GenomeNet

Database: RefSeq
Entry: NC_003198
LinkDB: NC_003198
Original site: NC_003198 
LOCUS       NC_003198            4809037 bp    DNA     circular CON 10-MAR-2020
DEFINITION  Salmonella enterica subsp. enterica serovar Typhi str. CT18,
            complete genome.
ACCESSION   NC_003198 AL627265-AL627284
VERSION     NC_003198.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMEA1705914
            Assembly: GCF_000195995.1
KEYWORDS    RefSeq; complete genome.
SOURCE      Salmonella enterica subsp. enterica serovar Typhi str. CT18
  ORGANISM  Salmonella enterica subsp. enterica serovar Typhi str. CT18
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Salmonella.
REFERENCE   1  (bases 1 to 4809037)
  AUTHORS   Parkhill,J., Dougan,G., James,K.D., Thomson,N.R., Pickard,D.,
            Wain,J., Churcher,C., Mungall,K.L., Bentley,S.D., Holden,M.T.,
            Sebaihia,M., Baker,S., Basham,D., Brooks,K., Chillingworth,T.,
            Connerton,P., Cronin,A., Davis,P., Davies,R.M., Dowd,L., White,N.,
            Farrar,J., Feltwell,T., Hamlin,N., Haque,A., Hien,T.T., Holroyd,S.,
            Jagels,K., Krogh,A., Larsen,T.S., Leather,S., Moule,S., O'Gaora,P.,
            Parry,C., Quail,M., Rutherford,K., Simmonds,M., Skelton,J.,
            Stevens,K., Whitehead,S. and Barrell,B.G.
  TITLE     Complete genome sequence of a multiple drug resistant Salmonella
            enterica serovar Typhi CT18
  JOURNAL   Nature 413 (6858), 848-852 (2001)
   PUBMED   11677608
REFERENCE   2  (bases 1 to 4809037)
  AUTHORS   Parkhill,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-2001) Submitted on behalf of the Salmonalla
            sequencing team, Sanger Centre, Wellcome Trust Genome Campus,
            Hinxton, Cambridge CB10 1SA, UK
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            AL513382.
            E-mail: parkhill@sanger.ac.uk
            
            Notes:
            Details of S. typhi sequencing at the Sanger Centre are available
            on the World Wide Web.
            (URL, http://www.sanger.ac.uk/Projects/S_typhi/).
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 03/10/2020 06:52:44
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 5,114
            CDSs (total)                      :: 5,000
            Genes (coding)                    :: 4,735
            CDSs (with protein)               :: 4,735
            Genes (RNA)                       :: 114
            rRNAs                             :: 8, 7, 7 (5S, 16S, 23S)
            complete rRNAs                    :: 8, 7, 7 (5S, 16S, 23S)
            tRNAs                             :: 80
            ncRNAs                            :: 12
            Pseudo Genes (total)              :: 265
            CDSs (without protein)            :: 265
            Pseudo Genes (ambiguous residues) :: 0 of 265
            Pseudo Genes (frameshifted)       :: 144 of 265
            Pseudo Genes (incomplete)         :: 72 of 265
            Pseudo Genes (internal stop)      :: 85 of 265
            Pseudo Genes (multiple problems)  :: 33 of 265
            CRISPR Arrays                     :: 1
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4809037
                     /organism="Salmonella enterica subsp. enterica serovar
                     Typhi str. CT18"
                     /mol_type="genomic DNA"
                     /strain="CT18"
                     /serovar="Typhi"
                     /sub_species="enterica"
                     /db_xref="taxon:220341"
                     /collection_date="1993-12"
     gene            190..255
                     /gene="thrL"
                     /locus_tag="STY_RS00005"
                     /old_locus_tag="STY0001"
     CDS             190..255
                     /gene="thrL"
                     /locus_tag="STY_RS00005"
                     /old_locus_tag="STY0001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thr operon leader peptide"
                     /protein_id="WP_001575544.1"
                     /translation="MNRISTTTITTITITTGNGAG"
     misc_feature    191..311
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00506"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Thr leader region; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /db_xref="RFAM:RF00506"
     gene            337..2799
                     /gene="thrA"
                     /locus_tag="STY_RS00010"
                     /old_locus_tag="STY0002"
     CDS             337..2799
                     /gene="thrA"
                     /locus_tag="STY_RS00010"
                     /old_locus_tag="STY0002"
                     /EC_number="1.1.1.3"
                     /EC_number="2.7.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005124053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aspartate kinase/homoserine
                     dehydrogenase I"
                     /protein_id="WP_001264731.1"
                     /translation="MRVLKFGGTSVANAERFLRVADILESNSRQGQVATVLSAPAKIT
                     NHLVAMIEKTIGGQDALPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIK
                     HVLHGISLLGQCPDSINAALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHY
                     LESTVDIAESTRRIAASQIPADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACL
                     RADCCEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQF
                     QIPCLIKNTGNPQAPGTLIGASSDDDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAAR
                     VFAAMSRAGISVVLITQSSSEYSISFCVPQSDCARARRAMQDEFYLELKEGLLEPLAV
                     TERLAIISVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATT
                     GVRVTHQMLFNTDQVIEVFVIGVGGVGGALLEQLKRQQTWLKNKHIDLRVCGVANSKA
                     LLTNVHGLNLDNWQAELAQANAPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYAD
                     FLREGFHVVTPNKKANTSSMDYYHQLRFAAAQSRRKFLYDTNVGAGLPVIENLQNLLN
                     AGDELQKFSGILSGSLSFIFGKLEEGMSLSQATALAREMGYTEPDPRDDLSGMDVARK
                     LLILARETGRELELSDIVIEPVLPDEFDASGDVTAFMAHLPQLDDAFAARVAKARDEG
                     KVLRYVGNIEEDGVCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAG
                     NDVTAAGVFADLLRTLSWKLGV"
     gene            2801..3730
                     /gene="thrB"
                     /locus_tag="STY_RS00015"
                     /old_locus_tag="STY0003"
     CDS             2801..3730
                     /gene="thrB"
                     /locus_tag="STY_RS00015"
                     /old_locus_tag="STY0003"
                     /EC_number="2.7.1.39"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine kinase"
                     /protein_id="WP_000241685.1"
                     /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGTLLGDVVSVEAADHF
                     RLHNLGRFADKLPPEPRENIVYQCWERFCQALGKTIPVAMTLEKNMPIGSGLGSSACS
                     VVAALVAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENGI
                     ISQQVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQ
                     PQLAAALMKDVIAEPYRARLLPGFSQARQAVSEIGALASGISGSGPTLFALCDKPETA
                     QRVADWLSKHYLQNQEGFVHICRLDTAGARVVG"
     gene            3734..5020
                     /gene="thrC"
                     /locus_tag="STY_RS00020"
                     /old_locus_tag="STY0004"
     CDS             3734..5020
                     /gene="thrC"
                     /locus_tag="STY_RS00020"
                     /old_locus_tag="STY0004"
                     /EC_number="4.2.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="WP_000781103.1"
                     /translation="MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHDLPEFSLTEID
                     EMLNQDFVSRSAKILSAFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGP
                     TLAFKDFGGRFMAQMLTHISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRG
                     KISPLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKTALGLNSANSINISR
                     LLAQICYYFEAVAQLPQGARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNIN
                     DTVPRFLHDGKWAPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDT
                     TTQQTMRELKAKGYISEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVESILGE
                     TLALPEALAERADLPLLSHHLPADFAALRKLMMTRQ"
     gene            complement(5114..5887)
                     /gene="yaaA"
                     /locus_tag="STY_RS00025"
                     /old_locus_tag="STY0005"
     CDS             complement(5114..5887)
                     /gene="yaaA"
                     /locus_tag="STY_RS00025"
                     /old_locus_tag="STY0005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxide stress protein YaaA"
                     /protein_id="WP_000906171.1"
                     /translation="MLILISPAKTLDYQSPLATTRYTQPELLDHSQQLIQQARQLSAP
                     QISRLMGISDKLADLNATRFHDWQPHFTPDNARQAILAFKGDVYTGLQAETFNDADFD
                     FAQQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENPRGKDLYQFWGDIITDKLNEALE
                     AQGDRVVVNLASEEYFKSVKPKKLDAELIKPVFLDEKNGKFKVVSFYAKKARGLMSRF
                     IIENRLTKPEQLTAFDREGYFFDEETSTQDELVFKRYEQ"
     gene            complement(5966..7396)
                     /locus_tag="STY_RS00030"
                     /old_locus_tag="STY0006"
     CDS             complement(5966..7396)
                     /locus_tag="STY_RS00030"
                     /old_locus_tag="STY0006"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:alanine symporter family protein"
                     /protein_id="WP_001113816.1"
                     /translation="MPEFFSFINEILWGSVMIYLLLGAGCWFTWRTGFIQFRYIRQFS
                     RSLKGSLSPQPGGLTSFQALCTSLAARIGSGNLAGVALAIAAGGPGAVFWMWVSAIIG
                     MATSFAECSLAQLYKERDPTGQFRGGPAWYMARGLGMRWMGVVFALFLLVAYGLIFNS
                     VQANAVSRALHFAFNIPPLISGIALAFCALLIIIRGIKGVARLMQWLIPLIALLWVAG
                     SVFICLWHIEQMPGVIASIVKSAFGWQEAAAGAAGYTLTQAITSGFQRGMFSNEAGMG
                     STPNAAAAATSYPPHPVAQGIVQMIGVFSDTIIICTASAMIILLAGNHASHSSTEGIQ
                     LLQHAMVSLTGEWGASFVALIVILFAFSSIVANYIYAENNLFFLRLHNAKAIWLLRLA
                     TLGMVIAGTLISFPLIWQLADMIMACMAITNLTAILLLSPVVYTLAGDYLRQRKLGVR
                     PQFDPRRFPDIEPQLAPDTWDAASRD"
     gene            7665..8618
                     /gene="tal"
                     /locus_tag="STY_RS00035"
                     /old_locus_tag="STY0007"
     CDS             7665..8618
                     /gene="tal"
                     /locus_tag="STY_RS00035"
                     /old_locus_tag="STY0007"
                     /EC_number="2.2.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017457867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transaldolase"
                     /protein_id="WP_000130175.1"
                     /translation="MTDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQ
                     IPEYRKLIDDAVAWAKQQSSDRAQQVVDATDKLAVNIGLEILKLVPGRISTEVDARLS
                     YDTEASIAKAKRIIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFS
                     FAQARACAEAGVYLISPFVGRILDWYKANTDKKDYAPAEDPGVVSVTEIYEYYKQHGY
                     ETVVMGASFRNVGEILELAGCDRLTIAPALLKELAESEGAIERKLSFSGEVKARPERI
                     TEAEFLWQHHQDPMAVDKLADGIRKFAVDQEKLEKMIGDLL"
     gene            8729..9319
                     /gene="mog"
                     /locus_tag="STY_RS00040"
                     /old_locus_tag="STY0008"
     CDS             8729..9319
                     /gene="mog"
                     /locus_tag="STY_RS00040"
                     /old_locus_tag="STY0008"
                     /EC_number="2.7.7.75"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000380375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin adenylyltransferase"
                     /protein_id="WP_001094677.1"
                     /translation="MNTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFELQT
                     RLIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQ
                     MRQISLRFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKADDGSVSVPGIFA
                     SVPYCIQLLDGPYVETAPEVVAAFRPKSARRENMSS"
     gene            complement(9376..9942)
                     /gene="satP"
                     /locus_tag="STY_RS00045"
                     /old_locus_tag="STY0009"
     CDS             complement(9376..9942)
                     /gene="satP"
                     /locus_tag="STY_RS00045"
                     /old_locus_tag="STY0009"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetate uptake transporter"
                     /protein_id="WP_000528527.1"
                     /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNAGFFALDGIILAMGIF
                     YGGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLTDAPDAQLLGAY
                     LGLWGVFTLFMFFGTLKAARALQFVFLSLTVLFALLAVGNITGNEATIHIAGWVGLVC
                     GASAIYLAMGEVLNEQFGRTILPIGEAH"
     gene            complement(10092..10805)
                     /gene="msyB"
                     /locus_tag="STY_RS00050"
                     /old_locus_tag="STY0010"
     CDS             complement(10092..10805)
                     /gene="msyB"
                     /locus_tag="STY_RS00050"
                     /old_locus_tag="STY0010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acidic protein MsyB"
                     /protein_id="WP_001103477.1"
                     /translation="MNVTYLHDEDLDFLQHCSEEQLADFARLLTHNEKGKARLSSVLS
                     HNELFKAMEGHPEQHRRNWQLIAGEFQHYGGDSIANKLRGHGKQYRAILLDVAKRLKL
                     KADKSMSTFEIEQQLLEHFLRHTWQKMDAAHKQEFLQAVDAKVSELEELLPLLMKDRS
                     LAKGVSHLLSTQLTRILRTHAAMSILGHGLLRGAGLGGPVGAALNGVKAMSGSAYRVT
                     IPAVLQIACLRRMMAAVQA"
     gene            complement(10841..11245)
                     /locus_tag="STY_RS00055"
                     /old_locus_tag="STY0011"
     CDS             complement(10841..11245)
                     /locus_tag="STY_RS00055"
                     /old_locus_tag="STY0011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2541 family protein"
                     /protein_id="WP_001258093.1"
                     /translation="MRSVLTISVGLLFGLALSSVAHANDHKILGVIAMPRNETNDLAL
                     KIPVCRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININS
                     DNDNKRCVSKITFSGHTVNSSDMARLKVIGDD"
     gene            11594..13510
                     /gene="dnaK"
                     /locus_tag="STY_RS00060"
                     /old_locus_tag="STY0012"
     CDS             11594..13510
                     /gene="dnaK"
                     /locus_tag="STY_RS00060"
                     /old_locus_tag="STY0012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001737966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaK"
                     /protein_id="WP_000516126.1"
                     /translation="MGKIIGIDLGTTNSCVAIMDGTQARVLENAEGDRTTPSIIAYTQ
                     DGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIIGADNGDAW
                     LDVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRI
                     AGLEVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEV
                     LATNGDTHLGGEDFDTRLINYLVDEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSA
                     QQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDI
                     NDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLL
                     DVTPLSLGIETMGGVMTPLITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASD
                     NKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLN
                     EEEIQKMVRDAEANAESDRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIE
                     SALSALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQAGSADASANNAKDD
                     DVVDAEFEEVKDKK"
     gene            13596..14735
                     /gene="dnaJ"
                     /locus_tag="STY_RS00065"
                     /old_locus_tag="STY0013"
     CDS             13596..14735
                     /gene="dnaJ"
                     /locus_tag="STY_RS00065"
                     /old_locus_tag="STY0013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_001119009.1"
                     /translation="MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAE
                     AKFKEIKEAYEVLTDAQKRAAYDQYGHAAFEQGGMGGGFGGGFNGGADFSDIFGDVFG
                     DIFGGGRGRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQ
                     PQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVK
                     IPAGVDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAM
                     AALGGEIEVPTLDGRVMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPV
                     GLSEKQKQLLKDLQESFGGPTGEKNSPRSKSFFDGVKKFFDDLTR"
     gene            15020..15967
                     /locus_tag="STY_RS00070"
                     /old_locus_tag="STY0014"
     CDS             15020..15967
                     /locus_tag="STY_RS00070"
                     /old_locus_tag="STY0014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_000534904.1"
                     /translation="MGSKGANKSFDYNLIKILDAVILSGNAAMAAKKLGITPAAVSLA
                     LKRLQSYYPEELFSRGKGGLIPTAKAVDIHQNFSQVMKLVDDTFLCNSKKDEAFQITL
                     LGSDIVESYYLSQLYNSDIFDRILINHFSVRNMSREHISELLFTAQGDLLISAEPLLE
                     SGIENQIIDSFKSFVCICSSKHMLSTLSQLSLHHFYSSRHALYQPGMGASVIYHDSEL
                     FKDELYYTGRRIVGYRSDSLNGLMSMIERTSLIALMPLKLALFYKNHRKYDIKFIQPP
                     PELAFKSVQVYASWKKNSRNISTINEMVSMLQTLSSFRR"
     gene            16094..16438
                     /locus_tag="STY_RS00075"
                     /old_locus_tag="STY0015"
     CDS             16094..16438
                     /locus_tag="STY_RS00075"
                     /old_locus_tag="STY0015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000026890.1"
                     /translation="MSIPNHVSTTEVVLLELEILLTIISIGAWGGFVSYLLRKDKTEY
                     NSSHESIKYCLTQIVISCFTSFLLSAIAIEKECSFNIVLLAAGLGGVFASPILKILGR
                     RIKKIIGGNNSD"
     gene            complement(16499..17032)
                     /locus_tag="STY_RS00080"
                     /old_locus_tag="STY0016"
     CDS             complement(16499..17032)
                     /locus_tag="STY_RS00080"
                     /old_locus_tag="STY0016"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 108 protein"
                     /protein_id="WP_001068133.1"
                     /translation="MNPIIDGIIALEGGYVFNPKDKGGATHWGITEATARAHGYAGDM
                     RDLTHAEAYAILEEDYWIKPGFDVISTLSWPVSFELCDAAVNIGDYHPSAWLQRWLNV
                     FNHEGKRYPDVHVDGNIGPRTLAALEHYLAWRGQEGEAVLVKALNCSQGMYYLNVAEK
                     NHNNEQFIYGWIKNRVT"
     gene            complement(17049..17492)
                     /locus_tag="STY_RS00085"
                     /old_locus_tag="STY0017"
     CDS             complement(17049..17492)
                     /locus_tag="STY_RS00085"
                     /old_locus_tag="STY0017"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_000860681.1"
                     /translation="MKTYIINSNCIYNEGKYELRTVSNSQVIKMTAMRAKCLSFIIEN
                     AHLEIIERQKITTALWGSRSHYVNDANLTQILYLIRRDLKALGINDLFITIPRQGLKV
                     NSDIAIIATDSETKGRKKQIVRQTIAALTTVFSVTLGSLMYLHIH"
     gene            17873..19972
                     /locus_tag="STY_RS00090"
                     /old_locus_tag="STY0018"
     CDS             17873..19972
                     /locus_tag="STY_RS00090"
                     /old_locus_tag="STY0018"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
                     /protein_id="WP_000235792.1"
                     /translation="MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYN
                     KYKNSTTKPKVFGYYTDWSQYDSRLQGNMSQPGRGCDLTNVSPTAYDKLIFGFVGITG
                     FRKIDKEDRDVVAEAAALCGKVKYEPTFLDPWGDFQSYINLGFETSGWDVDPKTVTQA
                     NAKGMLGALRDMQAKAKAAGHTLALSMSIGGWSMSNGFHETAASDSSRKTFAKGVVKL
                     FKQFPMFSEVDIDWEYPNDEGAGNPFGAEDGANYALLIAELRKQLDSAGLSNVKISIA
                     ASAVTTIFDHAKVKDLLAAGLYGINLMTYDFFGTPWAETLGHHTNRKALEEGGWAVET
                     IVDHLLAEGFSADRINIGYAGYTRNARQVEIESLSPLKGSYNPGSGDTTGSFESGTSE
                     WYDVIYSYLDLENQKGRNGFNVYTDQVADADYLYSPESKLFLSLDTPRTVKAKGEYAA
                     KLGLGGVFTWTIDQDNGVLVNAVREGLGYEIESEVIDMEPFYFEGINVEKDDEQSDSD
                     DAQKVNHAPKAAIELMVVGGSTVQLSGAGSSDEDNDELSFSWGVPSQIDVADKTAEII
                     EVVVPEVSEKTAFQFTLFVRDCYNEPSSQQRFVLTAVPALSQVQPEPEEEEEIIVPVP
                     DEEEETTPAEDDTSADDKTSPYAQWDASTVYGANWGSFEIVSWKGHNYQVKWWSMGNQ
                     PDLNCGVGGAWTDLGAY"
     gene            20064..23060
                     /locus_tag="STY_RS00095"
                     /old_locus_tag="STY0019"
                     /pseudo
     CDS             20064..23060
                     /locus_tag="STY_RS00095"
                     /old_locus_tag="STY0019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459024.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
     gene            23341..24045
                     /locus_tag="STY_RS00100"
                     /old_locus_tag="STY0021"
     CDS             23341..24045
                     /locus_tag="STY_RS00100"
                     /old_locus_tag="STY0021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /protein_id="WP_000738610.1"
                     /translation="MKKMMNDAFAKDNNENLLHSFLFSQQAKPHAAIDALFSALLPFG
                     QPFTLGIGDEFYLQANDEHYIVLLESGIVSFCRDDNRLHISSSFAPSVVGMVDSYGAT
                     YNVPARPEHFLLAETVCSGRFVRLPDFIKIADECDLWHDVARCLAYRLMVMSARDREL
                     VGVDSYLKVRALLIEIWAYPQAYRENIIVLNFIQRRTGISRSRTMKILSELKKGGYIH
                     IDNGRLTALGKLPVAY"
     gene            24473..25015
                     /locus_tag="STY_RS00105"
                     /old_locus_tag="STY0024"
     CDS             24473..25015
                     /locus_tag="STY_RS00105"
                     /old_locus_tag="STY0024"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein BcfA"
                     /protein_id="WP_000743355.1"
                     /translation="MKKPVLALMVSAIAFGGMLSTAQADTTTVTGGTVNFVGQVVDAA
                     CSVSADSVDQTVTLGQVRASKLTEAGMAANQKEDFTIKLEDCDTQTSQNAAVIFNGQQ
                     DANQPGSLANTAGAGSATNVALQLYGPDGQALNIGESSSTVTLNDGENVIPLSVDYIA
                     TGTATAGNVTATATFSMVYS"
     gene            25116..25802
                     /gene="bcfB"
                     /locus_tag="STY_RS00110"
                     /old_locus_tag="STY0025"
     CDS             25116..25802
                     /gene="bcfB"
                     /locus_tag="STY_RS00110"
                     /old_locus_tag="STY0025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial biogenesis chaperone BcfB"
                     /protein_id="WP_000742560.1"
                     /translation="MKKNVPIFLRLLLLLSAAGLSFAVQAGGIALGATRVIYPQGSKQ
                     TSLPIINSSASNVFLIQSWVANADGSRSTDFIITPPLFVIQPKKENILRIMYVGPSLP
                     TDRESVFYLNSKVIPSVDKNKLTGNSLQIATQSVIKLFIRPKNLAEAPAHAPATLRCR
                     NERGQLTITNPSPYYVSMVELYSAGKKLPNTMVPPKGAITLPATPGQVSLRTVNDFGA
                     TTPARVCPAS"
     gene            25807..28428
                     /gene="bcfC"
                     /locus_tag="STY_RS00115"
                     /old_locus_tag="STY0026"
                     /pseudo
     CDS             25807..28428
                     /gene="bcfC"
                     /locus_tag="STY_RS00115"
                     /old_locus_tag="STY0026"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459028.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial biogenesis usher protein BcfC"
     gene            28429..29436
                     /locus_tag="STY_RS00120"
                     /old_locus_tag="STY0029"
     CDS             28429..29436
                     /locus_tag="STY_RS00120"
                     /old_locus_tag="STY0029"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein BcfD"
                     /protein_id="WP_000701249.1"
                     /translation="MKIPLLFALLAGSVVSQYAHADVCKNVNGVPSSINYDLTTTLTA
                     EQNQVGKTVQLEKSQEVNVQAVCPAGASTYSQTYRSYVSPYPVVETSGNWKYLKLDPD
                     YLEGGMRIEDSSAGDIYPPMNNVLMGYDENVKAGQPFYVRDSNLEFQLKIVKPFVGTV
                     NISPKTMFNVYVMTAAGDPLTDVVYSILYSGTVTVPQSCEINAGQTILVNFGALYSGN
                     FNHAGQKPEGVRAKKFSVPVKCSGLDSQVNLTMRLIATPDSHFPQAIASDNADVGVVV
                     ETDEGNALIPNDVQSVAPFITDSAGRANITLQAYPVSTTGETPAEGAFTALASLRVDF
                     D"
     gene            29437..29982
                     /locus_tag="STY_RS00125"
                     /old_locus_tag="STY0030"
     CDS             29437..29982
                     /locus_tag="STY_RS00125"
                     /old_locus_tag="STY0030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein BcfE"
                     /protein_id="WP_001082042.1"
                     /translation="MNRSHCALFVMGLILCPQINASADDLAYNLEFTGTIVAQTCDID
                     ISSLSQSIDLGQFAVGDFPSTGTTTKFKPFNINLKNCSRGITGAKIWFTGEPDPDNPA
                     LLAITDTGMGSGNMLASGVGVEILNDDQDTISINNADSVVYPLKAGRNTLSFYIRYKS
                     TRPTVTSGNATAVMYFDMQYE"
     gene            29998..30516
                     /locus_tag="STY_RS00130"
                     /old_locus_tag="STY0031"
     CDS             29998..30516
                     /locus_tag="STY_RS00130"
                     /old_locus_tag="STY0031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein BcfF"
                     /protein_id="WP_001243237.1"
                     /translation="MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSEN
                     INVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASGVTVSFSGAGDSRNTDLLALT
                     AGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQASAHLQFYARYLADGGTVTPGD
                     ANASATFILAYE"
     gene            30482..31213
                     /locus_tag="STY_RS00135"
                     /old_locus_tag="STY0032"
     CDS             30482..31213
                     /locus_tag="STY_RS00135"
                     /old_locus_tag="STY0032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pili/flagellar-assembly chaperone"
                     /protein_id="WP_001135023.1"
                     /translation="MPPQPSFLPMNKFFLHCAIYWCLLPISWAQAGVVIGGTRFIYHA
                     GAPALSVPVSNHSEASWLIDTHILPGGRWPGTKNEGNITPFVVTPPLFMLSARQENSM
                     RVVYTGGPLPADRESLFTLSIAAIPSGKPEANRVQMAFRSALKLLYRPEGLAGNPQQA
                     YRHLIWSLTPDGATVRNPTPYYVTLFLLRANERAQDNAGVVAPFATRQTDWCRHAVRC
                     TVRWQSINDYGRVMTAQTVDLTRIH"
     gene            31278..32123
                     /locus_tag="STY_RS00140"
                     /old_locus_tag="STY0033"
     CDS             31278..32123
                     /locus_tag="STY_RS00140"
                     /old_locus_tag="STY0033"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DsbA family protein"
                     /protein_id="WP_000291399.1"
                     /translation="MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYI
                     VSHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIAQQQAYVQLALQYRAELLSSSSP
                     SVGPSEAKAAVVMFFDYQCSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGL
                     AARVGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEA
                     QSSGAVHDALLTNQALAQHMDFSGTPAFVVMPQTQNGDVKRVTVIPGSTTQDMLQMAI
                     QKAKG"
     gene            32162..32449
                     /locus_tag="STY_RS00145"
                     /old_locus_tag="STY0034"
     CDS             32162..32449
                     /locus_tag="STY_RS00145"
                     /old_locus_tag="STY0034"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000839835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000839835.1"
                     /translation="MKSMRCVIPVILLSFIVHEGTAKPTAQIHFMGSVVEAGCWNDVG
                     TLEIQCYNKEGVERYIIVENIITPISSPHATVKRDYLDEDKQLTVLRIVYD"
     gene            complement(32549..32998)
                     /locus_tag="STY_RS00150"
                     /old_locus_tag="STY0035"
     CDS             complement(32549..32998)
                     /locus_tag="STY_RS00150"
                     /old_locus_tag="STY0035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_001250363.1"
                     /translation="MRQYTINNEFIYNESLREIISLHDKKVLKVTLMRARCLSYLFEN
                     AYKKLITREMISHAVWGERSQFVSDANLTQLLYLLRRDLQQIGLFELFVTLPRQGIKI
                     DERFIIDAADIPPQAIQYHTHRCNKIISIGIPTLFLLIVLFFLAPFI"
     gene            33368..34363
                     /locus_tag="STY_RS00155"
                     /old_locus_tag="STY0036"
     CDS             33368..34363
                     /locus_tag="STY_RS00155"
