVIG
                     AGKASVEMARAFDALWKGSLEGVVVTKHGTRSSCSRIEVIEAAHPVPDRAGFVASRRL
                     LDAVSDLTEDDLVVALISGGGSSLLALPCEGLTLDDEIAVAKMLLSSGAPISAMNTVR
                     TQLSRIKGGRLAIAAYPAKVVTLIVSDIPGDDPVLVASGPTVLSRSTPQDALRVIDRY
                     GMALPDHVIRHLQDAAVGMDPDHPCFDNNQVTVIASPRASLEAAAVLARSQAVSAVVL
                     SDAIEGEASEVAKVHAVIAKEVARNDQPFRKPVVILSGGETTVTLRGKGKGGRNTEFL
                     LSLAIEIAEHGDITALAADTDGIDGSEDNAGSFVDGGSVARLCAAGLDPYDLLVSNDA
                     WTGFNSTKDLFVTGPTGTNVNDFRAILIG"
     gene            326886..327545
                     /locus_tag="ATU_RS25495"
                     /old_locus_tag="AGR_pAT_479"
                     /old_locus_tag="Atu5335"
     CDS             326886..327545
                     /locus_tag="ATU_RS25495"
                     /old_locus_tag="AGR_pAT_479"
                     /old_locus_tag="Atu5335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013691413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-hydroxy-acid oxidizing protein"
                     /protein_id="WP_010974589.1"
                     /translation="MQANARNLDKYLCLDDFEKAARRHLPRPLFGYVSGASETGASLR
                     HNREDFADYAFRPRVLRDVSQRSTRTTILGESYSAPFGIVPMGISALMAYQGDLVLAQ
                     GASQAGIPMIMSGSSLIRLEEVVAKAPATWFQAYLPGEPERIDALVDRVAEAGFKTSV
                     LTVDTSALANRENNIRAGFARTGKLMPVKPNELRVAGSSPFESIRLRKSPSSTYAVRL
                     V"
     gene            complement(327696..328049)
                     /locus_tag="ATU_RS25500"
                     /old_locus_tag="AGR_pAT_480"
                     /old_locus_tag="Atu5336"
     CDS             complement(327696..328049)
                     /locus_tag="ATU_RS25500"
                     /old_locus_tag="AGR_pAT_480"
                     /old_locus_tag="Atu5336"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007627061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF861 domain-containing protein"
                     /protein_id="WP_010974590.1"
                     /translation="MKVQKFSISDAELVKSPGQDAGIYVGNLVDERNGGPVSIGYGRY
                     APGQSLTETMAVDDTMIVLEGRLSVSTSDGTVTAGPGDIVYMPKGQSVTITTEGEGAT
                     TAFVTYPHWAEARET"
     gene            328120..328444
                     /locus_tag="ATU_RS25505"
                     /pseudo
     CDS             328120..328444
                     /locus_tag="ATU_RS25505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018114684.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(328595..329389)
                     /locus_tag="ATU_RS25510"
                     /old_locus_tag="AGR_pAT_482"
                     /old_locus_tag="Atu5338"
     CDS             complement(328595..329389)
                     /locus_tag="ATU_RS25510"
                     /old_locus_tag="AGR_pAT_482"
                     /old_locus_tag="Atu5338"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004117102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_010974592.1"
                     /translation="MKTRIAAGENPAPLSFRTESYEAGGIFEEKRQPWCKVGYALTGV
                     MEARVEGKRFLCPPHYATWIPADAVHACHNRENVKFVSIYIDRDLCAGMPETACTLAL
                     SPLIKAILADFAERRITVPQTEADRRLAFVLVDQLLNAPRRESFLPVSNDDLLQPVID
                     ALQADPGDRRSLSEWARLLQTTEKTLSRRFLGHLGVSFNEWRQRLKLVASLSLIEDGK
                     SVQSIAKTLGYNSPSAFIAMFRRLTGTSPTNLRSTPARTIKAASTP"
     gene            329469..330398
                     /locus_tag="ATU_RS25515"
                     /old_locus_tag="AGR_pAT_485"
                     /old_locus_tag="Atu5339"
     CDS             329469..330398
                     /locus_tag="ATU_RS25515"
                     /old_locus_tag="AGR_pAT_485"
                     /old_locus_tag="Atu5339"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008158690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_071241521.1"
                     /translation="MNKEAPMPVKYLLFSLLAVLIWVGNTIVSKLAAGAIAPGTIAFE
                     RWFIAFVILTPLVYRDAWRHRRTIAAHLPKLILLGLLGMAACQGLGYYAAGLTTATNM
                     AIMLSLVPLLTLILSAVFLAERPSSLAVIGGIISLSGIFIVLGQGDPSRLLSQGVGRG
                     DAMMLAAVLAYAGYGILLRRWAIPLATWTSIYVQIGAAVVLLVPSYLLSAPSALTLPN
                     TAMVLYAAIPGSILAPFVWMTAVKHLGAARTAIFMNLIPIFTAIVAAIFLGEALYIYH
                     LLGGGMTVAGIILVQRKPFREKSGQKAVVARAQ"
     gene            complement(331198..332166)
                     /locus_tag="ATU_RS25520"
                     /old_locus_tag="AGR_pAT_bx241"
                     /old_locus_tag="Atu5341"
     CDS             complement(331198..332166)
                     /locus_tag="ATU_RS25520"
                     /old_locus_tag="AGR_pAT_bx241"
                     /old_locus_tag="Atu5341"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006700619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GlxA family transcriptional regulator"
                     /protein_id="WP_010974595.1"
                     /translation="MSPKSPFHLTFLLFESFSNMVLASAIEPLRAARDLSGRQLFSWQ
                     LCSLDGNAIISSSRAAIAADLPLSRVGATDALILVAGYGIRNHLNQESAAAVRRKARG
                     LPIVGGLDTGAWLLARIGLLAGRRATIHWMEKKEFAENFPEVRVTDAPYVVDGNIVTC
                     GDAQSVLTWSLDLIGKHADEALRFDVANMFGGVQKSAERTLARGLSGRMSDHGLPAAL
                     QRAIVVMRETAEQPLKLPDIADRVAVSERSLDRLFHRYLGMSAGQYYSQIRLSHARAL
                     ALETNLTLYEIAFRTGFSSPSTLARAYRLKFGETLRRKKVTVISTS"
     gene            332255..333142
                     /locus_tag="ATU_RS25525"
                     /old_locus_tag="AGR_pAT_488"
                     /old_locus_tag="Atu5342"
     CDS             332255..333142
                     /locus_tag="ATU_RS25525"
                     /old_locus_tag="AGR_pAT_488"
                     /old_locus_tag="Atu5342"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011751289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-keto-5-aminohexanoate cleavage protein"
                     /protein_id="WP_010974596.1"
                     /translation="MNRDVFITCAVTGSGQSHTKSSLVPITPAQIADACIEAAKAGAA
                     IAHVHVRDPDTGAPSRDPALYREVVERVRASDTDVVLNLTAGMGGDIVLGSAEAPLPL
                     APQSDLVGATERLVHVEELLPEICTLDCGTMNFAEADYVMTNTPGTLRAMARRIQAAG
                     VRPEIEVFDTGHLWLAKTLVDEGLIDDPVMIQLCMGIPYGAPADINSLMAMVNNIPQG
                     WTYSMFSIGRMQLPYVAQAALAGGHVRVGLEDNIWLDRGVLARNGDLVERAATILTAM
                     GCRILTPQEVREKLKLLRR"
     gene            333186..334739
                     /locus_tag="ATU_RS25530"
                     /old_locus_tag="AGR_pAT_490"
                     /old_locus_tag="Atu5343"
     CDS             333186..334739
                     /locus_tag="ATU_RS25530"
                     /old_locus_tag="AGR_pAT_490"
                     /old_locus_tag="Atu5343"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006700618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_010974597.1"
                     /translation="MSKALFDITRRSLLAGAAGLAAAGIVPFGARAAEPRRGGTLRIG
                     HLGGATSDTIDPATFAAGPVVTAMLAVCNNLVEIDAEGKAVPELAESFETDADARIWT
                     FKLRQTATFSDGRKLTAKDVIASFNHHRGQDSKSGANGSLSQLTDIRSDGDHVVIFEL
                     KSGNADFAYLTSDYHFVIMPANEDGTLNWQSKLGTGGYVLADFEPGVRITLKRRDDYW
                     KSDRAWFDTVVLSTINDATARQNALITGEVDVINSPDLATLPLLLRRPGIKATEVTGT
                     AHYAMPMFCDAAPFKDPNVRLALKHAIDRKAVLEKVLHGHGRIANDSPIAPANRYFAA
                     DLPQHDYDPDKAKHYLKKAGMDALKVEISASDAASVGALAMVQLFQQSAKATGIDLGI
                     KREPDDGYWSNVWLKKPFCVSYWNGRPTEDDMFSLVYAKGVDWNESHWDNERFNSLLV
                     KARTTLDEKLRAEMYHEMQGLVSEDGGTIIPVFVNYVDVSNDKVAHGPVANNRFFDGW
                     KIVERWWQA"
     gene            334736..336190
                     /locus_tag="ATU_RS25535"
                     /old_locus_tag="AGR_pAT_493"
                     /old_locus_tag="Atu5344"
     CDS             334736..336190
                     /locus_tag="ATU_RS25535"
                     /old_locus_tag="AGR_pAT_493"
                     /old_locus_tag="Atu5344"
                     /EC_number="1.1.1.108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010397752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carnitine 3-dehydrogenase"
                     /protein_id="WP_010974598.1"
                     /translation="MKIAAIGGGVIGGGWIARFILAGHDVTVFDPHPEANRIVTEVMA
                     NAAEAWGRLYQSPLPKPGSINWASSIAEAVAGADYIQESVPERLDLKHRIIAEIEATA
                     SPQAIIASSTSGFKPSELREGSVHSERVIVAHPFNPVYLLPVVEVVGGGVAAQRASDI
                     LVSVGMKPVQIGREIDAHIGDRLLEAIWREALWLVKDGIATTQEIDDIIRYGFGLRWA
                     QMGLFETYRIAGGEAGMRHFLAQFGPALKWPWTKLMDVPEFNDELIDLIAGQSDAQSG
                     AYSIRELERIRDSNLIGIFHALKANDWGAGQTVKAMENRFYARNGKVQADYPLRLHEA
                     HVNGGWVDYNGHMTEFRYLQVLGDATDALLIHIGLDADYRAAGHSAYTVETHIRHLAE
                     VKAGARLTVETRLLGYDDKRLRLHHAILNEDGETVATGEHMLLHVDTKANRTVAMPPA
                     LMRALDHLNAQEEGPLPDHAGSGIRAVRLKETSA"
     gene            336187..337158
                     /locus_tag="ATU_RS25540"
                     /old_locus_tag="AGR_pAT_494"
                     /old_locus_tag="Atu5345"
     CDS             336187..337158
                     /locus_tag="ATU_RS25540"
                     /old_locus_tag="AGR_pAT_494"
                     /old_locus_tag="Atu5345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006700613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974599.1"
                     /translation="MKSGRKHPIQRMVAVRLGLGLFTLLFISLLIFLAVGLLPGDIAQ
                     QVLGQSATPETVAAFRRELGLDQPLSWRYLTWIGGILTGDFGHSLANGRPVAELLSAR
                     LGNTLFLAAYAAAIAIPLAVLLGLLAAMWRGTWFDRVINVMTLSAISFPEFFVAYILM
                     FWLSVHMGWFPSVADPGAAPDLFDMLRRAFLPAITLVLVVTAHMMRMTRAAVLNVLAE
                     PYVIMARLKGASRWRIITRHALPNALAPISNVIAINVAWLITGVVIVEVVFVYPGLGQ
                     LMVDSVTNRDMPVVQACALIFAAVYILLNLLADVLAIATNPRLLHPR"
     gene            337163..337990
                     /locus_tag="ATU_RS25545"
                     /old_locus_tag="AGR_pAT_496"
                     /old_locus_tag="Atu5346"
     CDS             337163..337990
                     /locus_tag="ATU_RS25545"
                     /old_locus_tag="AGR_pAT_496"
                     /old_locus_tag="Atu5346"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007534327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974600.1"
                     /translation="MTSLARTIRTMPLTALIGLIIIVIYVLLVTFAPMIAPYDQAEIV
                     GAQFEPWSTAFPVGTDALGRDMLSRLIWGARNTVGIAATTTVLAFALGAIAGLLAAAL
                     GGWFDLVLSRIVDVMMAVPPLILTLLALSALGSGVVNLILIVAVLDSTRVFRLARATA
                     ANVMVMDYVEAAKLRGDGIAWIIRKEVLPNITAPLIAEFGLRFCFVFLTISALAFLGL
                     GLPPPMADWGAMVRDNAALITFGDITPLLPAACIAVLTVSINFVVDWMLHRASGLKD"
     gene            337996..339603
                     /locus_tag="ATU_RS25550"
                     /old_locus_tag="AGR_pAT_497"
                     /old_locus_tag="Atu5347"
     CDS             337996..339603
                     /locus_tag="ATU_RS25550"
                     /old_locus_tag="AGR_pAT_497"
                     /old_locus_tag="Atu5347"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010397760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010974601.1"
                     /translation="MLLKIDNLKVEAKGEEGWSPILHGINLEVRRGEVVGLIGESGAG
                     KSTLGLAALGFAHAGLRFAGGRVLVENVDLLRLTERERSAYRGRRVAYVAQSAAASFN
                     PAWQLLDQFCEGPAIHGTASRPDCEILARQLYASMQLPDAANFGLRFPHQVSGGQLQR
                     AMVAMAMACKPDLIVFDEPTTALDVTTQIGVLTAIRSAVETSETAAIYITHDLAVVAQ
                     MADRIKVMRHGREVEEAPTRQIMQSPREDYTRSLWAVREFHRPERRLERNDAPVISIN
                     NVTASYGHFDVLRDVAFEIPRGATVAVVGESGSGKSTAARVVTGLLPPRIGSITLNGE
                     VLPPSFSRRSREQLRKIQMIYQMADTALNPRQSIRQILCRPLQFYVGLKGAALERRLG
                     ELMEQIELSPRQFLHRVPGELSGGQKQRIGIARALAANPEIIICDEVTSALDQLVAEG
                     ILRLLSRLQDETGISYMFITHDIDTVRAIADDVVVMKSGTVQDKGSKAEVMDPPRHHY
                     TRQLLASVPQMDPDWLRRLNADKPYDQ"
     gene            339593..340501
                     /locus_tag="ATU_RS25555"
                     /old_locus_tag="AGR_pAT_499"
                     /old_locus_tag="Atu5348"
     CDS             339593..340501
                     /locus_tag="ATU_RS25555"
                     /old_locus_tag="AGR_pAT_499"
                     /old_locus_tag="Atu5348"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006700607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_010974602.1"
                     /translation="MISDPQVLAFIRKTEASYPAQANTASAAENRAYYDAMCADFRAP
                     RPENVIVVDRSISGVACRLYGLASPVCVLYLHGGGLVVGGLDSHDDVCVEIADATGLQ
                     IISVDYRLAPEHRWPAQINDVEAVWRAVDQPVVVVGDSAGGLLAAALCLSQKGKRQPL
                     GQVLIYPGLGGDGDAASYRENAEAPLLRASDVLTYRDFVFGGQPATDPIARPLKAPDL
                     SDLAPAFVVTADVDPLRDDGWAYAERLAAAGVPVTLRNEAQLPHGFLRARIMSDRARR
                     SFQAVIAAISRFASNEVPLANFPHEP"
     gene            340671..>340892
                     /locus_tag="ATU_RS25560"
                     /pseudo
     CDS             340671..>340892
                     /locus_tag="ATU_RS25560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313387.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(340958..341446)
                     /locus_tag="ATU_RS25565"
                     /old_locus_tag="AGR_pAT_501"
                     /old_locus_tag="Atu5349"
     CDS             complement(340958..341446)
                     /locus_tag="ATU_RS25565"
                     /old_locus_tag="AGR_pAT_501"
                     /old_locus_tag="Atu5349"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing protein"
                     /protein_id="WP_010974603.1"
                     /translation="METPPRSLVENLLDGAGFYSWSLSTNTLTADAAFAAIYEIGEDD
                     LEKGVPVEAILERIVEEDRPRLAARIHDVILGGRPFVSPYRIRCADGRIRSLLSMGSC
                     SKDQNGVPSIYSGIVLIEREMEIKLNASGLEKHIDAALDLAKIGGLELTQRYLSSALR
                     SL"
     gene            341977..343083
                     /locus_tag="ATU_RS25570"
                     /old_locus_tag="AGR_pAT_503"
                     /old_locus_tag="Atu5350"
     CDS             341977..343083
                     /locus_tag="ATU_RS25570"
                     /old_locus_tag="AGR_pAT_503"
                     /old_locus_tag="Atu5350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fic family protein"
                     /protein_id="WP_010974604.1"
                     /translation="MKWNWQNTDWPNFRHDTASMVPLEQKFLQSAGEVIGAVRHFNED
                     DSNQLRIELLSDEAVKTSEIEGEFLDRVSVQSSLRRQFGLSTDDRQIRPQERGIAEMM
                     ADVYRSWHTPLRHEGLFHWHSMLMAGNRYIETVGAYRTHEDAMQIVSGRFDKPTIHFE
                     APPSRQVTGEMETFIAWFNQSGPDGQTSVQALTRAAIGHLYFESIHPFEDGNGRIGRA
                     LAEKSLAQNIGQPSLISLAFTIEKSRKAYYSELERHQRTLDITGWIIFFAETILDAQR
                     VTLERIDFFIHKAKFYDRFRGQLNERQEKVVTRIFKEGTAGFKGGLSAENYISITDTS
                     RATATRDLQHLVEIGALTRTGERRHTRYSLSLKK"
     gene            complement(343376..>345124)
                     /locus_tag="ATU_RS25575"
                     /old_locus_tag="AGR_pAT_506"
                     /old_locus_tag="Atu5352"
                     /pseudo
     CDS             complement(343376..>345124)
                     /locus_tag="ATU_RS25575"
                     /old_locus_tag="AGR_pAT_506"
                     /old_locus_tag="Atu5352"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011982997.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="Tn3 family transposase"
     gene            345166..346704
                     /locus_tag="ATU_RS25580"
                     /old_locus_tag="AGR_pAT_508"
                     /old_locus_tag="Atu5353"
     CDS             345166..346704
                     /locus_tag="ATU_RS25580"
                     /old_locus_tag="AGR_pAT_508"
                     /old_locus_tag="Atu5353"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010972061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-like element ISAtu3 family transposase"
                     /protein_id="WP_010972061.1"
                     /translation="MYSYADRLRAVELYIRLGKRLNTTIRQLGYPTKNALRGWYREYV
                     QHLDLRTQPVARAPKYSEAQRQAALEHFRTHDRCISGTMRALGYPGRGTLTAWVREAF
                     PEARTSMVGRSWHPGYSEEVRQAGVIGLCSGDESAQQVADRLGVSRPTLYSWKDQLLG
                     HEASSSMKRRKANPKVPEREELERKLEALQRDVRQLQLEHDLLKKANELLKKGLGVDL
                     LILSNREKTQLIDALKEVYRLPELLAQLRIARSSYFYHRARMCLADKYAAVRLSLAEI
                     FEANRRCYGYRRLQASLARKSVIVSEKVVQRLMKQEHLAVARPRRRRFGSYLGEISPA
                     PENLINRDFHADAPNVKWLTDITEFQIPAGKVYLSPIIDCFDGMVISWSIGTQPDAGL
                     VNTMLDAAIGTVANGEERPIIHSDRGAHYRWPGWLTRISEARLVRSMSRKGCSQDNAA
                     CEGFFGRLKTELFYPRDWKAITIEQFVAEVDAYIRWYNEKRIKISLGSLSPVEYRQSL
                     GLKL"
     gene            complement(347092..350454)
                     /locus_tag="ATU_RS25585"
                     /old_locus_tag="AGR_pAT_511"
                     /old_locus_tag="Atu5354"
     CDS             complement(347092..350454)
                     /locus_tag="ATU_RS25585"
                     /old_locus_tag="AGR_pAT_511"
                     /old_locus_tag="Atu5354"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010661819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter outer membrane beta-barrel
                     domain-containing protein"
                     /protein_id="WP_035258305.1"
                     /translation="MLIWSSPSLAGSCDPAGPETWSCSGAATGSDPSAVIFSSAPVTV
                     VTQPGFGLSTSGEAIRVETIGGIAITDGNASSITSSGGQGILAINDVSGAVEITSNGS
                     ITGIDGIYVINTGTGPTTITSSGTAIGTIGNGVYVSNDGFATDLTVSQTGGTIFGADN
                     GISTTNRGFGATAISVAGDVDGAAENGIWAQNFANATGITITQAVGSTITGYTHGIRA
                     DNWAAGAISITTAGVINQTQTGAANNDTFGVYAYNSTAGTDIILTQTAGSISGNWFGM
                     YANNQGSGSTRIISSGDVTAIVRAGLYAYNAAPADSIFVSQTSGTVKGGTYGVFADNA
                     GTGSTTVTLSGDVIASGDYGVYSRNASSATDLMVRQTAGSIAGRTGILASNRGTGASL
                     VSVGSRVSGGAGAGIQTIAANGSTIDIASSATVTATSGIAIRDGGVAGSPIASDTIGG
                     NVVVNSAGIVTGDAVLGLGDDTFNLAGGTYAGNIYGDDRDDPRSNDGVTNHEGNDTFT
                     WTGGTLAGGFYGQDGSDTAMVSASAYDGSQVLDGGDDTSVADGMIDTLTLKGVTATTN
                     GGKIINWEVVNLDGASLSIDDGVWHVGEPDEATTGVFLDNRSRLDGIASLAFDGNMTI
                     DSTSAFVGTGGGTGVYSFSGDVANAGTITTVDDAVGDVVIIGGNYNGNGGQILFDVAL
                     GDDNSKTDMVIINGDTSGMTNVGVNNVGGTGAQTSEGIRIIEVNGASNGYFSLVGDYT
                     IGDRQAVVAGAYAYQLYQGGTSSPNDGNWYLRSQLTVSNPTPTAPLYQAGVPSYEAYP
                     QALLGLNGVPTLQQRVGSRFWAGNGASVGTPYATPEGAGVAIEGNGVWGRIEGVHNHI
                     EPRFSAAAAEYDQNVFKLQAGIDGLLTETESGKLIGGFTVHYAHGKTDTRSVWGDGEI
                     STDGYGLGGTLTWYGENGFYLDGQAQMTWYTSGLNSLLARTNLTDNNDGFGYTLSLES
                     GTRIAIDPGWSVTPQAQLVYSNVDFDAFTDTFGARVSLDRGESLQGRLGVTLDHESAW
                     QNDKGLLNRSHVYGIGNLYYEFLEGTRVDVQGVRLASRNDRVWAGLGLGGTYSWDDDK
                     YSIYGEALVQTSLNDFGDSYSVKGQVGLRVKW"
     gene            351032..351286
                     /locus_tag="ATU_RS25590"
                     /old_locus_tag="AGR_pAT_513"
                     /old_locus_tag="Atu5355"
     CDS             351032..351286
                     /locus_tag="ATU_RS25590"
                     /old_locus_tag="AGR_pAT_513"
                     /old_locus_tag="Atu5355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_071241522.1"
                     /translation="MSFVLEKHWERLLKEIAACEMAVREIETDLRLRAMSNDANDREL
                     ALPRRLKGEKADLLHRYQNLREAFIALLCENDIAAEQFPG"
     gene            complement(351732..352313)
                     /locus_tag="ATU_RS25595"
                     /pseudo
     CDS             complement(351732..352313)
                     /locus_tag="ATU_RS25595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006219235.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
     gene            352498..353148
                     /locus_tag="ATU_RS25600"
                     /old_locus_tag="AGR_pAT_516"
                     /old_locus_tag="Atu5358"
     CDS             352498..353148
                     /locus_tag="ATU_RS25600"
                     /old_locus_tag="AGR_pAT_516"
                     /old_locus_tag="Atu5358"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020808183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysE family translocator"
                     /protein_id="WP_010974610.1"
                     /translation="MDLVIPGAANLGLFISTTLVLLLVPGPAVLYIFARSVEQGRSAG
                     LVSILGIHTATLVHVVAAAVGLSALLASSALAFSVVKYAGAAYLIWLGLKKLFGPSDI
                     PDVEGGLPTRSRMRIFREGFIVNLLNPKTALFFLAFLPQFVEVDRGHVAMQIAFLGIL
                     YTAIGILTDGTYALVAGTAGNWLKRSPVYLKAERWVSGFVYIGLGVTAAFAGNQRK"
     gene            complement(353283..353471)
                     /locus_tag="ATU_RS25605"
                     /old_locus_tag="AGR_pAT_518"
                     /old_locus_tag="Atu5359"
     CDS             complement(353283..353471)
                     /locus_tag="ATU_RS25605"
                     /old_locus_tag="AGR_pAT_518"
                     /old_locus_tag="Atu5359"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YegP family protein"
                     /protein_id="WP_035258281.1"
                     /translation="MYKFEVFKDKAGEFRFRFRASNGEIMFSSEGYKAKASVLNAIES
                     IKKNSPGAETVDQTTATV"
     gene            complement(353523..353815)
                     /locus_tag="ATU_RS25610"
                     /old_locus_tag="Atu5360"
                     /pseudo
     CDS             complement(353523..353815)
                     /locus_tag="ATU_RS25610"
                     /old_locus_tag="Atu5360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019564341.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(353909..354595)
                     /gene="aqpZ"
                     /locus_tag="ATU_RS25615"
                     /old_locus_tag="AGR_pAT_521"
                     /old_locus_tag="Atu5361"
     CDS             complement(353909..354595)
                     /gene="aqpZ"
                     /locus_tag="ATU_RS25615"
                     /old_locus_tag="AGR_pAT_521"
                     /old_locus_tag="Atu5361"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007697167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aquaporin Z"
                     /protein_id="WP_010974613.1"
                     /translation="MGRKLLAEFFGTFWLVFGGCGSAVFAAAFPELGIGFTGVALAFG
                     LTVLTMAYAVGGISGGHFNPAVSVGLTVAGRFPASSLVPYVIAQVAGAIVAAAALYVI
                     ATGKAGIDLGGFASNGYGEHSPGGYSLVSALLIEIILTAFFLIVILGSTHGRVPAGFA
                     PIAIGLALTLIHLISIPVTNTSVNPARSTGQALFVGGWALQQLWLFWLAPIVGGAAGA
                     VIWKLFGEKD"
     gene            complement(354753..355367)
                     /locus_tag="ATU_RS25620"
                     /old_locus_tag="AGR_pAT_523"
                     /old_locus_tag="Atu5362"
     CDS             complement(354753..355367)
                     /locus_tag="ATU_RS25620"
                     /old_locus_tag="AGR_pAT_523"
                     /old_locus_tag="Atu5362"
                     /inference="COORDINATES: protein motif:HMM:NF022515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2865 domain-containing protein"
                     /protein_id="WP_162180353.1"
                     /translation="MEADLADLGGKVFSRGSDGCSASARQQRKSTSPAHASSKFAGTF
                     RTGRAVLYCVRLADGYLFPAPNSQFVASDAADAILRQCQYICEDPAMDVYVLEDANLG
                     TEQMISIRSQTSYQDFPRAFRYRDQENFRKCDWNRYVARIYELQQTKQMSKEMADVSV
                     PPPALRPKIEENRVSMEETGSVKEVEPLIERPVRIVGPVFLQPQ"
     gene            complement(355621..355860)
                     /locus_tag="ATU_RS25625"
     CDS             complement(355621..355860)
                     /locus_tag="ATU_RS25625"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_046033441.1"
                     /translation="MSRNVYLASAARVLSLSDKEIARRLDVSVATLRSVDSVTSPAYL
                     RFALATLVAELDPEAVLGAGVNPSFPSSDKPSISQ"
     gene            complement(355857..356303)
                     /locus_tag="ATU_RS25630"
                     /old_locus_tag="AGR_pAT_524"
                     /old_locus_tag="Atu8205"
     CDS             complement(355857..356303)
                     /locus_tag="ATU_RS25630"
                     /old_locus_tag="AGR_pAT_524"
                     /old_locus_tag="Atu8205"
                     /inference="COORDINATES: protein motif:HMM:NF019844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SH3 domain-containing protein"
                     /protein_id="WP_010974615.1"
                     /translation="MRTKNILAALALFLGISLPSLVEAANAYATGNVNVRTGPGTRYP
                     RTGTIPAGATLTIRGCLNGYSWCEVIFAGQSGWASSNYLQATYQNRRRPVIHIGPVIG
                     LPVIVHKPRPPHWEHRPRPPRPPHWGHRPRPPHWDHRPRPPRPQPR"
     gene            complement(356355..359120)
                     /locus_tag="ATU_RS25635"
                     /old_locus_tag="AGR_pAT_528"
                     /old_locus_tag="Atu5364"
     CDS             complement(356355..359120)
                     /locus_tag="ATU_RS25635"
                     /old_locus_tag="AGR_pAT_528"
                     /old_locus_tag="Atu5364"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013891690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter domain-containing protein"
                     /protein_id="WP_010974616.1"
                     /translation="MRHRATDCRTKVLLSGTALLTGLLLCCPPPANAACNFPAPVGND
                     IYICDSGTSVGGLTDTGGNNTLLLPSAGTGTVAGNVTFGAGADRIEIYSGTINGAVVQ
                     GDGSDAFVISGGAVTGNVQQGSGVDDFRMTGGTIQSLNQGDNLDTFFMSDGRIIDAFD
                     DGDVATMTGGRIGRVNMKLDDNVFDMSGGIIDRNLVTGFGNDTIILSGGTIGGNISVS
                     GGTDSVTVTGGVVGGSVLLSFGNDRFNWNGSGIIYGAIDLGADDDTATLTNLANAHIG
                     ATTQISGGLGTDSLTMSNVKTGGVARFDSWETINLTNDTELVFDGTLTLGDSGTGTGT
                     LTIDSASTVYGGGQNGRVSAFSAGAFANLVNSGRIDLTNGGGGASDTFTVSGNYVGNG
                     GQIFLDTVLGTDGSASDKLVIDGGAASGSTGMNVVNAGGSGARTTADGIMVVQATNGA
                     TTAGGAFALNSRVAAGAYEYYLFKGGVSAGTQDNWYLRSTIVPGSGAVAGAPDPLQPN
                     TTPEAEAPDITGAPPASQLPPTPLPTEGSSTTEPTDPTPPINAGDPQPVAPPTPQAAG
                     TASPPPAPPVPPTTLAMIPSASAIPPTPGATRVIADIVPLYRVEVPTYSAVQPLAQYL
                     ALSTLGTFHERRGEQALLQGDGWMPTSWARTFGQNTEMKWDGTVSPSFDGNLFGLQAG
                     QDLLGRETEAGGFDRFGLFVGYSRMNGDIKGQALGWNNLAVGEVDIGGTSFGAYWTHV
                     GAQGWYLDAVLMGTWFSGDATSRAGESVNIDGSSVAASLEGGYPIALTEDWTLEPQAQ
                     IIWQKLSLDDEADRFSSVAFDSDNAVTGRLGVRLQGNYQTDSGLIQPYLKANIWHGFS
                     SDQMTRFDNDPIVTETGGTSLEIGGGLVASLTEKVSVFATVDYTTNLGGERKRAIEGN
                     IGLNIKW"
     gene            <359126..359464
                     /locus_tag="ATU_RS25640"
                     /old_locus_tag="AGR_pAT_529"
                     /old_locus_tag="Atu5365"
                     /pseudo
     CDS             <359126..359464
                     /locus_tag="ATU_RS25640"
                     /old_locus_tag="AGR_pAT_529"
                     /old_locus_tag="Atu5365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004431377.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
     gene            359898..360248
                     /locus_tag="ATU_RS25645"
                     /old_locus_tag="AGR_pAT_530"
                     /old_locus_tag="Atu5366"
     CDS             359898..360248
                     /locus_tag="ATU_RS25645"
                     /old_locus_tag="AGR_pAT_530"
                     /old_locus_tag="Atu5366"
                     /inference="COORDINATES: protein motif:HMM:NF013677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_161597239.1"
                     /translation="MIEAVPDRLDGSPRQLRRFWSDEFKETAVEQACQPGVNMSAVAR
                     QIGILPSQLYRWRRELLASDKPGEAPAAVDPQSVAPDANPVVEIVIDGIVVRADRHIE
                     EAHLQRVIRAVRSA"
     gene            360245..360589
                     /gene="tnpB"
                     /locus_tag="ATU_RS25650"
                     /old_locus_tag="AGR_pAT_531"
                     /old_locus_tag="Atu5367"
     CDS             360245..360589
                     /gene="tnpB"
                     /locus_tag="ATU_RS25650"
                     /old_locus_tag="AGR_pAT_531"
                     /old_locus_tag="Atu5367"
                     /inference="COORDINATES: protein motif:HMM:NF017528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family insertion sequence element accessory
                     protein TnpB"
                     /protein_id="WP_010974619.1"
                     /translation="MIPAGVKVFLASHPIDFRKGPDSLLSLVRDPGSDPSNGSLYVFR
                     AKRADRIKIVWCDGSGVCLYAKRLEKAQFCWPRIGHNRVQLNHAQLMALVDGMDWKRV
                     RSVAVKPPEIVG"
     gene            360663..>361703
                     /locus_tag="ATU_RS25655"
                     /pseudo
     CDS             360663..>361703
                     /locus_tag="ATU_RS25655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011053350.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family transposase"
     gene            complement(361737..362884)
                     /locus_tag="ATU_RS25660"
                     /old_locus_tag="AGR_pAT_535"
                     /old_locus_tag="Atu5370"
     CDS             complement(join(361737..362635,362635..362884))
                     /locus_tag="ATU_RS25660"
                     /old_locus_tag="AGR_pAT_535"
                     /old_locus_tag="Atu5370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611806.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-like element ISAtu4 family transposase"
                     /protein_id="WP_113519832.1"
                     /translation="MQRRIFSREYKLEAVKLVRERGVTVAQAARDLDVHENVLRKWVR
                     EYGDDPSQSFPGKGQMKPEQLEIERLRREVTKLKAERDIPKKGRSLLCQGRDMKFAFI
                     AKHRSIWPVAWLCEALGVSRSGFHAWFNRSPSEHARHDEVLLERIKQSFQSSDRTYGA
                     RRVWHDVLEEGLSCGLHRIERLMRLNALRARPRRRGFPKDAGDRPVVMPNVLDRQFVA
                     DRPNQKWVADFTYIWTAEGWLYVAAVIDLFSRRVVGWSMNANMTAQLVTDALIMAIWR
                     RGKPDALLHHSDQGSQYTSEQFQRLMGDHGITCSMSRSGNVWDNAAMESFFSSLKTER
                     TARKVYRTRNDARADVFDYIERFYNPKRRHSTLGYLSPDDFETKVGLA"
     gene            363293..364387
                     /locus_tag="ATU_RS25665"
                     /old_locus_tag="AGR_pAT_538"
                     /old_locus_tag="Atu5372"
     CDS             363293..364387
                     /locus_tag="ATU_RS25665"
                     /old_locus_tag="AGR_pAT_538"
                     /old_locus_tag="Atu5372"
                     /inference="COORDINATES: protein motif:HMM:TIGR00254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_162180352.1"
                     /translation="MLIETNYATPFKQIVEDNFIVASVILACRALNDRVQLNNNIAFD
                     LTMLLTSTIMVAISRTMFDSARLETLFVQACCAFVLWRGYIRFSILAATKSDKILSFT
                     FLLLAMVLTGQCLLYIAASETERLSGAWRTSVWGNLVQFTGLIGSITLVFSVVIATTY
                     EAIEKYRRYANLDPLTNLLNRRGLDAVLASAQGERLKKPATAIILADIDHFKAINDRF
                     GHSFGDLVIKRFGALVQSHTTTQGCVARLGGEEFAVLLPDTCLDDAIAAAEKMRRSFA
                     AERWPCDRKESEFTASFGVALVEDGEALSTAFERADQFLYAAKRMGRNRVAAAKHVWR
                     ETLDPSLQLGHDNVVYIDRVTNESTHRPGV"
     gene            complement(364875..365135)
                     /locus_tag="ATU_RS25670"
                     /old_locus_tag="AGR_pAT_541"
                     /old_locus_tag="Atu5374"
     CDS             complement(364875..365135)
                     /locus_tag="ATU_RS25670"
                     /old_locus_tag="AGR_pAT_541"
                     /old_locus_tag="Atu5374"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162180355.1"
                     /translation="MGWGHKVSFVLEKHWERLLEEIAACEMAVREIEIDLRLRAMANN
                     VNERELILLRRLKEEKADLLYRCLNLKEAFIALLRENDLAAG"
     gene            365514..366593
                     /locus_tag="ATU_RS25675"
                     /old_locus_tag="AGR_pAT_542"
                     /old_locus_tag="Atu5375"
     CDS             365514..366593
                     /locus_tag="ATU_RS25675"
                     /old_locus_tag="AGR_pAT_542"
                     /old_locus_tag="Atu5375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003504098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain S-box protein"
                     /protein_id="WP_035258276.1"
                     /translation="MEEYSHADDGATNEARLQRRLTQLKGAQPGYEAAAFLAAIVESS
                     DDAIISKSLQGIITTWNLSAERLFGYSADEAVGRPITMLIPEDRLDEEPAILARINAG
                     ERVDHFETVRRRKDGTLIDISLTISPIRAGDGTIIGASKIARDISERKRAAEHQDMLL
                     REMHHRVKNLFTITGSIITLAARTAQTPAELADGMKNRLIALSHAHQLTLPSFSGGES
                     PSERSTTLFNLLSNLLSPFADKDAGRWHLHGEDPHISAERVTSLALLFHEYATNAVKY
                     SALSVADGRLDVTLTPGPDCFEIAWLESNARTTAAGKTKEADFGTTLENMLVRTLNAQ
                     VSRDWQRQGLLIRLTLPRNVFSLPS"
     gene            366741..367064
                     /locus_tag="ATU_RS25680"
                     /old_locus_tag="Atu5376"
     CDS             366741..367064
                     /locus_tag="ATU_RS25680"
                     /old_locus_tag="Atu5376"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974628.1"
                     /translation="MACFDSTDASYRLMRSAVKVLADRFTHSETASAAIVEHSLQIIL
                     ADPDLLSDGSRGALFPVVRRVALEHFGIFNNLPTAPAADHPDGLDKAAAAESSKNKDG
                     NSARR"
     gene            367193..368593
                     /locus_tag="ATU_RS25685"
                     /old_locus_tag="AGR_pAT_543"
                     /old_locus_tag="Atu5377"
     CDS             367193..368593
                     /locus_tag="ATU_RS25685"
                     /old_locus_tag="AGR_pAT_543"
                     /old_locus_tag="Atu5377"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003567940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain S-box protein"
                     /protein_id="WP_010974629.1"
                     /translation="MNDNIIFSGVRTAVPTKQHMEDYEDFFENGAVALHLVGEDGTIL
                     RANRAELDLLGFTAEEYIGRPISQFHADSDTIREILARLSGGEKLNRFPARLRAKDGS
                     IRYVEITSSVQFRDGKFLNTRCFTIDVTDTVQLRRQLARKEQEMRQILEALPAAVYTT
                     DAQGKITYYNRAATELSGREPVVGQDEWCVTYRLFTPDGQPLPHDQCPMAIALREKRA
                     VRGVEAIAQRPDGTMVPFLPFPTPMFDEDGELIGAINMLVDISDRKTAETNQKVFLDE
                     LNHRVKNNMAMLYGLINSAARESRSDEARRVLGDAAQRVGAMAAAQQTLYMEKDRTRV
                     NAREFLQAVCSSARLAFSKEVALHIDVDAVQLPNDVTMPLALVLNELLTNAAKHGCDD
                     AGKCDVWITLSHHDGEFVLTVRDSGSGYNFEATGKRSSGTGLVSGLVRQLRGSFSVAP
                     GPGAMCTIRFIDNKLG"
     gene            368669..369049
                     /locus_tag="ATU_RS25690"
                     /old_locus_tag="AGR_pAT_544"
                     /old_locus_tag="Atu5378"
     CDS             368669..369049
                     /locus_tag="ATU_RS25690"
                     /old_locus_tag="AGR_pAT_544"
                     /old_locus_tag="Atu5378"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013949125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_010974630.1"
                     /translation="MRGTEPEDLRILIVEDEFLIALELESSLLDAGYKVVGIAVTATE
                     AVAMARAEQPNLAVMDIRLADRTDGVEAAIELFGMFGIRSIFASAHADEETRKRAAPA
                     RPIGWVQKPYSADALIRVIRDFCN"
     gene            complement(369171..369486)
                     /locus_tag="ATU_RS25695"
                     /old_locus_tag="AGR_pAT_545"
                     /old_locus_tag="Atu8206"
                     /pseudo
     CDS             complement(369171..369486)
                     /locus_tag="ATU_RS25695"
                     /old_locus_tag="AGR_pAT_545"
                     /old_locus_tag="Atu8206"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018860249.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
     gene            complement(369790..370293)
                     /locus_tag="ATU_RS25700"
                     /old_locus_tag="Atu5380"
     CDS             complement(369790..370293)
                     /locus_tag="ATU_RS25700"
                     /old_locus_tag="Atu5380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015343895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_010974632.1"
                     /translation="MLETQRLILRPSRRADIPELFEFLGNAVAMQHTHSDKTLRECQR
                     RVMVHEWRRRRDGCAPWVVVRREDGRIIGWGGLYEDPFDPGWNYEVGYYFRPEVWGNG
                     YASELVSAALGFADTQLKLPEVWAMAHPDNSGSQRVLEKAGFVFARRLHDRNRLLFRR
                     RRPITDP"
     gene            complement(371016..374174)
                     /locus_tag="ATU_RS25705"
                     /old_locus_tag="AGR_pAT_548"
                     /old_locus_tag="Atu5381"
     CDS             complement(371016..374174)
                     /locus_tag="ATU_RS25705"
                     /old_locus_tag="AGR_pAT_548"
                     /old_locus_tag="Atu5381"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018902453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter permease subunit"
                     /protein_id="WP_010974633.1"
                     /translation="MTWHNAPSSTEEKHKFNLSRWAISHPSIARFLFGLIIVMGALGV
                     INMGQKEDPDFTFRVMVVQSVWPGASIDDMQNQVVNKIERKLQETPHLDWVKSYIRAG
                     VAITTIQIKGDTNGADVADAFYQVRKKVGDIKQDLPSGLLGPYFNDEFGDTYITLHAI
                     SGDGYSYPELKKFAIQARDMLIAMPGVEKAVILGDQPQKIFIDVSSKALAERGLTVVD
                     IQNALQGQNDVDPAGSVETADRSVRISVEGDVTTPAEIRELRLKAGDQVIRLGDIATV
                     RDGLEDPFQRKFRVNGHDTVELGVVMAKGFKVTDVGKGIEETYKRFEDTLPVGVEVTQ
                     ISNQPEVVTEAVGEFTQALMEALGIVLIVSLISIGWRSGIVIAVAIPLVLAATLAIMF
                     YMGIELQRISLGALIIALGLLVDDAMIVVEMMERKLEEGLNRLDAASFAYSSTAFPML
                     TGTLITTAGFIPVGFAASTAGEYVRSLFFVVGIALVTSWFVAVYFTPWLGYMILKQRA
                     HAGTHHDAYDTRFYRGVGHTVGWAVRHKAIVLLLTLGAFVGSLWSFQFIPQSFFPQSS
                     RPEILVDMWLPEGTAIKEVERQAKALEAKIMDDPDKKFVATFIGEGAPRFFLPLDQQL
                     RNPNYAQLLVMSNGLEERERMIVKLRKILAEDFPTVRGKVDRLFLGPPVGWAVQMRVV
                     GPDRAEVRSIADQVKQRFEQQPNFGAVHDDWMEPVPAMKLVIDQDRARALGVSSQRVR
                     QILQAATNGAAISDFRDGEETVSIVVREPDATRSLLSAVNSVYIPTDIGGFVPASQIA
                     RVVPLLEQGIEWRRDRLPTITVKATLPDGVEPTQVTMNLYNSMADLRAKLPAGYKVEI
                     QGGAEDAAESQQSIAAKAPIMLLVILVLLMIQLQHFGKAMLVLATGPLGIIGAAMALL
                     ITGAPFGFVAILGVIALLGIIMRNSIILVDQIDQDIAAGHPRAEAIVGAAVRRFRPIM
                     LTALTAVLALIPISRGLFWGPMAYAMMGGILVATVLTILVLPAAYALFFGREPKAKKE
                     DEKPASQGELFEEHRDMPMAAE"
     gene            complement(374200..375354)
                     /locus_tag="ATU_RS25710"
                     /old_locus_tag="AGR_pAT_549"
                     /old_locus_tag="Atu5382"
     CDS             complement(374200..375354)
                     /locus_tag="ATU_RS25710"
                     /old_locus_tag="AGR_pAT_549"
                     /old_locus_tag="Atu5382"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007527846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter periplasmic adaptor
                     subunit"
                     /protein_id="WP_010974634.1"
                     /translation="MSSFRFVTATTVLKIAVVAGALSLLASCSEEKKAEAPDVVRPVK
                     VAEIGAPDEGRKLIYSGAVKARTEMNLGFHVSGKITERLVNVGDHVSPGAVLARLDPV
                     DYKLAVTRAEADLSSARKQVEITDLAYRRAQTLAAQNATSQSALEQASLSRDQAVSSR
                     QSAESALEQARNQVAYSDLKSDQKGIVTTVSADVGQVVSAGTPVVTVAVDGEKEVQIA
                     VPEMDVSHFQPGKQVSASFWAANTIVLTGKVREVAQSADPQSRTFSVRVSLPEDQRVL
                     LGMTATIEAKADNAVPAFSVPLAALGEKDGKKVVWVVDRQKGTVSSRPVEVVDFSDDG
                     ARISKGLSTGVLVVSAGTQFMREDMKVRLPETVTSRFGSVNSLTTASVVP"
     gene            complement(375414..376013)
                     /locus_tag="ATU_RS25715"
                     /old_locus_tag="AGR_pAT_551"
                     /old_locus_tag="Atu5383"
     CDS             complement(375414..376013)
                     /locus_tag="ATU_RS25715"
                     /old_locus_tag="AGR_pAT_551"
                     /old_locus_tag="Atu5383"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004668727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_010974635.1"
                     /translation="MDTTTSSDEVRRENITRILDAAERLFKHYGYTKTNVADIARDLG
                     MSPANIYRFFSSKADIHQALCRRMLAASQQVAVEIAARKDSACVRLRDFILAQFKITA
                     ETMLADKKVHEMVVVAMEENWPVIEEHIERIRVVIERVIAEGIAAEEFREQNAALAAE
                     NFMSATILLCHPQLVAKCLAETRIGKPEDLIDFALRGLK"
     gene            complement(376775..379138)
                     /locus_tag="ATU_RS25720"
                     /old_locus_tag="AGR_pAT_554"
                     /old_locus_tag="Atu5384"
     CDS             complement(376775..379138)
                     /locus_tag="ATU_RS25720"
                     /old_locus_tag="AGR_pAT_554"
                     /old_locus_tag="Atu5384"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974636.1"
                     /translation="MSMTKHDLSSRHFQRKISEFCELRIAPITSRRALENIRPFLISL
                     IIYRESPPLLNGHIDWTMISQACGIEAELTAELKKQLRPGLDAIIRWLGVPPAAEERR
                     APKSTVSSSKMAPARKAASASSTRKPQCAATDGAFTRSASTQRGPASKPISPFPQALF
                     EATEDPASFQDALVYHMRRFGDTYWQLYRAVVHLNETFDNKTLLSWIQGERVPRSVAS
                     FNILRRIERRYQLAEGYFKEKLPHQARSLYGHELGDISPAERRRISLHLPEDFNSLPF
                     TKREEILDWVRRVIISGSTEYRRYQAAASKQRYAIRFPGVTYGSSFLSSRSVAAAAGA
                     NQNVAAEIVDPDLLSGVVDAPPRLAMEMADLIRFKTSTLTAIGFQRNGVWGEETASQK
                     IEHLGLMFGALAASPNGVVKGFGVPVSQLSFGLLIFPGVWDWYLQWREQRRGFYTKWE
                     EDMLMVAQALTRAEVGWIRQHPELLQNVRPITGLIEQEEIEFAARDWHGACDAFHRHA
                     ANRSKEIQRVMRVHRDPFEPIMCVLEADSPLAEYRKITDEIVKRMPDENRYPRPAAEA
                     VRSFLLLRLGLHLGLRQKNLRQLRLCPRGHHPTSERRLEDMKCGELRWSDRDNGWEVL
                     IPAAAFKNSSSSFFGQKPFRLILPDLLELYQYLDAYIDRHRGVLLGGAKDPHTLFVKT
                     VKTTSTDAAYNSTTFYEAWRTVIQRYGIYNPYTGRGAIKDLLPHGPHNLRDILATHIL
                     KQTGSYEQASYAIQDTPDVVQQHYGRFLPQDKAALAAKILNQVWEAA"
     gene            379378..380559
                     /locus_tag="ATU_RS25725"
                     /old_locus_tag="AGR_pAT_556"
                     /old_locus_tag="Atu5385"
     CDS             379378..380559
                     /locus_tag="ATU_RS25725"
                     /old_locus_tag="AGR_pAT_556"
                     /old_locus_tag="Atu5385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016446673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fic family protein"
                     /protein_id="WP_010974637.1"
                     /translation="MSDSQSRNRLGRFVETVAASETVRAFVPPPLPPEPAIDVLSLLE
                     RLSLAERALGRLDGITMLLPRQELFLYMYVRKEAVLSSQIEGTQSTLSDLLRFETEAQ
                     AGQPVDDIREVSNYVDAMMYGLQRLETLPMSLRLIREMHAKLLHSGRGGTKDPGEFRR
                     SQNWIGGTRPGNALFVPPPVTEMAGCLDAFERFMHDDQSRLPALIKAGLLHVQFETIH
                     PFLDGNGRIGRLLVTLYLCMNGVLRKPLLYLSLYLKSHRREYYRLLQEVREHGNWEAW
                     LEFFLTGVADTANQAFEAATQIVDLFKEDRERITMESDRAGSALRIHELFQQNPFHTA
                     NQIVQVTGLSAPTVNAALADLERLGIVDEVTGRKRGRVFSYRRYLAILGEGTDPLPLN
                     S"
     gene            complement(380703..381305)
                     /locus_tag="ATU_RS25730"
                     /old_locus_tag="AGR_pAT_558"
                     /old_locus_tag="Atu5386"
     CDS             complement(380703..381305)
                     /locus_tag="ATU_RS25730"
                     /old_locus_tag="AGR_pAT_558"
                     /old_locus_tag="Atu5386"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007536864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_010974638.1"
                     /translation="MARLVAERSDTLAPLAEVFREHGYEGASLALIGKATGLGKGSLY
                     HFFPNGKEEMVRAVLAEIEQWFEYSVYSPLRDGDDADAAIATMLDETAKYFRSGRRVC
                     LVGALAVANTRDLFAQAIRGYFVAWVDALQAALVRQGRDAEQARLLSEDAVLAIQGAI
                     VLSRALDDPAVFQRAIDQLHRRLILEGATVHDEGFSNGST"
     gene            complement(381308..381772)
                     /locus_tag="ATU_RS25735"
                     /old_locus_tag="AGR_pAT_559"
                     /old_locus_tag="Atu5387"
     CDS             complement(381308..381772)
                     /locus_tag="ATU_RS25735"
                     /old_locus_tag="AGR_pAT_559"
                     /old_locus_tag="Atu5387"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007598189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1348 family protein"
                     /protein_id="WP_010974639.1"
                     /translation="MSRPPVPPFTCKTAIEKVRLAEDGWNSRDAAKVALAYTVDTRWR
                     NRVEFATNREEAQAFLTRKWNREHEYRLIKELWAFTGNRIAVRYAYEYRDDNGQWFRA
                     YGNENWEFAEDGLMAHRHACINEMPIAESDRLYHWPLGRRPDDHPSLTDLGL"
     gene            complement(382263..383099)
                     /locus_tag="ATU_RS25740"
                     /old_locus_tag="AGR_pAT_561"
                     /old_locus_tag="Atu5389"
     CDS             complement(382263..383099)
                     /locus_tag="ATU_RS25740"
                     /old_locus_tag="AGR_pAT_561"
                     /old_locus_tag="Atu5389"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_010974641.1"
                     /translation="MGFVTTKDGTEIFYKDWGPKDAQPIVFHHGWPLSSDDWDAQMLF
                     FLSKGYRVVAHDRRGHGRSAQVADGHDMDHYAADAFAVVQALDLKNAVHIGHSTGGGE
                     VARYVAKHGQKAGRVAKAVLVSAVPPLMVKTTANPEGLPIEVFDGFRSALAANRAQFF
                     RDVPAGPFYGFNRDGAKVQEGVIQNWWRQGMMGGAKAHYDGIKAFSETDQTEDLTAIT
                     VPTLVLHGEDDQIVPIADAARKSIKLLKNGQIKTYPGFSHGMLTVNADVLNQDLLAFI
                     KG"
     gene            383329..384342
                     /locus_tag="ATU_RS25745"
                     /old_locus_tag="AGR_pAT_562"
                     /old_locus_tag="Atu5390"
     CDS             383329..384342
                     /locus_tag="ATU_RS25745"
                     /old_locus_tag="AGR_pAT_562"
                     /old_locus_tag="Atu5390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006700620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GlxA family transcriptional regulator"
                     /protein_id="WP_010974642.1"
                     /translation="MTLSEAKVAKRKEADFIEVGLLVYPNCQLAAVYGLTDLFRVASE
                     WSTDLQVPTSLRSIRVSYWKIENGDVSCSWDSHPGIPHSLSYVISPPSIIMPEKMQNM
                     SPASQWLASQHARGVTVCSICAGAFVLAETGLMDGRRATTHWAFAERLAEQFPSIDVL
                     PDNMIIDDGDVITAGGILAWADLGLLLVEKLLGQTVMLETARFLVVDPPRRSQSRYKA