                     /old_locus_tag="STY0036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_001247397.1"
                     /translation="MRPIKNAKKIDYNLIKVFDTVITEGNATRAARKLDVTPAAISQA
                     LLRLQNLYGEELFIRTRKGLVPSSKGKSLHQVFRQAIESIESTLCDKTDAQESNELIV
                     LGSDITENYYFPALLDTVLMNRYIIKHYAIKKTGEYSPASMLTHGYADIIMGILEIKN
                     EMIESFLIDNLSDFVCVCGEKSPLVGLEKMSLYNFYAARHAVYHSDMFSSFNADSIDL
                     FKSSTPYAGRREIGYYSDSLFGVIGVVEKSDMVAILPGKIATYFRDVRRYNIKILRMP
                     DEIIFRTLPVYAYLATNSTHYKNAKKLISTFQSTFLFSQEKQPDALVEGSTSLCD"
     gene            complement(34380..34816)
                     /locus_tag="STY_RS00160"
                     /old_locus_tag="STY0038"
                     /pseudo
     CDS             complement(34380..34816)
                     /locus_tag="STY_RS00160"
                     /old_locus_tag="STY0038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459036.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
     gene            35339..37057
                     /locus_tag="STY_RS00165"
                     /old_locus_tag="STY0039"
     CDS             35339..37057
                     /locus_tag="STY_RS00165"
                     /old_locus_tag="STY0039"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aryl-sulfate sulfotransferase"
                     /protein_id="WP_001035853.1"
                     /translation="MNKKNSSMVNLPAPRESINQKIDTNNALVLNHNAIYEQRLAEIT
                     QSNTCDKAIVTVNPYGTAPLSLYLGIWIDEAAALEINVVDSEATTEAVRYQYDVHPGA
                     NLIPVCGMVSAVNNQITLRLASQIVGQYTVMTDALPPTDSANVSLGFPIISVSCPAQQ
                     ASLMEEGLYFSTYFDRYNLAFDHNGIVRWYVSQEIPSYNFVRMDNGHFLATSQGINHC
                     LNMYEFDIMGRVYTVYLLDNEFHHSILPIENNLAIAPSEYSNGRPDGYSTGKDGVSII
                     NLSTGLEVAYYDMLYVMDYSRSPRPSGSAPGQDVSMDDWLHINQSYINEPNNLLICSG
                     RHQSAIFGVNVDSGELRFIMANHEDWSDEFKQYLLTPVDDDGVPLYDLTSPGGIDAAD
                     KNFWTWGQHNIVEIPNDEPGILEFMVFDNGNYRSREDAKSLLPLDNFSRVVQFKINLN
                     TMTVTRPYEYGKTEVGNRGYSSFVSAKHLLTNGHLVIHFGATTVDEFEHTITAQPGSS
                     DLVDPDEGQQALGRLVLQEINKETKEVLFEAMVTSGYFKNEETNGTNYRYDISAFRVY
                     KMPLFA"
     gene            complement(37103..38674)
                     /locus_tag="STY_RS00170"
                     /old_locus_tag="STY0040"
     CDS             complement(37103..38674)
                     /locus_tag="STY_RS00170"
                     /old_locus_tag="STY0040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional metallophosphatase/5'-nucleotidase"
                     /protein_id="WP_000262866.1"
                     /translation="MVYMNKKFSISLLSLCIGLSSAISFSADARDITIYYTNDLHAHV
                     TPEIIPYVSKTRPVGGFAPISKIVKDAKAKEKDVFFFDAGDYFTGPFISTLTKGEAII
                     DILNTMPYDAVSVGNHEFDHGHENLVKQLSKLQFPVLLDNVFYSGTDTPLIKEPYTIV
                     EKDGFKIGVIGMHGVSAFYEAIAAGVREGVDCRDPIPYVKKQLEELKGKVDLTVLLAH
                     EGVPGMQSSAGEADVARALKTDVDMAKSLEGYGLNVLITGHAHKGTPEPIKVGDTLVV
                     STDAYTIELGKLVLDWNPETKKVDSYNGKLITMYADTYKPDPVTQAKIDEWDNKVKKI
                     TDEVVAHSPEVLTRSYGESAPTGNLITDALMATVPGADASFYNAGGIRTELPKGNITY
                     GDVLSMYPFTNDVMSMEISGKDLKSIMSHAADLKNGMLHVSKTVQFKYDSTKPLGQRI
                     VEFDIKGKPVEDNKLYTVALDSFIGKGGGGFTFTKGKNIKYIGIQTAPALVNYMKQVN
                     NIQPDHTMRVDDISK"
     gene            complement(38773..39534)
                     /locus_tag="STY_RS00175"
                     /old_locus_tag="STY0041"
     CDS             complement(38773..39534)
                     /locus_tag="STY_RS00175"
                     /old_locus_tag="STY0041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000791535.1"
                     /translation="MKNKKYINSLLAACVLFSCFNGQAAELKRVYGKLSFGYGDWNKG
                     FVNVDRGEVWKAVADFGAVFDRGEFASFYEMNVLNHPVEGRNHVTQFLGHYRVVEGSN
                     FTAMMKLYMSMENKFGDELNMMYGVGYLGLTSPSGFIKPYFAVHNLSNDYTSKKYGQA
                     TGFNGYVLGWVAAYNFDMFNEKFVISNWNEVEMDRNDAYAEQQGGTTGLNGAVTFTWK
                     FMPRWTASVSYRYFNNKLGYNGYGDRMNYLIGFKF"
     gene            40128..41621
                     /locus_tag="STY_RS00180"
                     /old_locus_tag="STY0042"
     CDS             40128..41621
                     /locus_tag="STY_RS00180"
                     /old_locus_tag="STY0042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase-like hydrolase/transferase"
                     /protein_id="WP_000831876.1"
                     /translation="MKRTVVASMIGLALCAGCVLSTAQAATAKRPNLVIILADDLGYG
                     DLATYGHRIVKTPNIDKLAQEGVKFTDYYAPAPLCSPSRAGLLTGRMPFRTGIRSWIP
                     EGKDVALGRNELTIANLLKQQGYDTAMMGKLHLNAGGDRTDQPQAKDMGFDYTLVNPA
                     GFVTDATLDNAKERPRYGVVHPTGWIRNGQHIGRADKMSGEFVSSEVVNWLDNKKDDN
                     PFFLYVAFTEVHSPLASPKKYLDMYSQYMTDYQKQHPDLFYGDWADKPWRGTGEYYAN
                     ISYMDEQVGKVLDKIKAMGEEDNTIVIFTSDNGPVTREARKVYELKLAGETDGLRGRK
                     DNLWEGGIRVPAIIKYGKHIPQGMVTDTPVYGLDWLPTLANMMDFKLPTDRTYDGQSL
                     VPLLKDKTLKRQKPLIFGIDMPFQDDPTDEWAIRDGDWKMIIDRQNKPKYLYNLKTDR
                     FETLNQIGKQPQIEKQLYGKFLKYKKDIDNDSLMKARGDKPTPVTWG"
     gene            41720..42910
                     /locus_tag="STY_RS00185"
                     /old_locus_tag="STY0043"
     CDS             41720..42910
                     /locus_tag="STY_RS00185"
                     /old_locus_tag="STY0043"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic sulfatase maturase"
                     /protein_id="WP_000971151.1"
                     /translation="MMFGKSCQVMVKPTGSVCNLDCKYCFYLEKEKLYPDRKNHYKMS
                     EETLELFIRQQIAAQDIDEVIFAWQGGEPTLMGIPFYRKAVEFQQRYCGGKTIVNTFQ
                     TNGILINDDWATFFREHDFLVGVSIDGDAALHDEWRVTRSGKPTHEKVENAVRCLAQH
                     DVEFNTLTVVNRTNMHHPVQVYRYLKSVGSRYMQFIPLVERCGENGLAQPQDKHIAMT
                     PWSVDSLQFGQFLNAVFDIWIREDIGDIGIQLFEQTLAAWCGLPPQVCVFAPTCGSAF
                     AMEMNGDVYNCDHFVYPQFKLGNIHQKTLRQMNQGEQNRQFGSDKQRSMAQECHRCQW
                     KFACYGGCPKHRFLPSASGATNHNYLCAGYQAFFSHTATAMSAMRTLYEKGISLAEIK
                     SIFV"
     gene            42929..44181
                     /locus_tag="STY_RS00190"
                     /old_locus_tag="STY0045"
                     /pseudo
     CDS             42929..44181
                     /locus_tag="STY_RS00190"
                     /old_locus_tag="STY0045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459042.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            44308..46023
                     /locus_tag="STY_RS00195"
                     /old_locus_tag="STY0046"
     CDS             44308..46023
                     /locus_tag="STY_RS00195"
                     /old_locus_tag="STY0046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aryl-sulfate sulfotransferase"
                     /protein_id="WP_001094796.1"
                     /translation="MNTLTATSVVLPAPRPAINQGIDINNEIVLNHTAIYENCLAQVT
                     QENTVENALMLLDPYGTAPLSAYAGVWSLEPAEIMVTVQDAAKTAMPVEHLYTLTAGA
                     NLLPVLGLVAETENRIVFSQADTPLAVYTLTTQPLPPVDSAEVVLGFPIINVTQPATD
                     VDKMAPGFYFVTHFDRYNYALDQNGLVRWYVTQDYPSYNFVRIDNGHFLTTSEAKNTY
                     LDMYEFDMMGRLHTFYNLDNQFHHSIWPWDSNTIVAPSEYTSGRPDDLKTNEDGVSVV
                     DLATGLETAYYDMAKVLDTTRVSRPSGTAPGEDPTVKDWLHINQSYVNETNQLLIASG
                     RHQSAVFGVDLQTQALRFILSTHEDWDDAYQPYLLTPVDSEGVALYDFSKQEDIDAAD
                     RDFWTWGQHNVVEIANNTPGIVEFMVFDNGNYRSRDDSKSLLPPDNYSRIVHFVVNMN
                     EMTVMRPFEYGKELGARGYSSCVSAKAIQQNGNIVVHFADCTFDENGRAISCQPGESD
                     IIDPQAGSEAMGLLILQEIAPTEKTVLFEATMTSGYYKNAETNGEGYRYDITSFRVYK
                     MDLYA"
     gene            46186..47352
                     /gene="nhaA"
                     /locus_tag="STY_RS00200"
                     /old_locus_tag="STY0047"
     CDS             46186..47352
                     /gene="nhaA"
                     /locus_tag="STY_RS00200"
                     /old_locus_tag="STY0047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter NhaA"
                     /protein_id="WP_000681337.1"
                     /translation="MKHLHRFFSSDASGGIILIIAAALAMLMANMGATSGWYHDFLET
                     PVQLRVGALEINKNMLLWINDALMAVFFLLIGLEVKRELMQGSLASLRQAAFPVIAAI
                     GGMIVPALLYLAFNYSDPVTREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALA
                     IIDDLGAIIIIALFYTSDLSIVSLGVAAFAIAVLALLNLCGVRRTGVYILVGAVLWTA
                     VLKSGVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSL
                     QGVTMDGLTSMLPLGIIAGLLIGKPLGISLFCWLALRFKLAHLPQGTTYQQIMAVGIL
                     CGIGFTMSIFIASLAFGNIDPELINWAKLGILIGSLLSAVVGYSWLRARLNAPA"
     gene            47414..48313
                     /gene="nhaR"
                     /locus_tag="STY_RS00205"
                     /old_locus_tag="STY0048"
     CDS             47414..48313
                     /gene="nhaR"
                     /locus_tag="STY_RS00205"
                     /old_locus_tag="STY0048"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator NhaR"
                     /protein_id="WP_000062872.1"
                     /translation="MSMSHINYNHLYYFWHVYKEGSVVGAAEALFLTPQTITGQIKAL
                     EERLQGKLFKRKGRGLEPSELGELVFRYADKMFTLSQEMLDIVNYRKESNLLFDVGVA
                     DALSKRLVSSVLDAAVVVDEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQE
                     GLFSVKIGECSVSFWCTNPLPEKAFPACLEERRLLVPGRRSMLGRKLLNWFNSQGLQV
                     EILGEFDDAALMKAFGATHDAIFVAPSLYSLDFYADESVIEIGRVENVMEEYHAIFAE
                     RMIQHPAVQRICNADYSALFKLQ"
     gene            complement(48368..50407)
                     /locus_tag="STY_RS00210"
                     /old_locus_tag="STY0049"
     CDS             complement(48368..50407)
                     /locus_tag="STY_RS00210"
                     /old_locus_tag="STY0049"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 31 protein"
                     /protein_id="WP_001116444.1"
                     /translation="MPFMQQDPRRLVWQQNDRYLWIEPWGENSLRVRSGRHLPVMRNE
                     DWALTEPVAESQCHIDYEHHQATLTNGKIIAIVNQKGQVTFYRHPHKPLLQEFWRLRG
                     EIGEDESSHGQYVSALNLEGREFRPIQGGKYSLKARFEATEGEKIYGMGQYQQANLDL
                     KGCVLELAQRNSQASVPFMLSSLGYGFLWNNPAVGRVTFAQNVTEWEAQVSEQLDYWI
                     TAGDTPAEIGRAYALATGTPPMMPDYAMGFWQCKLRYRTQEELLEVAREYKRRNLPIS
                     VIVIDFFHWPNQGDWMFDARDWPDPDAMIAELKSLGIELMVSVWPTVDNRTESYREMR
                     ENGWLVQTERGLPINMDFLGNTTYFDATHPGARDYVWGKAKRNYHDKGVKLFWLDEAE
                     PEFSVYDYDNYRYHAGPVLEVGNIYPRMYAKTFFDGMKADGEDQVINLLRCAWAGSQK
                     YGALVWSGDIHSSFRSLRNQFAAGLNMGIAGIPWWTTDIGGFHGGNIHDPKFHELLIR
                     WFQWGVFSPVMRLHGNRDPQILPAQPYRDGIAQCPTGAPNEVWSYGEEVCDVLTGCLA
                     LREKLKPYIKALMEETHKHNTPVMRPLFFEFPEQETSWTITDQYCFGPDLLIAPVMHE
                     GMRERDVWLPEGETWTDLATGESYSGGQTLHYATPLNRIPVFIREGGQYRSLLNL"
     gene            complement(50447..51820)
                     /locus_tag="STY_RS00215"
                     /old_locus_tag="STY0050"
     CDS             complement(50447..51820)
                     /locus_tag="STY_RS00215"
                     /old_locus_tag="STY0050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_010989104.1"
                     /translation="MSSVIEDTQPSGSASLSLLQRISYGSLDVAGNLLYCFGSTYILY
                     FYTDVAGISLAVAGIILLLARIVDGIDAPIWGIIIDKTRSRYGKCRPWFLWLPLPFAV
                     FSALSFWSPDISITGKAIYAAISYMIASILFTGLNTPLSAILPLMTLSPKERLVLNSW
                     RMTGGQIGVLLMNATALPLVAFLGNGDDHAGFIYTAITFAIISCALTLFAFKNIREMD
                     ADKIQHEPKLPMKKSFAAMKGNWPWILMVLANLIFWIALQQRSTTIVYYLTYNLDRKD
                     LVPLINSLATIQILFIIAIPFFSKYLAKTWIWVGGLLVATFGGVMMWLAADNITFLIA
                     AWILGNIGSGIACSMPFAMLGFAVDFGAWKTGIKATGILIAFGSTFCIKMGSGLGTAL
                     AAWIMNSFGYVPNHAQSAAGLEGITWAFIWAPALLFALAAIPLLFFRKYEAMEEKIRH
                     DLETINS"
     gene            complement(51978..52223)
                     /locus_tag="STY_RS00220"
     CDS             complement(51978..52223)
                     /locus_tag="STY_RS00220"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001110886.1"
                     /translation="MPAICRFSRQPLALTSLVHALPVPAYFFSYPSLSHVILESYFLS
                     LFSFSYFITEKTVTTLANKNIAHLKTNKRNPDVRFNN"
     gene            complement(52277..52540)
                     /gene="rpsT"
                     /locus_tag="STY_RS00225"
                     /old_locus_tag="STY0052"
     CDS             complement(52277..52540)
                     /gene="rpsT"
                     /locus_tag="STY_RS00225"
                     /old_locus_tag="STY0052"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006117633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="WP_001518655.1"
                     /translation="MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDK
                     AAALKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
     gene            52646..52861
                     /locus_tag="STY_RS00230"
                     /old_locus_tag="STY0053"
     CDS             52646..52861
                     /locus_tag="STY_RS00230"
                     /old_locus_tag="STY0053"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YaaY family protein"
                     /protein_id="WP_001575565.1"
                     /translation="MQHSLRSDGAGFYQLACCEYSLSMRKIALSGGFWGGVCRMAMKS
                     IFFMFHQGNRRLTLTAVQGILLRFSLF"
     gene            52869..53807
                     /gene="ribF"
                     /locus_tag="STY_RS00235"
                     /old_locus_tag="STY0054"
     CDS             52869..53807
                     /gene="ribF"
                     /locus_tag="STY_RS00235"
                     /old_locus_tag="STY0054"
                     /EC_number="2.7.1.26"
                     /EC_number="2.7.7.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional riboflavin kinase/FAD synthetase"
                     /protein_id="WP_000767311.1"
                     /translation="MKLIRGIHNLSQAPHGCVLTIGNFDGVHRGHRALLQGLQEEGRR
                     RGLPVVVMIFEPQPLELFATDKAPARLTRLREKLHYLAQCGVDYVLCVKFDRRFAALT
                     AQTFISELLVERLGVQFLAVGDDFRFGASRAGDFLLLQKAGAEYGFAVSSTQTFCEGG
                     VRISSTAVRQALAEDNLALAESLLGHPFTISGRVVHGDELGRTIGFPTANLPLRRQVS
                     PVKGVYAVEVTGLGDKPLPGVANIGTRPTVAGVRQQLEVHLLDVVMDLYGRHIDVILR
                     KKIRNEQRFASLDELKAQIARDELTARKFFGLAGQV"
     gene            53852..56686
                     /gene="ileS"
                     /locus_tag="STY_RS00240"
                     /old_locus_tag="STY0055"
     CDS             53852..56686
                     /gene="ileS"
                     /locus_tag="STY_RS00240"
                     /old_locus_tag="STY0055"
                     /EC_number="6.1.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005124083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucine--tRNA ligase"
                     /protein_id="WP_010989105.1"
                     /translation="MSDYKSTLNLPETGFPMRGDLAKREPGMLARWTDDDLYGIIRAA
                     KKGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGFDSPYVPGWDCHGLPI
                     ELKVEQEFGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFK
                     TEANIIRALGRIIKNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFRAVD
                     QDAVKAKFGLPGVSGPVSLVIWTTTPWTLPANRAISLAPDFDYALVQIDGQAVILAKD
                     LVESVIQRIGAAEYTILGTVKGAELELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHT
                     APGHGPDDYVIGQKYGLETANPVGPDGAYLPGTYPTLDGVNVFKANDIVIELLKEKGA
                     LLHVEKMQHSYPCCWRHKTPIIFRATPQWFVSMDKEGLRQQSLKEIKGVQWIPDWGQA
                     RIESMVANRPDWCISRQRTWGVPMSLFVHKETQELLPIERTLAAMEEVAKRVEVDGIQ
                     AWWDLDPKEILGEDADQYEKVPDTLDVWFDSGSTSYSVVDARPEFAGHAADMYLEGSD
                     QHRGWFMSSLMISVAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLGA
                     DILRLWVASTDYTGEMAVSDEILKRAADSYRRIRNTARFLLANLNGFNPATDMVKPEE
                     MVVLDRWAVGCAKTAQQEILKAYEAYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTA
                     KADSVARRSCQTALYHIAEALVRWMAPIMSFTADEIWGYLPGEREKYVFTGEWYDGLF
                     GLEENEEFNDAFWDDVRYIKDQVNKELENQKANGIKSNLEAKVTLKYADDANGTIKKL
                     KLLGEEVRFIFITSQFVISEQAGGIDDENIQYNAGNTTVQAVVTRAEGDKCPRCWHYT
                     TDVGKVAEHADICGRCVSNIAGNGEQRKFA"
     gene            56686..57186
                     /gene="lspA"
                     /locus_tag="STY_RS00245"
                     /old_locus_tag="STY0056"
     CDS             56686..57186
                     /gene="lspA"
                     /locus_tag="STY_RS00245"
                     /old_locus_tag="STY0056"
                     /EC_number="3.4.23.36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase II"
                     /protein_id="WP_000042743.1"
                     /translation="MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFP
                     SLNLHYARNYGAAFSFLADSGSWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYA
                     LIIGGALGNLFDRLWHGFVVDMIDFYVGDWHFATFNLADTAICIGAALIVLEGFLPKP
                     TAKEQA"
     gene            57341..57790
                     /gene="fkpB"
                     /locus_tag="STY_RS00250"
                     /old_locus_tag="STY0057"
     CDS             57341..57790
                     /gene="fkpB"
                     /locus_tag="STY_RS00250"
                     /old_locus_tag="STY0057"
                     /EC_number="5.2.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_000047269.1"
                     /translation="MSKSVQSNSAILVHFTLKLDDGSTAESTRNNGKPALFRLGDTSL
                     SEGLEQQLLGLKEGEKKAFSLEPDAAFGVPSPDLIQYFSRREFMAAGEPEVGAIMLFT
                     AMDGSEMPGVIREINGDSITVDFNHPLAGHTVHFDIEVLEIDPALEA"
     gene            57793..58743
                     /gene="ispH"
                     /locus_tag="STY_RS00255"
                     /old_locus_tag="STY0058"
                     /gene_synonym="lytB"
     CDS             57793..58743
                     /gene="ispH"
                     /locus_tag="STY_RS00255"
                     /old_locus_tag="STY0058"
                     /gene_synonym="lytB"
                     /EC_number="1.17.7.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005124087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="WP_001166426.1"
                     /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRY
                     VVDSLRQRGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKV
                     HMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGK
                     LSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVL
                     VVGSKNSSNSNRLAELAQRMGRTAFLIDDAADIQEAWVKDAACVGVTAGASAPDILVQ
                     NVIARLREFGGGEAVTLEGREENIVFEVPKELRVDVREVE"
     gene            58943..60145
                     /locus_tag="STY_RS00260"
                     /old_locus_tag="STY0059"
     CDS             58943..60145
                     /locus_tag="STY_RS00260"
                     /old_locus_tag="STY0059"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000516332.1"
                     /translation="MGKIKYRLPTLLAIGFWMDAASATVLELPAWERNYTGTIAGKPV
                     NVNITRFGNTLYGHYCYEPCNQHKAVIVLRGSLQDKEVHLEERVKALSGYWNAEISSS
                     EIKGEWTSADKKRHFPVALIYYKPKNSPDIVLVTNTNDAGGYDPSKEIDCGNTPAISA
                     IKLYRDGKLIQTLDTASVGTCSPFMPQWGDVNFDGYPDLSIVTELLAGPDAPVQTWLY
                     DPAKQRYVDAPASYQEITSPEIDAEHKQIVSYWRGGCCSHGVNVYRWKGKTIELIDRG
                     ESYFQPVISKGKMYNCYMTPSYADGRIIYPLVRKNGHLTPPLSLDGTCQSFWLTGNVR
                     TVIQAEKPGAEPESLEIQWQENKASPGRFCPLVPFVEGDKLSPRLVTDDDVPDTCISR
                     AEYEDIKQ"
     gene            60161..61081
                     /gene="rihC"
                     /locus_tag="STY_RS00265"
                     /old_locus_tag="STY0060"
     CDS             60161..61081
                     /gene="rihC"
                     /locus_tag="STY_RS00265"
                     /old_locus_tag="STY0060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside hydrolase RihC"
                     /protein_id="WP_000127280.1"
                     /translation="MTASLHIILDTDPGIDDAAAIAAALFAPQLDLQLITTVAGNVSV
                     EKTTRNALQLLHFWNSDIPLAQGAATPLLRPLRDAAYVHGESGMEGYDFVDHQRQPLA
                     KPAFIAIRDVLMNAPEPMTLVAIGPLTNIALLLMHYPECACNIRRLVLMGGSAGRGNF
                     TPNAEFNIAVDPEAAALVFRSGLEIVMCGLDVTNQAMLSPDFLNKLPALNRTGKMLHS
                     LFNHYRSGSMRTGVRMHDLCAIAWLVRPELFTLQSCFVAVETQGEYTAGTTVVDIEGR
                     LGQPANAQVALALDVDGFRQWVAEVFAYVP"
     gene            complement(61103..61789)
                     /locus_tag="STY_RS00270"
                     /old_locus_tag="STY0061"
     CDS             complement(61103..61789)
                     /locus_tag="STY_RS00270"
                     /old_locus_tag="STY0061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_000377415.1"
                     /translation="MDSITTLIVEDEPMLAEILVDTIKLFPQFSIVGIADKLESAKKQ
                     IRLYQPQLILLDNFLPDGKGIDLIRHTISTNYTGRIIFITADNHMDTISDALRMGVFD
                     YLIKPVHYQRLQHTLERFTRYRSSLRSSEQANQTHVDALFNIQAKEQTAEPNSGLRGI
                     DENTFNRVRQIFADPQAVHTADTLAQILGSSKTTARRYLEQGVKNNFLEAEISYGKVG
                     RPERLYRGKV"
     gene            complement(61791..63410)
                     /locus_tag="STY_RS00275"
                     /old_locus_tag="STY0062"
     CDS             complement(61791..63410)
                     /locus_tag="STY_RS00275"
                     /old_locus_tag="STY0062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_010989106.1"
                     /translation="MFIREITHWFARRSFQNRIFLLILFTSTIVMLAITWYLTDITKE
                     RLHYQVGQRALIQAMQISAMPELVEAVEAHDLSRIKALIDPMRSFSDATYITVGNEKG
                     QRLYHVNPDEIGKYMEGGDSDDALYNAKSYVSVRKGSLGSSLRGKSPIQDSTGKVIGI
                     VSVGYTLEQLESWLNLQISSLLFPMAILLLVLLYCARRFSLHIKKQMLNMEPQQLSQL
                     LIQQSVLFESVFEGLIAIDSHHRITAINQTARRLLNLSQPESELIGYAIHHIVLPEAF
                     FYDAPQKNKKDEIVTFNQMKVIASRMAVIIDNQPQGWVISFRNKDDINTLNLQLSQVR
                     QYADNLRAVQHEHRNLISTIAGLLFLKRYDNALALIQQQSESHQKVLDFISHNFRDHH
                     LAGLLIGKYYRAKELGLELIFDPSSFVEHLPSSLSHNEWISIVGNLLDNAYNATLLNR
                     EGSRQIECLINSEGNEVIIEVADQGCGIDENIRQHIFERGVTTHNNGDHGIGLWLVYS
                     YVKQANGDIIVDNNNSFGTIFTLYIPFTREE"
     gene            complement(63545..64846)
                     /locus_tag="STY_RS00280"
                     /old_locus_tag="STY0063"
     CDS             complement(63545..64846)
                     /locus_tag="STY_RS00280"
                     /old_locus_tag="STY0063"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxalacetate decarboxylase subunit beta"
                     /protein_id="WP_000444842.1"
                     /translation="MESLNALLQGMGLMHLGAGQAIMLLVSLLLLWLAIAKKFEPLLL
                     LPIGFGGLLSNIPEAGMALTALESLLAHHDAGQLAVIAAKLNCAPDVHAIKEALALAL
                     PSVQNQMENLAVDMGYTPGVLALFYKVAIGSGVAPLVIFMGVGAMTDFGPLLANPRTL
                     LLGAAAQFGIFATVLGALTLNYFGLIAFTLPQAAAIGIIGGADGPTAIYLSGKLAPEL
                     LGAIAVAAYSYMALVPLIQPPIMRALTSEKERKIRMVQLRTVSKREKILFPVVLLLLV
                     ALLLPDAAPLLGMFCFGNLMRESGVVERLSDTVQNGLINIVTIFLGLSVGAKLVADKF
                     LQPQTLGILLLGVIAFGIGTAAGVLMAKLLNLCSKNKINPLIGSAGVSAVPMAARVSN
                     KVGLESDAQNFLLMHAMGPNVAGVIGSAIAAGVMLKYVLAM"
     gene            complement(64859..66634)
                     /gene="oadA"
                     /locus_tag="STY_RS00285"
                     /old_locus_tag="STY0064"
     CDS             complement(64859..66634)
                     /gene="oadA"
                     /locus_tag="STY_RS00285"
                     /old_locus_tag="STY0064"
                     /EC_number="7.2.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium-extruding oxaloacetate decarboxylase
                     subunit alpha"
                     /protein_id="WP_000150450.1"
                     /translation="MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAQLDDVGYGSLEC
                     WGGATFDACIRFLGEDPWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVE
                     RAVKNGMDVFRVFDAMNDPRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTE
                     QLLETGVDSIAIKDMSGILTPMAAFELVSEIKKRFEVRLHLHCHATTGMAEMALLKAI
                     EAGVDGVDTAISSMSATYGHPATEALVATLAGTEHDTGLDILKLENIAAYFREVRKKY
                     HAFEGQLKGYDSRILVAQVPGGMLTNLESQLKQQNAADRLDQVLAEIPRVREDLGFIP
                     LVTPTSQIVGTQAVLNVLTGERYKTIAKETAGILKGEYGHTPVPVNAALQARVLEGSA
                     PVTCRPADLLKPELAELEADVRRQAQEKGITLAGNAIDDVLTVALFPQIGLKFLENRH
                     NPAAFEPLPQAEAAQPVAKAEKPAASGIYTVEVEGKAFVVRVSDGGDISQLTTAVPAA
                     SSAPVQAAAPAGAGTPVTAPLAGNIWKVIATEGQSVAEGDVLLILEAMKMETEIRAAQ
                     AGTVRGIAVKSGDAVSVGDTLMTLA"
     gene            complement(66650..66889)
                     /locus_tag="STY_RS00290"
                     /old_locus_tag="STY0065"
     CDS             complement(66650..66889)
                     /locus_tag="STY_RS00290"
                     /old_locus_tag="STY0065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010836018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxaloacetate decarboxylase subunit gamma"
                     /protein_id="WP_001001151.1"
                     /translation="MNEAVLLGEGFTLMFLGMGFVLSFLFLLIFAIRGMSAVITRFFP
                     EPVAAPAPRAVPAVDDFTRLKPVIAAAIHHHRLNA"
     gene            complement(67048..68388)
                     /gene="citN"
                     /locus_tag="STY_RS00295"
                     /old_locus_tag="STY0066"
                     /gene_synonym="citH"
     CDS             complement(67048..68388)
                     /gene="citN"
                     /locus_tag="STY_RS00295"
                     /old_locus_tag="STY0066"
                     /gene_synonym="citH"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate/sodium symporter CitN"
                     /protein_id="WP_000183602.1"
                     /translation="MTNMTQASATEKKGASDLLRFKIFGMPLPLYAFALITLLLSHFY
                     NAIPTDLVGGFALMFVMGAIFGEIGKRLPIFNKYIGGAPVMIFLVAAYFVYAGIFTQK
                     EIDAISNVMDKSNFLNLFIAVLITGAILSVNRKLLLKSLLGYIPTILAGIVGASLFGI
                     VIGLCFGIPVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRSREEYYSTAIAILTI
                     ANIFAIIFAALLDMIGKKYTWLSGEGELVRKASFKTEDDEKAGQITHRETAVGMVLST
                     TCFLLAYVVAKKILPSIGGVSIHYFAWMVLIVAALNASGLCSPEIKAGAKRLSDFFSK
                     QLLWVLMVGVGVCYTDLQEIIDALTFANVVIAAIIVVGAVVGAAIGGWLIGFYPIESS
                     ITAGLCMANRGGSGDLEVLSACNRMNLISYAQISSRLGGGIVLVIASIVFSMMV"
     gene            68633..69676
                     /gene="citC"
                     /locus_tag="STY_RS00300"
                     /old_locus_tag="STY0067"
     CDS             68633..69676
                     /gene="citC"
                     /locus_tag="STY_RS00300"
                     /old_locus_tag="STY0067"
                     /EC_number="6.2.1.22"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="[citrate (pro-3S)-lyase] ligase"
                     /protein_id="WP_001181444.1"
                     /translation="MQNRVNLIFKRIYLQKDVLRRESVAMFLEGVGLALEDDCEIAVC
                     AYWQGEIVGCGSLAGNVLKCIAVSPVLQGEGLSLKLLTELLTLAYELNRSELFLFTKP
                     QNRLLFSGAGFWPIAQAGELAVLMENSSERLARFCRQLALYRQPGKTIGAIVMNANPF
                     TLGHRYLVEQAAAACDWLHLFVVKEDASFFSYTDRWALIEQGIAGIDNVTLHSGSAYM
                     ISRATFPGYFLKEKGVVDDCHCQIDLQLFREHLAPALGITHRFVGSEPFCPLTCAYNQ
                     RMHDILHDPKRSGPVIEVVELARVEKNGTAISASRVRKLYSERNWPAISALVPAGTLA
                     YLQRHAARHTETI"
     gene            69706..69999
                     /gene="citD"
                     /locus_tag="STY_RS00305"
                     /old_locus_tag="STY0068"
     CDS             69706..69999
                     /gene="citD"
                     /locus_tag="STY_RS00305"
                     /old_locus_tag="STY0068"
                     /EC_number="4.1.3.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase acyl carrier protein"
                     /protein_id="WP_000691461.1"
                     /translation="MKIIKDALAGTLESSDVMIRIGPSSEPGIRLELESLVKQQFGAA
                     IEQVVRETLAKLGVERALVSVDDKGALECILRARVQAAALRAAEQTEIQWSAL"
     gene            69996..70865
                     /gene="citE"
                     /locus_tag="STY_RS00310"
                     /old_locus_tag="STY0069"
     CDS             69996..70865
                     /gene="citE"
                     /locus_tag="STY_RS00310"
                     /old_locus_tag="STY0069"
                     /EC_number="4.1.3.34"