                     FLPRFDHGDKEVLQVQHQFHATPEMQKSIGELAESVRLSERTLQRRFFRATRLKLTEY
                     LQNVRIMKARQLLETTNGSVESIAYAVGYIDPAAFRKIFGRLTGAKPNVYRGDTRLKS
                     STN"
     gene            complement(384757..385506)
                     /locus_tag="ATU_RS25750"
                     /old_locus_tag="AGR_pAT_564"
                     /old_locus_tag="Atu5391"
     CDS             complement(384757..385506)
                     /locus_tag="ATU_RS25750"
                     /old_locus_tag="AGR_pAT_564"
                     /old_locus_tag="Atu5391"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017966696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_010974643.1"
                     /translation="MDRLKSKRALITGGTSGIGLETARQFISEGARVAVTGTNPETLD
                     AARRELGPSALVIKADAADVDGQKVVAETIREAFGGLDVVFINAGVALLKPLEAWDEK
                     GFDRVFNINVKGPYFLLQALLPILANPASIVLNTSVNAHIGMPNSSVYAASKAALQSF
                     IRTLSGELIARGIRLNAVSPGPISTPLYGKLGFTETDLKNVAESIQNLVPAGRFGEPS
                     EIAKAVVFLASDEAAYTVGSEIMIDGGMGTL"
     gene            385617..386522
                     /locus_tag="ATU_RS25755"
                     /old_locus_tag="AGR_pAT_566"
                     /old_locus_tag="Atu5392"
     CDS             385617..386522
                     /locus_tag="ATU_RS25755"
                     /old_locus_tag="AGR_pAT_566"
                     /old_locus_tag="Atu5392"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974644.1"
                     /translation="MKLDGIASFVAVAEEGSISGAARTLRLSKSVVSERLAELERSLG
                     ATLLHRTTRRVSVTEDGVAFLERAKRILREVSEAAADLAERRGTLGGPIRIAAPVTFG
                     RMHLGPALYPFLTANPDIEMSLELDDRRVDIASDVYDGVVRHGAVDDSRLMVWRLAPS
                     RRVLVASEAYLAVNGTPATTTELAAHKGLFYTNRGVGDWRFLAPGGIEIVRARIGFRV
                     NNGDMLRDAAIAGLGIALLPLFIAGPDIRDGKLRIVDVGVRPDAEFVFLAHPEGRRPS
                     AKLRALAAHLKASFGDPPYWEDGVG"
     gene            complement(386787..387812)
                     /locus_tag="ATU_RS25760"
                     /old_locus_tag="AGR_pAT_567"
                     /old_locus_tag="Atu5393"
     CDS             complement(386787..387812)
                     /locus_tag="ATU_RS25760"
                     /old_locus_tag="AGR_pAT_567"
                     /old_locus_tag="Atu5393"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007761994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_010974645.1"
                     /translation="MESKDRLRQPRVTVHSVAAAAGVSKSTVSRILDERLPRSDSETA
                     QRVREIAAELGYVRDVSAANLRRGSTMTIGVIVPRLTDTVMAMLYEAIAKACTRSGRF
                     AIVATTEDKPQADRLAAESLLNRGVDGLILSTARGDDDFPDELRERGVPYVLALRTDG
                     HSLSAVGDDRLGGYLATRHLLDLGHERIGVIAGPDYASSATGRVDGYRHALEEASISV
                     DPQLIVPSTFGIQSGAEAIEKLMGLGCRPTAIFAVNDNTAIGALSALSKMGISVPDDV
                     SLVGYNDIPIVSHLPTPLTTLRVPFDQIAANAIDLLTHTTALRDNRILVSAPTLIPRK
                     STARLGS"
     gene            387975..388925
                     /locus_tag="ATU_RS25765"
                     /old_locus_tag="AGR_pAT_569"
                     /old_locus_tag="Atu5394"
     CDS             387975..388925
                     /locus_tag="ATU_RS25765"
                     /old_locus_tag="AGR_pAT_569"
                     /old_locus_tag="Atu5394"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019963483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase family protein"
                     /protein_id="WP_035258268.1"
                     /translation="MQPMDLRGLSPAPVTAFTRDGEVDYAANAKIARWLASMEGVKSL
                     VILGHAGEGTFLTEDERLELIRVYVDAVGGSLPIIAGITGEGTRVAAAEAKKCKAAGA
                     TGALVYPNHGWLRFGFQRGAPQDRYKAIWEESGLQEILFQYPDVTKASYDLDTQLAIA
                     TQPGVVATKNGVRNMKRWYVEIPELKNANPNLQVLSCHDEWLLPTMFDVDGLLVGYGN
                     IAPELLIDLIKAGKAQDYPQARKIFEQLLPVTRAVYHRGSHMEGTVALKLGLVHRGVL
                     DHATIREPLKNLGEKAEQEIFAAFDAAGIGRVEELLAAAE"
     gene            389105..390490
                     /locus_tag="ATU_RS25770"
                     /old_locus_tag="AGR_pAT_571"
                     /old_locus_tag="Atu5395"
     CDS             389105..390490
                     /locus_tag="ATU_RS25770"
                     /old_locus_tag="AGR_pAT_571"
                     /old_locus_tag="Atu5395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017989138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_010974647.1"
                     /translation="MNIMQPLRADATAVADPQADISARLERLPITREVFWARNIVGAA
                     TFFDGYTVIAIAYAMPVLVREWGLTPSQTGMILSMGYLGQLIGAILFGWLAERIGRLK
                     VLLFTILLFVSMDVACLFAAGAGMMMAFRFVQGIGTGGEVPVASAYINELIGSKGRGR
                     FFLLYEVMFLLGLVGAGLIGYFMVPLYGWKAMFIVGLVPAMLMIPLRWFLKESPRWLA
                     ATGRYDEANVIVKRMEESARAAGKALPEPRIIATPAKRVSDWRELFQGIYLKRTLSIW
                     AMWFCAYMVANGTITWLPTLYRQTFNLPLETSILYGFMTSAAGVVAAVICALLIDKVG
                     RKRWYAGALLLAPVPLAILAWLGATSPMQVLIFAGLAYAIVQTVTFSLYLYSAEIYPT
                     RMRAIGTGAGSAWLRLGSSAGPMLVGFVMSSMGIQYVFATFAFILIIGAVVTMLFAVE
                     TKGKVLEELSP"
     gene            complement(390744..390893)
                     /locus_tag="ATU_RS25775"
                     /old_locus_tag="AGR_pAT_573"
                     /old_locus_tag="Atu5396"
     CDS             complement(390744..390893)
                     /locus_tag="ATU_RS25775"
                     /old_locus_tag="AGR_pAT_573"
                     /old_locus_tag="Atu5396"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162520657.1"
                     /translation="MGFSTETTAEVLTGRREVHRHWLDEVKPRIVSDRLRLGVTVNEV
                     AERTV"
     gene            complement(391992..392921)
                     /locus_tag="ATU_RS25780"
                     /old_locus_tag="AGR_pAT_576"
                     /old_locus_tag="Atu5398"
     CDS             complement(391992..392921)
                     /locus_tag="ATU_RS25780"
                     /old_locus_tag="AGR_pAT_576"
                     /old_locus_tag="Atu5398"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014497146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase family protein"
                     /protein_id="WP_010974650.1"
                     /translation="MTKRIEGIIPVMITPFRDGKIDFEGVANLVEWYIANGSDALFAV
                     CQSSEMMFLTLEERVELAAFVKRAAAGRIPVIASGHISEALEDQQKELNAIARTGVDG
                     IVLVTNRMDARQEGGSKFLDDLGWLLDRLPPNLPLGLYECPAPYRRLMTDAEISFCAN
                     SGRFVILKDVSCDLETVKRRVALTANTPLAIVNANAAIAFDAMKAGSRGFTGVFTNFH
                     PDLYKWLLTEAGRKPELADELSVYLALAAMAEPMGYPKLAKLYHQRLGTINDIESRAV
                     TFDIQERFWAIEPLLDKIIQGTTDFRQRIMAAR"
     gene            complement(392984..393937)
                     /locus_tag="ATU_RS25785"
                     /old_locus_tag="AGR_pAT_578"
                     /old_locus_tag="Atu5399"
     CDS             complement(392984..393937)
                     /locus_tag="ATU_RS25785"
                     /old_locus_tag="AGR_pAT_578"
                     /old_locus_tag="Atu5399"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013253378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate dehydrogenase"
                     /protein_id="WP_010974651.1"
                     /translation="MSKTVLVTATNYSRYCADAKAMLAAEGIDVVENGFGRPMTFDEL
                     SARLGDVDAVIAGVDTWNERVFNLAPRLKAIARFGVGVDNIDIDAAHRHGIAVTNAPG
                     GNANAVAELTLGLILSAMRRIPYLHDALRGGAWDRFVGQELIGRRVGLLGFGNIARKI
                     ARKLCGFDVEVIAYDKFPDQVAATKLGVRMCEMDEVLSSSDILVMMMPSLPETRRLMD
                     AGRFARMKPGSIFINTARGALVDEKALYDALVSGHLQAAAIDVYETEPALPDNPLFTL
                     PQIVTTPHTAAETYETYTSIGRITAEAVIDVLANRQPRNQL"
     gene            complement(393963..395030)
                     /gene="ugpC"
                     /locus_tag="ATU_RS25790"
                     /old_locus_tag="AGR_pAT_580"
                     /old_locus_tag="Atu5400"
     CDS             complement(393963..395030)
                     /gene="ugpC"
                     /locus_tag="ATU_RS25790"
                     /old_locus_tag="AGR_pAT_580"
                     /old_locus_tag="Atu5400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020812373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate ABC transporter
                     ATP-binding protein UgpC"
                     /protein_id="WP_035258265.1"
                     /translation="MATLSIQNVVKAYGAHRVIHGLSFDIVDGEFIVFVGPSGCGKST
                     LLRMIAGLENFQEGSISIDGTVVNRLRPWERDVAMVFQEYALYPHMTVEKNIGFALRM
                     NGVPEAQVRQRVEEVSRTLQLTHLMKRRPRELSGGQRQRVAMGRAMVRGPKVFLFDEP
                     LSNLDAQLRVDLRAEIKQLHQRLGSTMIYVTHDQVEAMTMADRIVVLKDGHIQQIGAP
                     QELYRNPRTRFVAGFIGAPAMNFLPVQLSKGAATLPDGTRIAVPVERQDYEGAAELGV
                     RPEHLSLDVAHRASLSATISGSVQLIEPLGADTLALLDIAGNRLNCRLPGDMAPTPGE
                     ILTVSFDPGRCVLFDQAGARL"
     gene            complement(395035..395868)
                     /locus_tag="ATU_RS25795"
                     /old_locus_tag="AGR_pAT_582"
                     /old_locus_tag="Atu5401"
     CDS             complement(395035..395868)
                     /locus_tag="ATU_RS25795"
                     /old_locus_tag="AGR_pAT_582"
                     /old_locus_tag="Atu5401"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="WP_010974653.1"
                     /translation="MHEYEAYQPSLTERLRGGLSTVILVIAAITPILWMILSSFKDRY
                     EVTKLPPSLFFTPTLDNYRQLFERTEFLSNTLNSLIVSTGATLLGIMLAFPAAFAVSW
                     HRTTWPATLALFSRMAPGTLFLLPWFIIFSELGLVGSYTVLILTHAVIAMPVALWTML
                     PYFDAMPRELVEAAQMDGCRPLSVLWRIVLPVVMPGVVVSSILCFIFTWNYFLFALAL
                     SGFDTKTAIVASFNFIGEGVTNWGALMAAATMIALPPLILTLLVQRRLVAGLSAGAVK
                     G"
     gene            complement(395886..396767)
                     /locus_tag="ATU_RS25800"
                     /old_locus_tag="AGR_pAT_586"
                     /old_locus_tag="Atu5402"
     CDS             complement(395886..396767)
                     /locus_tag="ATU_RS25800"
                     /old_locus_tag="AGR_pAT_586"
                     /old_locus_tag="Atu5402"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002725002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_046033450.1"
                     /translation="MPSRISGPGQTVLSFRWMMAPAVAFVGLMIVFPILYAIWLSLRE
                     NSLGMDDRFVGLANYVELLSDGEFHNAFILTWVLYGLALAMQMVIGTWLGFTLNRVRS
                     ARNLVRTAAIMPFMMPPVVVGMMAIVILDPAVGVANWLLGQVGIGPSLWLADPKWVLL
                     TVAAVDTWQWSPLIGLLVLGGLQSLPTKVFEAAEIDGVIGWKRLVHITLPLLAPTLLS
                     AAILRSVDLLRFFDVIYITTRGGPGNASTTLNIYAYQQGFEFSRFGYASAGMITLAAV
                     VMVTVVAFSRLRQAVTW"
     gene            complement(396975..398297)
                     /locus_tag="ATU_RS25805"
                     /old_locus_tag="AGR_pAT_587"
                     /old_locus_tag="Atu5403"
     CDS             complement(396975..398297)
                     /locus_tag="ATU_RS25805"
                     /old_locus_tag="AGR_pAT_587"
                     /old_locus_tag="Atu5403"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020812376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_035258299.1"
                     /translation="MNFFRNSLAAASKMVALASCVVFTGSTAGAVDFNWRSQEGQTIN
                     VLFTNHPWPNAIKDMTSEFTKKTGIKVRVEILNEDPIRARLSTLMQARSSDVDAFISL
                     KIREGAVYNKAGWYADLNPLLKDASLTSPDFNFEDFGEGLRKNEIFDGKLTGVPINVE
                     GPLFYWRKDIFAKCNVPEPQYLEDIPAAAKTISECDKSVNAWTARGVRNAIPYPMASF
                     VFNLGGDFKSADKTKPGLCQDKTIAGLQMYGDLLKTYGAVGASNHSFPQVVELLGQGK
                     VAMTHESSNEFSNIVKFPGRAEDLAIKVLPPGKESGISKPVAFGWGLSMSNFSKRKEA
                     TWLFMQWATSPEIEARLIQAGVAPPRSSVFDGADMKKFTDELPIRKSWADAIRQISKT
                     GTGDYASPTDKVPQTREIIGKVVQDYLLGANTIKEGACEADKALLALQ"
     gene            complement(398609..399283)
                     /locus_tag="ATU_RS25810"
                     /old_locus_tag="AGR_pAT_588"
                     /old_locus_tag="Atu5404"
     CDS             complement(398609..399283)
                     /locus_tag="ATU_RS25810"
                     /old_locus_tag="AGR_pAT_588"
                     /old_locus_tag="Atu5404"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003492081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_035258296.1"
                     /translation="MRNAEGHVNQRDRAYSSFTEHLLSRQLRPGQFVSQRQLVELTQL
                     PLAAIRELIPRLEAEGLLVTVPQRGMQIAQVDLNLVQDAFQVRLFLEKEAVQIFARLV
                     SDEKLEAIRQEHLDVIDACNAEPDANHVSKALVDRAQELDSRFHHGMIDSLQNSILTN
                     IYRVNAIKIRLIRQAHTQLNPPLVLPTMYDHLSLIDAIASRDPPAAAAAMEQHIHNAK
                     NRALAR"
     gene            399515..400022
                     /locus_tag="ATU_RS25815"
                     /old_locus_tag="Atu5405"
                     /pseudo
     CDS             399515..400022
                     /locus_tag="ATU_RS25815"
                     /old_locus_tag="Atu5405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003182069.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione transferase GstA"
     gene            complement(400747..401496)
                     /locus_tag="ATU_RS25820"
                     /old_locus_tag="AGR_pAT_592"
                     /old_locus_tag="Atu5406"
     CDS             complement(400747..401496)
                     /locus_tag="ATU_RS25820"
                     /old_locus_tag="AGR_pAT_592"
                     /old_locus_tag="Atu5406"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007633121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_010974657.1"
                     /translation="MKKTRRQNPKAAPKAPIAAESAENANDDVSERIRTTLANAIGEG
                     ALKPGTKILEDAIADHFGVSRTVVRGALGVLESDHLLERKRNRGTFVAEPGIEEARAL
                     FEARRKIEHAILDLVMARATTEQLDALEKLTDEEEHIHHHGDEKSKTVLSGKFHIVLA
                     ELGVNVVMTETLSKIVARLSLVMALYGEDKKDDCGADHHRMIVAALKAKDLAKAQQLM
                     DHHLADIEGRVRLTAGQGDRHTFMAVLENFS"
     gene            complement(401642..402772)
                     /locus_tag="ATU_RS25825"
                     /old_locus_tag="AGR_pAT_594"
                     /old_locus_tag="Atu5407"
     CDS             complement(401642..402772)
                     /locus_tag="ATU_RS25825"
                     /old_locus_tag="AGR_pAT_594"
                     /old_locus_tag="Atu5407"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007815777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate isomerase/epimerase"
                     /protein_id="WP_010974658.1"
                     /translation="MKLGIDSQKLPEFVKRGPLASLDLVKELGLGGLFFPTVLDMSPT
                     LDKAALRDIREKADELGLYLESGVGKINPYCSAEAPEFRAIGEGDVILGFTRMIEASA
                     SIGCHELWISPGNFKSEYRGRLANDRFRTDVTWDEQLQAIEKVLLKLAPVARATGVHL
                     NMETHDEITSFEIMRLIEKIGEDCMGVVFDTANGLQRGEHPVYAAKRVAPYIRQTHVK
                     DAYVGRAPGGLDFQTRPVGRGIVDFAAIIPILAAANPDLNLSLEVAASVEDKPRKANP
                     RQCIEIEDPSWRAAHPDLNAEELEAYLSMIGAFEKRVASGEIPDWEAYEASNYGYPTY
                     ERQAYSFDAAITFIRNSAQHIEEICADNGIDLSASVAKRQAA"
     gene            complement(402876..403730)
                     /locus_tag="ATU_RS25830"
                     /old_locus_tag="AGR_pAT_595"
                     /old_locus_tag="Atu5408"
     CDS             complement(402876..403730)
                     /locus_tag="ATU_RS25830"
                     /old_locus_tag="AGR_pAT_595"
                     /old_locus_tag="Atu5408"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012651329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_010974659.1"
                     /translation="MALFAQPISMTVAPPNGKPVRWGQLATGSIAILMLALMTLAIGR
                     NQSVQWSEIPRYMIDPVILGGVILTLELTAGAMVAGIIIGCLVAVMATSQNIVLKAIA
                     VAFVWWFRGVPLIVQIFFWFNIALFVPEIGFGSWSVSVNDIVTPAFAGFLALGLHEAA
                     NMSEIIRSGLTAVDRGQREAASSLGLRPLQTLRTVVLPQAIRLIVPPTGNQAIGMLKA
                     SAIVSVIGMQDLLTQAQAIYARNFLVIELLCVASLWYLGITTIASIGQHYLERKLAPK
                     GRSNSDKI"
     gene            complement(403734..404669)
                     /locus_tag="ATU_RS25835"
                     /old_locus_tag="AGR_pAT_596"
                     /old_locus_tag="Atu5409"
     CDS             complement(403734..404669)
                     /locus_tag="ATU_RS25835"
                     /old_locus_tag="AGR_pAT_596"
                     /old_locus_tag="Atu5409"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007766037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_010974660.1"
                     /translation="MHSFKQTLTATLAGAAFALLASTTQAAEGKPVTIAPEADIAKLP
                     GVAFNQDLADRLPSAIKDKKVVKVATDLTPPISFQDEAGKLIGIDADLAAALGVILGV
                     DVQMTNVGAGAAIVPAVLSKRFDMTLSGINDDVELEKQVDVIDYMYDATTIMTIKGNP
                     LSIKSMEDLCGKKVAVPVGTFQNRLVVAASAKCKTTPIEIISIPKMPDVLQAVRTGRA
                     DATVNGYATSVYTTEKQTGKGVGLQALPDVRLTVGYLGMLVSKDNPELRDAVIASLQH
                     MVDSGAYQTIMEKWSLGPLAVKTVKFNDAASMPVD"
     gene            405195..406412
                     /locus_tag="ATU_RS25840"
                     /old_locus_tag="AGR_pAT_598"
                     /old_locus_tag="Atu5410"
     CDS             405195..406412
                     /locus_tag="ATU_RS25840"
                     /old_locus_tag="AGR_pAT_598"
                     /old_locus_tag="Atu5410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007766035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_035258293.1"
                     /translation="MTQSEPKIVDRKHFPLIPTSTVPSAVQAQPKGTFMSQTSNAAEG
                     KQLSVRGLTHSYGGLNAISDISFEIAAGEIVALLGPSGCGKSTVLRAIAGLIQPKSGV
                     IQLGGEDIANVSARARGIGMVFQNYALFPHLTVAENIAYPLACQKVGRTERRERIEEM
                     LSLVQLKGFGHRLPRELSGGQQQRVAVARAIAGRPSLLLLDEPFGALDRALRFDLQVE
                     LLHLQKTLGITTLIVTHDQEEAQSLAGRLVLMNKGNVEQIDTPMAVYDRPRSLFVNTF
                     IGQANVLHGTVDRVEAEATTISLANGRVLVLPRRLNFTTGSKITITCRPEDVRLSAAP
                     GAPALPARLTVSVPLGPTLVHDLLLEDGTNLRSSEVRGPSTFIPEPGAELFAEIDTIR
                     CHAFPSEPEASRE"
     gene            406432..407472
                     /locus_tag="ATU_RS25845"
                     /old_locus_tag="AGR_pAT_599"
                     /old_locus_tag="Atu5411"
     CDS             406432..407472
                     /locus_tag="ATU_RS25845"
                     /old_locus_tag="AGR_pAT_599"
                     /old_locus_tag="Atu5411"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007633116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="WP_010974662.1"
                     /translation="MQDFNITRRRFGLLAAGAAVAAAVPFAARAAGSTAVAATFPGNW
                     EDGYRTVLTPLVKEAGFDLTVAPAMAQDQLAKVMASPGNPPYDTLLMSPGQMAIAVEN
                     DLINKIDPSKLKNWGMLDPAFQGEYGPTVTIEVNGIAYNPDLVPAPKGYRDLFENPAY
                     KGLVSWTGFASNTGVMAYTEIAKIYGSGPIDMDAVFKLFKEHPEHIKGVVASTNHQMT
                     LFQQGEIAVFMCSTGNVAKLKAMGLKAEFVQPETGSPAAPVNIHLTKGAKNVDAAYAY
                     MDAAISKAAQDKLKMPPQEMFPTNKEVELTPGIEAYVKREQLASLVYPDWAAINKNRP
                     EWIRQFDALVAG"
     gene            407482..408309
                     /locus_tag="ATU_RS25850"
                     /old_locus_tag="AGR_pAT_600"
                     /old_locus_tag="Atu5412"
     CDS             407482..408309
                     /locus_tag="ATU_RS25850"
                     /old_locus_tag="AGR_pAT_600"
                     /old_locus_tag="Atu5412"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015918643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974663.1"
                     /translation="MKASGFPYVIPMLLLSVAFFATPLAVLVGFSFIGPDGLSLHNYA
                     RFLGDAFNYRVLINTAKLGAQTIVTTTLLGVPIALLYWHSGKTARQIIIFLTLIPMLT
                     SNVVRTFAWIVILGRQGPISETFVALGLAERPFTLMSTELGLVMAMCQIDLPLIILPL
                     VAILSRIPVTYTEAAQVSGAGPWRILVTVLLPMMLPGLLAGWILVFASTSASFVTQAV
                     IGGARNVYVPQLIYREVGTLFDWPMASAIAVVLLMSTGMLLVAMTMISRHRRLVGHA"
     gene            408302..409123
                     /locus_tag="ATU_RS25855"
                     /old_locus_tag="AGR_pAT_602"
                     /old_locus_tag="Atu5413"
     CDS             408302..409123
                     /locus_tag="ATU_RS25855"
                     /old_locus_tag="AGR_pAT_602"
                     /old_locus_tag="Atu5413"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020048729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974664.1"
                     /translation="MRRKSENPVPAILYKAFVFGFGGVSLIYLVAPIVIAITMSFTSG
                     QTLKYPPEGFSLRWYEALLDPIRSGTEHIAAGNSLKIAGLAVLGSLLFAVPATIGMAR
                     MQRRSVNTIEPLLLAPLVLPSLVYGLAALIVANFVGLQPSLWLTVIGHVVVFGPLMYR
                     AASVVAQGINPSLAEASTVMGATWFTTLRRVSLPLLTPGILAGAFLVFIQSLDNVSVS
                     LFLADAQTTVLPLRMFALIEESLDVRVAAMSGLLIGLTLVVMLVARRVLAPTRQA"
     gene            409155..410579
                     /locus_tag="ATU_RS25860"
                     /old_locus_tag="AGR_pAT_604"
                     /old_locus_tag="Atu5414"
     CDS             409155..410579
                     /locus_tag="ATU_RS25860"
                     /old_locus_tag="AGR_pAT_604"
                     /old_locus_tag="Atu5414"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020048728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase P family protein"
                     /protein_id="WP_010974665.1"
                     /translation="MNITATRAGAYRIGSLLADFQPDFDFAAPLPLPVAEFEDRLSRI
                     RRQAVEAGHDALIVHTGGVGWFHTSNHYLRYICDWMREGVLIIPTDVDKPMVLLSFFT
                     QSVLLPPGGEPVLLEDIWQIGPIGREYADRPGDSVIKTAEKCAELLGNMGLSKAQIGR
                     IGDRTSLTFWAGLDELMPRVKFVADNAILDRMQKVRSPREIEMFRAAAQLVSIATQAA
                     YHVAKPGVTDHEIYAAFTQAQLSFGGETGDGYQIGINEFGTHCGKPYGHVVRPGDLIN
                     LYVSNVTYRGYTAQTARMIAIGEITKRQEEVLAACTEGVKRAEKLIRPGALMRDINNA
                     AFEPMIEHGMLASPEARTMPYNWAPMDDGSARLIPRQYVKNIDWEAQGRTLMHVYPAT
                     HGPHNPNLGHSVGMAGGQNSFNISSHNYDRMEEGMVFVLHTQWLEPLSAGCNVGDMYV
                     VTKGGFENLSRHTPLETHRIAAEI"
     gene            410593..411255
                     /locus_tag="ATU_RS25865"
                     /old_locus_tag="AGR_pAT_605"
                     /old_locus_tag="Atu5415"
     CDS             410593..411255
                     /locus_tag="ATU_RS25865"
                     /old_locus_tag="AGR_pAT_605"
                     /old_locus_tag="Atu5415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015918640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavin reductase"
                     /protein_id="WP_162180354.1"
                     /translation="MLSHTHFDFAKLTERERYKILIGTVIPRPIALVTTVDRDGRPNA
                     GPFSFFNVLTHDPAIVAIGVENYADMRFKDTARNIRETGEFTVHICDNALVDQMEICA
                     IKFGPGINEMEEAGLETVKGEMVCSPRVLAAPAALECRRHTTLQVGPAREIILGEVVG
                     VFIRSDAVSASNLHIDQQMMDAVGRMGGHTYARTRDQFDIKTLTPQEWESRKLFGTDA
                     AE"
     gene            complement(411387..411866)
                     /locus_tag="ATU_RS25870"
                     /old_locus_tag="Atu5416"
                     /pseudo
     CDS             complement(411387..411866)
                     /locus_tag="ATU_RS25870"
                     /old_locus_tag="Atu5416"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012557599.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
     gene            411906..412184
                     /locus_tag="ATU_RS25875"
                     /old_locus_tag="AGR_pAT_bx246"
                     /old_locus_tag="Atu5417"
     CDS             411906..412184
                     /locus_tag="ATU_RS25875"
                     /old_locus_tag="AGR_pAT_bx246"
                     /old_locus_tag="Atu5417"
                     /inference="COORDINATES: protein motif:HMM:NF013677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080728820.1"
                     /translation="MQFVAACLEPGAIISEVARDAGVHVSQLFVGAKSSAGSRSRTSR
                     RQHLGAGDRCRNRAGRPCCTTGTAPTSPFSSEAKRCNDRTWTWPQYPR"
     gene            complement(412276..413358)
                     /locus_tag="ATU_RS25880"
                     /old_locus_tag="AGR_pAT_610"
                     /old_locus_tag="Atu5418"
     CDS             complement(412276..413358)
                     /locus_tag="ATU_RS25880"
                     /old_locus_tag="AGR_pAT_610"
                     /old_locus_tag="Atu5418"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD/NADP octopine/nopaline dehydrogenase family
                     protein"
                     /protein_id="WP_010974667.1"
                     /translation="MRIAILGAGSIAYGVAAFLAEAGHSPSLWSPSGRSGKPLSQGEP
                     LTATGALDFVGPVEVAASCEAAISDADAVIIAMPANGHRAAIDAALPHLRSGLPVIIS
                     SHSSFGALYLSKRLAERQLDLPIIAWGTTLLTARRQPDGHSVVVNTIRQKVDFATLPK
                     SAAQEGHSLCTELFGDRFVERDGLLAIALSNLNPQNHLGIALLNLTRMEKAESWGQGE
                     HVTPAVGQLIEALDAERLSIAESFGLGVKTVREHFSLSFHVPLASVSEMNQQMHREGR
                     GGMGPSSIDSRYIFEDVPFGLLPTVLLGRIVNRPAILHEAGIRIFTASVARNLEADND
                     LLPELSLDHLAPGELRDLCENGFSPA"
     gene            413745..414725
                     /locus_tag="ATU_RS25885"
                     /old_locus_tag="AGR_pAT_611"
                     /old_locus_tag="Atu5419"
     CDS             413745..414725
                     /locus_tag="ATU_RS25885"
                     /old_locus_tag="AGR_pAT_611"
                     /old_locus_tag="Atu5419"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974668.1"
                     /translation="MIAMEIRELEAFLAVMSAGSITGAARLLDRSQSQVTRLIQDLET
                     SLGFPLFDRNGPRITPSDKGVAFHAEAERFISGIEHLRNRAQRISLKEPEPVEIAATP
                     AFATGMVPLALAELPEALLPHTVFLRSMPAEAAVQAVLGRTADFCVTSLPAEQPGLEA
                     HGYFQGRCAAVLSVNDPLAAKDVVSISDLADQTIITLANPFRLRRRVDKALQEANVRA
                     RRIIATSAAMSAVQVASTGMGIAIVEPATAYGPLTAGVTVRPLDVDIPFLWGIFSATA
                     RPLSATAQELIQLIIRVASARMPDFTAHDPRTSGRLADVTYGGTVEGDVP"
     gene            414780..415880
                     /locus_tag="ATU_RS25890"
                     /old_locus_tag="AGR_pAT_613"
                     /old_locus_tag="Atu5420"
     CDS             414780..415880
                     /locus_tag="ATU_RS25890"
                     /old_locus_tag="AGR_pAT_613"
                     /old_locus_tag="Atu5420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="WP_010974669.1"
                     /translation="MKEFNATRRSTLKLLAAGSGILAAPSLMRSAHAQGKVVNITTYD
                     KFVPQSFIDQFQKDTGIEIRIRLTDDQGKQYNILTAEGATPSTDIVTVTGHRLSQFIG
                     SNLLTPLDTGRLKNWDKLAAAYKGAPQLTINGSTYGVPLLAGFEGLARNTEYTKPSDS
                     WGTMFDDEYKGLTSYIISDFLSLTMLYQGNDGDYVTYEGKEAVAQDATNKARDFLIRQ
                     KDKVRKYYDAGSEVQQMFLNEDIYVAQAWSGPTAKLIMDGHPIELSVPKEGTYGFLYS
                     FNVVKNGPNADAAYAFLDAILASPEIGAAMVRQSGFASAFDGVEKLLNDRERAAMALP
                     QDQMERIKFFSSVNRAMKNAMIDKAAAEIKAA"
     gene            415965..416948
                     /locus_tag="ATU_RS25895"
                     /old_locus_tag="AGR_pAT_616"
                     /old_locus_tag="Atu5421"
     CDS             415965..416948
                     /locus_tag="ATU_RS25895"
                     /old_locus_tag="AGR_pAT_616"
                     /old_locus_tag="Atu5421"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_006315839.1"
                     /translation="MVNTTMTELREESAPAPAHYSGWIGKVTGSTLYRTTIGRLADSR
                     HARLALLAGIPVIWLFVLHVGPILQMANISFTDNYPPQPNEATRYTLANYALFFSDSI
                     YVLPFIRSLVFAAVVTVSTLVIVYPVAYYVAKVLQPKQRMRALLLLLIPFWAGELIRT
                     FSVIMLLANRGAVNVLLREIGVIDRPIPMLYTSFSLSFGVIYLLALYMLLPLYSAIEK
                     IPVQLVHAAADLGASPFQRFRRVILPLSKDGIVSGCSLVYLTAVGVFAAPLLLGGPNA
                     VIFPEVIATLFHSSNDKWPEGAAFAMLMLAVSLTTVGLFMRVVGGRSVRLM"
     gene            416958..417749
                     /locus_tag="ATU_RS25900"
                     /old_locus_tag="AGR_pAT_618"
                     /old_locus_tag="Atu5422"
     CDS             416958..417749
                     /locus_tag="ATU_RS25900"
                     /old_locus_tag="AGR_pAT_618"
                     /old_locus_tag="Atu5422"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004446006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_006315838.1"
                     /translation="MRSPLNDLPKTALGACYAIFVIYLLLPLALMMAMSFKDANFIAF
                     PISNWTLDWYGKVLQDKQFIEASVYSAGIALATTIGATVIGVWIALLISTEGIRGKAI
                     LFALACLPAVVPGLINAISMRIFIRMVDIPTGTFAIILSHTVHAVPFVVIMVLTRLRS
                     MPANLVDAARDLGADAFVAFMRVTVPYILPALIGGMIFCVLTSIDDFVRTFFLGGYKP
                     TLPMLIFAKVQGGMSPEINAMATIVLIVTAAIGLYAEHFTRRSRS"
     gene            417753..418823
                     /locus_tag="ATU_RS25905"
                     /old_locus_tag="AGR_pAT_620"
                     /old_locus_tag="Atu5423"
     CDS             417753..418823
                     /locus_tag="ATU_RS25905"
                     /old_locus_tag="AGR_pAT_620"
                     /old_locus_tag="Atu5423"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010974670.1"
                     /translation="MQPVVHFKNVNKSYGASLAVDDLDLEVAPGQFVTLLGPSGCGKS
                     TTLRMLGGFETPSSGEIYLDGQPISHLPPNRRNVNIVFQDYALFPHLSVQRNIAFGLE
                     LKGLDSASIHRRVMELLGLVKLQDFAGRMPEQLSGGQRQRVALMRALAPDPNVLLLDE
                     PLSALDAKLRHEMQIELKSIQQTTGKTFIFVTHDQEEALTMSDVVVVMNKGRIEQMGA
                     PDDLYARPRSRFVADFIGQSNFLDGRLVSAESGVATVDWQGSLIRADLNGHHHAIGSH
                     VTIALRPEALFCLPEQPSDRFALKGQIERRVFKGAHTTLTIRLDNGALLSAQLDPVAL
                     SHLDGETVWMGWRDRDAVVLAD"
     gene            418884..420362
                     /locus_tag="ATU_RS25910"
                     /old_locus_tag="AGR_pAT_621"
                     /old_locus_tag="Atu5424"
     CDS             418884..420362
                     /locus_tag="ATU_RS25910"
                     /old_locus_tag="AGR_pAT_621"
                     /old_locus_tag="Atu5424"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="WP_010974671.1"
                     /translation="MTLEQQDRTEQQLAALNAQVRQDLCYLNYPAANWSKPVSTSDGQ
                     LVSDVVIIGGGMCGLVAWHALTRAGIANIRIVDRAAKGEEGPWVTYARMETLRSPKNL
                     LGPALGMASLTFRAWYTARFGKEAWEELFRIPRPMWMEYLSWYRQVMEIPVENNIHVT
                     RVIPRLDGLLELEIEGGKADPIITRKLVMATGRDGLGEPTIPDFVKGMPRHVSWAHSA
                     DMIDFQRLKGKRVVVIGVGASAVDNAAEALEQGAGEVRLLARRKTMPTINKLMGIGSY
                     GVTAGFAKIDPEWRWRLMDYSVKQQTPAPHNSTLRVSRHSNAYFHFDCGIQSMKEEGG
                     EVVITTINGRVFRTDFVILGTGFSIDPVSRPELEMFNGQIACWEDRYTPPAGEENPGL
                     GRFPWLQDDFSFTEKEPGAAPWLQHIHCFNYGSSVSLGKVSGDIPAISEGALWLARGI
                     AASLFIADIDHHWEALKAYEKPELDGSEWTDADADPSMQKTA"
     gene            420373..420966
                     /locus_tag="ATU_RS25915"
                     /old_locus_tag="AGR_pAT_622"
                     /old_locus_tag="Atu5425"
     CDS             420373..420966
                     /locus_tag="ATU_RS25915"
                     /old_locus_tag="AGR_pAT_622"
                     /old_locus_tag="Atu5425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxychromene-2-carboxylate isomerase"
                     /protein_id="WP_010974672.1"
                     /translation="MSRKTVYYYHALSSPWAYLGGPQFKALVEKHDLDVVVRPTRIVT
                     ENGGVPLRSRPQPRQDYHAVELDRWRKRLGMPLVLKPRYYPTNNEFSARMVIAADRQG
                     LPALELSHALLRALWAEEQDVTDPDVRIAVANSLGLDGRALRALEDTPEIMAAWHDSH
                     AEAQSRGVFGTPTWVYRDTLYWGQDRLTFLDDALSED"
     gene            420974..421480
                     /locus_tag="ATU_RS25920"
                     /old_locus_tag="AGR_pAT_623"
                     /old_locus_tag="Atu5426"
     CDS             420974..421480
                     /locus_tag="ATU_RS25920"
                     /old_locus_tag="AGR_pAT_623"
                     /old_locus_tag="Atu5426"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018010248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CMD domain-containing protein"
                     /protein_id="WP_010974673.1"
                     /translation="MTATPPEDVIDRVLGLDANSDLLKLRERRSKLKHLTQTSYLAAL
                     RPAEPRNFSYALRAALAARMSALWKAKELHAHYIERLAEEEGGSDQASVADPSSVLQH
                     TDSRLQAILNHVDLVTLTPKNATRENIEKLYAVGLDDRDIVTLAGLIAYVNYQVLVVA
                     GLKMMRDN"
     gene            421482..422060
                     /locus_tag="ATU_RS25925"
                     /old_locus_tag="AGR_pAT_625"
                     /old_locus_tag="Atu5427"
     CDS             421482..422060
                     /locus_tag="ATU_RS25925"
                     /old_locus_tag="AGR_pAT_625"
                     /old_locus_tag="Atu5427"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315833.1"
                     /note="This protein belongs to a clade of uncharacterized
                     proteins related to peroxidases such as the
                     alkylhydroperoxidase AhpD; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxidase-related enzyme"
                     /protein_id="WP_010974674.1"
                     /translation="MSQPVHEFTLDALEWHPYVKPVDLATATPEQLSALKVTPSNTKV
                     SAYVLVLANEAEALNERTPLFNDIMYSDGGLSRGGREIGALAASFVNHCIYCAAVHAN
                     RYIQLEKRPEVVDAIYKNGLDADLPDFEQALFNFGVDLTAHPDNVGVYQFYHLREIGL
                     DDLEILDLIHSIAIFGWANRLMHTLGEPHRKE"
     gene            422061..423398
                     /locus_tag="ATU_RS25930"
                     /old_locus_tag="AGR_pAT_627"
                     /old_locus_tag="Atu5428"
     CDS             422061..423398
                     /locus_tag="ATU_RS25930"
                     /old_locus_tag="AGR_pAT_627"
                     /old_locus_tag="Atu5428"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family efflux transporter"
                     /protein_id="WP_010974675.1"
                     /translation="MKATAITGTEAAVRPFDVAHRDVLKIAIPMMIAYLSTPLVGLVA
                     TGVIAHMRNEALVGGVALASVIFDVIFVTFNFLRGATTGFTAQAMGAGDRVGEQRMLL
                     SGLIIALVAGLLLLLLKGPIGALGMSVMGADGIVAEVASTYFHWRIWSAPFVLFNFVA
                     FGWLIGRGEAMWSMILQTLLNGLNAALSVHWVIGLGWGVEGVAIATLVAEAVTAVAGA
                     ALILGKTDRSAWRLPDIPAIRRSFEVNGDMMIRSFALLIGLSFFTRQSGFLGIEVLAA
                     NTILLRFYFFGVAFLDGVATAAEQLAGRAVGAHYRPAFDRTIKLTTLWGGIFAALVSL
                     AFLAGGDWVIALTAPTDIVARLADSYLIYVVVLPVIGIIAFQMDGVYIGSTWSRQMRN
                     LMVVSLIIYFAAWAVLQPLYGNDGLWISLLLFQGARSIAFRLMLPRLAAATFR"
     gene            complement(423428..423679)
                     /locus_tag="ATU_RS25935"
                     /old_locus_tag="AGR_pAT_629"
                     /old_locus_tag="Atu5429"
     CDS             complement(423428..423679)
                     /locus_tag="ATU_RS25935"
                     /old_locus_tag="AGR_pAT_629"
                     /old_locus_tag="Atu5429"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080728819.1"
                     /translation="MDVKGSITLDEPSLVRIATQKGIGLGYVMEPDVRDDIAAGRLVR
                     VLEDWTPSLIRLALYYPGRQNPPAAVSAFIKAARHFSNG"
     gene            complement(424011..424409)
                     /locus_tag="ATU_RS25940"
                     /old_locus_tag="AGR_pAT_630"
                     /old_locus_tag="Atu5430"
     CDS             complement(424011..424409)
                     /locus_tag="ATU_RS25940"
                     /old_locus_tag="AGR_pAT_630"
                     /old_locus_tag="Atu5430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013761471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006315830.1"
                     /translation="MSINVQRTIPAARMRQFHQMVDRWLEEGPIKLATNATITAMDNA
                     GIPKAEQAAIIEDRDIIMKYNMRLGVISEIFGPAIDNAVGSYRSGSEAKDEIARLIVT
                     AIGIRQNDDSELITFTFTTQNEADAFAEST"
     gene            complement(424764..425153)
                     /locus_tag="ATU_RS25945"
                     /old_locus_tag="AGR_pAT_632"
                     /old_locus_tag="Atu5431"
     CDS             complement(424764..425153)
                     /locus_tag="ATU_RS25945"
                     /old_locus_tag="AGR_pAT_632"
                     /old_locus_tag="Atu5431"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006315829.1"
                     /translation="MIYILFALCALVTTFFACRYYAARTLLAEHDIDKAIARRFASSG
                     KAIELAKLREENAVIRNLLLDLLENEAAFPVQQANFSKDDLSRMKAAKIQRYREILAE
                     SRHVLQQREAMTVFEHSSSLKGGERRM"
     gene            complement(426065..427075)
                     /locus_tag="ATU_RS25950"
                     /old_locus_tag="AGR_pAT_634"
                     /old_locus_tag="Atu5433"
     CDS             complement(426065..427075)
                     /locus_tag="ATU_RS25950"
                     /old_locus_tag="AGR_pAT_634"
                     /old_locus_tag="Atu5433"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019565831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_010974677.1"
                     /translation="MVARKVSITDVAKAAGVSTATVDRVLNNRGGVRADKEDLVLATA
                     RALGIDRALDRTPSRALRVAVLMQPPVNPFHAALREGIDLAGRMYTALNVQFFVHHID
                     PRKPAAIAAAVRDCRSYDGLVITSPDDIRIREAVAVLSRKMPVVTLATDLTDCGRAAY
                     VGPDDRQAGRVAGDLMGLFLREGGRVIVIAGSRDITGHREREEGFRAVLTERYPECSL
                     AAVLETGENQEEAGRVVEIAFHDDPALRGIYHLSAGAVPIVSTLQRLGRIDDTVVITH
                     ELTPDRRMLLKSRKINAVIDQKPLLEARLAVETISKLLGRLPGDGLSIATDIQIFLSE
                     NA"
     gene            427209..428132
                     /locus_tag="ATU_RS25955"
                     /old_locus_tag="AGR_pAT_635"
                     /old_locus_tag="Atu5434"
     CDS             427209..428132
                     /locus_tag="ATU_RS25955"
                     /old_locus_tag="AGR_pAT_635"
                     /old_locus_tag="Atu5434"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017963572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIM barrel protein"
                     /protein_id="WP_006315826.1"
                     /translation="MNITVTTAPCCWGVDDVRNPNLPPWELVFDEVKAAGYGGMELGP
                     YGYVPLDTDLVSSALTSRGLYIVAGTIFNDLVASENRDSLLRQTDEICSLITRLPRPP
                     KSAGQRFSAPYLTVMDWGHDERDYAAGHSDRAPRLDDAAWAGMMNNIRAISELARDKY
                     GVRATIHPHAGGYIEFEDEIARLAADIPQEVAGFCLDTGHTWYAGMDPVETLRKYADR
                     LDYIHFKDIDKAVFDRIMGEHIRFFEACGQGVMCPIGNGCIDYPAIRALLDELGYEGF
                     ITVEQERDPRNAGGSLADVKLSRDYLKSAGF"
     gene            428152..429324
                     /locus_tag="ATU_RS25960"
                     /old_locus_tag="AGR_pAT_638"
                     /old_locus_tag="Atu5435"
     CDS             428152..429324
                     /locus_tag="ATU_RS25960"
                     /old_locus_tag="AGR_pAT_638"
                     /old_locus_tag="Atu5435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="WP_010974678.1"
                     /translation="MIYGTRQTKRPLRWAMVGGGRGSQIGYIHRSAALRDRYFDLVAG
                     AFDIDAERGRAFGVELGLDEARCYADWRTLFAEEAKRPDGIEAVSIATPNNTHYEITK
                     AALESGLHVVCEKPLCFTVAEAEDLKRIAEERGRIVGVTYGYSGHQVIEHARELVAAG
                     ELGEIRLVNLQFAHGFHNEAVELQNPATRWRVDPRFAGPSYVLGDIGTHPLYISEVIL
                     PDLHIKRLLCARQSFIKTRAPLEDNAMTLMEYDNGAFGTVWSSAINAGSMHGQKVRIV
                     GSKASIEWWDEQPNQLRFEIQGEPVRILERGMGYLHAKALADDRIGAGHPEGLFEAWA
                     NLYDRFAIAMEARNENDGERLANLRYPGVEAGVEGVRWVENCVRSADLGGVWVDYQ"
     gene            429568..430470
                     /locus_tag="ATU_RS25965"
                     /old_locus_tag="AGR_pAT_639"
                     /old_locus_tag="Atu5436"
     CDS             429568..430470
                     /locus_tag="ATU_RS25965"
                     /old_locus_tag="AGR_pAT_639"
                     /old_locus_tag="Atu5436"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010395421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate isomerase/epimerase"
                     /protein_id="WP_006315824.1"
                     /translation="MRIAIDPFMHRHLSLEELPRKVRELGYDWIEMSPRADFLEWFKA
                     PRVFPQRMKEFKKALAAENVKIASLLPMYRWASNDETERKAAVKHWKRAIEIAVEMEI
                     DTMNSEFGRGPHPDKGSCYCCHTGSMIEACEDAWWRSMEELVPVFERENIQLNIEPHP
                     EDWCETLQPALDIIRTVNSKNVKFLYCAPHTFYFGDDTKAMLREAKDVLAHVHVGDTF
                     NHKASSGLRYILNPPGTQARVHQHLNIGQGEVPWDDFFGTLAEIGFDGTMTACVFAWE
                     DRADHSGKFMLSEMNRYIEKYWPK"
     gene            complement(430782..431174)
                     /locus_tag="ATU_RS25970"
                     /old_locus_tag="AGR_pAT_641"
                     /old_locus_tag="Atu5437"
     CDS             complement(430782..431174)
                     /locus_tag="ATU_RS25970"
                     /old_locus_tag="AGR_pAT_641"
                     /old_locus_tag="Atu5437"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_006315823.1"
                     /translation="MDEYTDLEALSQCALNDMARVRPVLDKIADKWTILILTVICPRP
                     SRFNEIKRRLDGITHKALADALKRLERNGLVTRTVLPTQPVGVEYAITPLGHSLREPF
                     EALCSWAAANGSKIEAATLRYDDGGNRR"
     gene            431256..431987
                     /locus_tag="ATU_RS25975"
                     /old_locus_tag="AGR_pAT_642"
                     /old_locus_tag="Atu5438"
     CDS             431256..431987
                     /locus_tag="ATU_RS25975"
                     /old_locus_tag="AGR_pAT_642"
                     /old_locus_tag="Atu5438"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007558269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_006315822.1"
                     /translation="MAQMSSKVALVVGGAKGIGLAIAERLSEEGAKVFITSRRSEDAE
                     KAATAIGHGAIGIAADAAIPEDMVATVEKVRKAHGRIDALVLNAGLSEPAQIAEITPE
                     HFDRHFDVNVRGMVFGFQAALPAMTEGGSVVLVGSIADSGGYASYGTYAATKAAVRSY
                     ARTWTAELASVGIRVNVVAPGPTDTEMMAAVQPDMRAAIVAPIPMGRMARPSEVAAAA
                     LFLLSDDASYIAGAELCVDGGLRQV"
     gene            complement(432238..432804)
                     /locus_tag="ATU_RS25980"
                     /old_locus_tag="AGR_pAT_643"
                     /old_locus_tag="Atu5439"
     CDS             complement(432238..432804)
                     /locus_tag="ATU_RS25980"
                     /old_locus_tag="AGR_pAT_643"
                     /old_locus_tag="Atu5439"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007250566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative glycolipid-binding domain-containing
                     protein"
                     /protein_id="WP_010974679.1"
                     /translation="MAVVRWKDWEGHGLEHCLYSESDDGLVLEGVVAGTRHGAYGGYY
                     YVLTDTNFQTREVRVVYVGGPSLHVESDGRGNWRDVIRNRPLPNLTGCIDVDIGITPA
                     TNTLPIKRLKLQAQESSDIVVAYVPLPDQIDGDFLPQRAEQRYTCLTPNRRYRYEGLF
                     RAFTAELEVDDAGLVLDYPQTFRRAVIE"
     gene            complement(433391..433621)
                     /locus_tag="ATU_RS25985"
                     /old_locus_tag="AGR_pAT_644"
                     /old_locus_tag="Atu5440"
     CDS             complement(433391..433621)
                     /locus_tag="ATU_RS25985"
                     /old_locus_tag="AGR_pAT_644"
                     /old_locus_tag="Atu5440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BrnA antitoxin family protein"
                     /protein_id="WP_006315820.1"
                     /translation="MTTPRRPSNPKDAAEALFKPAKKVAAPAVERPAIPNTKELVSLK
                     IDSDVLSHFQADGPGWQDRINDALRAAMNVSN"
     gene            433930..434406
                     /locus_tag="ATU_RS25990"
                     /old_locus_tag="AGR_pAT_646"
                     /old_locus_tag="Atu5441"
     CDS             433930..434406
                     /locus_tag="ATU_RS25990"
                     /old_locus_tag="AGR_pAT_646"
                     /old_locus_tag="Atu5441"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_046033446.1"
                     /translation="MASSLREGVKSHDGQPFTSDDVIFTLGRAGSVPNSPGGFGGFMR
                     NLASVEADGNSAVIINTKAPAPTLPGDLANIAIVSRHAGERVDTADYNSGKAAIATGA
                     FRLTTFKQGIEVGLERNPDWWGKKVTWEHATYRMISSANARTIFGCDIKHRNECGL"
     gene            434584..436524
                     /locus_tag="ATU_RS25995"
                     /old_locus_tag="AGR_pAT_647"
                     /old_locus_tag="Atu5442"
     CDS             434584..436524
                     /locus_tag="ATU_RS25995"
                     /old_locus_tag="AGR_pAT_647"
                     /old_locus_tag="Atu5442"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012649135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAMP domain-containing protein"
                     /protein_id="WP_006315817.1"
                     /translation="MSFLQHARIRTKILSLILPLCLVGIGGDILIAKNYSSSGETYSD
                     FISNETAAEINMAIASQRLVAVVYDAYQVFAYDPGTTGLMAAQEDYKQSTKRFLDLVS
                     DSRGLLPSEVSSFAAFETDAKEIFSITDRAIEAGAADRNTEAKQLLAQADEKVAVALP
                     KMRGWINTYSKTIADKAAALGVETRNTIFYSLAVVGTVFTVGIALTLLLISRGITGPI
                     AALRERMLSLAAGHSEAPVKGVDRRDEVGEMAKAVAVFRDNAIERMRLEQEADANRSL
                     SDKERLEREAQKAREAADTQFAVDGLATGLEELSRGNVAYRINVPFVTQLDRLRENFN
                     ASLAKLEDTLLQVGQNAHGIDAGANEIRAAADDLSKRTEQQAASVEETAAALEQITTA
                     VKDSARRAEEAGALVARARQGAEQSGQVVRNAVAAMQAIEKSSTEISNIIGVIDEIAF
                     QTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSAIAAKEIKTLIQGSGGHVQAG
                     VNLVGDAGRSLENISAEVQEINRHVSAIVEAAREQSIGLQEINTAVNAMDQGTQQNAA
                     MVEQSTAASHNLAKEAASLTAQLSQFNLTGMASAQSAALRKSAHAMAAVATQSSDVAV
                     GRPKARRVAGAFGATQGSWEEF"
     gene            complement(436623..437171)
                     /locus_tag="ATU_RS26000"
                     /old_locus_tag="AGR_pAT_650"
                     /old_locus_tag="Atu5443"
     CDS             complement(436623..437171)
                     /locus_tag="ATU_RS26000"
                     /old_locus_tag="AGR_pAT_650"
                     /old_locus_tag="Atu5443"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_010974682.1"
                     /translation="MKVSREQMAENRRRILDVASRLFKDKGFEAVSVAEVMKAAGMTH
                     GGFYGHFTSKDDLVAQTLAHALAADSDGDGEFSDFVRSYLAPRHRDNPGNGCPTAGLA
                     AAIRHQTPAAKAAMAEGLRAQIARIEKALPAQDPADGRRTAIGSWAAMVGAVILARAV
                     DDPELSDEVLIQTRAWIDSRTG"
     gene            437234..438070
                     /locus_tag="ATU_RS26005"