                     /EC_number="4.1.3.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate (pro-3S)-lyase subunit beta"
                     /protein_id="WP_001247810.1"
                     /translation="MRPRRSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVALREKDT
                     ARLLVHHALQHPFYQDVEKVVRINPLNTPFGLADLEAVVRGGADIVRLPKTDSKNDVL
                     ELEAQVERIERECGREVGSTRLMAAIESAKGVVNAVDIATSSPRMVAIALAAFDYVMD
                     MGTSRGDGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLKEVQLAKGLGFNGK
                     SLVNPRQIELLHQAYSPTRKEVEHAHEVIAAAEEAESRGLGVVSLNGKMIDGPIIDHA
                     RKVVALSASGIRD"
     gene            70876..72396
                     /gene="citF"
                     /locus_tag="STY_RS00315"
                     /old_locus_tag="STY0070"
     CDS             70876..72396
                     /gene="citF"
                     /locus_tag="STY_RS00315"
                     /old_locus_tag="STY0070"
                     /EC_number="2.8.3.10"
                     /EC_number="4.1.3.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase subunit alpha"
                     /protein_id="WP_000665586.1"
                     /translation="MKETVTMLNQQYVVPEGLQPYQGVTVNSPWLASETEKRRRKICD
                     SLEEAIRRSGLKNGMTISFHHAFRGGDKVVNMVMAKLAEMGFRDLTLASSSLIDAHWP
                     LIEHIKNGVVRQIYTSGLRGKLGEEISAGLMENPVQIHSHGGRVKLIQSGELNIDVAF
                     LGVPCCDEFGNANGFSGKSRCGSLGYAQVDAQYAKCVVLLTEEWVEFPNYPASIAQDQ
                     VDLIVQVDEVGDPEKITAGAIRLSSNPRELLIARQAANVIEHSGYFCDGFSLQTGTGG
                     ASLAVTRFLEDKMRRHNITASFGLGGITGTMVDLHEKGLIKALLDTQSFDGDAARSLA
                     QNPHHIEISTNQYANPGSKGAACERLNVVMLSALEIDVNFNVNVMTGSNGVLCGASGG
                     HSDTAAGADLTIITAPLVRGRIPCVVEKVLTTVTLGASVDVLVTDHGIAVNPARQDLL
                     DNLRAAGVALMTIEQLQQRAEQLTGKPQPIEFTDRVVAVVRYRDGSVIDVIRQVKG"
     gene            72396..72947
                     /gene="citX"
                     /locus_tag="STY_RS00320"
                     /old_locus_tag="STY0071"
     CDS             72396..72947
                     /gene="citX"
                     /locus_tag="STY_RS00320"
                     /old_locus_tag="STY0071"
                     /EC_number="2.7.7.61"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase holo-[acyl-carrier protein]
                     synthase"
                     /protein_id="WP_000679050.1"
                     /translation="MKGTDLLYQGQAVTLEEMLQARDKRAARQRQALNCYRLPLISLT
                     LVAPGAVKNSAVWRRVADYAIAEILALCEQKEWVNVWEMQVNERSGPEWMAAVCAPAM
                     ALKQHMSTLEMSHPLGRLWDIDIIDSDGKSLSRRELGHPARPCLICQQDAHLCARGKH
                     HTLDLLLDEIARRIECYERERCD"
     gene            72925..73833
                     /gene="citG"
                     /locus_tag="STY_RS00325"
                     /old_locus_tag="STY0072"
     CDS             72925..73833
                     /gene="citG"
                     /locus_tag="STY_RS00325"
                     /old_locus_tag="STY0072"
                     /EC_number="2.4.2.52"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triphosphoribosyl-dephospho-CoA synthase CitG"
                     /protein_id="WP_001103241.1"
                     /translation="MNVSVVTERRTPAYSSLAAGELNGLVARALLTEARLTPKPGLVD
                     IRNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVMLRPLGMACEND
                     MLQATNGVNTHRGAIFAFGLLSAAIGRLLARGEPLEQNRICDQVARLSRNIVAHELSA
                     RKAGKLTKSETHFQCYGLSGARGEAESGFRTVRTQALPVFNRVVQEHDDTHLALLQTL
                     LHLMAWNDDTNLVSRGGLEGLYYVQQQAQKLLWQGGVLVEGGIEAMQFLDDELILRNL
                     SPGGSADLLAVTWFLSHFPAGSLYPE"
     gene            74013..74834
                     /gene="dapB"
                     /locus_tag="STY_RS00330"
                     /old_locus_tag="STY0073"
     CDS             74013..74834
                     /gene="dapB"
                     /locus_tag="STY_RS00330"
                     /old_locus_tag="STY0073"
                     /EC_number="1.17.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-tetrahydrodipicolinate reductase"
                     /protein_id="WP_000544030.1"
                     /translation="MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSL
                     LGSDAGELAGAGKSGVIVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIG
                     TTGFDDAGKQAIREASQEIAIVFAANFSVGVNVMLKLLEKAAKVMGDYSDIEIIEAHH
                     RHKVDAPSGTALAMGEAIAGALDKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVG
                     EHTAMFADIGERVEITHKASSRMTFANGALRSALWLKTKKNGLFDMRDVLGLDVL"
     gene            <74990..75191
                     /locus_tag="STY_RS00335"
                     /pseudo
     CDS             <74990..75191
                     /locus_tag="STY_RS00335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_446529.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            75696..76844
                     /gene="carA"
                     /locus_tag="STY_RS00340"
                     /old_locus_tag="STY0076"
     CDS             75696..76844
                     /gene="carA"
                     /locus_tag="STY_RS00340"
                     /old_locus_tag="STY0076"
                     /EC_number="6.3.5.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine-hydrolyzing carbamoyl-phosphate
                     synthase small subunit"
                     /protein_id="WP_000597281.1"
                     /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILT
                     DPSYSRQIVTLTYPHIGNVGTNEADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYL
                     KRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDAKLALEKAKAFPGLNGMDLAK
                     EVTTAETYRWTQGSWTLKDGLPEAKSEDDLPFHVVAYDFGAKRNILRMLVDRGCRLTV
                     VPAQTSAEEVLKMNPDGIFLSNGPSDPAPCDYAIEAIKKFLQTDIPVFGICLGHQLLA
                     LASGAKTVKMKFGHHGGNHPVKDMDRNVVMITAQNHGFAVDEDSLPANLRVTHKSLFD
                     GTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIKHYRSSAK"
     gene            76860..80087
                     /gene="carB"
                     /locus_tag="STY_RS00345"
                     /old_locus_tag="STY0077"
     CDS             76860..80087
                     /gene="carB"
                     /locus_tag="STY_RS00345"
                     /old_locus_tag="STY0077"
                     /EC_number="6.3.5.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl-phosphate synthase large subunit"
                     /protein_id="WP_001126321.1"
                     /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRV
                     ILVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALEL
                     ERQGVLEEFGVTMIGATADAIDKAEDRRRFDIAMKKIGLDTARSGIAHTMEEALAVAA
                     DVGFPCIIRPSFTMGGTGGGIAYNREEFEEICERGLDLSPTNELLIDESLIGWKEYEM
                     EVVRDKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIG
                     VETGGSNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDE
                     LMNDITGGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQ
                     ESLQKALRGLEVGATGFDPKVSLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVD
                     GVFNLTNIDRWFLVQIEELVRLEEKVTEVGITGLNADFLRQLKRKGFADARLAKLAGV
                     REGEIRKLRDQYDLHPVYKRVDTCAAEFATDTAYMYSTYEDECEANPSVDRDKIMVLG
                     GGPNRIGQGIEFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLE
                     DVLEIVRIEKPKGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAV
                     DRLKLKQPANATVTAIEQAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQT
                     AVSVSNDAPVLLDRFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPA
                     YTLSQEIQDVMRQQVQKLAFELQVRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKA
                     TGVPLAKVAARVMAGKSLTEQGVTQEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRST
                     GEVMGVGRTFAEAFAKAQLGSNSTMKKQGRALLSVREGDKERVVDLAAKLLKQGFELD
                     ATHGTAIVLGEAGINPRLVNKVHEGRPHIQDRIKNGEYTYIINTTAGRRAIEDSRVIR
                     RSALQYKVHYDTTLNGGFATTMALNADATEKVTSVQEMHAQIKKS"
     gene            80361..80756
                     /gene="caiF"
                     /locus_tag="STY_RS00350"
                     /old_locus_tag="STY0078"
     CDS             80361..80756
                     /gene="caiF"
                     /locus_tag="STY_RS00350"
                     /old_locus_tag="STY0078"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carnitine metabolism transcriptional regulator
                     CaiF"
                     /protein_id="WP_000333324.1"
                     /translation="MCEKYVERPLYLLIADWMMAENRWITAREISRQFDIEHCKAINT
                     LSYILSEVGEIVCEVKMIPNQIAGRGCQCQRLVKVVSIDSQLYRRLNHNLQERKVSVA
                     KAPRLSAVPPTELNREQKWQMMLSKSMRR"
     gene            complement(80834..81430)
                     /gene="caiE"
                     /locus_tag="STY_RS00355"
                     /old_locus_tag="STY0079"
     CDS             complement(80834..81430)
                     /gene="caiE"
                     /locus_tag="STY_RS00355"
                     /old_locus_tag="STY0079"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carnitine operon protein CaiE"
                     /protein_id="WP_000122865.1"
                     /translation="MSYYAFEGLIPVVHPDAFVHPSAVLIGDVIVGAGVYIGPLASLR
                     GDYGRLILEAGSNLQDGCIMHGYCDTDTIVHENGHIGHGAILHGCVVGRDALVGMNSV
                     IMDGAVIGEESIVAAMSFVKAGFQGEARQLLVGSPARVLRQVTDQELYWKRLNTKEYQ
                     DLAIRCRTGLSETKPLTQVEENRPRLKGTTDVKPKSAQ"
     gene            complement(81542..82327)
                     /gene="caiD"
                     /locus_tag="STY_RS00360"
                     /old_locus_tag="STY0080"
     CDS             complement(81542..82327)
                     /gene="caiD"
                     /locus_tag="STY_RS00360"
                     /old_locus_tag="STY0080"
                     /EC_number="4.2.1.149"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="crotonobetainyl-CoA hydratase"
                     /protein_id="WP_000004377.1"
                     /translation="MSESLHLTRNGPILEITLDRPKANAIDAKTSFAMGEAFLNFRDD
                     PELRVAIITGGGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFDLDKPVIAAVN
                     GYAFGGGFELALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVM
                     TGRRMSAEEALRWGIVNRVVSQSELMESARELAQQLVNSAPLAIAALKEIYRATSEMP
                     VEEGYRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRAPVWKGR"
     gene            complement(82381..83934)
                     /gene="caiC"
                     /locus_tag="STY_RS00365"
                     /old_locus_tag="STY0081"
     CDS             complement(82381..83934)
                     /gene="caiC"
                     /locus_tag="STY_RS00365"
                     /old_locus_tag="STY0081"
                     /EC_number="6.2.1.48"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="crotonobetaine/carnitine-CoA ligase"
                     /protein_id="WP_000355790.1"
                     /translation="MDIVGGQNLRQMWDDLAGMYGDKTALIFESCEGIVRQFSYASLN
                     EEINRTANLFYYLGIRKGDRVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESA
                     WILQNSQVSLLVTSAQFYPMYREIRQDNSTPLNHICLIGEQLPADDGVSHFSQLQARQ
                     SATLCYTPALSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQIALRDDDVYM
                     TVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTL
                     MVQPATPTDRQHHLREVMFYLNLSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPG
                     DKRRWPSIGRVGFSYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATAR
                     ALEPEGWLHTGDSGYQDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIV
                     VVGIKDAIRDEAIKAFIVLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCS
                     GKIIKKNLK"
     gene            complement(83997..85214)
                     /gene="caiB"
                     /locus_tag="STY_RS00370"
                     /old_locus_tag="STY0082"
     CDS             complement(83997..85214)
                     /gene="caiB"
                     /locus_tag="STY_RS00370"
                     /old_locus_tag="STY0082"
                     /EC_number="2.8.3.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine CoA-transferase"
                     /protein_id="WP_001016209.1"
                     /translation="MNHLPMPTFGPLAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIE
                     NVAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFA
                     RRGITDEVLWEHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQAFSGYLIQNGDVDQP
                     MPAFPYTADYFSGMTATTAALAALHKVRETGKGESIDIAMYEVMLRMGQYFMMDYFNG
                     GEICPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILGTPEVPE
                     GTQLIHRVECPYGPLVEEKLDAWLAAHTIADVQARFAELNIACAKVLTIPELEGNPQY
                     VARESITQWQTMDGRTCKGPNIMPKFKNNPGKIWRGMPSHGMDTAAILKNIGYSEADI
                     KELVGKGLAKVED"
     gene            complement(85326..86468)
                     /gene="caiA"
                     /locus_tag="STY_RS00375"
                     /old_locus_tag="STY0083"
     CDS             complement(85326..86468)
                     /gene="caiA"
                     /locus_tag="STY_RS00375"
                     /old_locus_tag="STY0083"
                     /EC_number="1.3.8.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005124373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="crotonobetainyl-CoA dehydrogenase"
                     /protein_id="WP_000347135.1"
                     /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVK
                     ALADMGIDSLLIPEEHGGLEAGFVTVAAVWMELGRLGAPTYVLYQLPGGFNTFLREGT
                     QEQIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRKNGKVYLNGSKCFITSSA
                     YTPYIVVMARDGASPDKPVYTEWFVDMSKAGIKVNKLEKLGLRMDSCCEITFDDVELD
                     EKDMFGREGNGFNRVKEEFDHERFLVALTNYGTAMCTFEDAARYANQRVQFGEAIGRF
                     QLIQEKFAHMAIKLNSMKNMLLEAAWKADNGTITSGDAAMCKYFCANAAFEVVDTAMQ
                     VLGGVGIAGNHRITRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
     gene            complement(86503..88020)
                     /gene="caiT"
                     /locus_tag="STY_RS00380"
                     /old_locus_tag="STY0084"
     CDS             complement(86503..88020)
                     /gene="caiT"
                     /locus_tag="STY_RS00380"
                     /old_locus_tag="STY0084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine/gamma-butyrobetaine antiport BCCT
                     transporter"
                     /protein_id="WP_000787084.1"
                     /translation="MKNEKRKSGIEPKVFFPLLIIVGILCWLTVRDLDAANVVINAVF
                     SYVTNVWGWAFEWYMVVMLFSWFWLVFGPYAKKRLGDEKPEFSTASWIFMMFASCTSA
                     AVLFWGSIEIYYYISTPPFGLEPNSTGAKEIGLAYSLFHWGPLPWATYSFLSVAFAYF
                     FFVRKMDVIRPSSTLVPLVGEKHAKGLFSTIVDNFYLVALIFAMGTSLGLATPLVTEC
                     MQWLFGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIV
                     SGASFIMNYFTDSVGMLLMHLPRMLFYTDAIGKGGFPQGWTVFYWAWWVIYAIQMSIF
                     LARISRGRTVRELCFGMVMGLTASTWILWTVLGSNTLLLMDKNILNIPQLIEQHGVAR
                     AIIETWAALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCREVRDGEEPPLLVRI
                     GWSVLVGIIGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWKDK"
     gene            88501..89271
                     /locus_tag="STY_RS00385"
                     /old_locus_tag="STY0085"
     CDS             88501..89271
                     /locus_tag="STY_RS00385"
                     /old_locus_tag="STY0085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein FixA"
                     /protein_id="WP_000692187.1"
                     /translation="MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEA
                     ACQLKQQLGDAQVVAMSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQHTAT
                     ALAAAAQKSGFDLLICGDGSSDLYAQQVGLLVGEALNIPAINGVSKILSLTDSTLTVE
                     RELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLNSVPA
                     YSTQQVAAPKQRERQRVVIEGDGEEQIAAFVENLRKII"
     gene            89287..90228
                     /locus_tag="STY_RS00390"
                     /old_locus_tag="STY0086"
     CDS             89287..90228
                     /locus_tag="STY_RS00390"
                     /old_locus_tag="STY0086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit
                     alpha/FixB family protein"
                     /protein_id="WP_001032189.1"
                     /translation="MNKFSSVWVFSDTPSRLPELMSGAQAVGEKVNAFVLNEADSATA
                     CHLGADHVWLLSGKPEDRMIEDYAAAMAETIRQHSEGGAVLLPNTRRGKLLAAKLGYR
                     LSAAVSNDASDVSLQDGKAAVKHMVYGGLAIGAETIASPFAVITLSSGTFDAQQPDAS
                     RSGEMHTVQWQAPATAVTRTATQARQSNSVDLDKARLVVSVGRGIGSKENISLAEALC
                     QTIGAELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANGAQT
                     IFAINKDKNAPIFQYADFGIVGDALKILPALTAALAR"
     gene            90278..91564
                     /locus_tag="STY_RS00395"
                     /old_locus_tag="STY0087"
     CDS             90278..91564
                     /locus_tag="STY_RS00395"
                     /old_locus_tag="STY0087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_001287774.1"
                     /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKN
                     VTGGRLYAHSLERIIPGFADQAPIERMITHEKLAFMTDNGAMTIDYCNGEDASASQVS
                     YSVLRSKFDAWLMEQAEEAGAQLITGIRVDNVVQRDGKVVGVEADGDILEAKVVILAD
                     GVNSLLAEKLGMAKRVEASHVAVGVKELIELPKSVIEDRFQLQGNEGAACLFAGAPTD
                     GLMGGGFLYTNETTLSLGLVCGLHHLKDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEY
                     AAHVVPEAGMNMQPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAISAGEAAAKTVLSA
                     MKRDDFSKQSLGEYRQHLDEGPMRDMRMYQKLPAFLDNPRMFTAYPEMAVSIARDLFT
                     VDGSAPVPMRKKILRHAKKVGFINLMKDGLKGVTVL"
     gene            91561..91848
                     /gene="fixX"
                     /locus_tag="STY_RS00400"
                     /old_locus_tag="STY0088"
     CDS             91561..91848
                     /gene="fixX"
                     /locus_tag="STY_RS00400"
                     /old_locus_tag="STY0088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-like protein FixX"
                     /protein_id="WP_000203737.1"
                     /translation="MTSPVNVDVKLGVNKFNVDEDSPHIILKTDPDKQALEVLVKACP
                     AGLYKKQDDGSVRFDYAGCLECGTCRILGLDTALEKWEYPRGTFGVEFRYG"
     gene            91996..93336
                     /locus_tag="STY_RS00405"
                     /old_locus_tag="STY0089"
                     /pseudo
     CDS             91996..93336
                     /locus_tag="STY_RS00405"
                     /old_locus_tag="STY0089"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459084.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
     gene            93425..93655
                     /locus_tag="STY_RS00410"
                     /old_locus_tag="STY0091"
     CDS             93425..93655
                     /locus_tag="STY_RS00410"
                     /old_locus_tag="STY0091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YgdI/YgdR family lipoprotein"
                     /protein_id="WP_001172089.1"
                     /translation="MQKRLMTALFTAATLFTVAGCSSNQAVETTDGKTIVTDGKPEVD
                     NDTGMVSYKNAATGKTEQINRDQLKNMSELDN"
     gene            93946..94362
                     /locus_tag="STY_RS00415"
                     /old_locus_tag="STY0093"
     CDS             93946..94362
                     /locus_tag="STY_RS00415"
                     /old_locus_tag="STY0093"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000767274.1"
                     /translation="MKLIPFYLLALFSAASGATEINACKDLIGTWKTTADNPPYTMTI
                     LPPVEGCGEKCVKLNVQYELDVTHRNALYCHEGQEGVKGQGPMVIAFEGAYGGHAIGT
                     YNRQLQLLWAGVIPKNKKGKWITKMENYWFRQVKAH"
     gene            complement(94586..94876)
                     /locus_tag="STY_RS00420"
                     /old_locus_tag="STY0095"
     CDS             complement(94586..94876)
                     /locus_tag="STY_RS00420"
                     /old_locus_tag="STY0095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1471 domain-containing protein"
                     /protein_id="WP_000745961.1"
                     /translation="MKKRIIAAALLATVASFSTLAAEQVSKQEISHFKLVKVGTINVS
                     QSGGQISSPSDLREKLSELADAKGGKYYHIIAAREHGPNFEAVAEVYNDATK"
     gene            95774..97662
                     /locus_tag="STY_RS00425"
                     /old_locus_tag="STY0098"
                     /pseudo
     CDS             95774..97662
                     /locus_tag="STY_RS00425"
                     /old_locus_tag="STY0098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459089.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase-like hydrolase/transferase"
     gene            98069..98599
                     /gene="kefF"
                     /locus_tag="STY_RS00430"
                     /old_locus_tag="STY0100"
     CDS             98069..98599
                     /gene="kefF"
                     /locus_tag="STY_RS00430"
                     /old_locus_tag="STY0100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-regulated potassium-efflux system
                     oxidoreductase KefF"
                     /protein_id="WP_000600696.1"
                     /translation="MILIIYAHPYPHHSHANKQMLEQAGTLENVEIRSLYHLYPDFNI
                     DVAAEQEALSRASLIVWQHPMQWYSVPPLLKLWMDKVLTHGWAYGHGGTALHGKHLLW
                     AVTTGGGENHFAIGSHPGFAVLSQPLQATALYCGLKWLPPFAMHCTFICDDDTLQAQA
                     RQYKQRLLAWQEVNHG"
     gene            98592..100454
                     /gene="kefC"
                     /locus_tag="STY_RS00435"
                     /old_locus_tag="STY0101"
     CDS             98592..100454
                     /gene="kefC"
                     /locus_tag="STY_RS00435"
                     /old_locus_tag="STY0101"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-regulated potassium-efflux system
                     protein KefC"
                     /protein_id="WP_000377172.1"
                     /translation="MDSHTLLQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPW
                     GLRLVTDAESILHFAEIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMVVCGGLIG
                     LFCMFLGLRWQVAELIGMTLALSSTAIAMQAMNERNLTVSQVGRSAFAVLLFQDIAAI
                     PLVAMIPLLAASGASTTLGAFALSALKVAGALALVVLLGRYVTRPALRFVARSGLREV
                     FSAVALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLF
                     FIGVGMSIDFGTLVENPLRILLLLAGFLAIKIVMLWLVARTLGVPAKQRRWFAVLLGQ
                     GSEFAFVVFGAAQMADVLEPEWAKALTLAVALSMAATPIFLVLLTRMEKTATGEAREA
                     DEIDEEQPRVIVAGFGRFGQIAGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDA
                     TRMDLLESAGAAKAEVLINAIDDPQTNLQLSELVKTHFPHLQIIARARDVDHYIRLRQ
                     AGVAMPERETFEGALKSGRQALEALGLGRYEARERADLFCHFNTRMVEEMAKGENDPL
                     SRAAAYKRTSAMLSEIITEDREHLSLIQRHGWQGTAEGKHSGKAADEPEVKPSI"
     gene            100653..101132
                     /gene="folA"
                     /locus_tag="STY_RS00440"
                     /old_locus_tag="STY0102"
     CDS             100653..101132
                     /gene="folA"
                     /locus_tag="STY_RS00440"
                     /old_locus_tag="STY0102"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020456510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 3 dihydrofolate reductase"
                     /protein_id="WP_000624378.1"
                     /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGR
                     HTWESIGRPLPGRKNIIISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQ
                     FLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
     gene            complement(101228..102076)
                     /gene="apaH"
                     /locus_tag="STY_RS00445"
                     /old_locus_tag="STY0103"
     CDS             complement(101228..102076)
                     /gene="apaH"
                     /locus_tag="STY_RS00445"
                     /old_locus_tag="STY0103"
                     /EC_number="3.6.1.41"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bis(5'-nucleosyl)-tetraphosphatase
                     (symmetrical)"
                     /protein_id="WP_000257211.1"
                     /translation="MATYLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPG
                     SLDVLRYVKSLGNSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWL
                     RRQPLLQVDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMP
                     NNWSPELSGLARLRFITNAFTRMRYCFPNGQLDMYSKASPENAPAPLKPWFAIPGPVS
                     EAYSIAFGHWASLEGKGTPEGIYALDTGCCWGGELTCLRWEDKQYFVQPSNRQMDMGE
                     GEAVNA"
     gene            complement(102087..102464)
                     /gene="apaG"
                     /locus_tag="STY_RS00450"
                     /old_locus_tag="STY0104"
     CDS             complement(102087..102464)
                     /gene="apaG"
                     /locus_tag="STY_RS00450"
                     /old_locus_tag="STY0104"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Co2+/Mg2+ efflux protein ApaG"
                     /protein_id="WP_000610896.1"
                     /translation="MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQ
                     LLGRYWLITNGHGRETEVQGKGVVGVQPRIAPGEEYQYTGGAVIETPLGTMQGHYEMI
                     DENGDAFTIDIPVFRLAVPTLIH"
     gene            complement(102467..103288)
                     /gene="rsmA"
                     /locus_tag="STY_RS00455"
                     /old_locus_tag="STY0105"
     CDS             complement(102467..103288)
                     /gene="rsmA"
                     /locus_tag="STY_RS00455"
                     /old_locus_tag="STY0105"
                     /EC_number="2.1.1.182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA
                     (adenine(1518)-N(6)/adenine(1519)-N(6))-
                     dimethyltransferase RsmA"
                     /protein_id="WP_001065397.1"
                     /translation="MNNRVHQGHLARKRFGQNFLNDRFVIDSIVSAINPQKGQAMVEI
                     GPGLAALTEPVGERLDKLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELSA
                     QLGQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRL
                     SVMAQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPYPVKDIRVLSRITTEAF
                     NQRRKTIRNSLGNLFSVETLTEMGIDPAMRAENISVAQYCQMANYLSENAPLKES"
     gene            complement(103285..104274)
                     /gene="pdxA"
                     /locus_tag="STY_RS00460"
                     /old_locus_tag="STY0106"
     CDS             complement(103285..104274)
                     /gene="pdxA"
                     /locus_tag="STY_RS00460"
                     /old_locus_tag="STY0106"
                     /EC_number="1.1.1.262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase
                     PdxA"
                     /protein_id="WP_000093001.1"
                     /translation="MSSAQRVVITPGEPAGIGPDLVVQLAQRAWPIELVVCADGALLT
                     ERAAMLGLPLSLLPYSPDVPAAPQPAGTLTLLPVSLRAPAIPGQLTVENGPYVVETLA
                     RACDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERSQAKKVVMMLATEELRV
                     ALATTHLPLRAIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHM
                     GTEEIDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQ
                     GFGRGVNITLGLPFIRTSVDHGTALELAGRGKADVGSFITALNLAIKMIVNTQ"
     gene            complement(104274..105560)
                     /gene="surA"
                     /locus_tag="STY_RS00465"
                     /old_locus_tag="STY0107"
     CDS             complement(104274..105560)
                     /gene="surA"
                     /locus_tag="STY_RS00465"
                     /old_locus_tag="STY0107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase SurA"
                     /protein_id="WP_000800482.1"
                     /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDG
                     LMQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIAN
                     IAKQNNMTMDQMRSRLAYDGLNYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDAL
                     AKQIGTQNDASTELNLSHILIALPENPTSEQVNDAQRQAESIVEEARNGADFGKLAIT
                     YSADQQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGQ
                     SQSISVTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGS
                     ANQGGDLGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKVDKTDAA
                     QKDRAYRMLMNRKFSEEAATWMQEQRASAYVKILSN"
     gene            complement(105614..107968)
                     /gene="lptD"
                     /locus_tag="STY_RS00470"
                     /old_locus_tag="STY0108"
     CDS             complement(105614..107968)
                     /gene="lptD"
                     /locus_tag="STY_RS00470"
                     /old_locus_tag="STY0108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS assembly protein LptD"
                     /protein_id="WP_000746124.1"
                     /translation="MKKRIPTLLATMIASALYSHQGLAADLASQCMLGVPSYDRPLVK
                     GDTNDLPVTINADNAKGNYPDDAVFTGNVDIMQGNSRLQADEVQLHQKQAEGQPEPVR
                     TVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGEN
                     RYTILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKVGPVPIFYSPYLQL
                     PVGDKRRSGFLIPNAKYTTKNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEF
                     RYLTQAGAGLMELDYLPSDKVYEDEHPKEGDKHRWLFYWQHSGVMDQVWRFNVDYTKV
                     SDSSYFNDFDSKYGSSTDGYATQKFSVGYAVQNFDATVSTKQFQVFNDQNTSSYSAEP
                     QLDVNYYHNDLGPFDTRIYGQAVHFVNTKDNMPEATRVHLEPTISLPLSNRWGSLNTE
                     AKLMATHYQQTNLDWYNANNSKKLEDSVNRVMPQFKVDGKLVFERDMAMLAPGYTQTL
                     EPRVQYLYVPYRDQSGIYNYDSSLLQSDYNGLFRDRTYGGLDRIASANQVTTGVTTRI
                     YDDAAVERFNVSVGQIYYFTESRTGDDNIKWENDDKTGSLVWAGDTYWRISERWGLRS
                     GVQYDTRLDSVATSSSSLEYRRDQDRLVQLNYRYASPEYIQATLPSYYSTAEQYKNGI
                     NQVGAVASWPIADRWSIVGAYYFDTNSSKPADQMLGLQYNSCCYAIRVGYERKLNGWD
                     NDKQHAIYDNAIGFNIELRGLSSNYGLGTQEMLRSNILPYQSSM"
     gene            108222..109034
                     /gene="djlA"
                     /locus_tag="STY_RS00475"
                     /old_locus_tag="STY0109"
     CDS             108222..109034
                     /gene="djlA"
                     /locus_tag="STY_RS00475"
                     /old_locus_tag="STY0109"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone DjlA"
                     /protein_id="WP_001200595.1"
                     /translation="MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFDKARSRKMAWF
                     ANQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGDSRTAAQNAFR
                     VGKADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEE
                     LGISRVQFDQFLRMMQGGAQFGGGYHQQSGGGWQQAQRGPTLEDACNVLGVKTTDDAT
                     TIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK"
     gene            complement(109129..109788)
                     /gene="rluA"
                     /locus_tag="STY_RS00480"
                     /old_locus_tag="STY0110"
     CDS             complement(109129..109788)
                     /gene="rluA"
                     /locus_tag="STY_RS00480"
                     /old_locus_tag="STY0110"
                     /EC_number="5.4.99.28"
                     /EC_number="5.4.99.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional tRNA pseudouridine(32) synthase/23S
                     rRNA pseudouridine(746) synthase RluA"
                     /protein_id="WP_000525195.1"
                     /translation="MGMENYNPPQEPWLVILYQDEHIMVVNKPSGLLSVPGRLEAHKD
                     SIMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWG
                     HPSPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYNVVEFAADNTARVVLKPITGR
                     SHQLRVHMLALGHPILGDQFYASPEALSLAPRLQLHAEMLTITHPAYGNSMTFKVPAD
                     F"
     gene            complement(109800..112706)
                     /gene="rapA"
                     /locus_tag="STY_RS00485"
                     /old_locus_tag="STY0111"
     CDS             complement(109800..112706)
                     /gene="rapA"
                     /locus_tag="STY_RS00485"
                     /old_locus_tag="STY0111"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001117023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase-associated protein RapA"
                     /protein_id="WP_001116972.1"
                     /translation="MPFTLGQRWISDTESELGLGTVVAMDARTVTLLFPSTGENRLYA
                     RSDSPVTRVMFNPGDTITSHEGWQLHIDEVKEENGLLVYVGTRLDTEETNVTLREVLL
                     DSKLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPYSGLRGQRTNLIPHQLN
                     IAHDVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVE
                     MLRRFNLRFALFDDERYTEAQHDAYNPFETEQLVICSLDFARRNKQRLEHLCDAEWDL
                     LVVDEAHHLVWSTDAPSREYMAIEQLAERVPGVLLLTATPEQLGMESHFARLRLLDPN
                     RFHDFEQFVEEQKNYRPVADAVAMLLAGNKLSNDELNRLGDLIGEQDIEPLLQAANSD
                     RDDAQAARDELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTVKLPLPTQYQTAIKV
                     SGIMGARKSAEDRARDMLYPEQIYQEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLV
                     ICAKATTALQLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIG
                     SEGRNFQFASNLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRW
                     YHEGLDAFEHTCPTGRAIYDSAYASLINYLAAPEETDGFDDLIKSCREQHEALKAQLE
                     QGRDRLLEINSNGGEKAQQLAQSIEEQDDDTNLIAFAMNLFDIVGINQDDRGDNLIVL
                     TPSDHMLVPDFPGLPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGS
                     STISLLKNKALPVGTLLVELVYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQV
                     EFETFNRQLSAVNRHTGSKLVNAVQQDVHAILQLGETQIEQSARALIDNARREADEKL
                     SGELSRLEALRAVNPNIRDDELAAIDSNRQQVLESLNQAGWRLDALRLIVVTHQ"
     gene            complement(112880..115231)
                     /gene="polB"
                     /locus_tag="STY_RS00490"
                     /old_locus_tag="STY0112"
     CDS             complement(112880..115231)
                     /gene="polB"
                     /locus_tag="STY_RS00490"
                     /old_locus_tag="STY0112"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase II"
                     /protein_id="WP_000035599.1"
                     /translation="MAQAGFILTRHWRDTPQGTEVSFWLATDNGPLQATLAPQESVAF
                     IPTSQTSRAASLLQAEKDYRLTPLQLRDFHRQPVSGLYCRTHRQLMRMEKLLRENGVT
                     VYEADVRPPERYLMERFITSPVWVDGEMRNGVIRNARLKPHPDYRPPLKWVSLDIETT
                     RHGELYCIGLEGCGQRTVYMLGPANGDERQLDFELVYVASRPQLLEKLNAWFAEHDPD
                     VIIGWNVVQFDLRMLQKYAERYRIPLRLGRDNSELEWREHGFKNGVFFAQARGRVIID
                     GIDALKSAFWNFSSFSLEAVSQELLGEGKSIDNPWDRMDEIDRRFAQDKPALATYNLK
                     DCELVTRIFHKTEIMPFLLERATINGLPVDRHGGSVAAFGHLYFPRMHRAGYIAPNLG
                     EVPPLASPGGYVMDSQPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHS
                     TEGFLDAWFSREKHCLPEIVSQIWHGRDEAKRQGNKPLSQALKIIMNAFYGVLGTTAC
                     RFFDPRLASSITMRGHAIMRQTKALIEAQGYDVIYGDTDSTFVWLRRAHSEADAAEIG
                     HRLVRHVNEWWAQTLQQQNLTSALELEFETHFCRFLMPTIRGADTGSKKRYAGLIQEG
                     DSQRMVFKGLETVRTDWTPLAQRFQQELYLRVFRNEPYQDYVRETIDKLMAGELDAQL
                     VYRKRLRRPLHEYQRNVPSHVRAARLADEQNLKQGRPAQYQNRGAIKYVWTVNGPEPV
                     DYQQSPLDYEHYLTRQLQPVAEGILPFVEDNFATLLTGQLGLF"
     gene            complement(115275..115505)
                     /locus_tag="STY_RS00495"
     CDS             complement(115275..115505)
                     /locus_tag="STY_RS00495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000423444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001681725.1"
                     /translation="MELRWCTALLVSDPLHMLRLKTIAQDNGIDSRSSPTRATRYKSW
                     WAQTRFLLRETFYYSGYRLLRYMPVQNNSITP"
     gene            complement(115571..116011)
                     /locus_tag="STY_RS00500"
                     /old_locus_tag="STY0114"
     CDS             complement(115571..116011)
                     /locus_tag="STY_RS00500"
                     /old_locus_tag="STY0114"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000458342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605-like element ISSen6 family
                     transposase"
                     /protein_id="WP_000458342.1"
                     /translation="MFATLLFLRSTSIQKHKINRSRHAAFLLHVHLVFVTKYRRKILG
                     ESHYAAFHQYAAEVCRDFGGELKESNGDVDHVHMLIEYPPTVQLSVLVNSLKAVTSRR
                     LRNEFIDLRGAYGKAVLWSRSYFAGSCGGAPLEVVKQYIQHQRG"
     gene            116034..117239
                     /gene="tnpB"
                     /locus_tag="STY_RS00505"
                     /old_locus_tag="STY0115"
     CDS             116034..117239
                     /gene="tnpB"
                     /locus_tag="STY_RS00505"
                     /old_locus_tag="STY0115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001669153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605 family element transposase accessory
                     protein TnpB"
                     /protein_id="WP_014341280.1"
                     /translation="MLILKAYKFRLEPTPEQSQRLRQLCGCARFVWNLGLAETKRILG
                     SGEKLPSAFELNRMLTVWKKMPGHIFLQDAYTDNLQQKLKDLHTAWKRCFDKKLAAKA
                     PVWKRKNEGRDSIRFVNFEKYCRLENRRVKLPSGLGWVKFRQSQRVNGKIKNATISQL
                     AGQWYISFQVEVETAEPNHTSTTIVGLDAGVTKLATLSDGTVYQPVNSFKASQRKLAT
                     LQRQLSRKVRFSSNWQKQKRKVQHLHSHIANIRRDYLHKVTSEISKNHAMIVIEDLKV
                     SNMSKSAKGTAEQHGRNVKAKSGLNRSILDQGWYEMRRQLEYKQLWRGGQVLAVPPAY
                     TSQRCACCGHTAKENRLSQSKFVCQACGYTANADVNGARNILAAGHAVLACGGMVQSG
                     RPSETGTRR"
     gene            complement(<117315..117713)
                     /locus_tag="STY_RS00510"
                     /pseudo
     CDS             complement(<117315..117713)
                     /locus_tag="STY_RS00510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459103.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="YdcF family protein"
     gene            <117807..118016
                     /locus_tag="STY_RS00515"
                     /pseudo
     CDS             <117807..118016
                     /locus_tag="STY_RS00515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_446563.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            118231..118650
                     /locus_tag="STY_RS00520"
                     /old_locus_tag="STY0117"
     CDS             118231..118650
                     /locus_tag="STY_RS00520"
                     /old_locus_tag="STY0117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4751 family protein"
                     /protein_id="WP_001103153.1"
                     /translation="MNVSMQARLVGSDRYLFVNTQRANPSIKTVSRFFEYKTWTEQIW
                     RTEIIENGNAFFHWQGHDRKDGHRDTIINYLLNGQRWQSTIEDYIFFHALEGKAWQGH
                     YDNIIEYVSSDHYVYQSAFAEYITDQIHQRAPHGTRF"
     gene            complement(118656..119351)
                     /gene="araD"
                     /locus_tag="STY_RS00525"
                     /old_locus_tag="STY0118"
     CDS             complement(118656..119351)
                     /gene="araD"
                     /locus_tag="STY_RS00525"
                     /old_locus_tag="STY0118"
                     /EC_number="5.1.3.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005124519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-ribulose-5-phosphate 4-epimerase"
                     /protein_id="WP_000888641.1"
                     /translation="MLEDLKHQVLEANLALPKHNLVTLTWGNVSAVDRERGVLVIKPS
                     GVDYSVMTADDMVVVSLETGEVVEGHKKPSSDTPTHRLLYQAFPTIGSIVHTHSRHAT
                     IWAQAGQPIPATGTTHADYFYGTIPCTRKMTEAEINGEYEWETGNVIVEAFEKQGINA
                     AQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQSLLDKH
                     YLRKHGAKAYYGQ"
     gene            complement(119492..120994)
                     /gene="araA"
                     /locus_tag="STY_RS00530"
                     /old_locus_tag="STY0119"
     CDS             complement(119492..120994)
                     /gene="araA"
                     /locus_tag="STY_RS00530"
                     /old_locus_tag="STY0119"
                     /EC_number="5.3.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-arabinose isomerase"
                     /protein_id="WP_000151698.1"
                     /translation="MTIFDNYEVWFVIGSQHLYGAETLRQVTQHAEHVVNALNTEAKL
                     PCKLVLKPLGTSPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLSILNKPLLQ
                     FHTQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKEAHTRI
                     GAWMRQAVSKQDTRQLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVV
                     NSIGDGDISALIDEYESSYTLTPATQIHGDKRQNVREAARIELGMKRFLEQGGFHAFT
                     TTFEDLHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMED
                     YTDHFEKGNDLVLGSHMLEVCPSIAVEEKPILDVQHLGIGGKEDPARLIFNTQTGPAI
                     VASLIDLGDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHH
                     TVFSHALDLNDMRQFAEIHDIEIAVIDNDTRLPAFKDALRWNEVYYGLKR"
     gene            complement(121005..122714)
                     /gene="araB"
                     /locus_tag="STY_RS00535"
                     /old_locus_tag="STY0120"
     CDS             complement(121005..122714)
                     /gene="araB"
                     /locus_tag="STY_RS00535"
                     /old_locus_tag="STY0120"
                     /EC_number="2.7.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulokinase"
                     /protein_id="WP_000951805.1"
                     /translation="MAIAIGLDFGSDSVRALAVDCATGDEIATSVEWYLRWQEGRYCD
                     GPNNQFRHHPRDYMESMEAALKAVLAQLSAAQRANVVGIGVDSTGSTPAPIDADGNVL
                     ALRPEFAENPNAMFVLWKDHTAVEEADEITRLCHKPGKVDYSRYIGGIYSSEWFWAKI
                     LHVTRQDSAVAQAAVSWIELCDWVPALLSGTTRPQDIRRGRCSAGHKTLWHESWGGLP
                     PASFFDELDPCINRHLRYPLFSETFTADLPVGTLCAEWAQRLGLPESVVISGGAFDCH
                     MGAVGAGAQPNTLVKVIGTSTCDILIADKQSVGDRAVKGICGQVDGSVVPNFIGLEAG
                     QSAFGDIYAWFSRVLSWPLEQLAAQHPELKTQINASQKQLLPALTDAWAKNPSLDHLP
                     VVLDWFNGRRTPNANQRLKGVITDLNLATDAPALFGGLVASTAFGARAIQECFTEQGI
                     AVNNVMALGGIARKNQVIMQVCCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIP
                     AAQQSMASAVERTLRPRPEQAQRFERLYRRYQQWALSAEQHYLPTAAPAPTTPANQAI
                     LTH"
     gene            123055..123900
                     /gene="araC"
                     /locus_tag="STY_RS00540"
                     /old_locus_tag="STY0121"
     CDS             123055..123900
                     /gene="araC"
                     /locus_tag="STY_RS00540"
                     /old_locus_tag="STY0121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose operon transcriptional regulator AraC"
                     /protein_id="WP_000852388.1"
                     /translation="MAETQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKG
                     YILNLTIRGEGVINNNGEQFVCRPGDILLFPPGEIHHYGRHPDASGWYHQWVYFRPRA
                     YWQEWLTWPTIFAQTGFFRPDEARQPHFSELFGQIISAGQGEGRYSELLAINLLEQLL
                     LRRMAVINESLHPPMDSRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQ
                     LGISVLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEF
                     RARCE"
     gene            124019..124786
                     /locus_tag="STY_RS00545"
                     /old_locus_tag="STY0122"
     CDS             124019..124786
                     /locus_tag="STY_RS00545"
                     /old_locus_tag="STY0122"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DedA family protein"
                     /protein_id="WP_001148375.1"
                     /translation="MQALLEHFITQSTLYSLIAVLLVAFLESLALVGLILPGTVLMAG
                     LGALIGSGELNFWHTWLVGIIGCLMGDWISFWLGWRFKKPLHRWSFMKKNKSLLDKTE
                     HALHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFIGPNLIGCLLWPPFYFLPGI
                     LAGAAIDIPSDMQSGDFKWLLLATALLLWVGGWLCWRLWRSGKAAVDRLTAYLPRSRL
                     LYLAPLTLGIGVVALVVLVRHPLMPVYIDILRKVVGY"
     gene            complement(124825..125532)
                     /gene="thiQ"
                     /locus_tag="STY_RS00550"
                     /old_locus_tag="STY0123"
     CDS             complement(124825..125532)
                     /gene="thiQ"
                     /locus_tag="STY_RS00550"
                     /old_locus_tag="STY0123"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine ABC transporter ATP-binding protein
                     ThiQ"
                     /protein_id="WP_000915973.1"
                     /translation="MLKLIDITWLYHHLPMRFTLAVERGEQVAILGPSGAGKSTLLNL
                     IAGFLAPASGTLLIAGEDHTLTPPSRRPVSMLFQENNLFSHLNVQQNIGLGLNPGLTL
                     NASQREKRDAIARQMGIESLMARLPGELSGGQRQRVALARCLVREQPVLLLDEPFSAL
                     DPALRQEMLTLVSDICRERQLTLLMVSHSVEDAARIAPRSIVVADGRIAWQGKTDELL
                     SGQASASALLGIKSHIL"
     gene            complement(125516..127126)
                     /gene="thiP"
                     /locus_tag="STY_RS00555"
                     /old_locus_tag="STY0124"
     CDS             complement(125516..127126)
                     /gene="thiP"
                     /locus_tag="STY_RS00555"
                     /old_locus_tag="STY0124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine/thiamine pyrophosphate ABC transporter
                     permease ThiP"
                     /protein_id="WP_000235645.1"
                     /translation="MATRRQPLIPGWLIPGLCAAALMITVSLAAFLALWLNAPSGAWS
                     TLWRDSYLWHVVRFSFWQAFLSAVLSVVPAVFLARALYRRRFPGRLALLRLCAMTLIL
                     PVLVAVFGILSVYGRQGWLASLWQMLGLQWTFSPYGLQGILLAHVFFNLPMASRLLLQ
                     SLESIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLG
                     GGPQATTIELAIFQALSYDYDPARAAMLALIQMVCCLALVLLSQRLSKAIAPGMTLTQ
                     GWRDPDDRLHSRLTDALLIVLALLLLLPPLVAVVVDGVNRSLPEVLAQPILWQAVWTS
                     LRIALAAGVLCVVLTMMLLWSSRELHQRQQLFAGQTLELSGMLILAMPGIVLATGFFL
                     LLNNSVGLPESADGIVIFTNALMAIPYALKVLENPMRDITARYGMLCQSLGIEGWSRL
                     KVVELRALKRPLAQALAFACVLSIGDFGVVALFGNDNFRTLPFYLYQQIGSYRSQDGA
                     VTALILLLLCFTLFTLIEKLPGRHAKTD"
     gene            complement(127102..128085)
                     /locus_tag="STY_RS00560"
                     /old_locus_tag="STY0125"
     CDS             complement(127102..128085)
                     /locus_tag="STY_RS00560"
                     /old_locus_tag="STY0125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine ABC transporter substrate binding
                     subunit"
                     /protein_id="WP_000915326.1"
                     /translation="MLKKYLPLLLLCAAPAFAKPVLTVYTYDSFAADWGPGPAVKKAF
                     EADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKSGVA
                     NEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPRT
                     STPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTS
                     PAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIP
                     TGNWMYPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWISEWQRAVSR"
     regulatory      complement(128117..128216)
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00059"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="TPP riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="thiamine pyrophosphate"
                     /db_xref="RFAM:RF00059"
     gene            complement(128263..129921)
                     /locus_tag="STY_RS00565"
                     /old_locus_tag="STY0127"
     CDS             complement(128263..129921)
                     /locus_tag="STY_RS00565"
                     /old_locus_tag="STY0127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator SgrR"
                     /protein_id="WP_001139028.1"
                     /translation="MPSGRLQQQFIRLWQCCDGKTQDTTLNELADLLNCSRRHMRTLL
                     NTMQARGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKSA
                     VRQMLISHLGRSFRQGRHILRVLYYRPMHNLLPGTALRRSETHIARQIFSSLTRVNEE
                     NGELEADIAHHWQQISPLLWRFYLRPGIHFHHGRELEMEDVIASLTRINTLPLYSHIT
                     KIDSPTAWTLDIHLSQPDRWLPWLLGQVPAMILPREWETLANFASHPIGTGPYAVRRN
                     TPNQLKILAFDDYFGYRALIDEVNVWVLPDISEEPACGLMLEGPIQGGEKAIESRLEE
                     GCYYLLFDARTPRGAHPQVREWVSHVLSPTNLLYHADEPLQQLWFPAYGLLPRWHHAR
                     PGPGEKPAGLETLTLTFYREHIEHRVIARIMSALLAEHQVHLHIQEIDYDQWHAGEIE
                     SDIWLNSANFTLPLDFSLFAHLCEVPLLQNCIPRDWQDDAAQWRAGEMNLANWCQQLL
                     ANKAIVPLIHHWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
     gene            130014..130136
                     /gene="sgrT"
                     /locus_tag="STY_RS00570"
     CDS             130014..130136
                     /gene="sgrT"
                     /locus_tag="STY_RS00570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001248755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose uptake inhibitor SgrT"
                     /protein_id="WP_001248755.1"
                     /translation="MRQFWLRYFAATEKTSWLACLSAPQRLKMLAELMQWEATD"
     gene            complement(130471..131076)
                     /gene="leuD"
                     /locus_tag="STY_RS00575"
                     /old_locus_tag="STY0129"
     CDS             complement(130471..131076)
                     /gene="leuD"
                     /locus_tag="STY_RS00575"
                     /old_locus_tag="STY0129"
                     /EC_number="4.2.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="WP_000818262.1"
                     /translation="MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLF
                     NDWRFLDEKGQQPNPEFVLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVI
                     APSFADIFYGNSFNNQLLPVKLSDEQVDELFTLVKANPGIKFEVDLEAQVVKAGDKTY
                     SFKIDDFRRHCMLNGLDSIGLTLQHEDAIAEYENKQPAFMR"
     gene            complement(131087..132487)
                     /gene="leuC"
                     /locus_tag="STY_RS00580"
                     /old_locus_tag="STY0130"
     CDS             complement(131087..132487)
                     /gene="leuC"
                     /locus_tag="STY_RS00580"
                     /old_locus_tag="STY0130"
                     /EC_number="4.2.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="WP_001140632.1"
                     /translation="MAKTLYEKLFDAHVVFEAPNETPLLYIDRHLVHEVTSPQAFDGL
                     RAHHRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCNEFGVELYDLNH
                     PYQGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQ
                     GRAKTMKIEVTGNAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGDAIRALSMEGRMT
                     LCNMAIEMGAKAGLVAPDETTFNYVKGRLHAPKGRDFDEAVEYWKTLKTDDGATFDTV
                     VTLRAEEIAPQVTWGTNPGQVISVTDIIPDPASFSDPVERASAEKALAYMGLQPGVPL
                     TDVAIDKVFIGSCTNSRIEDLRAAAEVAKGRKVAPGVQALVVPGSGPVKAQAEAEGLD
                     KIFIEAGFEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMA
                     AAAAVTGHFADIRSIK"
     gene            complement(132490..133581)
                     /gene="leuB"
                     /locus_tag="STY_RS00585"
                     /old_locus_tag="STY0131"
     CDS             complement(132490..133581)
                     /gene="leuB"
                     /locus_tag="STY_RS00585"
                     /old_locus_tag="STY0131"
                     /EC_number="1.1.1.85"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005124544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="WP_000042333.1"
                     /translation="MSKNYHIAVLPGDGIGPEVMAQALKVMDAVRSRFDMRITTSRYD
                     VGGIAIDNHGHPLPKATVEGCEQADAILFGSVGGPKWENLPPESQPERGALLPLRKHF
                     KLFSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEK
                     AFDTEVYHRFEIERIARIAFESARKRRRKVTSIDKANVLQSSILWREIVNDVAKAYPD
                     VELAHMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQE
                     FGLYEPAGGSAPDIAGKNIANPIAQILSLALLLRYSLDADEAATAIEQAINRALEEGV
                     RTSDLARGAAAVSTDEMGDIIARYVAEGV"
     gene            complement(133581..135152)
                     /gene="leuA"
                     /locus_tag="STY_RS00590"
                     /old_locus_tag="STY0132"
     CDS             complement(133581..135152)
                     /gene="leuA"
                     /locus_tag="STY_RS00590"
                     /old_locus_tag="STY0132"
                     /EC_number="2.3.3.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016831521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="WP_000082813.1"
                     /translation="MSQQVIIFDTTLRDGEQALQASLSAKEKLQIALALERMGVDVME
                     VGFPVSSPGDFESVQTIARTIKNSRVCALARCVEKDIDVAAQALKVADAFRIHTFIAT
                     SPMHIATKLRSTLDEVIERAVYMVKRARNYTDDVEFSCEDAGRTPVDDLARVVEAAIN
                     AGARTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGIAVGNSLAAV
                     HAGARQVEGAMNGIGERAGNCALEEVIMAIKVRKDIINVHTNINHHEIWRTSQTVSQI
                     CNMPIPANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGR
                     AAVKHRMEEMGYKDTDYNMGHLYDAFLKLADKKGQVFDYDLEALAFINKQQEEPEHFR
                     LDYFSVQSGSSDIATASVKLACGEEIKAEAANGNGPVDAIYQAINRITGYDVELVKYD
                     LNAKGQGKDALGQVDIVVNHHGRRFHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKE
                     LQRKAQNKENNKETV"
     gene            complement(135240..135326)
                     /gene="leuL"
                     /locus_tag="STY_RS00595"
                     /old_locus_tag="STY0133"
     CDS             complement(135240..135326)
                     /gene="leuL"
                     /locus_tag="STY_RS00595"
                     /old_locus_tag="STY0133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leu operon leader peptide"
                     /protein_id="WP_001762463.1"
                     /translation="MSYIVRFTGLLLLNAFIVRGRPVGGIQH"
     gene            135983..136927
                     /gene="leuO"
                     /locus_tag="STY_RS00600"
                     /old_locus_tag="STY0134"
     CDS             135983..136927
                     /gene="leuO"
                     /locus_tag="STY_RS00600"
                     /old_locus_tag="STY0134"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LeuO"
                     /protein_id="WP_001115424.1"
                     /translation="MPEVKTEKPHLLDMGKPQLRMVDLNLLTVFDAVMQEQNITRAAH
                     TLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPG
                     SGFEPTSSERVFNLCVCSPLDNILTSQIYNRVEKIAPNIHVVFKASLNQNTEHQLRYQ
                     ETEFVISYEEFRRPEFTSVPLFKDEMVLVASRKHPRISGPLLEGDVYNEQHAVVSLDR
                     YASFSRPWYDTPDKQSSVAYQGMALISVLNVVSQTHLVAIAPCWLAEEFAESLELQIL
                     PLPLKLNSRTCYLSWHEAAGRDKGHQWMEDLLVSVCKR"
     gene            137249..138973
                     /gene="ilvI"
                     /locus_tag="STY_RS00605"
                     /old_locus_tag="STY0135"
     CDS             137249..138973
                     /gene="ilvI"
                     /locus_tag="STY_RS00605"
                     /old_locus_tag="STY0135"
                     /EC_number="2.2.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_025294.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase 3 large subunit"
                     /protein_id="WP_000425609.1"
                     /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGID
                     HVLVRHEQAAVHMADGLARATGDVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQ
                     VATSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPLVLKKAFWLAASGRPGPVVVD
                     LPKDILNPAKKMPYVWPETVSMRSYNPTTSGHKGQIKRALQTLASAKKPVVYVGGGAI
                     SAACYAPLRHIIETFNLPVVSSLMGLGAFPATHRQSLGMLGMHGTYEANMTMHNADVI
                     FAVGVRFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVNADIPVVGDARLVLEQMLEL
                     LAQDAPSQPQDDIRDWWQQIESWRARQCLKYDAESESIKPQAVIETLWRLTKGDAYVT
                     SDVGQHQMFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPKEMVVCVTGDGS
                     IQMNIQELSTALQYELPVLVLNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLA
                     EAYGHVGLQINRPDELESKLSEALEHVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEM
                     WLSKTERT"
     gene            138976..139467
                     /gene="ilvN"
                     /locus_tag="STY_RS00610"
                     /old_locus_tag="STY0136"
     CDS             138976..139467
                     /gene="ilvN"
                     /locus_tag="STY_RS00610"
                     /old_locus_tag="STY0136"
                     /EC_number="2.2.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001563086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase small subunit"