                     /old_locus_tag="AGR_pAT_651"
                     /old_locus_tag="Atu5444"
     CDS             437234..438070
                     /locus_tag="ATU_RS26005"
                     /old_locus_tag="AGR_pAT_651"
                     /old_locus_tag="Atu5444"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019566805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_035258290.1"
                     /translation="MMIVMNIGSSREKSNPMSQISAVLITGASTGIGATYAERFARRG
                     HDLVLVARDMARMEALASRLSQETGVRIDILPADLTQATDLVKVETRLRDDERIGILV
                     NNAGTAIGGTFVDQSVDDMTRLVALNATALVRLAGAIAPRLAKAGEGAIVNIGSVVGL
                     APEFGMTVYGATKAFVLFLSQGLAHELGPKGVYVQAVLPATTRTEIWDHVGADVNTLN
                     NVMEVGDLVDAALVGFDRREPVTIPPLPDAGQWEAFDLARKTMMANFGNALPGERYRN
                     RA"
     gene            438128..439222
                     /locus_tag="ATU_RS26010"
                     /old_locus_tag="AGR_pAT_653"
                     /old_locus_tag="Atu5445"
     CDS             438128..439222
                     /locus_tag="ATU_RS26010"
                     /old_locus_tag="AGR_pAT_653"
                     /old_locus_tag="Atu5445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkene reductase"
                     /protein_id="WP_006315813.1"
                     /translation="MTDKTLFEPYALGAISLSNRIVMAPLTRNRAGAGFVPGDLTAEY
                     YTQRASAGLIISEATQISQQGQGYQDTPGIYTRAQIDGWRKVTAAVHEKGGRIVLQLW
                     HVGRISHIDLQPNGGQPVAPSAIRAATKTFVNNAFVDVSEPRALEIEELAGIVNDFRK
                     AAANAIDAGFDGVEIHGANGYLLEQFAKDGANVRTDAYGGSVENRARLMLEVTAAVAQ
                     EIGPARTGIRISPVSPANGISCSDAQAQYDYIVDQLDALGVAYIHVVEGATGGPRDVA
                     PFDYGSLRRRFSKTYIANNGYDLELAATHIAEGKADLIAFGRPFIANPDLVKRLQSGA
                     PLAEIDPATIYGGGAEGYTDYPRFNEASGS"
     gene            439334..440236
                     /locus_tag="ATU_RS26015"
                     /old_locus_tag="AGR_pAT_654"
                     /old_locus_tag="Atu5446"
     CDS             439334..440236
                     /locus_tag="ATU_RS26015"
                     /old_locus_tag="AGR_pAT_654"
                     /old_locus_tag="Atu5446"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_010974684.1"
                     /translation="MATLASNGQTSAPATDASMTTTSTNFYRDAPNRFVTAGNIRFAY
                     RELGPHGGTPLVLLNHWGAVLDNFDPRIVDGLASSHHIVVLDYRGIGLSGGTAPVTID
                     EMARDVIAVIGKLGFSTVDLMGFSLGGFVAQDIALKTPDLVRKLILTGTGPAGGAGIE
                     RVGAVSWPLILKGILTLRDPKTYLFFTSTTNGRRAAKDFLARLKERKMGRDKGATPYA
                     FLRQLAAIKAWGRQAPQDLGRIHIPVLVANGDNDIMVPTSNSRDIARRIPNAELVIYE
                     DAGHGGIFQYHAEFVPKALAFLAT"
     gene            440268..441272
                     /locus_tag="ATU_RS26020"
                     /old_locus_tag="AGR_pAT_656"
                     /old_locus_tag="Atu5447"
     CDS             440268..441272
                     /locus_tag="ATU_RS26020"
                     /old_locus_tag="AGR_pAT_656"
                     /old_locus_tag="Atu5447"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016734910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent oxidoreductase"
                     /protein_id="WP_010974685.1"
                     /translation="MKAFVVDKYKKKGPLRLADMPNPVIGANDVLVRIHATAINLLDS
                     KVRDGEFKLFLPYRPPFILGHDLAGTVIRVGANVRQFKTGDEVFARPRDHRVGTFAEM
                     IAVDAADLALKPTSLSMEQAASIPLVGLTAWQALIEVGKVKSGQKVFIQAGSGGVGTF
                     AIQLAKHLGATVATTTSAANAELVKSLGADVVIDYKTQDFEQVLSGYDLVLNSQDAKT
                     LEKSLNVLRPGGKLISISGPPDVAFARSLKLNPLLRFVVRMLSRGVLKKASRRGVDYS
                     FLFMRAEGQQLHEIAELIDAGTIRPVVDKVFQFAQTPDALAYVETGRARGKVVVTYAS
                     "
     gene            441508..441768
                     /locus_tag="ATU_RS26025"
                     /old_locus_tag="AGR_pAT_658"
                     /old_locus_tag="Atu5448"
     CDS             441508..441768
                     /locus_tag="ATU_RS26025"
                     /old_locus_tag="AGR_pAT_658"
                     /old_locus_tag="Atu5448"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003501755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WGR domain-containing protein"
                     /protein_id="WP_010974686.1"
                     /translation="MITQPYRLYVERTDCKKNMARYYAMEITTTLFGDACLTRSWGRI
                     GKRGQSKMHHFEREEEAVDLFLTLTRQKRSRGYRPATGRDRG"
     gene            442069..442545
                     /locus_tag="ATU_RS26030"
                     /old_locus_tag="AGR_pAT_660"
                     /old_locus_tag="Atu5449"
     CDS             442069..442545
                     /locus_tag="ATU_RS26030"
                     /old_locus_tag="AGR_pAT_660"
                     /old_locus_tag="Atu5449"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007758851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp20 family protein"
                     /protein_id="WP_006315810.1"
                     /translation="MATSYDYAPLFRNSIGFDRALNLLENAQRARSISDWPPYDIIKT
                     GDDSYRIAIAVAGFALDDLDITFQSNLLTVTGQKHEASTEAYLHRGIAARSFEHRFEL
                     ADHVRVSAAELKNGLLSVNLVREVPEEMRPRKIAIETALKLEPSTPAERIEEKKAA"
     gene            442608..442907
                     /locus_tag="ATU_RS26035"
                     /old_locus_tag="AGR_pAT_661"
                     /old_locus_tag="Atu5450"
     CDS             442608..442907
                     /locus_tag="ATU_RS26035"
                     /old_locus_tag="AGR_pAT_661"
                     /old_locus_tag="Atu5450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF982 domain-containing protein"
                     /protein_id="WP_010974687.1"
                     /translation="MKPDMFKEPVSILVGLGFPAEMRSAMDAYRYLSEWPADLRDNAH
                     SVALKACGAALRGEIEADTARGLFFAFAEKNDLLAPETNFIVSSRARRDKDPRVS"
     gene            443547..444206
                     /locus_tag="ATU_RS26040"
                     /old_locus_tag="AGR_pAT_663"
                     /old_locus_tag="Atu5452"
     CDS             443547..444206
                     /locus_tag="ATU_RS26040"
                     /old_locus_tag="AGR_pAT_663"
                     /old_locus_tag="Atu5452"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010974689.1"
                     /translation="MILAICDIRKTYETAEGAIPVLNGVGLSLDAGESLALTGESGSG
                     KSTLLHLVGGLELPDSGTIMVRDRNIVDLDDRGRALFRRRDVGLIFQQFNLIPSLDVG
                     SNISFHAKLAGRCDPTWEKTLVEALGIAALLGRYPEQLSGGQQQRVAIARTLAARPPL
                     ILADEPTGNLDEATADIVIDIMLQLAKSAKIALLLVTHSSRLAAKLDRRITLTGGKVS
                     Q"
     gene            444203..446611
                     /locus_tag="ATU_RS26045"
                     /old_locus_tag="AGR_pAT_665"
                     /old_locus_tag="Atu5453"
     CDS             444203..446611
                     /locus_tag="ATU_RS26045"
                     /old_locus_tag="AGR_pAT_665"
                     /old_locus_tag="Atu5453"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974690.1"
                     /translation="MNRTAFQALLSHWRHRPLQLFTLFVGVALATALWSAVQAINAEA
                     RASYDRAASVLAQNQLDQLVAKDGSTISSNTYARLRRAGLDVSPIIEGEHRFGTTRIR
                     LIGIDPLTMPSEGRVLPVGEPSGLIDFMTAPGVMIVSPATAGTLKDTSGLPIKMAANI
                     PDGAGFVDISTADRVLHRNGNLSRIVVSPTQKLDIQAVATVAPELSLKEAGGRSDVAR
                     LTDSFHLNLTAFGFLAFVVGLFIAYSATGLSFEQRRGTFRTLRSLGIPLSSLTTMLVI
                     EITLFALVAGALGVVLGYVVASTLLPGVAATLSGLYGARVAGSLSIRPEWWLTGLGMA
                     LVGTWLSSLQHLYRVWRMPILSTAHSRGWTMASVKSLVLQAIAGIFLIALSSLLIWIG
                     SGLLAGFAILAAFLLGAAFILPPLLALALRAGERSSRHVLARWFFADTRQQLPGLSLA
                     LMALLLALSANIGVGTMVSSFRQTFLRWLDQRLAAEVYVTARDEAEAARLRKWFPDHA
                     RAVLPIWSTRGEVSGAQVQIFGVADDPTYRDHWPLILGSATTWDEIASGRGALVNEQF
                     WRSGNASLGQKIILPGGWSATVVGIFSDYGNPMGQVIIGINALNQHYPDVEKLRYGLR
                     VAPDDTADFRRRLIDDFGLPQDNIVDQASLKRQSAAIFEQTFAVTGALNILTLAVAGF
                     AMFSSLLTLASLRLPQLAPVWALGLRRRDLAWLEFIRALTLWFVTFVAAIPVGLALAW
                     VLLTIINVEAFGWRLPMILFPWEWVKLGLVALFAAVISVLIPVRQLAKTAPADLLRVF
                     ANER"
     gene            446601..447665
                     /locus_tag="ATU_RS26050"
                     /old_locus_tag="AGR_pAT_667"
                     /old_locus_tag="Atu5454"
     CDS             446601..447665
                     /locus_tag="ATU_RS26050"
                     /old_locus_tag="AGR_pAT_667"
                     /old_locus_tag="Atu5454"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_010974691.1"
                     /translation="MNVKRILLLCALSLPAPAVAVGQGFAGLGSSAEGFSIPQRGVAP
                     TFPRDHGPHPDFRVEWWYVTANLQTAGGEQLGVQWTLFRSALQPGRRAGWADPQIWLG
                     HAAVTTASRHYVAERLARGGVGQAAVEAEPFEAWIDNWQMKAATTGLADQLDQIDLNA
                     GGEDFNYQLKLQARGPLILQGERGFSVKSAAGQASYYYSQPFYDVSGTIGLDGKNQEV
                     TGKAWLDREWSSQPLASNQKGWDWFSLHLASGEKLMAFRLREEQGEYISANWISADGK
                     TSPINPTDVQLSPLRTATVNGRVMPVEWNVKIPSRGLDIKTVALNEQAWMATSMPYWE
                     GPIEFSGTTSGRGYLEMTGY"
     gene            complement(447689..448336)
                     /locus_tag="ATU_RS26055"
                     /old_locus_tag="AGR_pAT_668"
                     /old_locus_tag="Atu5455"
     CDS             complement(447689..448336)
                     /locus_tag="ATU_RS26055"
                     /old_locus_tag="AGR_pAT_668"
                     /old_locus_tag="Atu5455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipase"
                     /protein_id="WP_010974692.1"
                     /translation="MYDFPASIGTNRYDSDVVAVLTRLQRLGLPDDPIAFYGSSSFRL
                     WNSLAEDLNSLNVVNLGFGGGTFLSAIHYMGQLLVPLKPRQTLLYFGENDIASDGQTA
                     ETAFRHFQTLMNRISEGLPQTRLYILAIKPSPARWIYRDEFDRFNRLTQAWCENRYKV
                     TWLDLSGDLLGENGLPMFRYYQPDLVHLNAAGYAVWAQSLKAALGMRPSVDRPER"
     gene            complement(448384..449295)
                     /locus_tag="ATU_RS26060"
                     /old_locus_tag="AGR_pAT_669"
                     /old_locus_tag="Atu5456"
     CDS             complement(448384..449295)
                     /locus_tag="ATU_RS26060"
                     /old_locus_tag="AGR_pAT_669"
                     /old_locus_tag="Atu5456"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003492177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxygalactonokinase"
                     /protein_id="WP_010974693.1"
                     /translation="MASPATSIIVDWGTTSLRATLVGESGEELDYLETTDGISSLGKD
                     QHEPALMTALAPWFSSLGALPVAALGMITSRNGWVEVPYVQCPAGPAELAAGTVRRSL
                     PNGSELVFLPGLQDPLRRPFPDVMRGEETQVIGHGLDKDITIIIPGTHSKWARVKAGK
                     IDCFQTFVTGEIFNLLINHSFIARGSTQPAVDDADAYLWGLHEAKQSTAMSSLLFSAR
                     TGTLAGKLSADQLRSFVRGLVIGQEFRQARDANWFGENGQATIVGNDGLNDLYVQAAE
                     IFALKISLGADDDLTKGALTVLHQALS"
     gene            449411..450319
                     /locus_tag="ATU_RS26065"
                     /old_locus_tag="AGR_pAT_671"
                     /old_locus_tag="Atu5457"
     CDS             449411..450319
                     /locus_tag="ATU_RS26065"
                     /old_locus_tag="AGR_pAT_671"
                     /old_locus_tag="Atu5457"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase family protein"
                     /protein_id="WP_010974694.1"
                     /translation="MVAGLKGILPVLPTPFLADGGIDEAGMKRLVVFALDKGVDGVVF
                     PGFASEVETLNAAERAALLKIVVDAVAGRVPVVAGASAADWREVVEHGRAASALGIRH
                     LMVQPPKSVGTDASALIEFLGRIVEALPEVEIILQNAPAPRGSDLSPQAIVEIVRALP
                     QVTYVKEETLPAGPAISHIIAHAPSTLKGVIGGGGARYILDEYARGATAAMPALEIAE
                     EHVAIDRALVAGRQEEARRIYVRTLPLLVLQAVYRMRLTKYVLARRGVIDGVGVRAPT
                     PELDTAALADIDANLVELGLVAAEAA"
     gene            450316..451482
                     /locus_tag="ATU_RS26070"
                     /old_locus_tag="AGR_pAT_674"
                     /old_locus_tag="Atu5458"
     CDS             450316..451482
                     /locus_tag="ATU_RS26070"
                     /old_locus_tag="AGR_pAT_674"
                     /old_locus_tag="Atu5458"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020811824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase/muconate lactonizing enzyme
                     family protein"
                     /protein_id="WP_010974695.1"
                     /translation="MNSPIATVEVFTLTQPRKVPYLGALREGEVVNPNGYIVRKGNRT
                     VYPTFDRSVLVRMTTEAGTVGWGETYGIVAPGAVAALINDLLAGFVIGRDASDPSAVY
                     DDLYDMMRVRGYTGGFYVDALAALDIALWDIAGQEAGKSIRDLLGGGVDSFPAYVSGL
                     PERTLKARGELAKYWQDRGFNAFKFATPVADDGPAAEIANLRQVLGPQAKIAADMHWN
                     QTPERALELIAEMQPFDPWFAEAPVWTEDIAGLEKVSKNTDVPIAVGEEWRTHWDMRA
                     RIERCRIAIVQPEMGHKGITNFIRIGALAAEHGIDVIPHATVGAGIFLAASLQASSTL
                     SMLKGHEFQHSIFEPNRRLLDGDMDCREGRYHLPSGPGLGVRPSEAALGLIERI"
     gene            451507..452778
                     /locus_tag="ATU_RS26075"
                     /old_locus_tag="AGR_pAT_676"
                     /old_locus_tag="Atu5459"
     CDS             451507..452778
                     /locus_tag="ATU_RS26075"
                     /old_locus_tag="AGR_pAT_676"
                     /old_locus_tag="Atu5459"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020811823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_010974696.1"
                     /translation="MTKRMKKLALGTATAVLMTMGAVAPAMADTVLKFISWQTDDAGT
                     GEWWRSAIAAFEKQHPGVKIEFTKAERSSYADTMTTLFAANQPPQIVHLASFEFQMFA
                     DSGWLEPLDPWLKKDGIDMTGWAGQQKCEWNGETVCIMTNYFGFVMAYNKKLLEDAGV
                     AVPKTYDEFLAAAKATTKDLNGDGIIDQFGTGHETKGGPGQYLTEMLNYILDAGAYWT
                     DKDGNITIDTPQMVEGLSRWKTVMKSGISPVDMSASDVRKLFADGKMAMRLDGPWLYG
                     TTEKGSAKSDIVYVAPPLHPPLGGSSNVLAMPADIPDDQKALVWDFIKLTMTPEFQRS
                     YATLGGNTPPSPKADVSGVEKTIPHFPVLIETMKAASEAGIDRIPTGLELFYNEFSKM
                     VMEESQRMIIQDLDPAEVAKTMQAKAEAIKG"
     gene            452862..453788
                     /locus_tag="ATU_RS26080"
                     /old_locus_tag="AGR_pAT_678"
                     /old_locus_tag="Atu5460"
     CDS             452862..453788
                     /locus_tag="ATU_RS26080"
                     /old_locus_tag="AGR_pAT_678"
                     /old_locus_tag="Atu5460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020010283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_010974697.1"
                     /translation="MTEPVRAGRRKFFDLARPSRQHLLGYILIAPAVLMVAAIIVWPL
                     VLAIDLSFQQVKIPRLGGASRPFSLSNYTWLFSSPEFWLSCWVTLKLVVVVTAGSVAV
                     GLSTALLANNRFKGRSVARLGMALPWAVPEIIAVVIFAWMFDTSFGLFGWLAIKLGFT
                     DQMIPWVSSSTAAFWAVAITMVWKGFPFVSIMCLAGLQSIPADYYAAAKVDGASVWQR
                     FRWITMPLLMPVLGVTLVLTLLWVFRDFSIIKVLTGGGPLRSTQTLSIMTYDQAFQYH
                     NFGRAAAVGVLTLVICIVASLLMLGRRSKSIY"
     gene            453799..454629
                     /locus_tag="ATU_RS26085"
                     /old_locus_tag="AGR_pAT_680"
                     /old_locus_tag="Atu5461"
     CDS             453799..454629
                     /locus_tag="ATU_RS26085"
                     /old_locus_tag="AGR_pAT_680"
                     /old_locus_tag="Atu5461"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020010284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="WP_006315797.1"
                     /translation="MKRTFLQSLALYATVIFTLVMVLFPVYWLLVTALSTTDELYRLP
                     PTFWPDDPQWDIFARVWAAKPILLWLWNSMLAAIGSVALSMLVSVSAGYALSRYSMRG
                     GATMGLFVLTAKMLPATLLVIPLFSIFSSFGLIGSLWTLVLAHSTMIIPFATWMLKGY
                     FDTIPKELEQAAMVDGCSPIGAMVRVVLPIATPGLAATALYAFVLSWADYAYARTFLV
                     NSPDNWTANLGITTMQGEYVTYWNDISAASVFIALPIIAIYLFLERYLVGGLTAGAEK
                     "
     gene            454632..455714
                     /gene="ugpC"
                     /locus_tag="ATU_RS26090"
                     /old_locus_tag="AGR_pAT_681"
                     /old_locus_tag="Atu5462"
     CDS             454632..455714
                     /gene="ugpC"
                     /locus_tag="ATU_RS26090"
                     /old_locus_tag="AGR_pAT_681"
                     /old_locus_tag="Atu5462"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020811820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate ABC transporter
                     ATP-binding protein UgpC"
                     /protein_id="WP_006315796.1"
                     /translation="MANISIRNVSKSYGALNVLRPFSLEIENGEFVVLVGPSGCGKST
                     MLKILAGLEPASEGQIFIGDNEVTDLAPGDRDIAMVFQNYALYPHLTVRQNIGFGLKM
                     RGTDKAEIDRRVDDAARILEVTPYLDRKPKDLSGGQRQRVALGRAIVRQPQAFLMDEP
                     LSNLDAKLRVHMRAEIGALHKRIGVTTVYVTHDQVEAMTMADRVVIMQGGIIQQIAAP
                     DELFNNPANLFVAGFIGSPGMNFLNAELRGGAVTLFGQPVSLPGAVGREGSVIVGLRP
                     EHLVLGDAPVTFDVRPTLVESLGSEKYVYFDAEGARVADGEEGKSKGLIARVSHTGNL
                     PGNEALRLGFDPAQLYLFDAKTGARL"
     gene            455711..456694
                     /locus_tag="ATU_RS26095"
                     /old_locus_tag="AGR_pAT_682"
                     /old_locus_tag="Atu5463"
     CDS             455711..456694
                     /locus_tag="ATU_RS26095"
                     /old_locus_tag="AGR_pAT_682"
                     /old_locus_tag="Atu5463"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019565780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_006315795.1"
                     /translation="MILVTGSAGRVGRAVVAALRTQGRTVRGFDLRPSGTGGEEVVGS
                     LEDGQALSDAIMGVSAVLHLGAFMSWAPADRDRMFAVNVEGTRRLLDAASAAGVRRFV
                     FASSGEVYPENRPEFLPVTEDHPLCPNSPYGLTKLLGEELVRFHQRSGAMETVILRFS
                     HTQDATELLDEDSFFSGPRFFLRPRIHQQQNFGNAAIAELLQSRDIGEPSHILARNEN
                     GRPFRMHITDTRDMVAGILLALDHPEAAGGTFNLGADEPADFAALLPKIAALTGLPIV
                     TVDFPGDGVYYHTSNERIRNTLGFEAEWTMDRMLEEAATARRQRLAKEQRR"
     gene            456691..458373
                     /locus_tag="ATU_RS26100"
                     /old_locus_tag="AGR_pAT_685"
                     /old_locus_tag="Atu5464"
     CDS             456691..458373
                     /locus_tag="ATU_RS26100"
                     /old_locus_tag="AGR_pAT_685"
                     /old_locus_tag="Atu5464"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003492163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SMP-30/gluconolactonase/LRE family protein"
                     /protein_id="WP_006315794.1"
                     /translation="MKPETPGGTAALAKGLTLLDMVADAPEPPRFAELLRASGLPKPT
                     FARILRTLIAYGLVRQDEARGTYVLGQRFLEMSHKVWESFDLVSAATPELERLAAELG
                     ETVALCRLDGTMTQYLAERSPNGLSVRVEVGRRVPLHCTAPGKALLAFQDPAVGRALL
                     DRLTLDLQTAKTITTLDALQADLTLTRARGYSISYEEHLPGVNSVAAPVMGRDNTPMG
                     VLVALGPSSRLDSSNIHPAGRELIAAARRITGAAGAVAISSRPRPRSATGRPSAELSC
                     ILPWGAQLGESPVWHEGEDALYWVDILHPAVHRFDPATGRNETCETGKLVSAVIPVTG
                     GRLLVASQDGVEWLDFASGRLTPFVSPEAGIADNRLNDAKCGPDGAIWVGSMRIDASK
                     PTGALYRINANGASERKEGGIIVSNGLGWSPDGRTFYFVDTVPGLIHAYDCDPATGAL
                     SQRREFARIPVADGRPDGLAVDAEGGVWCAIWDGWCVRRYLPNGKLDQVIDMPVPRPS
                     SIAFGGPDLSTLFITSARTRLPASTLADAPLSGGLFSCRPGISGARIAMFEG"
     gene            458377..459138
                     /locus_tag="ATU_RS26105"
                     /old_locus_tag="AGR_pAT_687"
                     /old_locus_tag="Atu5465"
     CDS             458377..459138
                     /locus_tag="ATU_RS26105"
                     /old_locus_tag="AGR_pAT_687"
                     /old_locus_tag="Atu5465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_006315793.1"
                     /translation="MRLETIFGLRGRTALVTGSSRGIGAAIAEGLAGAGAHVILHGVK
                     PGSTAAVQQRIIASGGTAQELAGDLSEAGAGTDLIERAEAIAPVDILVINASAQINAT
                     LSALTPNDLAFQLAVNLGSTVDMLQSALPKMVARKWGRVVSIGSINQLRPKSVVTAYA
                     ATKAAQHNLIQSQARDFAGDNVLLNTLAPGLVDTDRNADRRAQDPEGWDEYVRTLNWM
                     GRAGRPEEMVGAALFLASEACSFMTGETIFLTGGY"
     gene            complement(459194..461107)
                     /locus_tag="ATU_RS26110"
                     /old_locus_tag="AGR_pAT_688"
                     /old_locus_tag="Atu5466"
     CDS             complement(459194..461107)
                     /locus_tag="ATU_RS26110"
                     /old_locus_tag="AGR_pAT_688"
                     /old_locus_tag="Atu5466"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007629850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter Kup"
                     /protein_id="WP_010974698.1"
                     /translation="MTSSNSTVPDSRSETKKFLVLLLGSIGVVYGDIGTSPLYAFRES
                     LRPFTANGVQHEHVVGLISLMIWTLTIIVTFKYVLFLLRADNDGEGGTLSLLALLMKK
                     TGSYMPVLFFAGLIGSALFIGDAMITPALSVMSALEGMKLVTPAFSDYVLPLSALIMV
                     GLFAVQSKGTGAVAVFFGPITVVWFLAMAWGGLIHIGDDWTILEAVNPINALWFITHA
                     GWAGLIVLGAVFLTVTGAEALYADLGHFGRKPISVAWFILVFPALALNYLGQGALVLS
                     NPAAIENPFYLLYPEWALFPMIILATMATVIASQAVITGAFSLARQAVHLGFLPKLMI
                     RFTSETNTGQIYVPAVNMVLFIGVLVLIFSFGDSESLATAYGISVTGAMVVTTLMAFQ
                     FLRSIRGKSAFTAAILLAPLFSIEAVFLAANLLKVHDGGWVPLALAGVIILVMWTWTK
                     GSRYLREKISKNDVSLDTFITSLERSISRESRSAPVLVSGTAVFLTSVPDKAPSVLLH
                     NLKHNHVLHEQNVILTIWTHDKPYVADTDRVEITRISKHFMRLDINFGFMDDPNVVKA
                     LPLCKKKGFKFEIMQTSFYLGRRNLIATPNTGLPRWQEDLYIALADFGVDPSAYFKLP
                     PNRVIEIGEQVAI"
     gene            461363..461674
                     /locus_tag="ATU_RS26115"
                     /old_locus_tag="AGR_pAT_689"
                     /old_locus_tag="Atu5467"
     CDS             461363..461674
                     /locus_tag="ATU_RS26115"
                     /old_locus_tag="AGR_pAT_689"
                     /old_locus_tag="Atu5467"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006315786.1"
                     /translation="MIADVAAWIFTLFVVDPFQAEMKSALERANLPVEVVQQSRECLA
                     TQVPRLVERADNEPGWAVATAVGISIGWTPPERLLDATDPTCGTLRGLMVFENSPEAE
                     G"
     gene            461941..463014
                     /gene="dinB"
                     /locus_tag="ATU_RS26120"
                     /old_locus_tag="AGR_pAT_692"
                     /old_locus_tag="Atu5469"
     CDS             461941..463014
                     /gene="dinB"
                     /locus_tag="ATU_RS26120"
                     /old_locus_tag="AGR_pAT_692"
                     /old_locus_tag="Atu5469"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV"
                     /protein_id="WP_010974700.1"
                     /translation="MRKIIHVDMDAFYASVEQRDNPELRGRPVAVGSAAARGVVAAAS
                     YEAREFGVRSAMPSVTAARRCPDLIFVPPRFDVYKAVSQQIRAIFAEYTRLIEPLSLD
                     EAYLDVTENLKGMEIATEIASEIRERIKQITGLNASAGISYNKFLAKMASDLNKPNGQ
                     AVITPKNGPAFVEQLAVKKFHGVGPATAEKMHRFGIETGADLKSKSLQFLAEHFGKSG
                     AYFYGIARGIDERQVRPDRIRKSVGAEDTFSVDINDLDLATAELRPLAEKVWHHCEAQ
                     RVSGKTVTVKVKYSDFTQATRSRTSALPVNGIQEILEAASALLATVYPFRRSVRLLGV
                     TLSSLTNDQEAEDEEQPQLDLAL"
     gene            463508..463744
                     /locus_tag="ATU_RS26125"
                     /old_locus_tag="AGR_pAT_694"
                     /old_locus_tag="Atu5471"
     CDS             463508..463744
                     /locus_tag="ATU_RS26125"
                     /old_locus_tag="AGR_pAT_694"
                     /old_locus_tag="Atu5471"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006315784.1"
                     /translation="MPRYFFHVRDAQGLSVDMEGAILSTDEQAKREAVQAAKEMLAEK
                     ILRDEILDGAAFEVVRSDGILIAKIPLKSVIRLK"
     gene            complement(464100..465100)
                     /locus_tag="ATU_RS26130"
                     /old_locus_tag="Atu5472"
                     /pseudo
     CDS             complement(464100..465100)
                     /locus_tag="ATU_RS26130"
                     /old_locus_tag="Atu5472"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010971661.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS30 family transposase"
     gene            complement(465274..466146)
                     /locus_tag="ATU_RS26135"
                     /old_locus_tag="AGR_pAT_698"
                     /old_locus_tag="Atu5473"
     CDS             complement(465274..466146)
                     /locus_tag="ATU_RS26135"
                     /old_locus_tag="AGR_pAT_698"
                     /old_locus_tag="Atu5473"
                     /EC_number="2.6.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino-acid transaminase"
                     /protein_id="WP_010974702.1"
                     /translation="MNMSSPERIVYVNGQYCAESEGKVSIFDRGYLFADAIYEVTCII
                     GGKLVDFDGHMIRLARSLKELDMPTPMSTEELLAVHRKLVADNNVEEGLIYMQISRGN
                     ADRDFNFPSKDTPPVVVMFTQARPVLESPLAKRGLKVISLPDIRWGRRDIKTVQLLYP
                     SMAKNAAHEAGADDAWLVQDGLVTEASSANAYIVTADGKIVTRSLSSDILHGITRAAV
                     LRFAEEAGYALDERSFTIAEALEAREAFITSATSFVTSVVSIDGQMIGDGTIGPVSRR
                     LREVYLEKAVGARI"
     gene            complement(466208..467143)
                     /locus_tag="ATU_RS26140"
                     /old_locus_tag="AGR_pAT_699"
                     /old_locus_tag="Atu5474"
     CDS             complement(466208..467143)
                     /locus_tag="ATU_RS26140"
                     /old_locus_tag="AGR_pAT_699"
                     /old_locus_tag="Atu5474"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxylate/hydroxypyruvate reductase A"
                     /protein_id="WP_010974703.1"
                     /translation="MIVLVTRMSEDAERLWLTSLSRKMPGETIVPFRQLDEAAREKAD
                     IAIVANPDPADIARLPNLKWIHSVWAGVERLVAELGESRLPIVRLVDPQLSQTMAEAV
                     LAWTYYLFRDMPAYANFQRQRVWQQLAYRRPQDVTIGLLGLGALGAESAARLRYAGFN
                     VIGWSRSHKEIDGVQTFHGDRGLEELLGRSEILVCLLPLTDETRGLIDAVRLSLLPEG
                     ASLINFARGPIVVADDLIRALDSGAMKHAVLDVFDVEPLPPDNKLWDHPAITVLPHIS
                     APTDRETAAAIVAGNILTYRSSGALPPTVDLARGY"
     gene            complement(467175..467588)
                     /locus_tag="ATU_RS26145"
                     /old_locus_tag="AGR_pAT_700"
                     /old_locus_tag="Atu5475"
     CDS             complement(467175..467588)
                     /locus_tag="ATU_RS26145"
                     /old_locus_tag="AGR_pAT_700"
                     /old_locus_tag="Atu5475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018901760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_006313628.1"
                     /translation="MRSLFHLAYHVTDLDETRRFYGGVLGCQEGRSTDTWVDFDFFGH
                     QISMHLGKPFETTRTGKVGNHMVMMPHLGVVLELEAWFALARRLEDAGIAFDIPPVVR
                     FEGEPGEQRTMFFFDPSGNPIEVKGFRDFDSVFAH"
     gene            complement(467628..468851)
                     /locus_tag="ATU_RS26150"
                     /old_locus_tag="AGR_pAT_703"
                     /old_locus_tag="Atu5476"
     CDS             complement(467628..468851)
                     /locus_tag="ATU_RS26150"
                     /old_locus_tag="AGR_pAT_703"
                     /old_locus_tag="Atu5476"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthase"
                     /protein_id="WP_010974704.1"
                     /translation="MGLILVHHDTGSPALYGAAAAAVAVRRNCGFMHLASRFDTKRHA
                     DAEQHVVASGGLAASGLCWFERLSGKPIEPVAPIEAVIDAAREADIVVPIHPAFLADA
                     NAIAGLFAAAQLQAVSVETIRIADGVHQFADDATGTVITWRDQFGRIRLDKPKAPTET
                     VLTIALVGARSDHVDVYPAALASLADAADSLRLPLAINFIDPVGFDEAYAEQTLRPYA
                     GILLPGGANMKNVAGQTAVAAFALENQLPIVGLCLGMQTMATAVAWRAFGRRNANLAE
                     ADPDVGIKTFLAMAGGTTADGGPLPEHRTGDQQTVPTAGTRLAGLIPHGTIVRCNHRY
                     RLNPDLVRDMETHGLRVAARGVNGSVVDAIEVVGHPFYMGMQGHPELSSRPDAPHPLL
                     VAFLEAALRRQSQAS"
     gene            complement(468878..470047)
                     /locus_tag="ATU_RS26155"
                     /old_locus_tag="AGR_pAT_704"
                     /old_locus_tag="Atu5477"
     CDS             complement(468878..470047)
                     /locus_tag="ATU_RS26155"
                     /old_locus_tag="AGR_pAT_704"
                     /old_locus_tag="Atu5477"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase P family protein"
                     /protein_id="WP_010974705.1"
                     /translation="MSIPSDIVQGQESAFPREEYARRQALAREGLSAAGLDALIVTGP
                     ENIFYLCGQQTPGYYTFQALILPADGDPVFLIRQLEYFNFIANTFISDAVVYQDGEDP
                     LALLVKLIESRGLASRRIAIDKRGWFLPIAVYEALQARLGTIGDGAGVIERFRAIKSP
                     LEVEKLEKAAAYVDEGMRAGLAAVRVGATENDLVSAMLGSAIAAGSEYLGMEPLVSVG
                     PRTGVPHGTWRRRAITDGDPAFLEMAACHDRYHAALMRSAWIGEPPREAVDMMKACQE
                     ALQVSLDTIRPGVACEVPHIACQKVIDRAGYTDNFKKRLGYSVGISFAPDWGEGAILS
                     LNTGVKTELQPGMTFHLPPALRIYGRFTVGVSETIVVTETGYRALGSIDRNLLIV"
     gene            complement(470044..471141)
                     /locus_tag="ATU_RS26160"
                     /old_locus_tag="AGR_pAT_707"
                     /old_locus_tag="Atu5478"
     CDS             complement(470044..471141)
                     /locus_tag="ATU_RS26160"
                     /old_locus_tag="AGR_pAT_707"
                     /old_locus_tag="Atu5478"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase/muconate lactonizing enzyme
                     family protein"
                     /protein_id="WP_010974706.1"
                     /translation="MRASLHRATLQYCDGLLLHTAASGPIAGLDTLYLRLEHGGHIGI
                     GEVRINIAYLNGISPEVCVEQALLTLGDMDWSQEPAAMQAELAARTDVIAPVSMLIDI
                     ALHDLVARSNGVTVCAMLGGKAGSMVRYATNQTLFISSTERFLAQAGTYVARGFRDLK
                     VRVGGGDFAADIARLEALRQNFGDEVKLAIDANGAWSETEASENLMALARFGLAYVEQ
                     PVAPGDWDILGRLAEASPVPLMLDESVATSADIDAIVALNGRLWAHLKLVKLGGIAAS
                     LAAAKRLSNANIPFMVGQMNEGAVATAAALHLSAAVSPRFAELYGADGLENDAADGLV
                     YRNGGVEGPATTGLGLEFDAARTHLVKEFGA"
     gene            complement(471138..472301)
                     /locus_tag="ATU_RS26165"
                     /old_locus_tag="AGR_pAT_709"
                     /old_locus_tag="Atu5479"
     CDS             complement(471138..472301)
                     /locus_tag="ATU_RS26165"
                     /old_locus_tag="AGR_pAT_709"
                     /old_locus_tag="Atu5479"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M20 family metallopeptidase"
                     /protein_id="WP_010974707.1"
                     /translation="MTIMPDIARMKRELAEIIAIRSENPPGGEADVAVYVERLLKDEG
                     FSVSLTEYKPGRFNVEARIENGPGPVFAFNTHMDTVPAGDGWTTDAFILREDDGKLFG
                     RGACDCKGPLIAMIEAMRMLAADRTAWSGTLLGVFVGDEEIASEGAKYYAAARPKIDF
                     AVVGEPTSNTTYSAHKGSLRPVVRVHGVTAHSGTPHLGDNAIYRAGQLLTLVEAFHNN
                     VVRKRTHPLVGEASLTVTRISGGHADNVLPGSCDLLLDRRMVPGESEDAVKQEFATLL
                     KDAYDRFGVKAEIVDYKATTGSATETAADQSIVAASLEACRASGTSDPGPFGFQGGCD
                     LVHFRSLGAQGTVIGPGSLSVAHKADEFVPLDEFVTCSVIYRDVARKMLRPNP"
     gene            complement(472315..473079)
                     /locus_tag="ATU_RS26170"
                     /old_locus_tag="AGR_pAT_712"
                     /old_locus_tag="Atu5480"
     CDS             complement(472315..473079)
                     /locus_tag="ATU_RS26170"
                     /old_locus_tag="AGR_pAT_712"
                     /old_locus_tag="Atu5480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_006313623.1"
                     /translation="MKETSMNSREEKPLLEIMGINKSFGDLKILKSCSLNVHSRETMV
                     IIGPSGSGKSTLLRCINLLEPADDGNIFFEGDDIARELRQAPKIRRQIGMVFQNFELF
                     QHLTAIENIMLAPMKVLGMSRSDAHDIAMDLLKKVRIPERADFFPDELSGGQQQRIAI
                     ARALAMKPKLMLYDEPTSALDPEMIREVLDVMAELSSEGMTSIVVTHEMGFAKRAADQ
                     IVFMENGEVIENAPRDSFFGGTVNERATRFLDQILH"
     gene            complement(473076..473804)
                     /locus_tag="ATU_RS26175"
                     /old_locus_tag="AGR_pAT_713"
                     /old_locus_tag="Atu5481"
     CDS             complement(473076..473804)
                     /locus_tag="ATU_RS26175"
                     /old_locus_tag="AGR_pAT_713"
                     /old_locus_tag="Atu5481"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_006313622.1"
                     /translation="MSLDLVFDYVFSPAFFHGALLTLVITVTSLFFGMIAGLIVALLQ
                     ESRIRPLQIFTLVYLWLFRGTPVLFQIIFIYNVLPTFGVMLSAFVSAVIALSLNEGAY
                     MAEIIRSGLQAVKKGQRTAGLALGMTRFAVMCYIVIPQAARIVLPPTGNQMIGMLKTS
                     ALVSVVAVEELLLVANQTASSNFKYFEALTAAGIYYLALTSIFMGFQYLLERALDRKR
                     PRGKRRSVSLMARLAALTAKTDAR"
     gene            complement(473838..474647)
                     /locus_tag="ATU_RS26180"
                     /old_locus_tag="AGR_pAT_714"
                     /old_locus_tag="Atu5482"
     CDS             complement(473838..474647)
                     /locus_tag="ATU_RS26180"
                     /old_locus_tag="AGR_pAT_714"
                     /old_locus_tag="Atu5482"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_010974708.1"
                     /translation="MLKTILAALIVPLGIAASASAAELPGTGLVEKGALTYGVAATFA
                     PFEFQKGDQLTGFDIDLISALSKKLKAEAKPMNMEFKGLIPALIGGRIDLINSAMYIN
                     PARSEQVDFIPYLKIGNMVLVQAGNPKKITGRDDSLCGKTVSVTLGGIQESQARADDT
                     RCKAKGLEGVKVLTFPTAQDSALTLRQGRADATFDSTPGAVVLQSSVPGVYETVGEEF
                     ESNTSIGMATRKGDAAVQKAIKDALGEIVADGTYKSLIEKWKLPASVAIFN"
     gene            474957..475853
                     /locus_tag="ATU_RS26185"
                     /old_locus_tag="AGR_pAT_716"
                     /old_locus_tag="Atu5483"
     CDS             474957..475853
                     /locus_tag="ATU_RS26185"
                     /old_locus_tag="AGR_pAT_716"
                     /old_locus_tag="Atu5483"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009756604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_035258228.1"
                     /translation="MTTNAQQGRHRLANQILDLIRDAKFEIGHHLREQQLGDMLGVSR
                     TPVRAALNLLAERGIVEARKNQGFFLKAQQGALHRTEVEVPATADQDLYTRIVEDRLS
                     GALGDSITQVEMTRRYMVDRALLQRTLAHLVNDGLLSRNRGRGWTFRPTLDSEMALRD
                     SYDYRSTLEPAGLLLGSFQVDAGLLERSRLEHLYLEGHPEIAGVDPRQLFETDAQFHE
                     MIAAFSGNMFFLQAIQQQNRLRRLLEFGGYSNRRRVRDWCREHLDIIAAILEGDRLRA
                     SKLMLNHLSAARGAARHYPKSD"
     gene            complement(475927..476673)
                     /locus_tag="ATU_RS26190"
                     /old_locus_tag="AGR_pAT_717"
                     /old_locus_tag="Atu5484"
     CDS             complement(475927..476673)
                     /locus_tag="ATU_RS26190"
                     /old_locus_tag="AGR_pAT_717"
                     /old_locus_tag="Atu5484"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019567396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_010974710.1"
                     /translation="MLESGFCVYNRLLQIIGKEGLARLVSRMEPVDLPMGHRLVTSDM
                     LISHLCFIESGLASTIVRDDGGKSIETVLVGREGITGWPALLGAETTPSETIMCVGGR
                     GFLITTVEIRRAMDEDTRLRELLLGYINICLLQVGHLVLANGQYGLRERLARWLLMCH
                     DRLDTDNLPITHEFLSTVLGVRRPGITNELHVLEGIHAIRARRGNVRIINRSILEEVA
                     TITYGAPEKEYERLMARMQADVATPSLFSA"
     gene            477090..477392
                     /locus_tag="ATU_RS26195"
                     /old_locus_tag="AGR_pAT_718"
                     /old_locus_tag="Atu5485"
     CDS             477090..477392
                     /locus_tag="ATU_RS26195"
                     /old_locus_tag="AGR_pAT_718"
                     /old_locus_tag="Atu5485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974711.1"
                     /translation="MQKNIEYQIMAHENGWAVVVCDVIGGTYPSRHLALAAAKQLESE
                     VVSTEEAEHLGAIAHLTLTDAVASDRLRISCQMTVAVSYQVDIPCDAEAEKSAFHR"
     gene            477793..478152
                     /locus_tag="ATU_RS26200"
                     /old_locus_tag="AGR_pAT_719"
                     /old_locus_tag="Atu5487"
     CDS             477793..478152
                     /locus_tag="ATU_RS26200"
                     /old_locus_tag="AGR_pAT_719"
                     /old_locus_tag="Atu5487"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020808127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035258201.1"
                     /translation="METVKRLTVAIIGMADTLTSQIRTAWCHAQIDLEGPYSASFIER
                     EDVLKFVAAIIDVRYEADVMLRLTEQLDGEAIPYLFFVPETVIDSEPGPFVLSGRSED
                     IANIVSALTAQGGGVRH"
     gene            478166..478930
                     /locus_tag="ATU_RS26205"
                     /old_locus_tag="Atu5488"
     CDS             478166..478930
                     /locus_tag="ATU_RS26205"
                     /old_locus_tag="Atu5488"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_010974714.1"
                     /translation="MLKRPDGHNEANILLSLLPDDVRHDVMSVCRPVKLNLGDMLISA
                     GAPIERVFFPSSGIASIVVVSRSGRKTEAGLVGKEGFVPTGALAGAQTNLTEIVVQAP
                     GEALFVERGSFDALRARHRIFSDILVCAVHASRTQVECTASSNATQSVTERLARWLLM
                     CHDRVHGDCLRLTHDFLSTMLAVRRASVTDALHVLESHGFIRSERGRITIRNRETLEI
                     YAHDLYGLPEEENNRMLAHFLREYRSDVALGDLTAS"
     gene            479072..479299
                     /locus_tag="ATU_RS26210"
                     /old_locus_tag="Atu5489"
     CDS             479072..479299
                     /locus_tag="ATU_RS26210"
                     /old_locus_tag="Atu5489"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006315854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006313615.1"
                     /translation="MHEHHYYQRSGIFLNEDINVVKSAYETVLSAEPDSALSATDVAR
                     YVLKMYDRGVVDPSKLQGLAVLYFRTKLRVG"
     gene            complement(479424..479966)
                     /locus_tag="ATU_RS26215"
                     /old_locus_tag="AGR_pAT_720"
                     /old_locus_tag="Atu5490"
     CDS             complement(479424..479966)
                     /locus_tag="ATU_RS26215"
                     /old_locus_tag="AGR_pAT_720"
                     /old_locus_tag="Atu5490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="WP_010974715.1"
                     /translation="MAKHAVSGAPGNTLTEAQLEVLRSGIADLAPALTAFARRFVRNE
                     DDVNDLVQETMLRGFRSLQGFTPGTALKSWLFTILRNTFCTRYKVSRRECVGLPVGIE
                     QSMSIPADQEWRLQHQEVMRAILELDKDQKKALLLIAGGTSYSDAAAICGCRVGTIKS
                     RVNRARESLRQKLDRVGTPH"
     gene            complement(<480203..480295)
                     /locus_tag="ATU_RS26220"
                     /old_locus_tag="AGR_pAT_721"
                     /old_locus_tag="Atu8052"
                     /pseudo
     CDS             complement(<480203..480295)
                     /locus_tag="ATU_RS26220"
                     /old_locus_tag="AGR_pAT_721"
                     /old_locus_tag="Atu8052"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020009970.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF892 family protein"
     gene            complement(480336..482477)
                     /locus_tag="ATU_RS26225"
                     /old_locus_tag="AGR_pAT_722"
                     /old_locus_tag="Atu5491"
     CDS             complement(480336..482477)
                     /locus_tag="ATU_RS26225"
                     /old_locus_tag="AGR_pAT_722"
                     /old_locus_tag="Atu5491"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase C"
                     /protein_id="WP_010974716.1"
                     /translation="MARKPNSTSSITATIHDQQLIRGAGGELHQIATGDEPVLTTAQG
                     APVADDQNSLRIGPRGPLVVDDFHFREKIFHFDHERIPERVVHARGYGAHGYFETYDS
                     LATHTKADLFQRAGERTPAFVRFSTVAGNKGSADLARDVRGFAVKLYTKEGNWDLVGN
                     NIPVFFIQDAIKFPDLVHAAKQEPDRAFPQAQTAHDTFWDFISLTPESMNMVMWIMSD
                     RTIPRSFRFMEGFGVHTFRFINAKEQSTFVKFHWKPKLGLQSVAWNEAVKINGADPDF
                     HRRDLWTAIQSGNFPEWELQVQLFDQDFADSFDFDVLDPTKIIPEEILAPKPVGRLVL
                     DRMPDNFFAETEQVAFMTQNVPPGIDFSNDPLLQGRNFSYLDTQLKRLGGPNFTHLPI
                     NAPKCPFAHFQQDGHMAMRNPTGRANYQPNSFGEGQRESPTRGFQHFAAEEQGVKARL
                     RPESFADHYSQARQFYISQTPPEQRHIASALTFELSKVETVEIRERMVSHLLNIDETL
                     ATTVAQKLGLQTMPEPANTAIPTRQDLEPSPALSIVERGPKRFEGRKLGILITDGVDA
                     KLLKGLTQAVTAEKAVFEFIAPKVGGVTASNGTLIEAHHMIDGGPSVLFDAVALLTSE
                     AAIAELTEEATARDFVADAFQHCKFIGYDRSALPLLEIAGIADAMDEGVLPLPGEEGL
                     AAFVAELGKLRVWAREPSLKLGKASVPVNKE"
     gene            complement(482554..483156)
                     /locus_tag="ATU_RS26230"
                     /old_locus_tag="AGR_pAT_724"
                     /old_locus_tag="Atu5492"
     CDS             complement(482554..483156)
                     /locus_tag="ATU_RS26230"
                     /old_locus_tag="AGR_pAT_724"
                     /old_locus_tag="Atu5492"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006313611.1"
                     /translation="MRTVTGLFDNYDDASAAVSELERAGVPSNDISIVGNNVDRRHGE
                     DSNAAEGAGTGAGIGAVVGGAGGLLTGLGLMAIPGLGPVVAAGWLAATAVGAAGGAVA
                     GGAAGGVIGAMTRSGVSEEDANVYAEGIRRGGTIVTARVEENLVPEAEDILKRSNYVD
                     LPERRAAYRDQGWTRFDEAARPYAPEDVEQERNRYRRSTI"
     gene            complement(483181..483498)
                     /locus_tag="ATU_RS26235"
                     /old_locus_tag="AGR_pAT_726"
                     /old_locus_tag="Atu5493"
     CDS             complement(483181..483498)
                     /locus_tag="ATU_RS26235"
                     /old_locus_tag="AGR_pAT_726"
                     /old_locus_tag="Atu5493"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020808141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006313610.1"
                     /translation="MKKTVLVALFFGGSALSAFAQQAPAANPGGDMPAIATPDLKNPT
                     APVEGANSFTEAQAKERIEAAGYTQVKDLKKDDKGVWMASGTKGGKAVTIALDYQGNV
                     VAK"
     gene            484030..484524
                     /locus_tag="ATU_RS26240"
                     /old_locus_tag="AGR_pAT_727"
                     /old_locus_tag="Atu5494"
     CDS             484030..484524
                     /locus_tag="ATU_RS26240"
                     /old_locus_tag="AGR_pAT_727"
                     /old_locus_tag="Atu5494"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin-like domain-containing protein"
                     /protein_id="WP_010974717.1"
                     /translation="MKTLSDIFEHTLRDVYYAENAITKALPKVAKSAKSAELKKAAED
                     HLAETKDQIKKLDEVFKSIGKKASGEKCDAIEGLIKEAEGLMEEAEGTALDAGLLAAC
                     QAIEHYEIARYGSLREWAKDLGHDEAHKLLSEILDQEKATNNKLTNLAVTTVNKTSAA
                     KKAA"
     gene            485227..486087
                     /locus_tag="ATU_RS26245"
                     /old_locus_tag="AGR_pAT_728"
                     /old_locus_tag="Atu5495"
     CDS             485227..486087
                     /locus_tag="ATU_RS26245"
                     /old_locus_tag="AGR_pAT_728"
                     /old_locus_tag="Atu5495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_010974718.1"
                     /translation="MFENFRLEMVKLPETKLRVRHGGSGPPLLLLHGHPRTHTTWYKV
                     APILAEHFTVICPDLRGFGQSGKPDDPYDYEASSKRAKARDCVALMDHFGFNEFSLAG
                     HDRGSYTAFRTAMDHPARVAKLAILDGVPILEALEHCNARFATQWWHWFFFAQHDKPE
                     QAISADPLRWYGGTEDLMGKENYADFRLAVQDHSTIQGMLGDYRAGVRIDHLHDREDR
                     NSGRKLQCPLRVLWSLRDDLEDLYNDVLAIWQPWAELPVSGLGIDSGHHMAEEAPLEV
                     ARELKSFFLA"
     gene            complement(486325..486909)
                     /locus_tag="ATU_RS26250"
                     /old_locus_tag="AGR_pAT_729"
                     /old_locus_tag="Atu5496"
     CDS             complement(486325..486909)
                     /locus_tag="ATU_RS26250"
                     /old_locus_tag="AGR_pAT_729"
                     /old_locus_tag="Atu5496"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_035258233.1"
                     /translation="MPKERTQPPLSEAPLRADARRNREKLIEVASLAFSEQGAAASLE
                     DIARRAGVGIGTLYRHFPTREHLVESVYRRELELLATAARDLIAEEEPAEAIEEWMNR
                     FVNYMAAKRGMANSLKLLFTSNSTLFAEGSKLLHTAFEGLLDNAVKADAVKGDIEAAD
                     VLNALFGIYSIPEGPEWRDRAHRIVRLVMDGLRR"
     gene            487132..488121
                     /locus_tag="ATU_RS26255"
                     /old_locus_tag="AGR_pAT_731"
                     /old_locus_tag="Atu5497"
     CDS             487132..488121
                     /locus_tag="ATU_RS26255"
                     /old_locus_tag="AGR_pAT_731"
                     /old_locus_tag="Atu5497"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XdhC family protein"
                     /protein_id="WP_010974720.1"
                     /translation="MTQSADIIRHNGGAPRWLPRNADIPTVAVPQKAFSTDTACDILS
                     FAIANIKAGLQVGLCTLVEIRGGSSRPLGAHMAVAQDGRYCGYVSGGCTEAAVAAEAL
                     QAMKSGHDRFVLLGEGSPFFDIVLPCGGGITVAIHLLKDVDPLCSVNMLVDGRRSATL
                     CYSPGLEELSLGSPGARTGWDGDIFLTSYRPKPRVIFSGRSLEVETAVNVAKAGGYEV
                     IFFDHTAGDSFDSSLIDADTAVALLLHDLDLEMPILGAALVATPFYIGALGSSRTHEK
                     RVERLRQIGHSEEAIARIKAPIGLFGRARDAQSLAFSVVADIAASRQSCVMHS"
     gene            488249..488782
                     /locus_tag="ATU_RS26260"
                     /old_locus_tag="AGR_pAT_732"
                     /old_locus_tag="Atu5498"
     CDS             488249..488782
                     /locus_tag="ATU_RS26260"
                     /old_locus_tag="AGR_pAT_732"
                     /old_locus_tag="Atu5498"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2Fe-2S iron-sulfur cluster binding
                     domain-containing protein"
                     /protein_id="WP_010974721.1"
                     /translation="MQFTINGTAVEVEADIRTSLLDLMRNYLGFTGTKKGCDQGACGA
                     CTVLVDGERINSCLALAVQYQGRSITTVEGLAANGNLHPLQKAFIEHDGFQCGYCTPG
                     QLCSAIGMAGEIERNIPSVVTADLSSNSITVDDTEIRERMSGNLCRCGAYNGIVEAIS
                     DTLVQQTAVPSEERARA"
     gene            488779..489768
                     /locus_tag="ATU_RS26265"