                     /protein_id="WP_001750262.1"
                     /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLS
                     RMTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGREEVK
                     RNTEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVVGLSRGDK
                     VMR"
     gene            139751..140755
                     /gene="cra"
                     /locus_tag="STY_RS00615"
                     /old_locus_tag="STY0138"
     CDS             139751..140755
                     /gene="cra"
                     /locus_tag="STY_RS00615"
                     /old_locus_tag="STY0138"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catabolite repressor/activator"
                     /protein_id="WP_000762406.1"
                     /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVRE
                     HNYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQ
                     PDNEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVV
                     GADQDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVNFLYAN
                     SYEREAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDH
                     ELLDFLQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIRRNLYRRGILSRS
                     "
     gene            141361..141819
                     /gene="mraZ"
                     /locus_tag="STY_RS00620"
                     /old_locus_tag="STY0139"
     CDS             141361..141819
                     /gene="mraZ"
                     /locus_tag="STY_RS00620"
                     /old_locus_tag="STY0139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020325403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="division/cell wall cluster transcriptional
                     repressor MraZ"
                     /protein_id="WP_000488291.1"
                     /translation="MFRGATLVNLDSKGRLTVPTRYREQLIESATGQIVCTIDIHHPC
                     LLLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHA
                     GLTKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQDLSL"
     gene            141821..142762
                     /gene="rsmH"
                     /locus_tag="STY_RS00625"
                     /old_locus_tag="STY0140"
     CDS             141821..142762
                     /gene="rsmH"
                     /locus_tag="STY_RS00625"
                     /old_locus_tag="STY0140"
                     /EC_number="2.1.1.199"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005124563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (cytosine(1402)-N(4))-methyltransferase
                     RsmH"
                     /protein_id="WP_000970440.1"
                     /translation="MMENFKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQ
                     LGEEGRLLAIDRDPQAIAVAQTINDPRFSIIHGPFSALADYVAERELTGKIDGILLDL
                     GVSSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTFGEERF
                     AKRIAHAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEE
                     IEQALKSSLSVLASGGRLSIISFHSLEDRIVKRFMREQSRGPQVPAGLPMTEAQLKKL
                     GGRELRALGKLMPGEKEVAENPRARSSVLRIAERTNA"
     gene            142759..143124
                     /gene="ftsL"
                     /locus_tag="STY_RS00630"
                     /old_locus_tag="STY0141"
     CDS             142759..143124
                     /gene="ftsL"
                     /locus_tag="STY_RS00630"
                     /old_locus_tag="STY0141"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000625658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsL"
                     /protein_id="WP_000625651.1"
                     /translation="MISRVTEALSKVKGSIGSNERHALPGVIGDDLLRFGKLPLCLFI
                     CIILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIAT
                     EKLQMQHVDPSQENIVVQK"
     gene            143140..144906
                     /gene="ftsI"
                     /locus_tag="STY_RS00635"
                     /old_locus_tag="STY0142"
     CDS             143140..144906
                     /gene="ftsI"
                     /locus_tag="STY_RS00635"
                     /old_locus_tag="STY0142"
                     /EC_number="3.4.16.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000642204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan glycosyltransferase FtsI"
                     /protein_id="WP_000642235.1"
                     /translation="MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAW
                     LQIIAPDMLVRQGDMRSLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAG
                     GISVGDRWKALSTALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIH
                     LREESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVI
                     EDISSTDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMA
                     NSPSYNPNNLAGTPKDAMRNRTITDVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPY
                     RINGHEIKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLG
                     LVGERSGLYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVD
                     PPVPGERIFPESTVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYI
                     NKYIAYTAGVAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPD
                     ALATGEKNEFVINQGEGTGGRS"
     gene            144893..146380
                     /gene="murE"
                     /locus_tag="STY_RS00640"
                     /old_locus_tag="STY0143"
     CDS             144893..146380
                     /gene="murE"
                     /locus_tag="STY_RS00640"
                     /old_locus_tag="STY0143"
                     /EC_number="6.3.2.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,
                     6-diaminopimelate ligase"
                     /protein_id="WP_000775075.1"
                     /translation="MADRNLRDLLAPWVAGLPARELREMTLDSRVAAAGDLFVAVVGH
                     QADGRRYIPQAIAQGVAAIIAEAKDEASDGEIREMHGVPVVYLSQLNERLSALAGRFY
                     HEPSENMRLVAVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTG
                     SAVDVQHVLASLVAQGATFGAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDM
                     AHYEAAKWMLYSTHHHGQAIVNADDEVGRRWLASLPDAVAVSMEGHINPNCHGRWLKA
                     EAVEYHDRGVTIRFASSWGEGEIESCLMGAFNVSNLLLALATLLALGYPLTDLLKTAA
                     RLQPVCGRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDK
                     GKRPLMGAIAEEFADIVVVTDDNPRTEEPRAIINDILAGMLDAGQVRVMEGRAEAVTN
                     AIMQAKDNDVVLIAGKGHEDYQIVGTQRLDYSDRVTAARLLGVIA"
     gene            146377..147735
                     /gene="murF"
                     /locus_tag="STY_RS00645"
                     /old_locus_tag="STY0144"
     CDS             146377..147735
                     /gene="murF"
                     /locus_tag="STY_RS00645"
                     /old_locus_tag="STY0144"
                     /EC_number="6.3.2.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-
                     alanine ligase"
                     /protein_id="WP_000626645.1"
                     /translation="MISVTLSKIADVLGAEHRGADLTLDTVITDTRKVTPGCLFVALK
                     GERFDAHDFADKAKANGAGALLVSRPLDIDLPQVIVKDTRQAFGQLAAWVRMQVPARV
                     VALTGSSGKTSVKEMTAAILSQCGNTLYTASNFNNDIGVPITLLRLNHDYDYAVIELG
                     ANHQGEIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIYTGLPENGIAIMN
                     ADNNDWLNWQSIIGDRQVWRFSPNAANSDFTAANIHVTSHGTEFTLQTPMGSIDVLLP
                     LPGRHNIANALAAAALSMAVGATLAAVKAGLAALKAVPGRLFPIQLSENQLVLDDAYN
                     ANVGSMTAAVQVLSEMPGYRVLVVGDMAELGAESEACHLQVGEAAKAAGIDRVLSTGK
                     LSQVISHASGVGEHFADKAALIARLHALLQEQPMMTILVKGSRSAAMEDVVHALQEKG
                     SC"
     gene            147729..148811
                     /gene="mraY"
                     /locus_tag="STY_RS00650"
                     /old_locus_tag="STY0145"
     CDS             147729..148811
                     /gene="mraY"
                     /locus_tag="STY_RS00650"
                     /old_locus_tag="STY0145"
                     /EC_number="2.7.8.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005124610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="WP_000964138.1"
                     /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRM
                     IARLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVL
                     VVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQL
                     VVPFFKDVMPQLGLFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWA
                     TGNMNFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGA
                     LGIIAVLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWP
                     EPRVIVRFWIISLMLVLIGLATLKVR"
     gene            148814..150130
                     /gene="murD"
                     /locus_tag="STY_RS00655"
                     /old_locus_tag="STY0146"
     CDS             148814..150130
                     /gene="murD"
                     /locus_tag="STY_RS00655"
                     /old_locus_tag="STY0146"
                     /EC_number="6.3.2.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005124612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoyl-L-alanine--D-glutamate
                     ligase"
                     /protein_id="WP_000796441.1"
                     /translation="MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGL
                     DKLPQEVERHVGGLNDEWLLAADLIVASPGIALAHPSLSAAASAGVEIVGDIELFCRE
                     AQAPIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDADRELYVLELS
                     SFQLETTSSLQAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALT
                     MPVRGADERCVSFGVNMGDYHLNRQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAA
                     LALADAVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGL
                     HVDGTLHLLLGGDGKSADFSPLARYLTGDRIRLYCFGRDGAQLAALRPEIAQQTETME
                     EAMRLLAPHVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKELG"
     gene            150130..151374
                     /gene="ftsW"
                     /locus_tag="STY_RS00660"
                     /old_locus_tag="STY0147"
     CDS             150130..151374
                     /gene="ftsW"
                     /locus_tag="STY_RS00660"
                     /old_locus_tag="STY0147"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsW"
                     /protein_id="WP_001239803.1"
                     /translation="MRLSLPRLRMPRVPGFGLLAWLFAALKGWVMASRDKDADSLIMY
                     DRTLLWLTFGLAAIGFVMVTSASMPVGQRLANDPFLFAKRDALYIFLAFCLAMVTLRL
                     PMTFWQKYSTTMLIASIIMLLIVLVVGSSVNGASRWIALGPLRIQPAEFTKLSLFCYL
                     ANYLVRKVDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAK
                     LWQFIAIIGMGISAVILLILAEPYRIRRVTSFWNPWEDPFGSGYQLTQSLMAFGRGEI
                     WGQGLGNSVQKLEYLPEAHTDFIFAIIGEELGYIGVVLALLMVFFVAFRAMSIGRKAL
                     EIDHRFSGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIM
                     FLLRIDYETRLEKAQAFTRGSR"
     gene            151371..152438
                     /gene="murG"
                     /locus_tag="STY_RS00665"
                     /old_locus_tag="STY0148"
     CDS             151371..152438
                     /gene="murG"
                     /locus_tag="STY_RS00665"
                     /old_locus_tag="STY0148"
                     /EC_number="2.4.1.227"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyldiphospho-muramoylpentapeptide
                     beta-N-acetylglucosaminyltransferase"
                     /protein_id="WP_000016622.1"
                     /translation="MSGQPKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTSDR
                     MEADLVPKHGIDIDFIRISGLRGKGVKALLAAPLRIFNAWRQARAIMKRFKPDVVLGM
                     GGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATTVMQAFPGAFPNAEVVGN
                     PVRTDVLALPLPQVRLAGRDGPIRVLVVGGSQGARVLNQTMPQVAARLGDTVTIWHQS
                     GKGAQLTVEQAYAGAGQPQHKVTEFIDGMAAAYAWADVVVCRSGALTVSEIAAAGLPA
                     IFVPFQHKDRQQYWNALPLENAGAAKIFEQPQFTVEAVADTLAGWSREALLTMAERAR
                     AVSIPDATERVASEVSRVART"
     gene            152557..154032
                     /gene="murC"
                     /locus_tag="STY_RS00670"
                     /old_locus_tag="STY0149"
     CDS             152557..154032
                     /gene="murC"
                     /locus_tag="STY_RS00670"
                     /old_locus_tag="STY0149"
                     /EC_number="6.3.2.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate--L-alanine ligase"
                     /protein_id="WP_001096072.1"
                     /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGY
                     QISGSDLAPNPVTQQLTSLGATIFFNHRPENVRDASVVVVSSAISADNPEIVAAHEAR
                     IPVIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAG
                     VHARLGHSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFL
                     HNLPFYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLR
                     QGMPDLHVTLNAPGRHNALNAAAAVAVATEEGIDDDAILRALESFQGTGRRFDFLGEF
                     PLEPVNGKAGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRYTRTRDLYD
                     DFANVLTQVDALLMLDVYPAGEAPIPGADSRSLCRTIRNRGKIDPILVSDPAQVATML
                     APVLTGNDLILVQGAGNVGKIARYLSEIKLKPQIQEEEQHG"
     gene            154025..154945
                     /locus_tag="STY_RS00675"
                     /old_locus_tag="STY0150"
     CDS             154025..154945
                     /locus_tag="STY_RS00675"
                     /old_locus_tag="STY0150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--D-alanine ligase"
                     /protein_id="WP_000763895.1"
                     /translation="MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQE
                     VDVAQLKAMGFQKVFIALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKL
                     LWQGAGLPVAPWVALTRAEFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEE
                     NALQGALSLAFQHDDEILIEKWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLS
                     DETQYFCPAGLEASQEAALQSLVLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPG
                     MTSHSLVPMAARQAGMSFSQLVVRILELAD"
     gene            154947..155777
                     /gene="ftsQ"
                     /locus_tag="STY_RS00680"
                     /old_locus_tag="STY0151"
     CDS             154947..155777
                     /gene="ftsQ"
                     /locus_tag="STY_RS00680"
                     /old_locus_tag="STY0151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsQ"
                     /protein_id="WP_000075728.1"
                     /translation="MSQAALNTRNSDEETPSSRRNNGTRLAGILFLLTVLCTVFVSGW
                     VVLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQAILALGAPGTFMTQDVNIIQSQIER
                     LPWIKQASVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPSDRIGKQVLPML
                     YGPEGSASEVLQGYREMGQVLAKDKFTLKEAAMTARRSWQLTLNNGIKLNLGRGDTMK
                     RLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESNQQQNQAQAEQQ
                     "
     gene            155774..157036
                     /gene="ftsA"
                     /locus_tag="STY_RS00685"
                     /old_locus_tag="STY0152"
     CDS             155774..157036
                     /gene="ftsA"
                     /locus_tag="STY_RS00685"
                     /old_locus_tag="STY0152"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017374018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="WP_000588463.1"
                     /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSR
                     GMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE
                     EVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHL
                     ITCHNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDI
                     AVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVE
                     VPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVL
                     TGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLN
                     GEAEVEKRVTASVGSWIKRLNSWLRKEF"
     gene            157097..158248
                     /gene="ftsZ"
                     /locus_tag="STY_RS00690"
                     /old_locus_tag="STY0153"
     CDS             157097..158248
                     /gene="ftsZ"
                     /locus_tag="STY_RS00690"
                     /old_locus_tag="STY0153"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015965916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="WP_000462798.1"
                     /translation="MFEPMELTNDAVITVIGVGGGGGNAVEHMVRERIEGVEFFAVNT
                     DAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALEGADMVFIAA
                     GMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSL
                     ITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMS
                     EMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFE
                     TVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQP
                     VLDRYQQHGMAPLTQEQKTVAKVVNDNAPQAAKEPDYLDIPAFLRKQAD"
     gene            158349..159266
                     /gene="lpxC"
                     /locus_tag="STY_RS00695"
                     /old_locus_tag="STY0154"
     CDS             158349..159266
                     /gene="lpxC"
                     /locus_tag="STY_RS00695"
                     /old_locus_tag="STY0154"
                     /EC_number="3.5.1.108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000595491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-acyl-N-acetylglucosamine deacetylase"
                     /protein_id="WP_000595474.1"
                     /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDL
                     NPPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIP
                     IMDGSAAPFVYLLLDAGIDALNCAKKFVRIKETVRVEDGDKWAEFRPYNGFTLDFTID
                     FNHPAIDSSSQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVV
                     DDYRVLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVL
                     AKQEAWEFVTFQDDAELPLAFKAPSTVLA"
     gene            159548..160045
                     /gene="secM"
                     /locus_tag="STY_RS00700"
     CDS             159548..160045
                     /gene="secM"
                     /locus_tag="STY_RS00700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_308128.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secA regulator SecM"
                     /protein_id="WP_000014336.1"
                     /translation="MSGILTRWRQLGRRYFWPHLLLGMVAASFGLPALSNAAETNTPA
                     RTTASTASKVNFSHLALLEASNRRPNFTVDYWHQHAIRTVIRHLSFAMAPQTLPVADA
                     PSPLQAHHIALLNTLSAMLTQEGTPPAIVRRLSLAYFAPQTAFSIPAWISQAQGIRAG
                     PQRLS"
     gene            160107..162812
                     /gene="secA"
                     /locus_tag="STY_RS00705"
                     /old_locus_tag="STY0156"
     CDS             160107..162812
                     /gene="secA"
                     /locus_tag="STY_RS00705"
                     /old_locus_tag="STY0156"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="WP_000905763.1"
                     /translation="MLIKLLTKVFGSRNDRTLRRMRKAVSLINAMEPEMEKLSDDELK
                     AKTNEFRARIGKGESVESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEM
                     RTGEGKTLTATLPAYLNALSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMSVGINLPG
                     MPAPAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDE
                     ARTPLIISGPAEDSSEMYKKVNKIIPHLIRQEKEDSDTFQGEGHFSVDEKARQVNLTE
                     RGLVLIEELLVQEGIMDEGESLYSPGNIMLMHHVTAALRAHALFTRDVDYIVKDGEVI
                     IVDEHTGRTMQGRRWSDGLHQAVEAKEGVEIQNENQTLASITFQNYFRLYEKLAGMTG
                     TADTEAFEFSSIYKLDTVVVPTNRPMIRKDLPDLVYITEAEKIQAIIEDIKERTANGQ
                     PVLVGTISIEKSEVVSRELTKAGIKHNVLNAKFHANEAGIVAQAGYPAAVTIATNMAG
                     RGTDIMLGGSWQAEVAALEAPTEEQIAQIKADWQVRHDAVLAAGGLHIIGTERHESRR
                     IDNQLRGRSGRQGDPGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVT
                     KAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIYTQRNELLDVSDVSDTINSIRED
                     VFKATIDAYIPPQSLEEMWDIPGLQERLKNDFDLEMPIAEWLDKEPELHEETLRERIL
                     AQSIEVYQRKEEVVGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKD
                     PKQEYKRESFAMFAAMLESLKYEVISTLSKVQVRMPEEVEAMEMQRREEAERLAQMQQ
                     LSHQDDDAAVAADLAAQTGERKIGRNDPCPCGSGKKYKQCHGRLS"
     gene            162968..163363
                     /gene="mutT"
                     /locus_tag="STY_RS00710"
                     /old_locus_tag="STY0157"
     CDS             162968..163363
                     /gene="mutT"
                     /locus_tag="STY_RS00710"
                     /old_locus_tag="STY0157"
                     /EC_number="3.6.1.55"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000736055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="8-oxo-dGTP diphosphatase MutT"
                     /protein_id="WP_000736063.1"
                     /translation="MKKLQIAVGIIRNPNDEIFITRRAADAHMANKLEFPGGKIEAGE
                     TPEQALIRELQEEVGITPTQVTLFDTLEYQFPDRHITLWFWLVERWEGEPWGKEGQPG
                     RWIAQNALNTDDFPPANEPIIRKLRQFAP"
     gene            complement(163397..164386)
                     /locus_tag="STY_RS00715"
                     /old_locus_tag="STY0158"
     CDS             complement(163397..164386)
                     /locus_tag="STY_RS00715"
                     /old_locus_tag="STY0158"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014914155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="WP_001200039.1"
                     /translation="MQYRTLGANGPRVSAIGLGCMGMSAFYGAHDDSTSIKTLHYALD
                     QGVTLLDTADMYGPYTNERLVGRAIADRRDRVFLATKFGIVLDPANPMARGVNGRPEY
                     VRRSCEQSLQRLGVDHIDLYYQHRVDPSVPIEETVGAMADLVREGKVRYLGLSEASTQ
                     TLERAHNVHPITALQSEYSLWSREAEISALSTCERLGIGFVAYSPLGRGFLTGTIKTP
                     EDFAANDFRRTNPRFMGENFSRNLRLAEAIKQMAREKECTPAQLALAWLLARNRHLVP
                     IPGTRHCARVDENLGALSLTLSPQELAAIEAVFPHDAAAGPRYWPEIMSTLNR"
     gene            164472..165413
                     /locus_tag="STY_RS00720"
                     /old_locus_tag="STY0159"
     CDS             164472..165413
                     /locus_tag="STY_RS00720"
                     /old_locus_tag="STY0159"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001697068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_001802116.1"
                     /translation="MKAGLIMRHDVMSVLHAFCMIAENHSFTRAAAQLHISTSALSQN
                     MRQLEDELGVKLLNRTTRRVGLTEAGHAFLASIRPALNHIDEAMEHACQSRDIPGGTL
                     RLTVPRTAATLLLQPNLAGFMRDYPDIRLDIDVNDGFVDLINERFDAGIRFGDAVQLD
                     MNVVPLGDVLRPAIVASPAYLARFGTPLHPQELINHRCLCHRFTRESGLYRWEFVHGA
                     QRLEITPEAALMVNDKALRLSAARDGAELTYVFEQDVHEDLQDGRLCSVLEEWLPAAD
                     RFYLYYPGRAHMAPKLRVFIDYFCHKAILPSQQSYHR"
     gene            complement(165410..165601)
                     /gene="yacG"
                     /locus_tag="STY_RS00725"
                     /old_locus_tag="STY0160"
     CDS             complement(165410..165601)
                     /gene="yacG"
                     /locus_tag="STY_RS00725"
                     /old_locus_tag="STY0160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase inhibitor YacG"
                     /protein_id="WP_001286419.1"
                     /translation="MSDVTVVNCPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEE
                     KRIASSGDQSDSDDWSEER"
     gene            complement(165611..166354)
                     /gene="zapD"
                     /locus_tag="STY_RS00730"
                     /old_locus_tag="STY0161"
     CDS             complement(165611..166354)
                     /gene="zapD"
                     /locus_tag="STY_RS00730"
                     /old_locus_tag="STY0161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapD"
                     /protein_id="WP_000557441.1"
                     /translation="MHTQVLFEHPLNEKMRTWLRIEFLIQQLSINLPIADHAGALHFF
                     RNISDLLDVFERGEVRTELLKELERQQRKLQAWVEVPGVDQDRIEALRQQLKSAGSVL
                     ISAPRIGQQLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLQQAQRDAQIESWLAS
                     LNPLTQALTLVLDLIRNSAPFRKQTSLNGFYQDNGDDADLLRLMLTLDSQLYPQISGH
                     KSRFAIRFMPLDSENGLVPERLDFELACC"
     gene            complement(166354..166974)
                     /gene="coaE"
                     /locus_tag="STY_RS00735"
                     /old_locus_tag="STY0162"
     CDS             complement(166354..166974)
                     /gene="coaE"
                     /locus_tag="STY_RS00735"
                     /old_locus_tag="STY0162"
                     /EC_number="2.7.1.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="WP_001270913.1"
                     /translation="MRYTVALTGGIGSGKSTVADAFADLGITVIDADIIARQMVEPGQ
                     PALNAIAEHFGSELIAADGTLRRRALRERIFSHPEEKAWLNALLHPLIQQETQRQFQQ
                     ATSPYVLWVVPLLVENRLYQKANRVLVVDVTPETQLIRTMQRDDVTREHVEHILAAQA
                     TREARLAVADDVIDNNGAPDAIASDVARLHASYLKLASQFVSQEKP"
     gene            167200..168243
                     /locus_tag="STY_RS00740"
                     /old_locus_tag="STY0163"
     CDS             167200..168243
                     /locus_tag="STY_RS00740"
                     /old_locus_tag="STY0163"
                     /EC_number="1.7.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008461816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMP reductase"
                     /protein_id="WP_001217357.1"
                     /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQTW
                     SGVPIIAANMDTVGTFEMAQALAGFDILTAVHKHYSVEEWAAFINTASADVLKHVMVS
                     TGTSDADFEKTVQILALNPALNFVCIDVANGYSEHFVQFVAKAREAWPSKTICAGNVV
                     TGEMCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVS
                     DGGCTMPGDVAKAFGGGADFVMLGGMLAGHEESGGSVVEENGEKFMLFYGMSSESAMN
                     RHVGGVAKYRAAEGKTVKLPLRGPVGNTARDILGGLRSACTYVGASRLKELTKRTTFI
                     RVQEQENRIFNSL"
     gene            complement(168274..169476)
                     /gene="hofC"
                     /locus_tag="STY_RS00745"
                     /old_locus_tag="STY0164"
     CDS             complement(168274..169476)
                     /gene="hofC"
                     /locus_tag="STY_RS00745"
                     /old_locus_tag="STY0164"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein transport protein HofC"
                     /protein_id="WP_000114107.1"
                     /translation="MSVKQLWRWQGVNDKGQLEQDVVWVDNRLALIITLQHQRIMPLR
                     IKRISVNAALWKEEQSAEIIHQLATLIHAGLTLSEGLELLAKQHPHRQWQALLRTLAH
                     ELEQGVPFSSALVSWPQVFPPLYQTMIRTGELTGKLAECCFELARQQKAQRQITVSVK
                     KALRYPAIILTMAALVVFAMLHFVLPEFAAIYRSFNTPLPLLTRGIIAIAQWGPAWGW
                     LILFLTMLVAIAHRRLKQKPSWQAQRQRLLLRLPVMGRLIRGQKLAQIFTVLALTQSA
                     GIPFLQGLESAIDSLGCPYWSQRLTQVHQEIAAGNPVWLALKNTQEFSPLCLQLVRTG
                     EASGSLDIMLHNLARHHSESTLALADNLASLLEPALLIITGLIIGTLVVAMYLPIFHL
                     GDAMSGMG"
     gene            complement(169466..170851)
                     /gene="gspE"
                     /locus_tag="STY_RS00750"
                     /old_locus_tag="STY0165"
     CDS             complement(169466..170851)
                     /gene="gspE"
                     /locus_tag="STY_RS00750"
                     /old_locus_tag="STY0165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein GspE"
                     /protein_id="WP_000650611.1"
                     /translation="MKDAQLNTLCQRHQAVLINSASNSITVAVVDAPSHALLDALHFA
                     TQKQIDIVCWTRQQMENHRHKPDQAPSTNAAKGGETAAQLLNQTLRSAMAKRASDIHL
                     EPGASRYRIRLRIDGVLHILQDIAKETGLALTARLKVLGNLDIAEHRLPQDGQFTVDL
                     TGDSISFRIATLPCKEGEKVVLRLLHQVEQTLDLDTLGMYGAQLTAFRQALQQPQGLV
                     LVTGPTGSGKTVTLYSALQTRNTPGINLCSVEDPIEIPLDGINQTQIHPRAGLTFQNV
                     LRALLRQDPDIIMVGEIRDGDTAEIAIKAAQTGHLVLSTLHTNSTSETLIRLQQIGVT
                     RWMISSALTLVVAQRLVRKLCPHCKQRLSDPVVLSPNLWPSALPRWQANGCQHCYHGF
                     YGRTALFEVLTVTPALRQLIASGASAQALEAHLQQTGTGTLFENGCRAVEQGMTSFEE
                     ILRVLGMPHER"
     gene            complement(170861..171298)