                     /old_locus_tag="AGR_pAT_735"
                     /old_locus_tag="Atu5499"
     CDS             488779..489768
                     /locus_tag="ATU_RS26265"
                     /old_locus_tag="AGR_pAT_735"
                     /old_locus_tag="Atu5499"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010218095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine dehydrogenase family protein subunit M"
                     /protein_id="WP_010974722.1"
                     /translation="MNIFSYHQPSDTASAIALKQAGPTAKYLAGGTNLVDLMRETVER
                     PETLVDVTHLSSIIERRTDGSLLVGAGVKNTALAAHDAVRAQFPLLSRAILAGASAQI
                     RNVATVGGNILQRTRCRYFYDNAARCNKRQPNSGCDALEGFNRYHAILGASESCVATH
                     PSDMCVALVALDASVHLQGPAGTRSLPLRDLHRLPGHTPEIETELDTDDLITAVEIPS
                     LPFAGRSTYRKVRDRASYAFALVSVAAALDVDDAGNVKDVRLALGGVAHKPWRALKAE
                     SRLKGQQANAESFRAAAEAELADAIGLQDNAFKIELAKRTIVAVLEELKGESA"
     gene            489765..492068
                     /locus_tag="ATU_RS26270"
                     /old_locus_tag="AGR_pAT_739"
                     /old_locus_tag="Atu5500"
     CDS             489765..492068
                     /locus_tag="ATU_RS26270"
                     /old_locus_tag="AGR_pAT_739"
                     /old_locus_tag="Atu5500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine dehydrogenase family protein
                     molybdopterin-binding subunit"
                     /protein_id="WP_010974723.1"
                     /translation="MSTDSQTLPEAGKLGRWQPAVTSDPLLRKHGALGQGISRIEGPM
                     KVQGKTRFAAEFPYDNISYAALAFSTVARGRVIDLNVSAAEAAPGVILVMTHKNAPRM
                     KAPSLMMSSPTAAGASNLPVMQSDEIHWNGQPIALVLAETQEQADHAASLVTAKYELL
                     PAVTSFDDAKKSPRQLDNLLGQPPFIDIGDAETALANAEVKVDLVYRTPRHNHNAIEL
                     HAATVVWKDDELRVHDASQLLDLTTGQLADIFGLDVSKVHVTSPYVGGGFGGKCFWDH
                     QILACAAARLAGRPVRIMLSREGVFRIIGGRTVTEQRVALGAKADGTLDALIHTGTAA
                     MTLHNSCPEQFTFPARHLYAAKTFHIGQDVADMDMLANTFMRAPGESVGTFALECALD
                     ELAEKLGLDPIELRRRIEPEKDPTTGKPFSSRYLIEAYEKGAEQFGWSKRSQTPRQKR
                     EGEWLIGMGCATATYPYHRFPGGAVRIKLTVDGRVTVSTAVHDMGMGTATAQMQHLAA
                     RLGLPLDHVTFEYGDSKLPRGVIAGGSTQTASIGGAVIAATEVLVEELIKLSGNDSPL
                     AGLSLLEVEARDGGLSHISDNSLFESYQSILRRAGREELVCEAEAPAPAEMEAFSMHS
                     YGAQFCEVHVSARTGETRVSRFLGSFDAGQILNSKMATSQFKGGIIMGIGLALTEETN
                     FDERTGRIVNASLADYHVPVQMDVPAIEILYTNKPDPQAPMGARGIGEIGITGVGAAV
                     ANAVYNATGVRVRDLPITLDKLTGGLD"
     gene            complement(492412..493077)
                     /locus_tag="ATU_RS26275"
                     /old_locus_tag="AGR_pAT_742"
                     /old_locus_tag="Atu5501"
     CDS             complement(492412..493077)
                     /locus_tag="ATU_RS26275"
                     /old_locus_tag="AGR_pAT_742"
                     /old_locus_tag="Atu5501"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NTP transferase domain-containing protein"
                     /protein_id="WP_035258206.1"
                     /translation="MMKIETRPSPQDKAEGNRRPVTVAAIILAAGKASRMGDGGAHKL
                     LAEFDGKPLVRRSAEIALTADAASVIVVTGHRRSEIEAALLGLGVTTTNNPDYASGIA
                     SSLIAGFSAPAACDADGVLVMLADMPGVTIGDLDTLISAFRMASGRAIVRAVSRGKRG
                     NPVILPRSLNGAVMRLEGDVGARQIIETSGLRIIDVEIGDSAHLDVDTPEAVVAAGGI
                     LRT"
     gene            complement(493189..493944)
                     /locus_tag="ATU_RS26280"
                     /old_locus_tag="AGR_pAT_743"
                     /old_locus_tag="Atu5502"
     CDS             complement(493189..493944)
                     /locus_tag="ATU_RS26280"
                     /old_locus_tag="AGR_pAT_743"
                     /old_locus_tag="Atu5502"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974725.1"
                     /translation="MIIKTIAATLTVIATTTWCATSSNAREGIVRVAVYRGPASCEDC
                     SETMRKSIMALGPEYSVDYVGAEEKIDISDETLSKFDIYVQPGGGQDIPAAFESLGEQ
                     RVEAIRRFVEAGGGFFGSCMGAYLASGSGIGLIDDELESEVGRPGFPVSSIISTAVST
                     SWNGEKQTVFFQDGPYMSEPKDIRGFKKIATYQNGDIAAARYHFGNGIVVLTGPHPEA
                     GGSWFHEAGIPIDKMPDHRVLRSVMDEFRSEPR"
     gene            complement(494054..495511)
                     /locus_tag="ATU_RS26285"
                     /old_locus_tag="AGR_pAT_745"
                     /old_locus_tag="Atu5503"
     CDS             complement(494054..495511)
                     /locus_tag="ATU_RS26285"
                     /old_locus_tag="AGR_pAT_745"
                     /old_locus_tag="Atu5503"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974726.1"
                     /translation="MPRSKLKLVSLTPLFAALAASPLVQQTVAATAIVSLSMGQAVAG
                     SPVRMNAPALLGDMRRSLAEIAFSFSEAKGDSKRRSGVAVLAALTEATQAVQSLETAI
                     AAHDASRISRATKALSHAVGNLQTRYSLSSAKCDAVTRALQRFNAAWAEYSSRFVLAK
                     HKASAANATASDVQALRRKVADLSYRMQQLEDDVADNAALRGEVIRMRREIAITQSTP
                     ANAYDYQRLSFTLTVLSGSFAALSLTTREYYPSYYVSVAPFESYRSIDTYWDGYYDGY
                     YQGVADSYYSEPMVISSPVMTESRTETYQNVTYETIYSVTNETTNIYQTMPEEDLSDV
                     AVVPVPQGVNFSVEDISANQKSGSPEVDEFSNTGLPASEAASGTMPEVLPESNSTDQA
                     PDVPDDQDEPPPAIPSPLEHHSNDGNAGTFDDTAGSVSPDHDDKPWAPEDRLSRDHST
                     PDTLPSSENSDEPRAGMRVQEDKASEEEPVMKATP"
     gene            495835..496290
                     /locus_tag="ATU_RS26290"
                     /old_locus_tag="AGR_pAT_746"
                     /old_locus_tag="Atu5504"
     CDS             495835..496290
                     /locus_tag="ATU_RS26290"
                     /old_locus_tag="AGR_pAT_746"
                     /old_locus_tag="Atu5504"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="PepSY domain-containing protein"
                     /protein_id="WP_162180346.1"
                     /translation="MKPLSPKRYVRYSVVLALMLSAAFHARAYAEDDTDGGAESETSS
                     QTESDDGVAEGVYNGSDAAGSMRGFSNDIEDDEQQDRGGLNSLQGEHILSLDSITAKT
                     QALTDGRILDAELKPRHDGLRYELKVLENDDRLRRYSFDAHDGRLIGVK"
     gene            496294..496959
                     /locus_tag="ATU_RS26295"
                     /old_locus_tag="AGR_pAT_747"
                     /old_locus_tag="Atu5505"
     CDS             496294..496959
                     /locus_tag="ATU_RS26295"
                     /old_locus_tag="AGR_pAT_747"
                     /old_locus_tag="Atu5505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_006313598.1"
                     /translation="MRVLVAEDDKRIAQSLSVALAAAGFVTELSANGEDAWFRGETEA
                     FDAVILDLGLPGLDGLTILKRWRRDGRATPVLILTARGDWSERVEGIESGADDYVVKP
                     FRMEEVVARVRALVRRAAGFSSPIITIGQYTLDTRLKQVSMGGLPVALSPQEYRLLAF
                     MAHRPGKVVSQLEITEHLYAQDDDRLSNAVEVLVGRLRRRLGADIIITRRGLGYLLGG
                     HAA"
     gene            496983..498314
                     /locus_tag="ATU_RS26300"
                     /old_locus_tag="AGR_pAT_749"
                     /old_locus_tag="Atu5506"
     CDS             496983..498314
                     /locus_tag="ATU_RS26300"
                     /old_locus_tag="AGR_pAT_749"
                     /old_locus_tag="Atu5506"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAMP domain-containing histidine kinase"
                     /protein_id="WP_162180350.1"
                     /translation="MIVAGAVWIFFALILAGSAISYMFIENVEKGVRSDLTATLSRLI
                     AIIDLDAQQDRPRLTRQLPDPRYETPFSGVYWQITDVDNQQALRSRSLWDKNLQTGAK
                     NTDGEHFASVQGPAGQSLLALSLTTTFKARNLERHYQIVVAQDRSILDETIRKFAWEM
                     AAALTVLGASLVFAALFQVRFGLLPFRQLKSEVETIRKGAASSLGSEYPTEVYPLVAE
                     VNELLKLQETSIEFARARASDLAHGLKTPLSVLATIAYELENRGETSAASVLFDLSDE
                     MNSRIDYQLKLSKLRQRARLHSLRAPLGSIVNRAVAVLKKTKEGEQLHWQIEMTQNID
                     VDLDENDLVELVGILLENAAKWATSKVHVSASMQDYVAELRVHDDGPGIGQSQLELIG
                     KRGQRFDESVGGSGLGLAIAREILAINHGSITFESGQGMGTLVIVRLPLPV"
     gene            498561..500318
                     /gene="ggt"
                     /locus_tag="ATU_RS26305"
                     /old_locus_tag="AGR_pAT_750"
                     /old_locus_tag="Atu5507"
     CDS             498561..500318
                     /gene="ggt"
                     /locus_tag="ATU_RS26305"
                     /old_locus_tag="AGR_pAT_750"
                     /old_locus_tag="Atu5507"
                     /EC_number="2.3.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008548309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltransferase"
                     /protein_id="WP_010974729.1"
                     /translation="MKMRFLSEAFLALMLSTAITSAQQASDTVAPEKATAVATARRVE
                     SRSFMVAAANPLAAEAGRDVIAAGGNAIDAMVAVQTVLGLVEPQSSGLGGGAFLVYYH
                     AKNGKLTTLDGRETAPMDATPKLFLDDKGQPLKFMDAVVGGRSVGTPGTVRLLEEAHK
                     RYGKADWASLLKPAETLATEGFKVSPRLASLIASEGDRLKKYPEARSYFFDTSGAALQ
                     TGALLKNPAYAETLATLAKSGADAFYKGRIAEAVVKTVREATDNPGVLSLSDLSNYRV
                     IEREPVCFIYRALDVCGMGPPSSGGIAIGQMLGMAESFDLKSLGPKNVESWRLIGDAQ
                     RLAFADRERYVADTDFVPLPIKGLLDKTYLGERAKLLDGDRALAKDAVKAGEPEWDHA
                     LLFGRDAALELPSTSHFVIVDKEGNVVSMTTTIESGFGSRLMTNGFLLNNELTDFSFK
                     THDGGLPIANRVEPGKRPRSSMAPTIVMKDGKPLLAIGSPGGSQIIGYVAQALIAYID
                     WGMPVEAIVAQPHLINRFGTYDIEAGTSAEDLVEPLKALGYEVKPGELNSGLHAIEIT
                     AQGLAGSADPRREGAVMGE"
     gene            500374..501072
                     /locus_tag="ATU_RS26310"
                     /old_locus_tag="AGR_pAT_752"
                     /old_locus_tag="Atu5508"
     CDS             500374..501072
                     /locus_tag="ATU_RS26310"
                     /old_locus_tag="AGR_pAT_752"
                     /old_locus_tag="Atu5508"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012222481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_010974730.1"
                     /translation="MNTFDLYYWPVPFRGQLIRGILAHCGCSWDEHDVDAIEGLMDCG
                     AEKQPVAFMGPPVLIDRERNFAISQMPAIAIYLGERLDILPATVEGRTLSAKIVNDAN
                     DVLDELTLNGGREMWTPEKWQEFVPRLQKWIRIFADTGARNGLSAASGFMLGTEKIGV
                     ADIVTAILWTTVADRFPAIKGIIEDTSPIIWGLSRRVVATAPLAALNSKSFEEYGNAY
                     CGGEIEKSLRKVAS"
     gene            complement(501370..503415)
                     /locus_tag="ATU_RS26315"
                     /old_locus_tag="AGR_pAT_755"
                     /old_locus_tag="Atu5509"
     CDS             complement(501370..503415)
                     /locus_tag="ATU_RS26315"
                     /old_locus_tag="AGR_pAT_755"
                     /old_locus_tag="Atu5509"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_010974731.1"
                     /translation="MAAIPERDIFGLIHTPIGRDAPIAAALLHEAGLRANIVPTLDAL
                     VADLNENVAFAVMTEEALRSVDLRPLVSWIETQPSWSDLPIIILTARGGGPERNPAAA
                     RLSEVLGNVSFVERPFHPTTFISVARSAMRARRRQYEASARMEALDEGERRLQTALEA
                     GRLGAWELNLSTNVLTTSATCRGIFGRSPNDGFTYEDLLQAIHPDDAARMKDALRNTI
                     ETGADYSITYRIVWPDGSIHGAEIRAQLHRDRTGRPIRLVGVSADITERMQSEEQQRH
                     LNETLEERVAERTRELEEAHRLVLAEVSQRERAEEQLRHAQKMEAIGQLTGGVAHDFN
                     NLLMAVLGNLELLRKHLTDDAKATRLIDGALQGAQRGASLTQRLLAFARRQDLQVGPV
                     DLAGLVTNMQDLLQRSVGSRIAIEVVAPERLPAVSADANQVELALLNLAVNARDAMPD
                     GGTIKIGLKEAVQPTVSDLLAPGRYVVLSVIDQGQGMDAATLQKAIEPFFSTKELGKG
                     TGLGLSMVHGLALQLNGQLKLASAVGEGTTADLWIPVSTSQSLEKEQDVAVADARNDA
                     GPKRILLVDDDALIAMSSADMLTDLGHEVVEAHSGKEALSLIDGGATFDLVITDYSMP
                     GMTGAELAKAVRDRLPSLPIVLASGYVDFPSGVELEVARLSKPYSQDELALMLSKIS"
     gene            complement(503399..504907)
                     /locus_tag="ATU_RS26320"
                     /old_locus_tag="AGR_pAT_757"
                     /old_locus_tag="Atu5510"
     CDS             complement(503399..504907)
                     /locus_tag="ATU_RS26320"
                     /old_locus_tag="AGR_pAT_757"
                     /old_locus_tag="Atu5510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_010974732.1"
                     /translation="MTDNSVAKAKTGVEGLDDILSGGLSRRHVFLLEGAPGSGKTTIA
                     LQFLLEGATIGERCLYITLSETEEELRDSASSHGKDIGDQVEIFELVPPESLLDADQQ
                     QSLLYSSDLELGETTKLIFEAFERVKPHRVVIDSLSEIRLLAQSSLRYRRQILALKHF
                     FSRSDATVLLLDDMTSDAMDKTVHSVVHGVIHLEQLAPDYGSERRRLRVLKYRGQAFR
                     GGYHDFTIKTGGVEVFPRLRALEHRVAFERTLVASGISEFDDLLGGGVARGSSTLLIG
                     PAGTGKSLFALQFVEAAVSRGERAAIFVFDEELGLLFDRTKEMGLDLEAMRDKNLLHI
                     EQLDAAELSPGEFSQRVRDKVASFDAKTVVIDSINGYQAAMPEENALILHMHELLQYL
                     NRQGANTFITVAQHGLVGDMKSPVDVTYLADTVILLRYFEAEARVRRAISVIKKRTGR
                     HEDTIREYKIGANGLTLGEPLSAFQGILRGVPIFVGNRQPLLQTLDEDGSHS"
     gene            complement(505230..505505)
                     /locus_tag="ATU_RS26325"
                     /old_locus_tag="AGR_pAT_759"
                     /old_locus_tag="Atu5511"
     CDS             complement(505230..505505)
                     /locus_tag="ATU_RS26325"
                     /old_locus_tag="AGR_pAT_759"
                     /old_locus_tag="Atu5511"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003588919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006313590.1"
                     /translation="MASDTNELQTINTAWQIAIQEILRMVVRDMYHAGGEAAFSGHIK
                     RIEEAAVDSIYTDLRLRDTDEWTETLVKERASNFVTSLLTSFTYDRA"
     gene            complement(505590..505814)
                     /locus_tag="ATU_RS26330"
                     /old_locus_tag="AGR_pAT_760"
                     /old_locus_tag="Atu5512"
     CDS             complement(505590..505814)
                     /locus_tag="ATU_RS26330"
                     /old_locus_tag="AGR_pAT_760"
                     /old_locus_tag="Atu5512"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006313589.1"
                     /translation="MTERYSKSRQQAEIAFSNLQTEFFSKNSAVEELESATQVRDAKT
                     LRLRAARLSKEHAERTSATNALLAKRAKKG"
     gene            complement(505931..506140)
                     /locus_tag="ATU_RS26335"
                     /old_locus_tag="AGR_pAT_762"
                     /old_locus_tag="Atu5513"
     CDS             complement(505931..506140)
                     /locus_tag="ATU_RS26335"
                     /old_locus_tag="AGR_pAT_762"
                     /old_locus_tag="Atu5513"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018066164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="WP_006313588.1"
                     /translation="MTTGTVKWFNSTKGFGFIQPDNGGVDAFVHISAVERAGMRELVE
                     GQKIGFDLERDMKSGKMSACNLQSA"
     gene            506593..507198
                     /locus_tag="ATU_RS26340"
                     /old_locus_tag="AGR_pAT_763"
                     /old_locus_tag="Atu5514"
     CDS             506593..507198
                     /locus_tag="ATU_RS26340"
                     /old_locus_tag="AGR_pAT_763"
                     /old_locus_tag="Atu5514"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018068081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="J domain-containing protein"
                     /protein_id="WP_010974734.1"
                     /translation="MTHDSKIFVGLRSPRKRSPSASESTGPKCQWDGCEKTGVHRAPV
                     GAGAEGLYLMFCLEHVTAYNKGYSFTTAPPNPNVARYQKEATTGARPTWGTRVSEATE
                     TPLPSSVRSGSAKTLNARRADRSGQTKAGAQQRKLKVLEAKAFDTLGLSPDATSSEIR
                     SRYKERLKMHHPDANDGDRNSEDALRASIEAYRILKLNGFC"
     gene            507352..507495
                     /locus_tag="ATU_RS26345"
     CDS             507352..507495
                     /locus_tag="ATU_RS26345"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162180345.1"
                     /translation="MVLKTTADISMYPKAMAASGITYGEIIDRLVEHIAAPSGSHAMN
                     LAR"
     gene            complement(507596..508975)
                     /locus_tag="ATU_RS26350"
                     /old_locus_tag="AGR_pAT_766"
                     /old_locus_tag="Atu5516"
     CDS             complement(507596..508975)
                     /locus_tag="ATU_RS26350"
                     /old_locus_tag="AGR_pAT_766"
                     /old_locus_tag="Atu5516"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019565864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974736.1"
                     /translation="MENPVALNHLSENTVFRKGDVFVLFGELFGRGYATGLLDEARRA
                     GMEIVGITVGRRDENNALRPLNAEELSSAEAQLGGRIINIPLMAGFDLDAPAGGPTPT
                     DLLAKMTLESWEHDKLEWDYVEQCRDIATARFTESLSKVMTVLDGMIPDGRNVFFSHT
                     MAGGIPKAKVFLVIANRIYKGTGTRHMSSQTLIDSDLGKLILQNFDDVSANTFRHLID
                     FSAAIRERVEASGGQVRYTAYGYHGSAVLIDGSYRWQTYTNYTQGYAKMRLESIAEEA
                     WAKGIKATVYNCPEIRTNSSDVFTGIELPLIPLLLALKKENGSEWADEQWQACEQLLV
                     DGLTMKDVFSKIATMQASDVMRPFYDFSAWPMANSQAQADLTIGTSNEITRMHRDGKV
                     MISDLLSGLVVKATGQLIFRESSKPSGPVLWLNHDIVAQRLNASHQHSNSPAPPIAQG
                     MEPSQIEMA"
     gene            complement(509639..511147)
                     /locus_tag="ATU_RS26355"
                     /old_locus_tag="AGR_pAT_769"
                     /old_locus_tag="Atu5518"
     CDS             complement(509639..511147)
                     /locus_tag="ATU_RS26355"
                     /old_locus_tag="AGR_pAT_769"
                     /old_locus_tag="Atu5518"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD/NAD(P)-binding protein"
                     /protein_id="WP_010974738.1"
                     /translation="MSSFVPIASARVTVAVVGGGFTGAAMAVHLVAGKAIPADMSVVV
                     IEPRPELGRGLAYSATDPAHRVNVPAARMTLFPDIPDDFESYLNGVSADDDTELMGHD
                     GSPYPKRSVFGDYVSARIQPFLDDGRIRHWRTKAISVSQRGSRYEIIGSDGTVLIADI
                     VVLAVSHPPPFLPRVLQPFKDDPKLIADVTVADAIDVVERGDHVLIVGNGLTSADVVA
                     SLKRRGHVGQITSISRRGLRSRGHGPAEQGPFGDFLSEPFNSASKLLHHVRHLLREAE
                     QQGMTWHSVVDALRGQGNEIWKNLPVVERRRIARHLRPIWDVHRFRIAPQVEVAVEQA
                     TASGQMDVRAASLSSVVRIDAGYRVMLRPRRGSVNEVLDVDAIVVTTGPAHGGILQSQ
                     ALLRDLEEAGLLQPCPTGLGILVDAKSNPLSASGVSTTSLFVAGPLARGTFGELMGLP
                     QVTEHAIFVAEQIRGSLDEHRISYPPAQVAETYPESDRTTGLQRSKSQTIVP"
     gene            complement(511588..512835)
                     /locus_tag="ATU_RS26360"
                     /old_locus_tag="AGR_pAT_773"
                     /old_locus_tag="Atu5520"
     CDS             complement(511588..512835)
                     /locus_tag="ATU_RS26360"
                     /old_locus_tag="AGR_pAT_773"
                     /old_locus_tag="Atu5520"
                     /EC_number="1.-.-.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018517088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SfnB family sulfur acquisition oxidoreductase"
                     /protein_id="WP_010974740.1"
                     /translation="MTISNVNTKDAVEGVPAVPRPTERAHIIRSDAEAIEVAKIVAAE
                     IAPGAALRDRDRIWPVKELDAFSQSGLWSINVPKKFGGPEVSYATLAKVIEIVSAADS
                     SIGQIAQNHLGVVAAIRTVSDEAQQKLLFAEVLRGTRFGNAFSEFGSKRAADFETKFV
                     DAGDHVIVNGQKFYSSGALLAHLVPIVALDDEGRAWYAIAERDAPGLTVIDDWSSFGQ
                     RTTLSGTVILNNVKVPKTYLVPGYKGYAEPTADGAIFQIIQVAVDTGIARAAIDETVS
                     FVRTKSRAWVDSGVDHAWDDPYTIQAVGDLTLRLHAAQALLEKAGYAIDRAIQNPNAE
                     TVAEAQVVTAEAKILATEIAIAATNKLFELAGTRSTLAEHHLDRHWRNARTHTLHDPV
                     RWKYSILGKYFLNGEKPPLHAWS"
     gene            complement(512862..513641)
                     /locus_tag="ATU_RS26365"
                     /old_locus_tag="AGR_pAT_775"
                     /old_locus_tag="Atu5521"
     CDS             complement(512862..513641)
                     /locus_tag="ATU_RS26365"
                     /old_locus_tag="AGR_pAT_775"
                     /old_locus_tag="Atu5521"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010974741.1"
                     /translation="MTEDNRLLTVEGLHATYNHAITALHGVTLSLGRGEILAILGANG
                     AGKTTTLKAVSNLLPAERGQVVAGHILFDGRAVTHETPARLVRLGLVQVLEGRHCFKA
                     LTVEENLVSGGLGRSASRAEIAVDLEKIYTHFPRLKEKRRVLSGLTSGGEQQMTAIGR
                     ALMSRPRLLVLDEPSMGLAPRVVQDIFRTLKHLNREEGLSILVAEQNSAVALNYADRA
                     VILENGVSVLSGTAAELRARDDVKAFYLGEKPSASAAAYIH"
     gene            complement(513714..515048)
                     /locus_tag="ATU_RS26370"
                     /old_locus_tag="AGR_pAT_777"
                     /old_locus_tag="Atu5522"
     CDS             complement(513714..515048)
                     /locus_tag="ATU_RS26370"
                     /old_locus_tag="AGR_pAT_777"
                     /old_locus_tag="Atu5522"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018517086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_035258212.1"
                     /translation="MTLYTKIKAAAFAAGISLSAIAFPAMADEQHFPLQSYRVGPYAA
                     GGTGFFGGFIDYLNLINVRDGGVNGVKLTWSEAETQYEVERGVEAYERLKSNHGIAAW
                     NPLSVGIAYAMIDRITQDKVPLITINHGRTDSTDGRVFPYVFPLLLNPYSETSGIVNY
                     IASKEGGLEGLKGKKIVVLYHGSPYGKETIPIYDLLAKKYGFDLQQIEVPHPGNEQQS
                     QWLTIRRAKPDYVVLRGWGVMNPVALKTAAKTGFPVDHIIGNVWSNSEEDVIPAGAAA
                     KGYTAITTQASGAEYPVVKEIVKTLYDQGKGNLEDKSRIGSVYHNLGIVNGILNVEAV
                     RIAQDKFGKRTLTGDEVRWGFEHLQLDPARVEALGARDLFHSINVTWDNHEGNGYVTF
                     QQWDGKKWNVVSDWIAPDWALLRPIIEKSSEAYAAEKGIKLRTSEDAASVTN"
     gene            complement(515117..516211)
                     /locus_tag="ATU_RS26375"
                     /old_locus_tag="AGR_pAT_778"
                     /old_locus_tag="Atu5523"
     CDS             complement(515117..516211)
                     /locus_tag="ATU_RS26375"
                     /old_locus_tag="AGR_pAT_778"
                     /old_locus_tag="Atu5523"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_010974743.1"
                     /translation="MSAIAADLSLPCSLPRRAGTVVVLAIAYLVVPFVGTSYLFEAIL
                     LPFLALSLAGVGLNLLTGYAGQVSLGSAAFMAVGAFAAYNFDLRVDGLPLTVSIVLAG
                     LSAAIIGIVFGLPSLRLRGFYLAVSTLAAQFFVQWALTKFSWLSNESASGVIDAPALS
                     LAGISFEGPVGRYLFALTTVTALTFLAYRLVSSQTGRNFIAVRDNETAARIIGVPVLR
                     TKLLAFAISSFIIGVAGVIWAFAYLRTVEPAGFNLDRSFQILFIVIIGGLASIRGAFF
                     GAALIVVFPLVLSRLGSLLLGDVFDSGVLDMTQRIVIGALIILFLILEPDGLVSLWDR
                     LKSRIAAAIRRARTPRSPAPKAKGLPTRKA"
     gene            complement(516213..517109)
                     /locus_tag="ATU_RS26380"
                     /old_locus_tag="AGR_pAT_780"
                     /old_locus_tag="Atu5524"
     CDS             complement(516213..517109)
                     /locus_tag="ATU_RS26380"
                     /old_locus_tag="AGR_pAT_780"
                     /old_locus_tag="Atu5524"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003591660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_010974744.1"
                     /translation="MAEFDWLFFIEVLIGGLLSGVMYSLVAIGFVLIYKTSGVLNFSQ
                     GALLLFAALTFVSLVERGVPFAPAFAITFAIMVVIGIAIERVVLRPLTNKPPITLFMA
                     TLGLSYIIEGAAQLLWGTQVHGLDLGIEDIPFDVGGVFISQFDIFAALVAAGMVAALS
                     AFFRYTRIGLGFRAVADDQFAALAVGLRLPWIWASVWAAAGLVALVAGLLWGARVGVQ
                     FSLSLVVLKALPVLVLGGFDSILGAIIGGLLVGASEKLAEVYIGEYFGGGIEGWFAYV
                     VALAFLLIRPSGLFGQKFVERV"
     gene            complement(517109..518026)
                     /locus_tag="ATU_RS26385"
                     /old_locus_tag="AGR_pAT_781"
                     /old_locus_tag="Atu5525"
     CDS             complement(517109..518026)
                     /locus_tag="ATU_RS26385"
                     /old_locus_tag="AGR_pAT_781"
                     /old_locus_tag="Atu5525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010974745.1"
                     /translation="MSASNFLLASLGAEVAVPADIREYVALHGERVEHDRRAPHQAEG
                     LALELRGIDLSFGGIAALQDIDLAVRHGEIRAIIGPNGAGKSSLINVISGVYRPDRGY
                     VAIDGTAYRPVPTQKLARLGVARTFQNLALFKGLSVLDNVAAGRAYVSRANFLSQVAG
                     LPLARREQADARERAGRILEFLHLTPYVDRLAGTLPYGLQKRVELARALAAEPRILLL
                     DEPMAGMTATEKNELADYVRLARDEYAITVVLIEHDVGVVMGLSDRIAVLDYGRKIAD
                     GTPAEIASDQRVIDAYLGIAPENEDGEGI"
     gene            complement(518135..519238)
                     /gene="sfnG"
                     /locus_tag="ATU_RS26390"
                     /old_locus_tag="AGR_pAT_784"
                     /old_locus_tag="Atu5526"
     CDS             complement(518135..519238)
                     /gene="sfnG"
                     /locus_tag="ATU_RS26390"
                     /old_locus_tag="AGR_pAT_784"
                     /old_locus_tag="Atu5526"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016736901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyl sulfone monooxygenase SfnG"
                     /protein_id="WP_006313574.1"
                     /translation="MTEHHAEPVKFAYWVPNVSGGLVISNIEQRTSWTIDYNRKLAQI
                     AEASGFDYALSQIRFTAGYGAEFQHESVSFSHALLESTTTLKVIAAILPGPWNPALAA
                     KQIATINHLTNGRVAINVVSGWFRGEFHAIGEPWLDHDERYRRSEEFIRALRGIWTEE
                     NFTFRGDFYRFNNYSLKPKPIDPQPEIFQGGSSRAARDMAARVSDWYFTNGNTPEEIA
                     KQVDDIRAKAKENNHSVKVGVNAFAIVRETEEEARAVLAEIIEKANPEAVNAFGHEVK
                     NAGKSSPEGEGNWAKSSFEDLVQYNDGFRSNLIGTPLQVAERIVNLKRAGADLILLGF
                     LHFQEEVEYFGKHVIPLVRALEQAEVGAAIAAE"
     gene            complement(519261..519851)
                     /gene="msuE"
                     /locus_tag="ATU_RS26395"
                     /old_locus_tag="AGR_pAT_786"
                     /old_locus_tag="Atu5527"
     CDS             complement(519261..519851)
                     /gene="msuE"
                     /locus_tag="ATU_RS26395"
                     /old_locus_tag="AGR_pAT_786"
                     /old_locus_tag="Atu5527"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019567190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="WP_035258216.1"
                     /translation="MNVLGISGSVKQPSRTARVVSDILASIERRASVSVDTIDLAVAA
                     PILFRALRADQLDEAGRRIIDAVEIADVLVVGSPVYRASYTGALKHLFDLVDFRALQG
                     KRVVLAATGGTPLHGLMLEHQFRPLFGFFGAVTVPTTVYAVEADFTGYTLSNPEVEAR
                     IERAVAELIDLLPARDVAAADHHSALRVVSNEAVAN"
     gene            complement(520603..522423)
                     /locus_tag="ATU_RS26400"
                     /old_locus_tag="AGR_pAT_788"
                     /old_locus_tag="Atu5528"
     CDS             complement(520603..522423)
                     /locus_tag="ATU_RS26400"
                     /old_locus_tag="AGR_pAT_788"
                     /old_locus_tag="Atu5528"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006699857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain S-box protein"
                     /protein_id="WP_162180351.1"
                     /translation="MEILILNNVNEPANAVPVASLLDVTDWASGPLGPRSEWPACLHA
                     AIGIMLPSQAQIVMFWGQEFVALYNDIYAPTIGNKHPHAFGRPAREYWNELWDDLEPL
                     LKRVLDKGETIAAKDRPFYIERHGYPETVYFDISYSPVTDQDGIVRGVFCIVNETTER
                     VKADAALRESEERLRAIFAQSAVGIALGDLTGKLISVNDHFCQIVGRRRDELIGIQMQ
                     DITFAEDLPENQRLFKHMVETGESFEIEKRYVRGDGSLVWVLNSVSAIRDDQGNMSQA
                     VAISADIGERRHAQEVERHLASMIASSNDAILGIDLDMTITSWNAAAEKLYGYSEDEV
                     VGRTVLMLVPDDRQEEEPTILRQIKAGRIVEPYETQRLRKDGRLVEVLLSVSPIRDVN
                     GRVIGASKTAHDITARKDADRLRSILVNELHHRVKNILATVTAIARQTIGRDKANHED
                     MEAFTSRLGSLSRAQDLLVHADWQHADLRAVLQQALSPYPAESFQISGPGVSLPPRAV
                     VSLSLALHELATNAAKYGALSVPEGQVSISWQRQGTDGERLRVVWEERGGPEVMSPQR
                     KGFGSTLVERLLSAELNGETKLFYEKNGVICVIEAEINHV"
     gene            522963..524114
                     /locus_tag="ATU_RS26405"
                     /old_locus_tag="AGR_pAT_789"
                     /old_locus_tag="Atu5529"
     CDS             522963..524114
                     /locus_tag="ATU_RS26405"
                     /old_locus_tag="AGR_pAT_789"
                     /old_locus_tag="Atu5529"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="WP_010974748.1"
                     /translation="MMNSESWRVGVLFSETGVTGAVEKTQRFATLLAIEEINAAGGVL
                     GRAIEPVAYDPQSTPNLYKELAMKLCDEDRVRVVFGCHMSSTRKAALPVIEARDALLF
                     YPTLYEGFEYSRHCIYTGAAPNQNSVQLVDFLTTHYGKRVFLVGSNYVYPYESNRTIS
                     DLFLQVGGQVLDEMYVPLNLKTEDIAKIIRHIGAAQPDVIYSTIVGDGIIPFYTAFKE
                     AGFDAATMPIASQSTSEADVIRMRPEVAEGHITAAPFFASLDTPRAHAFVSAYQKRYG
                     KQMLPTAPAEAAYFQVYLYAAALQRAGNDGLEQLLPALYEVEYDAPQGAVKIDRLTNH
                     THLWPRVARVNAHGGYDIVYDPSLRVAPDPFMREYRPDLTQNFHHRVQV"
     gene            524127..524735
                     /locus_tag="ATU_RS26410"
                     /old_locus_tag="AGR_pAT_790"
                     /old_locus_tag="Atu5530"
     CDS             524127..524735
                     /locus_tag="ATU_RS26410"
                     /old_locus_tag="AGR_pAT_790"
                     /old_locus_tag="Atu5530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011649210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ANTAR domain-containing response regulator"
                     /protein_id="WP_006313570.1"
                     /translation="MSFALLRDLRDLKVLVIHPRTSEGEFLVDHLRRIGCTVSCLWPV
                     PAELPHGTDVVFLAMEDEARPEIERLLKCLPNPAPTMLAIVGYENPSTLQIVLESGAL
                     AIVERPIKPFGLLTNLAIARSLWLERQKLVKEARKYKRKVLGDQKLARAKAILMANRG
                     TSENEAYREMREQAMARRVPIDEIANSIISAEQLLRPPQKHD"
     gene            524983..526233
                     /locus_tag="ATU_RS26415"
                     /old_locus_tag="AGR_pAT_792"
                     /old_locus_tag="Atu5531"
     CDS             524983..526233
                     /locus_tag="ATU_RS26415"
                     /old_locus_tag="AGR_pAT_792"
                     /old_locus_tag="Atu5531"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018495028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="WP_010974749.1"
                     /translation="MVFNRREFLKTAATASAALALPALGGRAFAADAIKVGALYSQTG
                     GLSVAEKLLANGVMMAVAEINAAGGVLGRQVEVVVEDGASDPKTFSEKASKLILKDKI
                     STVFGCHTSASRKAVLPIFERRGAMLFYQTHYEGFECSRNVVYSGAVPNQQLSNYIPW
                     IVEKLGKKKFFIVGSNYVYPREMAKVSKKLIEAAGAEWVADEYLELGHSEWAVMVSKI
                     KESGADVVLSNVVGDSIIAFYREFKNQGLSQEDIPICATVTSEIEIAAMGAEYAAGSY
                     TSFPYFMSIETPENKSFIERFRTFVNDPKAVTYHSLEAAYFQVFLWKQAVEKSGDLSA
                     DAIRAGIRGQTYDAPGGKVTTDPDNLHCWLTPRIGQWQPDGQSKVVNAYPAPIKPLPY
                     SAYGETESNLFCTTNGLDAAKLKG"
     gene            526388..527281
                     /gene="urtB"
                     /locus_tag="ATU_RS26420"
                     /old_locus_tag="AGR_pAT_793"
                     /old_locus_tag="Atu5532"
     CDS             526388..527281
                     /gene="urtB"
                     /locus_tag="ATU_RS26420"
                     /old_locus_tag="AGR_pAT_793"
                     /old_locus_tag="Atu5532"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012042177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter permease subunit UrtB"
                     /protein_id="WP_035215689.1"
                     /translation="MLDILFIGLSLGSILLLVALGLAITYGAMGVINMAHGEMVMIGA
                     YVAVLSGIWLKTSLLLAIPLAFVVTALLGLIIERVVVRRLYGRLLDTLLATWGIAILL
                     QQAVRLELGLTFLGIHIEGLGAGLQNVAVPSYLQGTFRFAGADINAYRTFIIAVTAAL
                     TLATWFILYRTTAGMQVRAIIRNPKMAAACGIDVKRINALTFAFGSGLAGVAGVMMSG
                     FKTVFPDMGTTMVVDGFMVVVTGGVGSLFGTALSSGLLGEINALVAIGTNDILARAVV
                     FGVVILVILVKPSGLFSFKGR"
     gene            527283..528422
                     /gene="urtC"
                     /locus_tag="ATU_RS26425"
                     /old_locus_tag="AGR_pAT_795"
                     /old_locus_tag="Atu5533"
     CDS             527283..528422
                     /gene="urtC"
                     /locus_tag="ATU_RS26425"
                     /old_locus_tag="AGR_pAT_795"
                     /old_locus_tag="Atu5533"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018444504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter permease subunit UrtC"
                     /protein_id="WP_010974751.1"
                     /translation="MSNERKFQIAAYVLFIAIIFAAPVFGDEFWLNRISKYLVYGMLG
                     VAIALTWGYAGILNLGQGLFFGLGAYMLAMSLKLSSLTSLQQGSDKPVPDFMLWNAEP
                     GAPTELCCINKGSFLWLPFQSQSVGLVLGVLLPVLIAGALGMLVFRKRISGVFVSIIT
                     LALVLLVRLVVVDAQPVTNGFNGLTDLGWLMVGGIEFDPYSRATYYLCAACLSLTLIG
                     ARLVVETRAGMILQAIRDDQVRARYLGFDVSLYQVFFFVISAGIAGVAGMLYVVVAEF
                     ASPTFMDLSFSVTMVVWAAVGGRSSLLGACIGAILINMIEAEVSETEALVEAWKAIIG
                     LIFVLVVLFMPRGLGGVAHDVLRTFTRRVKPAVAPSALQQQSEAL"
     gene            528424..529173
                     /gene="urtD"
                     /locus_tag="ATU_RS26430"
                     /old_locus_tag="AGR_pAT_797"
                     /old_locus_tag="Atu5534"
     CDS             528424..529173
                     /gene="urtD"
                     /locus_tag="ATU_RS26430"
                     /old_locus_tag="AGR_pAT_797"
                     /old_locus_tag="Atu5534"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013637550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter ATP-binding protein UrtD"
                     /protein_id="WP_010974752.1"
                     /translation="MSAIALTVDGLSVEFGGFKAVSNVSITVRDGELRVLLGANGAGK
                     TTLMDLISGKTRSTQGKVFVYDTDITNWPEHNIARAGIGRKFQIPSIFRDLTVRQNLE
                     VANCRNPSVFANLRFGFSPAEANRVDEVLALTGLEAEKDVTAAYLSHGQTQWLELGML
                     IVQDPKVILLDEPTAGMTQAETRKTAQIIKNLKGRHTILVVEHDMGFVREIAEYITVL
                     HLGEVLAEGSVGDIEHNPKVREAYLGSKGIS"
     gene            529173..529868
                     /gene="urtE"
                     /locus_tag="ATU_RS26435"
                     /old_locus_tag="AGR_pAT_798"
                     /old_locus_tag="Atu5535"
     CDS             529173..529868
                     /gene="urtE"
                     /locus_tag="ATU_RS26435"
                     /old_locus_tag="AGR_pAT_798"
                     /old_locus_tag="Atu5535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter ATP-binding subunit UrtE"
                     /protein_id="WP_010974753.1"
                     /translation="MLTLKNVHSYYGRSHILHGVTLDVPTGKVTSILGRNSTGKTTLL
                     KTLMALTDGMTGEMHLQGQDISSSPTHMRARAGIAYVPQGREIIPDFSIRENILMGAF
                     ARADRKREIPALVPELFPYLMANLDRPGGVLSGGQQQQLAIARALAADPKVLLLDEPN
                     EGIQPSIVEEIEKIIIRLNREIGMTIVLVEQNVAFARHASHHFAMLEKGGVVAAGAID
                     ALSDTLVHRHMAV"
     gene            529894..531645
                     /locus_tag="ATU_RS26440"
                     /old_locus_tag="AGR_pAT_799"
                     /old_locus_tag="Atu5536"
     CDS             529894..531645
                     /locus_tag="ATU_RS26440"
                     /old_locus_tag="AGR_pAT_799"
                     /old_locus_tag="Atu5536"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_006313564.1"
                     /translation="MGTIMTPTQSYTAAAIQFEPTMFEKARNISRLTALCEEAAQAGA
                     RLIVTPEMGTTGYCWFDRAEVKPFVETIPGPTTDVFHAIARQHRCYIVVGMPEVDPES
                     DLYYNTAVLIGPDGVIGRHRKSHPYIAEPKWAANGDIVHEVFETEIGRISMLVCMDLH
                     FFETARLEALAGADIICHISNWLQERTPAPYWINRAFENACYVIESNRWGLERTVQFS
                     GGSCLIEPDGTVVASIDTGDGIAYGKVDLARARRREVLSEPVFKSRRPELYMNMMTNS
                     FTWNPGDYFRLYGYQPIPRGRTSRAAVAQFAPTSVIADNIAHITRLATEAKATTAPDI
                     LVFPELSLTGLDDPHTRAEPLSGPAVSVFVRLAMKLGLYLVAGFAEADGDRIYNSAVL
                     AGPEGLVGNYRKTHLGVADSWATAGDDWKIYDLAIGRVGLAIGHDALYPEAIRSLSLM
                     GCDLVACPSAIAGNFTGSHAGTKIPHNYPIPKGADPFHWHALRVRGGENNVYFAFANV
                     LDAARGYQGKSAVFGPDSFAFPRQESAILDEEGIAAAAVDTTNLDTPYPTNIVRRKDL
                     VVMRQPHHYQPLVKWHQ"
     gene            complement(531985..>532137)
                     /locus_tag="ATU_RS26445"
                     /pseudo
     CDS             complement(531985..>532137)
                     /locus_tag="ATU_RS26445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008532204.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
     gene            complement(532146..533507)
                     /locus_tag="ATU_RS26450"
                     /old_locus_tag="AGR_pAT_803"
                     /old_locus_tag="Atu5537"
     CDS             complement(532146..533507)
                     /locus_tag="ATU_RS26450"
                     /old_locus_tag="AGR_pAT_803"
                     /old_locus_tag="Atu5537"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-containing oxidoreductase"
                     /protein_id="WP_010974755.1"
                     /translation="MKEYDAIFIGAGQAGPFLAARMAAMGRKVVLIERKFLGGTCVNA
                     GCMPTKTLVASAKTAQVARRASEFGVRIDGEPVVDMKAVAARARKVTLDARSGLASWF
                     DSLETMDVVYGHARFVGAKVVSVGGSLYTAPQIFINVGARPHIPDVPGLANVPYLTST
                     SVIALEELPKHLVVLGGSYIGLEFAQMYRRFDAQVTVIERGQYLASREDEDISQAIAD
                     ILTRDGIKVLLSHKIVSVTTDSAEITVRTDQGDVRGSHVLVAVGRQPNTDDLGLDQAG
                     VETDRRGYITVDERLQTNVEGIWALGDCNGRGAFTHTSYNDFEIAAANLLDGGDRKVS
                     DRILGYGLYIDPPLGRVGMTERQAKEAGHRIKVATRPMNRVGRAVEKGETLGLMKLVT
                     EADTDRVLGAAFLGVGGDEAVYGVLDAMNLGATTEKLRWAVPIHPTVGELVPTLISDL
                     KET"
     gene            complement(533504..533965)
                     /locus_tag="ATU_RS26455"
                     /old_locus_tag="AGR_pAT_804"
                     /old_locus_tag="Atu5538"
     CDS             complement(533504..533965)
                     /locus_tag="ATU_RS26455"
                     /old_locus_tag="AGR_pAT_804"
                     /old_locus_tag="Atu5538"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4126 family protein"
                     /protein_id="WP_010974756.1"
                     /translation="MLILLSILIGTVAGLRAMTAPTAIAWGAYLGWLDISQTGLSFMG
                     SLWAAMIFTLLAVTELITDQLPSTPSRKVPMQFGARISMGALSGAAIGATGNTVVIGL
                     ITGVIGAVIGTLGGASVRAYLANRFGRDLPAALLEDAFAVALAILVAVSVP"
     gene            complement(534191..535066)
                     /locus_tag="ATU_RS26460"
                     /old_locus_tag="AGR_pAT_806"
                     /old_locus_tag="Atu5539"
     CDS             complement(534191..535066)
                     /locus_tag="ATU_RS26460"
                     /old_locus_tag="AGR_pAT_806"
                     /old_locus_tag="Atu5539"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010660316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="WP_010974757.1"
                     /translation="MKNLVFISGRVLLTLSMSSCAAVMGWHLWSFHIGTPWTRDAHVR
                     ADIVRLAPDISGPVTEVLVSDNALVEKDAPLFRIEKDRFELALREAEAQVTGAKAGTD
                     AAKVDFERYQRLASKEAASVRERQHAETQMYQAEAAYQSALVARDLAKLNLERTTVRA
                     PASGAITNFSLRKGNYVLAGNAVGVLVEKESVYVAGYFEETKLPRIHIGDRVKIDIMG
                     EPESAIGHVAGVAAGIEDRERSDTAGSLASVAPTFSWVRLAQRIPVRIEIDHVPNNVR
                     LIAGRTATIAIEQSK"
     gene            complement(535063..535272)
                     /locus_tag="ATU_RS26465"
                     /old_locus_tag="Atu5540"
     CDS             complement(535063..535272)
                     /locus_tag="ATU_RS26465"
                     /old_locus_tag="Atu5540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019565787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1656 domain-containing protein"
                     /protein_id="WP_010974758.1"
                     /translation="MIGQLDLYGIFLPSFAALALFAYGAFRVLASLLGKVGFYRAVWH
                     RSLFNFALYIALVGGVSAIINWLQI"
     gene            complement(535269..537284)
                     /locus_tag="ATU_RS26470"
                     /old_locus_tag="AGR_pAT_807"
                     /old_locus_tag="Atu5541"
     CDS             complement(535269..537284)
                     /locus_tag="ATU_RS26470"
                     /old_locus_tag="AGR_pAT_807"
                     /old_locus_tag="Atu5541"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018115908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FUSC family protein"
                     /protein_id="WP_035258221.1"
                     /translation="MSVRPVVTSGNVIFSLKTFLAAMLAYLIAISFDLDRPYWAVATV
                     YIVAHPLSGAISSKSVFRLLGTLVGSFATLIMVPNLVNEPILLSGAIVLWVAACTFIS
                     LLDRTPRSYVSLLAGYTVLLAGLPLVSAPANTFDTVVSRVEEIGLAIICASVVSHIVF
                     PVHVGAVLISRIDGWMDRARTLLEATAAGKLSETQSRVERHALAADAADLRSFNLHLQ
                     YDGSRYRWAVSLVRSMQYRMAAFLPLLSEMEDLRRSLGKLNTSGATQALAIITDAASH
                     TRGSAEILDSRIDALTSATTRHTWEKLLLANAARTVRNILRLADECRALLKSMEGENN
                     ARVVRVPHRRRAQHRDIGMALLSSLTVAVCLATSIFFWIESGWADGMTFTQISGVLCC
                     LLATMDDPVPAMRKFVGVTMCSVMAAFVYNFTIFPVIDGFVPLIAALGLFLVPAGICL
                     AVPSLAIVGMGLCINFPLLLTLQAYPRADFVTFSNAAVATILAMVWTITVCGIFRSVR
                     AETNARRFFSVTRKHVANIAAGKYSNAHVTYDRMTDIAGLFASRAAKVPTTSDIWDGD
                     LLRDLRAGLHLTAMLERIETVSGGLQVLAKPIFPTIRTLYQQPRAGRGERLKNAVRAL
                     DDLILSAEARTAVDIELLSHAVALRVCIAPDADAPTLKTPSPNRRAA"
     gene            complement(537281..537652)
                     /locus_tag="ATU_RS26475"
                     /old_locus_tag="AGR_pAT_809"
                     /old_locus_tag="Atu5542"
     CDS             complement(537281..537652)
                     /locus_tag="ATU_RS26475"
                     /old_locus_tag="AGR_pAT_809"
                     /old_locus_tag="Atu5542"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035258224.1"
                     /translation="MASQNHDDRWWADIVQTEIRLPQKGLYRICVFPPSGKERIAARS
                     AVLKKIANALYSKIRALFASQQAVASHVSDADLAELYVHACLASPLFCYVPPGIYGLA
                     DSDASAEQCTTRNRARPGDDI"
     gene            537724..538530
                     /locus_tag="ATU_RS26480"
                     /old_locus_tag="AGR_pAT_810"
                     /old_locus_tag="Atu5543"
     CDS             537724..538530
                     /locus_tag="ATU_RS26480"
                     /old_locus_tag="AGR_pAT_810"
                     /old_locus_tag="Atu5543"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006697863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_046033456.1"
                     /translation="MITKSNKARISLSGALADHDLENSSAAVRSVRIDVSQNEREAPE
                     HQHRKGQLVMPLRGGVTCRVPSGMWMVPPHCGVWVPGGMLHSNVATANARLFFLFIEP
                     GAADLPNRCCTLSLSPLVRELIIELADQSEVATADSELMTTLLLSALSRMPVEHLHLP
                     LTDEPRLARIASELADDPSDRSTMAQWARRVAMSENSLARLVQHQTGLTFGRWRQQLQ
                     LIIAIRSLASGATVQQVSGDLGYESVSAFITMFKKALGTSPSRYLRNFDR"
     gene            538571..538945
                     /locus_tag="ATU_RS26485"
                     /old_locus_tag="AGR_pAT_811"
                     /old_locus_tag="Atu5544"
     CDS             538571..538945
                     /locus_tag="ATU_RS26485"
                     /old_locus_tag="AGR_pAT_811"
                     /old_locus_tag="Atu5544"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007694630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_010974762.1"
                     /translation="MFTHVMIGSNNLERARDFYDATFVALGGKPGEIDARGRLIYAHE
                     GGRLMITKPIDGKPATAANGGTIGIAAASPDHVLAWHAAGVSHGGTAVESLPLERPTG
                     AFVAYLRDPDGNKLTARTPPTK"
     gene            complement(539626..540579)
                     /locus_tag="ATU_RS26490"
                     /old_locus_tag="AGR_pAT_814"
                     /old_locus_tag="Atu5546"
     CDS             complement(539626..540579)
                     /locus_tag="ATU_RS26490"
                     /old_locus_tag="AGR_pAT_814"
                     /old_locus_tag="Atu5546"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007601676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974765.1"
                     /translation="MDRVSWNFRNVPLKLWKDKMDRFDAMSVLLAVVDAGSLSAGARR
                     LHAPLATVSRKVADLEKHLGARLVLRTRRGLTLTDEGRNYVAASRRILEALDVAEEEV
                     SGAHGALRGGLHMTAPIAFGERHVLPIALEFLREHQEIDLRLTLADRQISLADEHVDV
                     ALRIGHLADSALIATRVGAVRRVVCASPDYLACRGVPLQPDDLARHDGISFQGFATAP
                     EVRYRRDVTAFNVEPRARFAVNTTEAAIRAAVSGIGIIRVLSYQVADQIKSGALQEVL
                     SEFAPEPLPVNVVHGPVDPMPMKVRRFLNWITPRLRAQMAY"
     gene            540651..541622
                     /locus_tag="ATU_RS26495"
                     /old_locus_tag="AGR_pAT_815"
                     /old_locus_tag="Atu5547"
     CDS             540651..541622
                     /locus_tag="ATU_RS26495"
                     /old_locus_tag="AGR_pAT_815"
                     /old_locus_tag="Atu5547"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018449580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_010974766.1"
                     /translation="MPLLSRRTFASALPLGLLAGGLIGVGKAISATPDRAVTLATVTP
                     LAQISIGRFTVTALADGYADMPYNFFPGREPGEVEKAAAVEFTARKSGVRFLFNQYLI
                     DDGQRRILIDAGAAGSIGQTGKLPQALAALGLQRDQIDAVIVTHMHQDHMGGLIAGGK
                     NNYPGAELYIDGRDVKHWTDPAKRSGAPVYLQTSFSMAEEVVRLYPRLQAIDRERDII
                     PGVSIVDLTGHTPGHIGVRIEDDGKSLIMVSDMIFPVVHPAATDVFFLFEQDRIAAKA
                     MRDRFFPRAASEGALIAATHMPFPGLGRVVSDRGEMRWEVADWAFQD"
     gene            541657..542226
                     /locus_tag="ATU_RS26500"
                     /old_locus_tag="AGR_pAT_816"
                     /old_locus_tag="Atu5548"
     CDS             541657..542226
                     /locus_tag="ATU_RS26500"
                     /old_locus_tag="AGR_pAT_816"
                     /old_locus_tag="Atu5548"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006313549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase family
                     protein"
                     /protein_id="WP_010974767.1"
                     /translation="MSRYLDIATTPSVAVAQQHYGSADQWARVAARGSADETAQSQHL
                     GPAEAAFIRERDGFYLASVSESCWPYVQYRGGPAGFLLPLGPTLLGFADFRGNRQYIT
                     TGNVSVNDRVSLFLMDYAHRRRLKIFGHVRVIDANDDQELAARLTMPDYPARVERLIL
                     IAVEAYDWNCPQHITPRFTLAELERWRLE"
CONTIG      join(AE007872.2:1..542868)
//
DBGET integrated database retrieval system