                     /gene="ppdD"
                     /locus_tag="STY_RS00755"
                     /old_locus_tag="STY0166"
     CDS             complement(170861..171298)
                     /gene="ppdD"
                     /locus_tag="STY_RS00755"
                     /old_locus_tag="STY0166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin peptidase-dependent pilin"
                     /protein_id="WP_000414989.1"
                     /translation="MEKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQ
                     TFVPYRTAVELCALEHGGTSTCDAGVNGIPSPVITRYVSGMSVEKGVITLTGQESLSG
                     LSVIMTPAWDNANGITGWTRNCNIQSDSALQQACEDVFRFDAN"
     gene            complement(171520..172413)
                     /gene="nadC"
                     /locus_tag="STY_RS00760"
                     /old_locus_tag="STY0167"
     CDS             complement(171520..172413)
                     /gene="nadC"
                     /locus_tag="STY_RS00760"
                     /old_locus_tag="STY0167"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylating nicotinate-nucleotide
                     diphosphorylase"
                     /protein_id="WP_001135134.1"
                     /translation="MPPRRYNPDDRRDALLERINLDIPAAVAQALREDLGGEVDAGND
                     ITAQLLPADTQAHATVITREDGVFCGKRWVEEVFIQLAGDDVRLTWHVDDGDAIHANQ
                     TVFELNGPARVLLTGERTALNFVQTLSGVASEVRRYVGLLAGTQTQLLDTRKTLPGLR
                     TALKYAVLCGGGANHRLGLTDAFLIKENHIIASGSVRQAVEKAFWLHPDVPVEVEVEN
                     LDELDDALKAGADIIMLDNFNTDQMREAVKHVNGQARLEVSGNVTAETLREFAETGVD
                     FISVGALTKHVRALDLSMRFC"
     gene            172501..173064
                     /gene="ampD"
                     /locus_tag="STY_RS00765"
                     /old_locus_tag="STY0168"
     CDS             172501..173064
                     /gene="ampD"
                     /locus_tag="STY_RS00765"
                     /old_locus_tag="STY0168"
                     /EC_number="3.5.1.28"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,6-anhydro-N-acetylmuramyl-L-alanine amidase
                     AmpD"
                     /protein_id="WP_000936326.1"
                     /translation="MLPDKGWLVEARRVPSPHYDCRPDDEKPSLLVVHNISLPPGEFG
                     GPWIDALFTGTIDPDAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSNY
                     QGRERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRTLIACYPAIADNMTGHCNIAPD
                     RKTDPGPAFDWPRFRALVALSSHKEMT"
     gene            173061..173915
                     /gene="ampE"
                     /locus_tag="STY_RS00770"
                     /old_locus_tag="STY0169"
     CDS             173061..173915
                     /gene="ampE"
                     /locus_tag="STY_RS00770"
                     /old_locus_tag="STY0169"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase regulator AmpE"
                     /protein_id="WP_000172040.1"
                     /translation="MTLFTTLLVLIVERLFKLGEHWQLDHRLEALFRRITHFSMLRTM
                     GMTAIAMVVTFLLLQALKGLLFNVPTLVVWILLGVLCIGAGKVRVHYHAWLKAASRND
                     PHPCEAMASELTLIHGVPPDCNEREFLRELQNALLWINFRFYLAPLFWFIVGGPWGPV
                     TLVGYAFLRAWQTWLARYQTPHQRLQSGIDAILHVLDWIPVRLAGVVYALLGHGEKAL
                     PAWFASLADLHTSQYQVLTRLAQFSLVREPHTDKVETPKAAVSMAKKASFVVVVIIAL
                     LTIYGALV"
     gene            complement(174007..174957)
                     /locus_tag="STY_RS00775"
                     /old_locus_tag="STY0170"
     CDS             complement(174007..174957)
                     /locus_tag="STY_RS00775"
                     /old_locus_tag="STY0170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="family 43 glycosylhydrolase"
                     /protein_id="WP_000024772.1"
                     /translation="MANWPNPFIEQRADPFILRDGSDYYFIASVPEYDRLEIRRADSL
                     EGLRAADPVVVWRKPESGPMSQLIWAPEMHRINGKWYIYFAATHTQALDKLGMFQHRM
                     FALECADADPLTGKWTEKGQIKTPFDTFSLDATTFYHQGKQWYLWAQKAPDIAGNSNI
                     YLAELENPWTLKGEPVRLSKPEYDWECRGFWVNEGPAVVVHGDKLFISYSASATDENY
                     CMGLLWINVNDDPRDPANWHKSPRPVFTTSYENRQYGPGHNSFTQTSEGEDVLVYHAR
                     NYTEIEGDPLYDPNRHTRLKRVRWDENGMPDFGVPPADTI"
     gene            complement(174957..176363)
                     /locus_tag="STY_RS00780"
                     /old_locus_tag="STY0171"
     CDS             complement(174957..176363)
                     /locus_tag="STY_RS00780"
                     /old_locus_tag="STY0171"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_000357550.1"
                     /translation="MDKGRLSVREKIGYGMGDAGYNIIFGAIMLFVNYFYTDIFGLAP
                     ALVGVLLLSVRVIDAVTDPVMGALADRTQSKYGRFRPWLLWIAFPYALFSVLMFTTPD
                     WGYNSKVIYAFVTYFLLSVTYTAINIPYCSLGGVITNDPKERVACQAYRFVLVGIATL
                     LLSLTLLPMVDWFGDGDKAKGYQLAMTVLAIIGMGMFLFCFASVRERVRPAVPTHDDM
                     KNDFKDVWKNDQWVRILLLTLCNVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVV
                     GMMIGSMLAKVLTDRWCKLKVFFWTNIALAIFSCAFYFFDPKATVMIVALYFLLNILH
                     QIPSPLHWSLMADVDDYGEWKTGKRITGISFSGNLFFLKLGLAIAGAMVGFLLSWYGY
                     DASAKAQSASAMNGIMLLFTVIPGVGYLITAGVVRLLKVDRELMKKIQDDLEKRRTNY
                     RELSELQELKAAESVRKA"
     gene            complement(176527..177900)
                     /gene="aroP"
                     /locus_tag="STY_RS00785"
                     /old_locus_tag="STY0173"
     CDS             complement(176527..177900)
                     /gene="aroP"
                     /locus_tag="STY_RS00785"
                     /old_locus_tag="STY0173"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid transporter AroP"
                     /protein_id="WP_000969487.1"
                     /translation="MMDSQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSA
                     GPGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVL
                     YVLVAMAELTAVGKYIQFWYPEIPTWASAAAFFVIINAINLTNVKVFGEMEFWFAIIK
                     VIAVIAMILFGAWLLFSDTAGPQATVRNLWEQGGFLPHGWTGLVMMMAIIMFSFGGLE
                     LVGITAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLLPWTRVTADTSPFVLIF
                     HELGDTFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLNVDKRGVPV
                     SSILVSAVVTALCVLLNYLAPESAFGLLMALVVSALVINWAMISLAHMMFRRAKQQQG
                     VKTRFPALFYPFGNVLCLLFMAAVLIIMLMTPGMAISVWLIPVWLLILGVGYLCKEKT
                     AKTVKAH"
     gene            178463..179227
                     /gene="pdhR"
                     /locus_tag="STY_RS00790"
                     /old_locus_tag="STY0174"
     CDS             178463..179227
                     /gene="pdhR"
                     /locus_tag="STY_RS00790"
                     /old_locus_tag="STY0174"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase complex transcriptional
                     repressor PdhR"
                     /protein_id="WP_000331771.1"
                     /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQF
                     DVSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQFDLLE
                     TRHALEGIAAYYAALRSTDEDKDRIRELHHAIELAQESGDLDAESEAVLQYQIAVTEA
                     AHNVVLLHLLRCMEPMLAQNVRQNFELLYARREMLPLVSTHRTRIFEAIMAGKPEEAR
                     EASHRHLAFIEEIMLDRSREESRRERALRRLEQRKN"
     gene            179387..182050
                     /gene="aceE"
                     /locus_tag="STY_RS00795"
                     /old_locus_tag="STY0175"
     CDS             179387..182050
                     /gene="aceE"
                     /locus_tag="STY_RS00795"
                     /old_locus_tag="STY0175"
                     /EC_number="1.2.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008814576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase (acetyl-transferring),
                     homodimeric type"
                     /protein_id="WP_000003851.1"
                     /translation="MSERFQNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLSEA
                     RKGGVKVAAGAGASNYINTIAVEDEPEYPGNLELERRIRSAIRWNAIMTVLRASKKDL
                     ELGGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGIYARAFLEGRLTQ
                     EQMDNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLK
                     DTSKQTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIV
                     NELEGIFAGAGWNVIKVMWGGRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYV
                     REHFFGKYPETAALVADWTDEQIWALNRGGHDPKKVYAALKKAQETKGKATVILAHTI
                     KGYGMGDTAEGKNIAHQVKKMNMDGVRYVRDRFNVPVADADLEKLPYITFPEGSEEHK
                     YLHERRQALHGYLPSRQPNFTEKLELPQLSDFGALLEEQSKEISTTIAFVRALNVMLK
                     NKSIKDRLVPIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQIL
                     QEGINELGAGASWLAAATSYSTNDLPMIPFYIYYSMFGFQRIGDLCWQAGDQQARGFL
                     IGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEK
                     QENVYYYITTLNENYHMPAMPAGAEEGIRKGIYKLETLEGSKGKVQLLGSGSILRHVR
                     EAAEILAKDYGVGSDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPA
                     VASTDYMKLFAEQVRTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGE
                     LAKRGEIDKKVVADAITKFNIDADKVNPRLA"
     gene            182065..183954
                     /gene="aceF"
                     /locus_tag="STY_RS00800"
                     /old_locus_tag="STY0176"
     CDS             182065..183954
                     /gene="aceF"
                     /locus_tag="STY_RS00800"
                     /old_locus_tag="STY0176"
                     /EC_number="2.3.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459158.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase complex
                     dihydrolipoyllysine-residue acetyltransferase"
                     /protein_id="WP_000963602.1"
                     /translation="MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASM
                     EVPSPQAGVVKEIKVSVGDKTETGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAA
                     AAAKDVHVPDIGSDEVEVTEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEI
                     KVNTGDKVSTGSLIMVFEVAGEAGAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDE
                     VEVTEVMVKVGDKVTAEQSLITVEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIM
                     VFEVEGAAPAAAPAKQEAAAPAPAAKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRR
                     LAREFGVNLAKVKGTGRKGRILREDVQAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVD
                     FSKFGEVEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKR
                     KLDVKYTPVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVP
                     VFKDVNKKSVTELSRELTTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNA
                     PEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSFDHRVIDGADGARFITIINNMLSDI
                     RRLVM"
     gene            184156..185580
                     /gene="lpdA"
                     /locus_tag="STY_RS00805"
                     /old_locus_tag="STY0177"
     CDS             184156..185580
                     /gene="lpdA"
                     /locus_tag="STY_RS00805"
                     /old_locus_tag="STY0177"
                     /EC_number="1.8.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001738005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoyl dehydrogenase"
                     /protein_id="WP_001527420.1"
                     /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGV
                     CLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVITQLTGGLA
                     GMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDP
                     RVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDI
                     VKVFTKRISKKFNLMLETKVTAVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPN
                     GKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEV
                     IAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDC
                     ADGMTKLIFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHE
                     SVGLAAEIFEGSITDLPNPKAKKK"
     gene            185869..186153
                     /locus_tag="STY_RS00810"
                     /old_locus_tag="STY0178"
     CDS             185869..186153
                     /locus_tag="STY_RS00810"
                     /old_locus_tag="STY0178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="WP_000765363.1"
                     /translation="MKLFLTTAALTATLISGMAFASDPVIPWATNSGGTESTHIAAMG
                     EDLNAQHQQITHTHEGVWAANSGSIQADEAALTSNKPPVQGHPELMPHQG"
     gene            complement(186191..186982)
                     /locus_tag="STY_RS00815"
                     /old_locus_tag="STY0179"
     CDS             complement(186191..186982)
                     /locus_tag="STY_RS00815"
                     /old_locus_tag="STY0179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2950 family protein"
                     /protein_id="WP_000757452.1"
                     /translation="MKKVMLSALLLSLPLLGYAQERFPSPEAAASAFAAAVAGKNETQ
                     LTALLGDDWRQFLPPEGADPEAVARFNRDWREGHRIVQKDNTAHLNVGREDWQLPVPM
                     VKETGGWRFDMAAAGNEILTRTIGRNELSTLQAMHAYVDAQQDYYLQNHRWAHRIISS
                     EGQKDGLYWPTKAGDVPSPLGPNFSPAAPDEGYHGYHFRIISDNDGHGAALLAWPMHY
                     GETGVMSFMVNQDDRIYQADLGKETESKVQAITRFAPDAQWQVAE"
     gene            complement(186995..188617)
                     /locus_tag="STY_RS00820"
                     /old_locus_tag="STY0180"
     CDS             complement(186995..188617)
                     /locus_tag="STY_RS00820"
                     /old_locus_tag="STY0180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459162.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3300 domain-containing protein"
                     /protein_id="WP_000174529.1"
                     /translation="MTLPFKPHLIALVCSAGLFAASGVLYVKSRAPEAPAQAAAPTSE
                     PTQTAVPAPVAKTTFTTAQIDQWVAPVALYPDALLSQVLMASTYPANVVQAVQWSRDN
                     PTLQGDAAIQAVASQPWDPSVKSLVAFPQLMALMGENPQWVQNLGDAFLAQPQDVMDA
                     VQRLRLLAQQTGSLKSTPQQTVTSVPKSSASTAVTTTTTTSASTPATPSTVIKIEPAN
                     PQVVYVPNYNPTTVYGAWPNTAYPPVYLPPPPGQQFADSFVKGFGYSLGVATTYALFS
                     SIDWDDDDHHHHDDDHHDDDYHHGGNGYQHNGDNININVNNFNRISGQNLPGQTMGWQ
                     HNPAWRNGVPYPNNTVAQRFHPTNVSGGLSATQQAPVSRDSQRQAAMAQFQQRSHTSP
                     ANVSGETSRDRQRKAASQQLNQIAQRNNYRGYDGTQNSSRREAAQQTLNKSTTQQHRS
                     ELKAKAQQHPVSQQQRDTARQRIESSTPQQRQAFRQNMHANVFSGNDSRSPSWQSQQL
                     RGLESRRGSHLNTEQRAAAREHFSEHHEFHRR"
     gene            189006..191603
                     /gene="acnB"
                     /locus_tag="STY_RS00825"
                     /old_locus_tag="STY0181"
     CDS             189006..191603
                     /gene="acnB"
                     /locus_tag="STY_RS00825"
                     /old_locus_tag="STY0181"
                     /EC_number="4.2.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aconitate hydratase
                     2/2-methylisocitrate dehydratase"
                     /protein_id="WP_000888954.1"
                     /translation="MLEEYRKHVAERAAQGIVPKPLDATQMAALVELLKTPPVGEEEF
                     LLDLLINRVPPGVDEAAYVKAGFLAAVAKGDTTSPLVSPEKAIELLGTMQGGYNIHPL
                     IDALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLSRP
                     PLAEKITVTVFKVTGETNTDDLSPAPDAWSRPDIPLHAQAMLKNAREGIEPDQPGVVG
                     PIKQIEALQKKGYPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPNVPNKRGGGLCLGG
                     KIAPIFFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRNHETDELLATFELKTDV
                     LIDEVRAGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESSRGFSLAQKMVGRA
                     CGVKGIRPGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPK
                     PVDVTTHHTLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISF
                     PAGSGLVAFAAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVE
                     KKGKKNIFSGRILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIVEYLTSNI
                     VLLKWMIAEGYGDRRTLERRIQGMEKWLADPQLLEADADAEYAAVIDIDLADIKEPIL
                     CAPNDPDDARLLSDVQGEKIDEVFIGSCMTNIGHFRAAGKLLDSHKGQLPTRLWVAPP
                     TRMDAAQLTEEGYYSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLG
                     TGANVFLASAELAAVAALIGKLPTPEEYQTFVAQVDKTAVDTYRYLNFDQLSQYTEKA
                     DGVIFQTAV"
     gene            191791..192153
                     /locus_tag="STY_RS00830"
                     /old_locus_tag="STY0182"
     CDS             191791..192153
                     /locus_tag="STY_RS00830"
                     /old_locus_tag="STY0182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YacL family protein"
                     /protein_id="WP_000384314.1"
                     /translation="MDYEFLRDVTGRVLVRMSMGHEVVGHWFNEEVKDNLSLLDEVEQ
                     AARTVKGSERSWQRAGHEYTIWMDGEEVMIRANQLDFSGDEMEEGMSYYDEESLSLCG
                     MEDFLRVVAAYREFVSKA"
     gene            192388..193341
                     /locus_tag="STY_RS00835"
                     /old_locus_tag="STY0183"
     CDS             192388..193341
                     /locus_tag="STY_RS00835"
                     /old_locus_tag="STY0183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-3-deoxygluconate permease 1"
                     /protein_id="WP_001022089.1"
                     /translation="MNIKKAIERVPGGMMVVPLVIGAVINTFAPQALEIGGFTTALFK
                     NGAAPLIGAFLLCMGAGISVKAAPQALLQGGTITLTKLLVAIGIGLGVEHLFGAEGIF
                     GLSGVAIIAAMSNSNGGLYAALVGEFGNERDVGAISILSLNDGPFFTMIALGAAGMAN
                     IPIMALVAVLVPLVVGMILGNLDPHMRDFLTKGGPLLIPFFAFALGAGINLEMLLQGG
                     LAGILLGVLTTFVGGFFNIRADRLVGGTGIAGAAASSTAGNAVATPLAIAQADPSLAE
                     VAAAAAPLIAASVITTAILTPVLTSWVAKKQARQASLEKNA"
     gene            193338..194609
                     /locus_tag="STY_RS00840"
                     /old_locus_tag="STY0184"
     CDS             193338..194609
                     /locus_tag="STY_RS00840"
                     /old_locus_tag="STY0184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-threonate kinase"
                     /protein_id="WP_000783298.1"
                     /translation="MKMMVIADDFTGSNDTGVQLAKKGARTEVMLSASQKPSRRADVL
                     VINTESRAMPADQAASAVYAALSPWCETSPAPLVYKKIDSTFRGNIGAEVTAAMRASQ
                     RKLAVIAAAIPAAGRTTLEGKCLVNGAPLLETEFASDPKTPIVSSRIAEIVALQSEIP
                     VYEVFLQDVRRGGLSALLTAYAAEGEGIIVVDAVEERDLTLIAQAACEQPSMPLLVGA
                     AGLANALPVELFMQDRQRLPVLVVAGSMSEATRRQVDNALCRGRAEVVDIDAARMVSD
                     SAEQEIASVVEQACALLSQHRHTILRTSRRAEDRQLIDALCEKSAMSRQQLGERLSHR
                     LGVVTLNIIEQARIGGLFLTGGDIATAVAGALGAEGYRIQSEVAPCIPCGTFVNSEID
                     DLPVITKAGGFGSDSTLCDALYYIEEMYCGD"
     gene            194599..195582
                     /locus_tag="STY_RS00845"
                     /old_locus_tag="STY0185"
     CDS             194599..195582
                     /locus_tag="STY_RS00845"
                     /old_locus_tag="STY0185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-threonate 4-phosphate dehydrogenase"
                     /protein_id="WP_000448742.1"
                     /translation="METKTVAITMGDPAGIGPEIIVKALSEDGLNGAPLVVIGCLATL
                     KCLQAKGITPNVELRAIERVAEARFAPGIIHVIDEPLAQPEALEAGKVQAQAGDLAYR
                     CVKRATELALRGDVQAIATAPLNKEALHLAGHNYPGHTELLATLTHSRDYAMVLYTDK
                     LKVIHVSTHIALRKFLDTLSTTRVETVIGIADTFLKRVGYVKPRIAVAGVNPHAGENG
                     LFGDEETRILTPAITDARAKGMDVYGPCPPDTVFLQAYEGQYDMVVAMYHDQGHIPLK
                     LLGFYDGVNITAGLPFIRTSADHGTAFDIAWTGKAKSESMAVSIKLAMQLA"
     gene            195592..196359
                     /locus_tag="STY_RS00850"
                     /old_locus_tag="STY0186"
     CDS             195592..196359
                     /locus_tag="STY_RS00850"
                     /old_locus_tag="STY0186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR/GlpR transcriptional regulator"
                     /protein_id="WP_000678254.1"
                     /translation="MKGQHRLDLIVAYLKNHTLVTVEQLVEAVDASPATIRRDLIKLD
                     EQGVISRSHGGVALRRFEPAQPTTNEKQLRSPAEKRAIARVAASLVNAGDAVVLDAGT
                     TMMELAKCLTHLPLRVITVDLHIALFLAEFRQIEVTIVGGRIDDSSQSCIGEHGRKLL
                     RSVYPNIAFMSCNSWGVKTGVTTPTEDKAGLKQEIIANAQRKVLLADSSKYGAHSLFN
                     VVPLERFNDVITDVNLPPSAQVELKGRAFALTLVQPE"
     gene            complement(196389..197183)
                     /gene="speD"
                     /locus_tag="STY_RS00855"
                     /old_locus_tag="STY0187"
     CDS             complement(196389..197183)
                     /gene="speD"
                     /locus_tag="STY_RS00855"
                     /old_locus_tag="STY0187"
                     /EC_number="4.1.1.50"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine decarboxylase"
                     /protein_id="WP_000734279.1"
                     /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYN
                     ANRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPIDPKLIDQTEHPGPLP
                     ETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDI
                     VTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVNVYQENIFHTKML
                     LKEFDLKHYMFHTKPEDLTETERQQITAALWKEMREIYYGRNISAV"
     gene            complement(197204..198064)
                     /gene="speE"
                     /locus_tag="STY_RS00860"
                     /old_locus_tag="STY0188"
     CDS             complement(197204..198064)
                     /gene="speE"
                     /locus_tag="STY_RS00860"
                     /old_locus_tag="STY0188"
                     /EC_number="2.5.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine aminopropyltransferase"
                     /protein_id="WP_000829972.1"
                     /translation="MAENTMWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFG
                     RVMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVE
                     TITMVEIDAGVVSFCRQYLPNHNAGSYDDPRFTLVIDDGVNFVNQTHQTFDVIISDCT
                     DPIGPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQDEALDSHRKLSHYFSDVGF
                     YQAAIPTYYGGIMTFAWATDNDALRHLSSEIIQARFHAAGLKCRYYNSAIHAAAFALP
                     QYLHDALSAQ"
     gene            complement(198171..198518)
                     /locus_tag="STY_RS00865"
     CDS             complement(198171..198518)
                     /locus_tag="STY_RS00865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YacC family pilotin-like protein"
                     /protein_id="WP_000846613.1"
                     /translation="MKTFFRPVLFGSLMALCANSYALTESEAEDMADLTAVFVFLKND
                     CGYQNLPNSQIRRALVFFAQQNQWDLSNYDTFDMKSLGEDSYRDLSGIGIPVAKKCKA
                     LARDSLSLLAYVK"
     gene            198720..200330
                     /gene="cueO"
                     /locus_tag="STY_RS00870"
                     /old_locus_tag="STY0190"
     CDS             198720..200330
                     /gene="cueO"
                     /locus_tag="STY_RS00870"
                     /old_locus_tag="STY0190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multicopper oxidase CueO"
                     /protein_id="WP_000946058.1"
                     /translation="MLRRDFLKYSVALGVASALPLWSRAAFAAERPALPIPDLLTADA
                     SNRMQLIVKAGQSTFAGKNATTWGYNGNLLGPAVQLHKGKSVTVDIHNQLAEDTTLHW
                     HGLEIPGIVDGGPQGIIPAGGTRTVTFTPQQRAATCWIHPHKHGKTGRQVAMGLAGLV
                     LIEDDEIRKLRLPKQWGIDDVPVIIQDKRFSADGQIDYQLDIMTAAVGWFGDTLLTNG
                     AIYPQHSAPKGWLRLRLLNGCNARSLNIAASDNRPLYVIASDGGLLAEPVKVTELPLL
                     MGERFEVLVDISDGKAFDLVTLPVSQMGMAIAPFDKPHPVMRIQPLRITASGTLPDTL
                     TTMPALPSLEGLTVRNLKLSMDPRLDMMGMQMLMKKYGAQAMSGMDHDSMNAHMQGGN
                     MGHGEMDHGNMDHSGMNHGAMGNMNHGGKFDFHNANFINGQVFDMNKPMFAAQKGRHE
                     RWVISGVGDMMLHPFHIHGTQFRILSENGKAPAAHRTGWKDTVRVEGGISEVLVKFDH
                     DAPKEHAYMAHCHLLEHEDTGMMLGFTV"
     gene            complement(200408..202798)
                     /locus_tag="STY_RS00875"
                     /old_locus_tag="STY0191"
     CDS             complement(200408..202798)
                     /locus_tag="STY_RS00875"
                     /old_locus_tag="STY0191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone-dependent
                     dehydrogenase"
                     /protein_id="WP_000829735.1"
                     /translation="MAENNARSPRLLVTLTALFAALCGLYLLIGGVWLVAIGGSWYYP
                     IAGLVMLVVAGLLWRSKRAALWLYAALLLATMIWGVWEVGFDFWALTPRSDILVFFGI
                     WLILPFVWHRLVVPSSGAVAALVVALLISGGILTWAGFNDPQEINGTLRADATPAATS
                     SSIADEDWPAYGRNQEGQRYSPLKQITADNVHQLKEAWVFRTGDLKQPNDPGEITNEV
                     TPIKVGDTLYLCTAHQRLFALDAASGKEKWHFDPQLKTDSSFQHVTCRGVSYHEAKAD
                     TASPEVIADCPSRIILPVNDGRLFAVNAETGKLCETFANKGVLNLQTNMPDTTPGLYE
                     PTSPPIITDKTIVIAGSVTDNFSTRETSGVIRGFDVNSGKLLWAFDPGAKDPNTIPAD
                     EHAFTFNSPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNATT
                     GKLAWSYQTVHHDLWDMDLPAQPTLADITVDGTTVPVIYAPAKTGNIFVLDRRNGELV
                     VPAPEKPVPQGAAKGDYVAKTQPFSDLTFRPKKDLSGADMWGATMFDQLVCRVMFHQL
                     RYEGIFTPPSEQGTLVFPGNLGMFEWGGISVDPDRQVAIANPMALPFVSKLIPRGPGN
                     PMEPPKDAKGTGTEAGIQPQYGVPFGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEI
                     VWKKRIGTPRDSMPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSN
                     GEKLWQGRLPAGGQATPMTYEVNGKQYVVISAGGHGSFGTKMGDYIVAYALPDDAK"
     gene            203004..203540
                     /gene="hpt"
                     /locus_tag="STY_RS00880"
                     /old_locus_tag="STY0192"
     CDS             203004..203540
                     /gene="hpt"
                     /locus_tag="STY_RS00880"
                     /old_locus_tag="STY0192"
                     /EC_number="2.4.2.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="WP_000683333.1"
                     /translation="MKHTVEVMIPEAEIKARIAELGRQITERYKDSDSEMVLVGLLRG
                     SFMFMADLCREVQVPHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDII
                     DSGNTLSKVREILGLREPKSLAICTLLDKPSRREVDVPVEFVGFSIPDEFVVGYGIDY
                     AQRYRHLPYVGKVVLLDE"
     gene            complement(203598..204260)
                     /gene="can"
                     /locus_tag="STY_RS00885"
                     /old_locus_tag="STY0193"
     CDS             complement(203598..204260)
                     /gene="can"
                     /locus_tag="STY_RS00885"
                     /old_locus_tag="STY0193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonate dehydratase"
                     /protein_id="WP_000651585.1"
                     /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSD
                     SRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDALEVEHIIICGHSGCG
                     GIKAAVENPELGLINNWLLHIRDIWLKHSSLLGKMPEEQRLDALYELNVMEQVYNLGH
                     STIMQSAWKRGQNVTIHGWAYSINDGLLRDLDVTATNRETLENGYHKGISALSLKYIP
                     HQ"
     gene            204369..205295
                     /locus_tag="STY_RS00890"
                     /old_locus_tag="STY0194"
     CDS             204369..205295
                     /locus_tag="STY_RS00890"
                     /old_locus_tag="STY0194"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000150644.1"
                     /translation="MTIALELQQLKKTYPGGVQALRGIDLQVEAGDFYALPGPNGAGK
                     STTIGIISSLVNKTSGRVNVFGYDLEKDVVNAKRQLGLVSQEFNFNPFETVQQIVVNQ
                     AGYYGVEHKEAVLRSEKYLKQLDLWEKRHERARMLSGGMKRRLMIARALMHEPKLLIL
                     DEPTAGVDIELRRSMWGFLKDLNAKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENT
                     SMKNLLSKLKSETFILDLAPKSPLPKLTGYQYRLVDTSTLEVEVLREQGVNSVFSQLS
                     EQGVQVLSMRNKANRLEELFVSLVHEKQGDRA"
     gene            205292..206062
                     /locus_tag="STY_RS00895"
                     /old_locus_tag="STY0195"
     CDS             205292..206062
                     /locus_tag="STY_RS00895"
                     /old_locus_tag="STY0195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001747261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_000983419.1"
                     /translation="MMQLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGN
                     LIGSRIGEMHGFSYMQFIVPGLIMMAVITNSYANVASSFFSAKFQRNIEELLVAPVPT
                     HVIIAGFVGGGVARGLCVGILVTAISLFFVPFQVHSWVFVALTLILTAILFSLAGLLN
                     AVFAKTFDDISLIPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGF
                     LGIHDVPLVTTFGVLVIFIATFYLLCWSLIQRGRGLRS"
     gene            206167..206607
                     /locus_tag="STY_RS00900"
                     /old_locus_tag="STY0196"
     CDS             206167..206607
                     /locus_tag="STY_RS00900"
                     /old_locus_tag="STY0196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIA"
                     /protein_id="WP_000901966.1"
                     /translation="MLGWVITCHDDRAQDMLDRLERKNGPLAQCRAVNFWRGLSSNML
                     SRMMCDALHATDSGEGVIFLTDISGAAPYRVASLMSHKHPQCEVISGISYSLIEEMIP
                     LRESMSSSAFRDQIVALGAPDVTSLWHQQQKNPPFVLLHDLYEF"
     gene            206669..207898
                     /locus_tag="STY_RS00905"
                     /old_locus_tag="STY0197"
     CDS             206669..207898
                     /locus_tag="STY_RS00905"
                     /old_locus_tag="STY0197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase family protein"
                     /protein_id="WP_000245324.1"
                     /translation="MVMRVVLILLFFFAGNVLAALPARYMQTTKDAAIWSQIGDKMVT
                     VGNIRAGQILSVTPVAVDYYAFKFGFGVGFIDKGHLGPVQGKQKVEDGLGDLNKPLSN
                     QNLVTWKDTPVYNAPDISSAPFGVLVDNLRYPIISKLKGRLHQTWNQIRIGDRLAYVN
                     AMDAQEDNGIPILTYHHILRDEENTRFRHTSTTTSVRAFSNQMTWLRDRGYATLTMYQ
                     LEDYIYNRANFPARAVAITFDDGLKSVSRYAYPVLKQYDMKATAFIISSRIKRHPQKW
                     NPRSLQFMSVSELRKISDVFDFQSHTHFLHRVDGHRRPILYSRSYHNILFDFERSRRA
                     LTQFTPHVFYLSYPFGGYNATAIKAAKDAGFHLAVTTVRGKVKPGDNPMLLKRLYILR
                     TDSLETMSRLIVNQPQG"
     gene            complement(207905..208285)
                     /gene="panD"
                     /locus_tag="STY_RS00910"
                     /old_locus_tag="STY0198"
     CDS             complement(207905..208285)
                     /gene="panD"
                     /locus_tag="STY_RS00910"
                     /old_locus_tag="STY0198"
                     /EC_number="4.1.1.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005124704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate 1-decarboxylase"
                     /protein_id="WP_000621526.1"
                     /translation="MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAI
                     DIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDEEARTWR
                     PKVAYFEGDNEMKRTAKAIPVQVA"
     gene            complement(208380..209234)
                     /gene="panC"
                     /locus_tag="STY_RS00915"
                     /old_locus_tag="STY0199"
     CDS             complement(208380..209234)
                     /gene="panC"
                     /locus_tag="STY_RS00915"
                     /old_locus_tag="STY0199"
                     /EC_number="6.3.2.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="WP_000905353.1"
                     /translation="MLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEA
                     KARADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPQG
                     LEGQTYVDVPGLSTMLEGTSRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIR
                     KMVADMGYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNVMNSIAEKLIAG
                     NRELQEIIAIAEQELNEKGFRADDIQIRDADTLLELTETSKRAVILAAAWLGQARLID
                     NQSVTLAQ"
     gene            complement(209360..210154)
                     /gene="panB"
                     /locus_tag="STY_RS00920"
                     /old_locus_tag="STY0200"
     CDS             complement(209360..210154)
                     /gene="panB"
                     /locus_tag="STY_RS00920"
                     /old_locus_tag="STY0200"
                     /EC_number="2.1.2.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000043003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="WP_000043003.1"
                     /translation="MSKPTTIAVLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLV
                     GDSLGMTIQGHDSTLPVTVEDIAYHTRAVRRGAPNCLLLSDLPFMAYATPEQAFENAA
                     IVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGDAG
                     QILLDDALALEAAGAQLLVLECVPVELAKRVTEALSIPVIGIGAGNVTDGQILVMHDA
                     FGITGGHIPKFAKNFLAEAGDMRAAVRQYMAEVESGVYPGEEHSFH"
     gene            complement(210264..211439)
                     /locus_tag="STY_RS00925"
     CDS             complement(210264..211439)
                     /locus_tag="STY_RS00925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000925246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_000924983.1"
                     /translation="MLLKNTTWFAAFFLMMAIMSNCYAINTTLAVGDYASSEHDGPSG
                     DSVFTDNSHNFGQTIAIHKETALRQITVFNWSGIQYVMEMFCNGSGNHTYLQLTHNYI
                     SAGKSYNGHPLYKTSIPGFYFTIEMTFLQPAENMTSSTFWFDKTSTPITSEFTEFPSA
                     CSRTNVYSNLGKLMYGLKIYAYVDSDFAPTEAQLQSFTLSKNGDSDFYIDNPGSGLSN
                     YKMKFNLAATGLKAVWPTCSASTISGTNVSGSTVKLGSFYPKQIMEGLSPTKFQINLS
                     SCQYINNIEVKLASNNVGTKNTSLLTNNSTSNTKASGIGVLIEGLKSSSSAQMVLKPN
                     DSSSIYKDTTNNTGDGSPVGSATKSLYFQATLKPDGDNPTINPGDFKATAQFSITYP"
     gene            complement(211476..212060)
                     /locus_tag="STY_RS00930"
                     /old_locus_tag="STY0202"
     CDS             complement(211476..212060)
                     /locus_tag="STY_RS00930"
                     /old_locus_tag="STY0202"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001253684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_001253683.1"
                     /translation="MRRLREPTLATLFSGLATALFSATLYADTNVNFTASVQKDTCQI
                     KIDGNGTVNFATIAPAYFADGITAETDYEGGKEFTIKLISCPISDGKITNVTFNFAPL
                     NGQFSPENQQVFPNDIATDAGGVDNVGVVIFTTDSPRTNVLNTDGSSRATFAASTYSD
                     TVWTFYSRMQKIRSAEKVTTGELSSRVLVNVSYE"
     gene            complement(212072..212680)
                     /gene="staE"
                     /locus_tag="STY_RS00935"
                     /old_locus_tag="STY0203"
     CDS             complement(212072..212680)
                     /gene="staE"
                     /locus_tag="STY_RS00935"
                     /old_locus_tag="STY0203"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000744142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein StaE"
                     /protein_id="WP_000744142.1"
                     /translation="MKKQILRVVIFSSLIATGAGISTMTYADGTNSLDLTVNANITAG
                     TCSASVVEGDTITDTIAFGNVYISEVYAKSKIKLFKLRFSDCVGLKDKKAKFRLAPNN
                     VACPGSSGTDGQFANASTSTTKAAMVAMEVWTTETPGGTGAVKLHCWSKPEQTVDLSG
                     ASVTTPVDFPLSAMMVAQSGGTLQNMTAGDFYSPTTFTITYQ"
     gene            complement(212695..213261)
                     /locus_tag="STY_RS00940"
                     /old_locus_tag="STY0204"
     CDS             complement(212695..213261)
                     /locus_tag="STY_RS00940"
                     /old_locus_tag="STY0204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001542775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_000827925.1"
                     /translation="MKRNKYLLAASVLAVIFPLTSQAENINVDFTATVLATTCSMSIA
                     ALDGSNLSGDATSGYTLNVGDVGLDKIIKKSAESQKNFKFVAKDCSAALTKITTTLAS
                     STDASGNFIKNQSAASGAATNVGMGFKRKSTTDETYFTPGSGSFSWTSDERAANEVEM
                     TVALRELTDGAGTTGAFSSTATFNFTYQ"
     gene            complement(213248..215854)
                     /locus_tag="STY_RS00945"
                     /old_locus_tag="STY0205"
     CDS             complement(213248..215854)
                     /locus_tag="STY_RS00945"
                     /old_locus_tag="STY0205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015406108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane usher protein"
                     /protein_id="WP_001125010.1"
                     /translation="MPKKTMLAVCCALFYSQSSISAESVEYDSSFLMGSSASTIDISK
                     YSDGNPTPVGTYSVKVFVNENPVSSLSIPFIDIGKVSAEACLTQKNLAQLHIKQPEIN
                     ATNQILKKGEEEDQDCLNLPVAIAHSEVNFDMGEQRLDITVPQAWLIEGYDGYVEPSL
                     WEDGIPAALLSYSANGYHSTNGSADNDSMYAAFNTGINLGAWRFRANGNYNWTKDSGS
                     SFDYQNRYLQRDLPSMRSQLVVGETYTTGETFDSVSIRGARLYSDNRMLPSQLANYAP
                     IIRGVANSNTKVSITQGGYKIYESTVPPGPFEISDISPSGYGSDLIVTVEEADGSKRT
                     FSQPFSSVMQMQRPGVGRWDFSAGEVNDDELHDKPYMAQGSYYYGLNNFLTLYTGVQG
                     TDNNYLAGLLGVGLNTPLGAFALDVTQSRTEIPEDKTYKGQSYRLTWNKLIEPTATSF
                     NVAAYRYSTQDYLGLNDALQLIDDAKHKDADDRNTMLNYSRMKNQVTVSINQPLRFKE
                     VDYGSFFLSGSWTDYWATNESRTDYSLGYGRGFSWGSLSINLQRSWDEDGEKDDSLYI
                     NFNVPLENLLGGGRRKSGFSSLTAQMRTDFDGGYQLSMNSNGSSEDHTLNYSVNTGYT
                     MQKNEKNITDVSGYASYQSPWGDVTASASANNDSSRQYSLATTGDFVLHGGGVTFTND
                     NFGNSDAIVLVKAPGAKGARINGGNSTIDRWGYGATNSLSAYRENQVNIDIDTLENDV
                     ELKSTSTTLIPRDGAVVLASFETDQGRSVILNMSRNDGKALPFGAEVYENDVQIDNMG
                     QGGQAFVRGISDAGELSVRWFEENQPATCLATFALPATQQTVGSSQTLLLDHITCRVN
                     NLKSNGIDNEKE"
     gene            complement(215914..216648)
                     /locus_tag="STY_RS00950"
                     /old_locus_tag="STY0206"
     CDS             complement(215914..216648)
                     /locus_tag="STY_RS00950"
                     /old_locus_tag="STY0206"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000967611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial chaperone"
                     /protein_id="WP_000967611.1"
                     /translation="MLYVKKSLTAIVLASAVFSTFSYADIIISGTRIVYDENKKDVSI
                     RLENKGTRPLLVQNWIDLGNDNDDPGSIKAPFVSTPPVSRVEPKRGQSVKIMYTQASA
                     LPKDRESVFWFNVLEVPPKADTSKEENKSLLQLAFRTRIKLFYRPTGLKGQPAEAAKQ
                     LKWQIASEQGYAVLRADNSTPYFVSFNDATYTAGGKRYDVEATMVAPFSKSSFTVKGL
                     SGASAGKLEYHAINDFGGLIEGSVSL"
     gene            complement(216827..217411)
                     /locus_tag="STY_RS00955"
                     /old_locus_tag="STY0207"
     CDS             complement(216827..217411)
                     /locus_tag="STY_RS00955"
                     /old_locus_tag="STY0207"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000709193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_000709193.1"
                     /translation="MKKAILAAAMVMAMGSTSAMAVEGGQIEFHGLVSATTCSKVVSS
                     SRGNQATDGDVYLTTAAPGDITEGVAANAYGALPAPFSIILDCSGAADVTDATKASLV
                     MDSSFSNTTGTLDNDTTLSVAGETGAENVNIAIHDADTKTQVKIDGAEIHEASFKNKV
                     ATYNFMASYVRADASKEVTTGHVTTNAMYTFTYQ"
     gene            complement(217806..218285)
                     /gene="folK"
                     /locus_tag="STY_RS00960"
                     /old_locus_tag="STY0208"
     CDS             complement(217806..218285)
                     /gene="folK"
                     /locus_tag="STY_RS00960"
                     /old_locus_tag="STY0208"
                     /EC_number="2.7.6.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000150775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine diphosphokinase"
                     /protein_id="WP_000150775.1"
                     /translation="MTIAYIALGSNLASPLEQVNAALKAIADIPDSRIVAVSSFYRTP
                     PLGPQDQPDYLNAAVALDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLF
                     GDEVINTDRLTVPHYDMKNRGFMLWPLFEIAPELVFPDDKGLLIELMSQMSPCPDRW"
     gene            complement(218282..219700)
                     /gene="pcnB"
                     /locus_tag="STY_RS00965"
                     /old_locus_tag="STY0209"
     CDS             complement(218282..219700)
                     /gene="pcnB"
                     /locus_tag="STY_RS00965"
                     /old_locus_tag="STY0209"
                     /EC_number="2.7.7.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polynucleotide adenylyltransferase PcnB"
                     /protein_id="WP_000174623.1"
                     /translation="MTLPRCAIFTRVANFCRKVLSREESEAEQAVARPHMTIIPREQH
                     AISRKDISENALKVLYRLNKAGYEAYLVGGGVRDLLLGKKPKDFDVTTNATPDQVRKL
                     FRNCRLVGRRFRLAHVMFGPEIIEVATFRGHNEGSESDRTTSQRGQNGMLLRDNIFGS
                     IEEDAQRRDFTINSLYYSVADFTVRDYVGGMQDLQEGVIRLIGNPETRYREDPVRMLR
                     AVRFAAKLNMRISPETAEPIPRLATLLNDIPPARLFEESLKLLQAGNGFETYQQLREY
                     HLFQPLFPTITRYFTENGDSAMERIIAQVLKNTDNRIRNEMRVNPAFLFAAMFWYPLL
                     EMAQKIAQESGLAYYDAFALAMNDVLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQG
                     KRAWKLMEHPKFRAAFDLLELRAQVENNTELQRLAQWWAEFQASAPPEQKGMLNELDD
                     DPAPRRRRSRPRKRAPRREGTV"
     gene            complement(219841..220782)
                     /gene="gluQRS"
                     /locus_tag="STY_RS00970"
                     /old_locus_tag="STY0210"
     CDS             complement(219841..220782)
                     /gene="gluQRS"
                     /locus_tag="STY_RS00970"
                     /old_locus_tag="STY0210"
                     /EC_number="6.1.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459190.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA glutamyl-Q(34) synthetase GluQRS"
                     /protein_id="WP_000145630.1"
                     /translation="MTGGSFPALFFIARSMTDSHYIGRFAPSPSGELHFGSLIAALGS
                     YLQARAQRGVWRVRIEDIDPPREVPGAAATILRQLEHYGLHWDGEVLWQSQRHEAYRE
                     ALAWLHEQGLSYYCTCPRSRIQRLGGIYDGHCRTLCHGPENAAVRIKQQHPVMHFHDA
                     LRGDIQADPQLASEDFIIHRRDGLFAYNLAVVVDDHFQGVTEIVRGADLIEPTVRQLS
                     LYKQFGWRAPGYVHLPLALNEQGAKLSKQNHAPALATGDPRPVLVQALRFLGQRDVVA
                     WQEMSVEELLRFAVAHWRLTAVPTSANVNPAFSNASR"
     gene            complement(220806..221261)
                     /gene="dksA"
                     /locus_tag="STY_RS00975"
                     /old_locus_tag="STY0211"
     CDS             complement(220806..221261)
                     /gene="dksA"
                     /locus_tag="STY_RS00975"
                     /old_locus_tag="STY0211"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase-binding protein DksA"
                     /protein_id="WP_001155232.1"
                     /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRIL
                     EAWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKT
                     LKKVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
     gene            complement(221438..222142)
                     /gene="sfsA"
                     /locus_tag="STY_RS00980"
                     /old_locus_tag="STY0212"
     CDS             complement(221438..222142)
                     /gene="sfsA"
                     /locus_tag="STY_RS00980"
                     /old_locus_tag="STY0212"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA/RNA nuclease SfsA"
                     /protein_id="WP_000899414.1"
                     /translation="MLFSPPLQRATLIQRYKRFLADVITPDGTTLTLHCPNTGAMTGC
                     ATPGDTVWYSTSENTKRKYPHTWELTETQSGAFICVNTLRANQLTKEAIQENRLPALA
                     GYNILNSEVKYGAERSRIDFMLQADFRPDCYIEVKSVTLAEKENGYFPDAITERGQKH
                     LRELMGVAAAGHRAVVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAE
                     LSATKMELNEPVPITL"
     gene            complement(222159..222689)
                     /gene="thpR"
                     /locus_tag="STY_RS00985"
                     /old_locus_tag="STY0213"
     CDS             complement(222159..222689)
                     /gene="thpR"
                     /locus_tag="STY_RS00985"
                     /old_locus_tag="STY0213"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA 2',3'-cyclic phosphodiesterase"
                     /protein_id="WP_001294175.1"
                     /translation="MSEPKRLFFAIDLPDDARAQIIAWRAAHFASEDGRPVAAANLHL
                     TLAFLGDVSNDKQRALAQLAGRIRQPGFTLHLDDAGQWLRSRVVWLGMRQPPRGLLQL
                     ANMLRAQAARSGCYQSPQPFHPHITLLRDASHTVAIPPPGFCWSFPVTSFALYASSYG
                     QGRTRYAELQRWTLGE"
     gene            222762..225191
                     /gene="hrpB"
                     /locus_tag="STY_RS00990"
                     /old_locus_tag="STY0214"
     CDS             222762..225191
                     /gene="hrpB"
                     /locus_tag="STY_RS00990"
                     /old_locus_tag="STY0214"
                     /EC_number="3.6.4.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_414690.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase HrpB"
                     /protein_id="WP_024131150.1"
                     /translation="MTSLPVAAVLPELLTALKTAPQVLLSAPTGAGKSTWLPLQLLQQ
                     GPVAGKILLLEPRRLAARNVAQRLAEALNEKPGETVGYRMRAQSCVGPRTRLEVVTEG
                     VLTRMIQRDPELRGVGLVILDEFHERSLQADLALALLLDIQQGLRDDLRLLIMSATLD
                     NDRLCQRLPDAPTIVSEGRAFPVERRYQPLAAHLRFDEAVAMATAELLRNENGSLLLF
                     LPGVGEIQRVHEHLASRVGSDVLLCPLYGALSLEAQRKAIVPAPAGMRKVVLATNIAE
                     TSLTIEGIRLVVDSAQERVARFDARTGLTRLVTQRISQASMTQRAGRAGRLAPGICLH
                     LLAKEQAERAAAQSDPEILHSDLSGLLMEVLQWGCHDPASLFWLDRPPEVNLQAARRL
                     LLMLGALEGERLSARGRKMAATGNDPRLAAMLVNADEGDSAATAAMLAAILEDPPRGG
                     GTDLSVLFSRRQPGWQQRSQQLLKRLQVRNGEPDSALIMPLLARAFSDRIARRRGQEG
                     RYQLANGMGAMLDADDALGRHEWLIAPLLLQGSASPDARILLAQPLDIASLIQACPDL
                     LRQSDTVEWDEAQGTLKAWRRMRIGQLTVSVQPLAKPSEEELHQAMLNGIRDKGLSVL
                     NWTPEAEQFRLRLHCAAKWLPEYDWPAVDEASLLATLENWLLPHMTGVQSLRSLKSLN
                     VTQALRGLLDYAMLQRLDSELPGHYTVPTGSRITIRYHEDNPPALAVRMQEMFGEAST
                     PTLAQGRVPLVLELLSPAQRPLQITRDLSAFWQGAYREVQKEMKGRYPKHVWPDDPAN
                     TAPTRRTKKYS"
     gene            225332..227854
                     /gene="mrcB"
                     /locus_tag="STY_RS00995"
                     /old_locus_tag="STY0215"
     CDS             225332..227854
                     /gene="mrcB"
                     /locus_tag="STY_RS00995"
                     /old_locus_tag="STY0215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional glycosyl
                     transferase/transpeptidase"
                     /protein_id="WP_000918132.1"
                     /translation="MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMP
                     RKGKGKGRKPRGKRGWLWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVY
                     GRMVNLEPDMPVSKNEMVKLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSK
                     EGQVRARLTFSDGRLETIVNLDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPD
                     LLVDTLLATEDRRFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSE
                     RSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPV
                     EELSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQKIIDQELYDMLSAR
                     PLGVQPRGGVISPQPAFMQMVRQELQAKLGDKIKDLSGVKIFTTFDSVAQDAAEKAVV
                     EGIPALKKQRKLSDLETAMVVVDRFSGEVRAMVGGAEPQYAGYNRAMQARRSIGSLAK
                     PATYLTALSQPNLYRLNTWIADAPISLRQPNGQVWSPENDDRRYSESGKVMLVDALTR
                     SMNVPTVNLGMALGLPAVTDTWTKLGVPKDQLNPVPAMLLGALNLTPIEVAQAFQTIA
                     SGGNRAPLSALRSVIAEDGKVLYQSYPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLG
                     AKYPGLHLVGKTGTTNNNVDTWFAGIDGSQVTITWVGRDNNQPTKLYGASGAMAIYQR
                     YLANQTPTPLVLTPPEDVVDMGVDYDGNFVCNGGMRTLPVWTDDPNTLCQQGEMMQQQ
                     QQPSGNPFDQSSQPQQPAQQQPPKEEKSDGVAGWIKEMFGGN"
     gene            228147..230338
                     /gene="fhuA"
                     /locus_tag="STY_RS01000"
                     /old_locus_tag="STY0218"
                     /pseudo
     CDS             228147..230338
                     /gene="fhuA"
                     /locus_tag="STY_RS01000"
                     /old_locus_tag="STY0218"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459196.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ferrichrome porin FhuA"
     gene            230387..231184
                     /gene="fhuC"
                     /locus_tag="STY_RS01005"
                     /old_locus_tag="STY0219"
     CDS             230387..231184
                     /gene="fhuC"
                     /locus_tag="STY_RS01005"
                     /old_locus_tag="STY0219"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe3+-hydroxamate ABC transporter ATP-binding
                     protein FhuC"
                     /protein_id="WP_001157197.1"
                     /translation="MQENHIHSDTTFALRSVAFRVPGRTLLHPLSLTFPAGRVTGLIG
                     HNGSGKSTLLKMLGRHQLPSEGDILLDNQPLASWSSKAFARKVAYLPQQLPQAEGMTV
                     RELVAIGRYPWHGALGRFGVADREKVDEAITLVGLKPLAHRLVDSLSGGERQRAWIAM
                     LVAQDSRCLLLDEPTSALDIAHQVDVLALVHRLSQQRGLTVVAVLHDINMAARYCDYL
                     VALRGGEMIAQGTPAELMRSDTLEQIYGIPMGILPHPAGAAPVSFVY"
     gene            231184..232074
                     /gene="fhuD"
                     /locus_tag="STY_RS01010"
                     /old_locus_tag="STY0220"
     CDS             231184..232074
                     /gene="fhuD"
                     /locus_tag="STY_RS01010"
                     /old_locus_tag="STY0220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe(3+)-hydroxamate ABC transporter
                     substrate-binding protein FhuD"
                     /protein_id="WP_001208784.1"
                     /translation="MRELYPLTRRRLLTAMALSPLLWQMNTAQAAAIDPRRIVALEWL
                     PVELLLALGITPYGVADVPNYKLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVW
                     SAGYGPSPEKLARIAPGRGFDFSDGKKPLAVARRSLVELAQTLNLEAAAEKHLAQYDR
                     FIASQKPRFIRRGGRPLLMTTLIDPRHMLVLGPNCLFQEVLDEYGIVNAWQGETNFWG
                     STAVSIDRLAMYKEADVICFDHGNSTDMNALMATPLWQAMSFVRAGRFHRVPAVWFYG
                     ATLSTMHFVRILNNVLGGKA"
     gene            232089..234128
                     /gene="fhuB"
                     /locus_tag="STY_RS01015"
                     /old_locus_tag="STY0221"
     CDS             232089..234128
                     /gene="fhuB"
                     /locus_tag="STY_RS01015"
                     /old_locus_tag="STY0221"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016504759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe(3+)-hydroxamate ABC transporter permease
                     FhuB"
                     /protein_id="WP_094516706.1"
                     /translation="MPDGGAKNALTDLRFGRFVGRIRRSRHPALLLLALLVAACWLTW
                     VNFSVALPRSQWQQAIWSPDIDIIEQMIFHYSQLPRLAISLLVGAGLGLVGVLFQQVL
                     RNPLAEPTTLGVATGAQLGITVTTLWAIPGALTTQFAALTGACIVGALVFGVAWGKRL
                     SPVTLILAGLVVSLYCGAINQLLVIFHHDQLQSMFLWSTGTLTQTDWSGVQRLWPQLL
                     GGVMLTLLLLRPMTLMGLDDGVARNLGLALSLARLAALSLAIVLSALLVNAVGIIGFI
                     GLFAPLLAKMLGARRLLARLMLAPLIGALILWLSDQIILWLTRVWMEVSTGSVTALIG
                     APLLLWLLPRLKSMSAPDMNASDRVAAERRHVLTFAVAGGALLLLATWVALSFGRDAH
                     GWTWASGTLLEELMPWRWPRILAALMAGVMLAVAGCIIQRLTGNPMASPEVLGISSGA
                     AFGVVLMLFLVPGNAFGWLLPAGSLGAAATLLIIMIAAGRGGFSPQRMLLAGMALSTA
                     FTMLLMMLQASGDPRMADVLTWISGSTYNATGGQVTRTAIVMVILLAVVPLCRRWLTI
                     LPLGGDAARAVGIALTPSRIALLALAACLTATATMTIGPLSFVGLMAPHIARMLGFRR
                     TMPHMVISALAGGVLLVFADWCGRMALFPYQIPAGLLSSFIGAPYFIYLLRKQSR"
     gene            complement(234219..235499)
                     /gene="hemL"
                     /locus_tag="STY_RS01020"
                     /old_locus_tag="STY0223"
     CDS             complement(234219..235499)
                     /gene="hemL"
                     /locus_tag="STY_RS01020"
                     /old_locus_tag="STY0223"
                     /EC_number="5.4.3.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020233394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde 2,1-aminomutase"
                     /protein_id="WP_000045264.1"
                     /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYL
                     YDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNL
                     VPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTL
                     GQPNSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPE
                     FLPGLRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAF
                     GGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGIHETLDELTTRLAEG
                     LLEAAEEANIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHLMLEEGVY
                     LAPSAFEAGFMSVAHSMDDINNTIDAARRVFAKL"
     gene            235669..237090
                     /gene="clcA"
                     /locus_tag="STY_RS01025"
                     /old_locus_tag="STY0225"
     CDS             235669..237090
                     /gene="clcA"
                     /locus_tag="STY_RS01025"
                     /old_locus_tag="STY0225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="H(+)/Cl(-) exchange transporter ClcA"
                     /protein_id="WP_000845433.1"
                     /translation="MKTDTSTFLAQQIVRLRRRDQIRRLMQRDKTPLAILFMAAVVGT
                     LTGLVGVAFEKTVSWVQNMRIGALVQVADHAFLLWPLAFILSALLAMVGYFLVRKFAP
                     EAGGSGIPEIEGALEELRPVRWWRVLPVKFIGGMGTLGAGMVLGREGPTVQIGGNLGR
                     MVLDVFRMRSAEARHTLLATGAAAGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAV
                     FTGVIMSSIVFRIFNGEAPIIEVGKLSDAPVNTLWLYLILGIIFGCVGPVFNSLVLRT
                     QDMFQRFHGGEIKKWVLMGGAIGGLCGILGLIEPAAAGGGFNLIPIAAAGNFSVGLLL
                     FIFITRVVTTLLCFSSGAPGGIFAPMLALGTLLGTAFGMAAAVLFPQYHLEAGTFAIA
                     GMGALMAASVRAPLTGIVLVLEMTDNYQLILPMIITCLGATLLAQFLGGKPLYSTILA
                     RTLAKQDAEQAAKNQNAPAGENT"
     gene            237172..237516
                     /gene="erpA"
                     /locus_tag="STY_RS01030"
                     /old_locus_tag="STY0226"
     CDS             237172..237516
                     /gene="erpA"
                     /locus_tag="STY_RS01030"
                     /old_locus_tag="STY0226"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001295564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster insertion protein ErpA"
                     /protein_id="WP_001278668.1"
                     /translation="MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSG
                     FQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNA
                     KSTCGCGSSFSI"
     gene            complement(237617..238240)
                     /locus_tag="STY_RS01035"
                     /old_locus_tag="STY0227"
     CDS             complement(237617..238240)
                     /locus_tag="STY_RS01035"
                     /old_locus_tag="STY0227"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRIC cation channel family protein"
                     /protein_id="WP_000964234.1"
                     /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGG
                     TIRDMALDNGPVFWVKDPTDLVVAMVTSMLTILLVRQPRRLPKWMLPVLDAVGLAVFV
                     GIGVNKAFLAETGPLVAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIV
                     HATAFYTFSVPLESASMMGMVVTLFIRLAAIRWHLKLPTFALDENGR"
     gene            complement(238277..239077)
                     /gene="btuF"
                     /locus_tag="STY_RS01040"
                     /old_locus_tag="STY0228"
     CDS             complement(238277..239077)
                     /gene="btuF"
                     /locus_tag="STY_RS01040"
                     /old_locus_tag="STY0228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="vitamin B12 ABC transporter substrate-binding
                     protein BtuF"
                     /protein_id="WP_001118833.1"
                     /translation="MAKQMFRALGALLLTLPVWLYAAPRVITLSPANTELAFAAEITP
                     VGVSSYSDYPPEAQKIEQVSTWQGMNLERIVALKPDLVVAWRGGNAERQVNQLTSLGI
                     KVMWVDAVTIEQIADALRQLAAWSPQPEKAQQAAQTLLKEYAALKVEYAGKAKKRVFL
                     QFGMNPLFTSGKGSIQHQVLTTCGGENVFADSRVPWPQVSREQVLARHPQAIIVAGKA
                     GEILKIEQYWGNLLKIPVIPLNSDWFERASPRIILAAKQLCNALSQVN"
     gene            complement(239070..239768)
                     /gene="mtnN"
                     /locus_tag="STY_RS01045"
                     /old_locus_tag="STY0229"
     CDS             complement(239070..239768)
                     /gene="mtnN"
                     /locus_tag="STY_RS01045"
                     /old_locus_tag="STY0229"
                     /EC_number="3.2.2.16"
                     /EC_number="3.2.2.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-methylthioadenosine/S-adenosylhomocysteine
                     nucleosidase"
                     /protein_id="WP_000689821.1"
                     /translation="MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVA
                     LLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADV
                     TAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAK
                     IRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQS
                     TLMVETLVQKLAHG"
     gene            239853..241370
                     /gene="dgt"
                     /locus_tag="STY_RS01050"
                     /old_locus_tag="STY0230"
     CDS             239853..241370
                     /gene="dgt"
                     /locus_tag="STY_RS01050"
                     /old_locus_tag="STY0230"
                     /EC_number="3.1.5.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dGTPase"
                     /protein_id="WP_000146450.1"
                     /translation="MASIDFRNKINWHRRYRSPQGVKTEHEILRIFESDRGRIINSPA
                     IRRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKEQNRLEEYGLDAL
                     TGPFESIVEMACLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTHDRCVVSSL
                     RLQEGEENLNDIRRKVRQDICHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWW
                     RGPVPDSHRYLMKKPGYYLSEEKYIARLRKELQLAPYSRFPLTWIMEAADDISYCVAD
                     LEDAVEKRIFSVEQLYHHLYHAWGHHEKDSLFELVVGNAWEKSRANTLSRSTEDQFFM
                     YLRVNTLNKLVPYAAQRFIDNLPQIFAGTFNQALLEDASGFSRLLELYKNVAVEHVFS
                     HPDVEQLELQGYRVISGLLDIYQPLLSLSLNDFRELVEKERLKRFPIESRLFQKLSTR
                     HRLAYVEVVSKLPTDSAEYPVLEYYYRCRLIQDYISGMTDLYAWDEYRRLMAVEQ"
     gene            241500..242927
                     /gene="degP"
                     /locus_tag="STY_RS01055"
                     /old_locus_tag="STY0231"
     CDS             241500..242927
                     /gene="degP"
                     /locus_tag="STY_RS01055"
                     /old_locus_tag="STY0231"
                     /EC_number="3.4.21.107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine endoprotease DegP"
                     /protein_id="WP_000753959.1"
                     /translation="MKKTTLAMSALALSLGLALSPLSATAAETSSSAMTAQQMPSLAP
                     MLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQDGSPFQNSPFCQGGGNG
                     GNGGQQQKFMALGSGVIIDAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPR
                     SDIALIQIQNPKNLTAIKLADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLN
                     VENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKN
                     LTSQMVEYGQVKRGELGIMGTELSSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAG
                     DVITSLNGKPISSFAALRAQVGTMPVGSKISLGLLREGKAITVNLELQQSSQSQVDSS
                     TIFSGIEGAEMSNKGQDKGVVVSSVKANSPAAQIGLKKGDVIIGANQQPVKNIAELRK
                     ILDSKPSVLALNIQRGDSSIYLLMQ"
     gene            243080..244237
                     /locus_tag="STY_RS01060"
                     /old_locus_tag="STY0232"
     CDS             243080..244237
                     /locus_tag="STY_RS01060"
                     /old_locus_tag="STY0232"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator CdaR"
                     /protein_id="WP_000929458.1"
                     /translation="MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERI
                     GELHEGALLVLSQGRVVDIDNAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLR
                     KYGELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALVEWAQRLGIDL
                     NQPRVAAVVEVDSGQLGVDSAMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNS
                     FGRWDAEDHRKRVEQLISRMKENGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQ
                     RMPESRSYFYQDLMLPVLLDSLRGGWQANELARPLVKLKAMDNNGLLRRTLTAWFRHN
                     VQPLATSKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEQR"
     gene            complement(244326..244712)
                     /locus_tag="STY_RS01065"
                     /old_locus_tag="STY0233"
     CDS             complement(244326..244712)
                     /locus_tag="STY_RS01065"
                     /old_locus_tag="STY0233"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000272186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3461 family protein"
                     /protein_id="WP_000272193.1"
                     /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRGEFFAK
                     SVKFKYPRQRKTVVADGIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKRKILD
                     DLRHLESVVANKISEIEADLDKLTRK"
     gene            244959..246261
                     /locus_tag="STY_RS01070"
                     /old_locus_tag="STY0235"
                     /pseudo
     CDS             244959..246261
                     /locus_tag="STY_RS01070"
                     /old_locus_tag="STY0235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459217.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="MHS family MFS transporter"
     gene            complement(246298..247122)
                     /gene="dapD"
                     /locus_tag="STY_RS01075"
                     /old_locus_tag="STY0236"
     CDS             complement(246298..247122)
                     /gene="dapD"
                     /locus_tag="STY_RS01075"
                     /old_locus_tag="STY0236"
                     /EC_number="2.3.1.117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase"
                     /protein_id="WP_001186669.1"
                     /translation="MQQLQNVIETAFERRADITPANVDTVTREAVKQVISLLDSGALR
                     VAEKIDGQWVTHQWLKKAVLLSFRINDNQVIDGAESRYFDKAPMKFADYDEARFQKEG
                     FRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSG
                     GVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRE
                     TGEVHYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
     gene            complement(247152..249824)
                     /gene="glnD"
                     /locus_tag="STY_RS01080"
                     /old_locus_tag="STY0237"
     CDS             complement(247152..249824)
                     /gene="glnD"
                     /locus_tag="STY_RS01080"
                     /old_locus_tag="STY0237"
                     /EC_number="2.7.7.59"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     uridylyltransferase/uridylyl-removing protein GlnD"
                     /protein_id="WP_001094518.1"
                     /translation="MNTLPEQHANTALPTLPDQPQNPGVWPRAELTVAGIKARIDIFQ
                     HWLGEAFDSGICAEQLIEARTEFIDQLLQRLWIEAGFGQIADLALVAVGGYGRGELHP
                     LSDIDLLILSRKKLPDEQAQKVGELLTLLWDVKLDVGHSVRTLEECLLEGLSDLTVAT
                     NLIETRLLIGDVALFLALQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPD
                     IKSSPGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTPAECAELNECLHILWRIRFAL
                     HLVVSRYDNRLLFDRQLSVAQRLNYSGEGNDPVERMMKDYFRVTRRVSELNQMLLQLF
                     DEAILALPADEKPRPVDDEFQLRGTLIDLRDDTLFIREPQAILRMFYMMVRNSAITGI
                     YSTTLRHLRHARRHLSQPLCYIPEARTLFLSMLRHPGAVSRGLLPMHRHSVLWAYMPQ
                     WSHIVGQMQFDLFHAYTVDEHTIRVMLKLESFAKEETRQRHPLCVDLWPRLPHPELIL
                     IAALFHDIAKGRGGDHSVLGAQDVLTFAELHGLNSRETQLVAWLVRQHLLMSVTAQRR
                     DIQDPEVIKQFAEEVQTETRLRFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQ
                     LRRGMQNTPDMRERVRHHQLQALALLRMDNIDEAALHKIWTRCRANYFVRHSPNQLAW
                     HARHLLQHDLSQPLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQI
                     FTTRDGMAMDTFIVLEPDGSPLAADRHDVIRTGLEQTITQHSWQPPQPRRQPAKLRHF
                     TVETEVNFLPTHTDRKSFMELIALDQPGLLARVGQIFADLGISLHGARITTIGERVED
                     LFIIATADRRALNNVLQLEVQQRLTAALNPNDKG"
     gene            complement(249937..250731)
                     /gene="map"
                     /locus_tag="STY_RS01085"
                     /old_locus_tag="STY0238"
     CDS             complement(249937..250731)
                     /gene="map"
                     /locus_tag="STY_RS01085"
                     /old_locus_tag="STY0238"
                     /EC_number="3.4.11.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I methionyl aminopeptidase"
                     /protein_id="WP_001018214.1"
                     /translation="MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRI
                     CNDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIK
                     DEFHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGE
                     GFSVVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMK
                     DGWTVKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE"
     gene            251181..251906
                     /gene="rpsB"
                     /locus_tag="STY_RS01090"
                     /old_locus_tag="STY0239"
     CDS             251181..251906
                     /gene="rpsB"
                     /locus_tag="STY_RS01090"
                     /old_locus_tag="STY0239"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S2"
                     /protein_id="WP_000246886.1"
                     /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLE
                     KTVPMFNEALAELNKISARKGKILFVGTKRAASEAVKEAANSCDQFFVNHRWLGGMLT
                     NWKTVRQSIKRLKDLETQSQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDA
                     LFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLGAVA
                     ATVREGRSQDLASQAEESFVEAE"
     gene            252164..253015
                     /gene="tsf"
                     /locus_tag="STY_RS01095"
                     /old_locus_tag="STY0240"
     CDS             252164..253015
                     /gene="tsf"
                     /locus_tag="STY_RS01095"
                     /old_locus_tag="STY0240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Ts"
                     /protein_id="WP_000808106.1"
                     /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKS
                     GAIKAAKKAGNVAADGVIKTKIDGNVAFILEVNCQTDFVAKDAGFQAFADKVLDAAVA
                     GKITDVEVLKAQFEEERVALVAKIGENINIRRVASLEGDVLGSYQHGARIGVLVAAKG
                     ADEELVKQLAMHVAASKPEFVKPEDVSADVVEKEYQVQLDIAMQSGKPKEIAEKMVEG
                     RMKKFTGEVSLTGQPFVMEPSKSVGQLLKEHNADVTGFIRFEVGEGIEKVETDFAAEV
                     AAMSKQS"
     gene            253160..253885
                     /gene="pyrH"
                     /locus_tag="STY_RS01100"
                     /old_locus_tag="STY0241"
     CDS             253160..253885
                     /gene="pyrH"
                     /locus_tag="STY_RS01100"
                     /old_locus_tag="STY0241"
                     /EC_number="2.7.4.22"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000224576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UMP kinase"
                     /protein_id="WP_000224567.1"
                     /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKEL
                     VELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNA
                     RLMSAIPLNGVCDNYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADV
                     VLKATKVDGVFTADPAKDPSATMYDQLTYSEVLDKELKVMDLAAFTLARDHKLPIRVF
                     NMNKPGALRRVVMGEKEGTLITE"
     gene            254032..254589
                     /gene="frr"
                     /locus_tag="STY_RS01105"
                     /old_locus_tag="STY0242"
     CDS             254032..254589
                     /gene="frr"
                     /locus_tag="STY_RS01105"
                     /old_locus_tag="STY0242"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000622421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome recycling factor"
                     /protein_id="WP_000622423.1"
                     /translation="MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEY
                     YGTPTPLRQLASVTVEDSRTLKINVFDRSMGPAVEKAIMASDLGLNPSSAGTDIRVPL
                     PPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKAISEDDDRRSQEEV
                     QKMTDAAIKKVDAALADKEAELMQF"
     gene            254731..255927
                     /gene="ispC"
                     /locus_tag="STY_RS01110"
                     /old_locus_tag="STY0243"
     CDS             254731..255927
                     /gene="ispC"
                     /locus_tag="STY_RS01110"
                     /old_locus_tag="STY0243"
                     /EC_number="1.1.1.267"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate reductoisomerase"
                     /protein_id="WP_000811892.1"
                     /translation="MKQLTILGSTGSIGCSTLDVVHHNPDSFRVIALVAGKNVARMAE
                     QCLEFSPRYAVMDDTSSAEQLKIMLQQHGSRTEVLSGQQAACEMAALDEVGHVMAAIV
                     GAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKRSNARLLPVDSEHNAIFQSL
                     PQSIQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKI
                     SVDSATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDM
                     RTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPDYQRYPCLKLAMEAFEQGQAATTA
                     LNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLHEPASVDDVLQVDAIAREVARKQ
                     VIRLSR"
     gene            256240..256998
                     /gene="ispU"
                     /locus_tag="STY_RS01115"
                     /old_locus_tag="STY0244"
                     /gene_synonym="uppS"
     CDS             256240..256998
                     /gene="ispU"
                     /locus_tag="STY_RS01115"
                     /old_locus_tag="STY0244"
                     /gene_synonym="uppS"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2E,6E)-farnesyl-diphosphate-specific
                     ditrans,polycis-undecaprenyl-diphosphate synthase"
                     /protein_id="WP_000947409.1"
                     /translation="MLSATQPVSENLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKA
                     GAKSVRRAVSFAANNGIDALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRH
                     NVRLRIIGDISRFNSRLQERIRKSEALTAHNTGLTLNIAANYGGRWDIVQGVRQLAEL
                     VQAGVLRPDQIDEERLGQQICMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDV
                     LWPDFDEQDFEGALHAFANRERRFGGTEPGDDKA"
     gene            257011..257868
                     /gene="cdsA"
                     /locus_tag="STY_RS01120"
                     /old_locus_tag="STY0245"
     CDS             257011..257868
                     /gene="cdsA"
                     /locus_tag="STY_RS01120"
                     /old_locus_tag="STY0245"
                     /EC_number="2.7.7.41"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="WP_000922422.1"
                     /translation="MLKYRLISAFVLIPAVIAALFLLPPVGFAIITLVVCMLAAWEWG
                     QLSGFAARSQRVWLAVLCGLLLALMLFLLPEYHHNIRQPLVEMSLWASLGWWVVALLL
                     VLFYPGSAAIWRNSKTLRLIFGLLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMIL
                     VWGADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLNVAPV
                     ILLICSVVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFAC
                     LLLLVFRTL"
     gene            257880..259232
                     /gene="rseP"
                     /locus_tag="STY_RS01125"
                     /old_locus_tag="STY0246"
     CDS             257880..259232
                     /gene="rseP"
                     /locus_tag="STY_RS01125"
                     /old_locus_tag="STY0246"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma E protease regulator RseP"
                     /protein_id="WP_000949016.1"
                     /translation="MLSILWNLAAFIIALGVLITVHEFGHFWVARRCGVRVERFSIGF
                     GKALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELRRHAFNNKTVGQRAAIIA
                     AGPVANFIFAIFAYWLVFIIGVPGVRPVIGEITPNSIAAQAQIAPGTELKAVDGIETP
                     DWDAVRLQLVSKIGDQQTTVSVAPFGSDQRQDKTLDLRHWAFEPDKQDPVSSLGIRPR
                     GPQIEPVLSEVQANSAASKAGLQAGDRIVKVDGQPLTQWMKFVTFVRDNPGKPLALEI
                     ERQGSALSLTLTPDTKSVNGKAEGFAGVVPKIIPLPEEYKTIRQYGPFSAILEATDKT
                     WQLMKLTVNMLGKLITGDVKLNNLSGPISIAQGAGMSAEFGVIYYLMFLALISVNLGI
                     INLFPLPVLDGGHLLFLAIEKLKGGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL
                     "
     gene            259264..261675
                     /gene="bamA"
                     /locus_tag="STY_RS01130"
                     /old_locus_tag="STY0247"
     CDS             259264..261675
                     /gene="bamA"
                     /locus_tag="STY_RS01130"
                     /old_locus_tag="STY0247"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor BamA"
                     /protein_id="WP_001240921.1"
                     /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALL
                     SMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGN
                     KSVKDDMLKQNLEASGVRVGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPR
                     NRVDLKLVFQEGVSAKIQQINIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQK
                     LAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGN
                     LAGHSAEIEKLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKT
                     VKLRVNVDAGNRFYVRKIRFEGNDTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRL
                     GFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWL
                     GTGYSVGINGTKNDYQTYSELSVTNPYFTVDGVSLGGRIFYNDFEADDADLSDYTNKS
                     YGTDVTLGFPINEYNTLRAGLGYVHNKLSNMQPQIAMDRYLESMGDPDASDFAADDFT
                     FNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVSLDTATYVPIDNDHKWVV
                     LGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYKNGAHTSWDDDDD
                     YEDCTQESGCKSDDAVGGNAMAVASLEFITPTPFISEKYANSVRTSFFWDMGTVWDTN
                     WDPSSAPSDVPDYSDPGNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFN
                     IGKTW"
     gene            261798..262283
                     /gene="skp"
                     /locus_tag="STY_RS01135"
                     /old_locus_tag="STY0248"
                     /gene_synonym="hlpA; ompH"
     CDS             261798..262283
                     /gene="skp"
                     /locus_tag="STY_RS01135"
                     /old_locus_tag="STY0248"
                     /gene_synonym="hlpA; ompH"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone Skp"
                     /protein_id="WP_000758966.1"
                     /translation="MKKWLLAAGLGLAMVTSAQAADKIAIVNMGNLFQQVAQKTGVSN
                     TLENEFKGRAAELQKMETDLQSKMQRLQSMKAGSDRTKLEKDVMSQRQTFAQKAQAFE
                     KDRARRSNEERNKLVTRIQTAVKKVANDQSIDLVVDANTVAYNSSDVKDITADVLKQV
                     K"
     gene            262287..263312
                     /gene="lpxD"
                     /locus_tag="STY_RS01140"
                     /old_locus_tag="STY0249"
     CDS             262287..263312
                     /gene="lpxD"
                     /locus_tag="STY_RS01140"
                     /old_locus_tag="STY0249"
                     /EC_number="2.3.1.191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-(3-hydroxymyristoyl)glucosamine
                     N-acyltransferase"
                     /protein_id="WP_001139265.1"
                     /translation="MPSIRLADLAEQLDAELHGDGDIVITGVASMQSATTGHITFMVN
                     PKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAP
                     SAVIDATATLGSNVSVGANAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTI
                     YHDIQIGENCLIQSSTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRG
                     ALDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGH
                     MEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIE
                     RKVNQQD"
     gene            263418..263873
                     /gene="fabZ"
                     /locus_tag="STY_RS01145"
                     /old_locus_tag="STY0250"
     CDS             263418..263873
                     /gene="fabZ"
                     /locus_tag="STY_RS01145"
                     /old_locus_tag="STY0250"
                     /EC_number="4.2.1.59"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000210741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-ACP dehydratase FabZ"
                     /protein_id="WP_000210741.1"
                     /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNV
                     SVNEPFFQGHFPGKPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFK
                     RPVVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
     gene            263877..264665
                     /gene="lpxA"
                     /locus_tag="STY_RS01150"
                     /old_locus_tag="STY0251"
     CDS             263877..264665
                     /gene="lpxA"
                     /locus_tag="STY_RS01150"
                     /old_locus_tag="STY0251"
                     /EC_number="2.3.1.129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-ACP--UDP-N-acetylglucosamine
                     O-acyltransferase"
                     /protein_id="WP_000566033.1"
                     /translation="MIDKSVFIHPTAIVEDGAVIGANAHIGPFCIVGPQVEIGEGTVL
                     KSHVVVNGQTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGT
                     VQGGGLTKVGSDNLLMINAHVAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVH
                     QFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREGLVAIRNA
                     YKLLYRSGKTLDEAKLEIAELAEKHPEVKAFTEFFERSTRGPIR"
     gene            264665..265813
                     /gene="lpxB"
                     /locus_tag="STY_RS01155"
                     /old_locus_tag="STY0252"
     CDS             264665..265813
                     /gene="lpxB"
                     /locus_tag="STY_RS01155"
                     /old_locus_tag="STY0252"
                     /EC_number="2.4.1.182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid-A-disaccharide synthase"
                     /protein_id="WP_000741216.1"
                     /translation="MAAQRPLTIALVAGETSGDILGAGLIRALKARVPNARFVGVAGP
                     RMQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTRRFTELKPDVFVGIDAPDF
                     NITLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRSTHMVLAFLPFEKAFYDKFNVP
                     CRFIGHTMADAMPLDPDKNAARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQL
                     LRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASG
                     TAALECMLAKCPMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEP
                     QKLAEALLPLLANGKTSHAMHDTFRELHQQIRCNADEQAADAVLELAQ"
     gene            265810..266406
                     /gene="rnhB"
                     /locus_tag="STY_RS01160"
                     /old_locus_tag="STY0253"
     CDS             265810..266406
                     /gene="rnhB"
                     /locus_tag="STY_RS01160"
                     /old_locus_tag="STY0253"
                     /EC_number="3.1.26.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HII"
                     /protein_id="WP_000569412.1"
                     /translation="MIEFVYPHTHLVAGVDEVGRGPLVGAVVTAAVILDPARPIVGLN
                     DSKKLSEKRRLSLYDEIKEKALSWSLGRAEAHEIDELNILHATMLAMQRAVAGLHIAP
                     EYVLIDGNRCPELPVPSMAVVKGDSRVAEISAASILAKVTRDAEMAALDIVFPQYGFA
                     QHKGYPTAFHLEKLAQYGATAHHRRSFAPVKRALGLVS"
     gene            266430..269912
                     /gene="dnaE"
                     /locus_tag="STY_RS01165"
                     /old_locus_tag="STY0254"
     CDS             266430..269912
                     /gene="dnaE"
                     /locus_tag="STY_RS01165"
                     /old_locus_tag="STY0254"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012815364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit alpha"
                     /protein_id="WP_001294828.1"
                     /translation="MSEPRFVHLRVHSDYSMIDGLAKTGPLVKKAASLGMPALAITDF
                     TNLCGLVKFYGAGHGAGIKPIVGADFNVHNELLGDELTHLTVLAANNTGYQNLTLLIS
                     KAYQRGYGAAGPIIERDWLVELKEGLILLSGGRMGDVGRCLLRGNQALVEECVAFYEA
                     HFPDRYFLELIRTGRQDEETYLHAAVELAEARGLPVVATNDVRFLESDDFDAHEIRVA
                     IHDGFTLDDPKRPRNYSPQQYMRSEEEMCELFSDIPEALENTVEIAKRCNVTVRLGEY
                     FLPQFPTGDMTTEDYLVKKSKEGLEERLAFLFPDEEERKKRRPEYDERLDIELQVINQ
                     MGFPGYFLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFL
                     NPERVSMPDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLG
                     HPYGFVDRISKLVPPDPGMTLAKAFEAEPQLPEIYEADEEVRALIDMARKLEGVTRNA
                     GKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIIN
                     WALEMINKRRAKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQ
                     PDCFEDMIALVALFRPGPLQSGMVDNFIDRKHGREELSYPDVQWQHESLKPVLEPTYG
                     IILYQEQVMQIAQVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFEEGAKKNGIDGEL
                     AMKIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVV
                     GLVDECWRMGLKILPPDINSGLYHFHVNDEGEIVYGIGAIKGVGEGPIEAIIDARNQG
                     GYFRELFDLCARTDTKKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAK
                     AEAIGQADMFGVLAEEPEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKE
                     IERYVGGVRLKDMHPTERGKVTTAAGLVIAARVMVTKRGNRIGICTLDDRSGRLEVML
                     FTDALDKYQQLLEKDRILIVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISL
                     TDRQIDDQLLNRLRQSLEPHRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDL
                     RGLIGSEQVELEFD"
     gene            269925..270884
                     /gene="accA"
                     /locus_tag="STY_RS01170"
                     /old_locus_tag="STY0255"
     CDS             269925..270884
                     /gene="accA"
                     /locus_tag="STY_RS01170"
                     /old_locus_tag="STY0255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase carboxyl transferase
                     subunit alpha"
                     /protein_id="WP_000055753.1"
                     /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLR
                     EKSVELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIV
                     GGIARLEGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITF
                     IDTPGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVN
                     MLQYSTYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAH
                     RNPEAMAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA"
     repeat_region   270922..271646
                     /note="IS200"
     gene            271076..271534
                     /locus_tag="STY_RS01175"
                     /old_locus_tag="STY0256"
     CDS             271076..271534
                     /locus_tag="STY_RS01175"
                     /old_locus_tag="STY0256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605-like element IS200F family
                     transposase"
                     /protein_id="WP_000502118.1"
                     /translation="MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKL
                     CEWKNVRILEAECCADHIHMLLEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRN
                     REFWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLSIPYPGSLFTGRK"
     gene            271774..273537
                     /locus_tag="STY_RS01180"
                     /old_locus_tag="STY0257"
                     /pseudo
     CDS             271774..273537
                     /locus_tag="STY_RS01180"
                     /old_locus_tag="STY0257"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459238.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
     gene            273613..275754
                     /gene="ldcC"
                     /locus_tag="STY_RS01185"
                     /old_locus_tag="STY0259"
     CDS             273613..275754
                     /gene="ldcC"
                     /locus_tag="STY_RS01185"
                     /old_locus_tag="STY0259"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine decarboxylase LdcC"
                     /protein_id="WP_001021059.1"
                     /translation="MNIIAIMGPHGVYYKDEPIKELERALQSLGFQIIWPQNSVDLLK
                     FIEHNPRICGVIFDWDEYSLDLCSEINQLNEYLPLYAFINTNSTLDVSVHDMRMALWF
                     FEYALGLAEDIATRIHQYTNEYLDNITPPFTKALFTYAKEGKYTFCTPGHMAGTVYQK
                     SPPGCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYMVTN
                     GTSTSNKIVGMYAAPAGSTLLIDRNCHKSLAHLLMMSDVVPLWLKPTRNALGILGGIP
                     KREFTRDSIARKVAETAQAQWPVHAVITNSTYDGLLYNTNWIKQMLDVPSIHFDSAWV
                     PYTHFHPIYQGKSGMSGDRVPGKVIFETQSTHKMLAAFSQASLIHIKGEYDEETFNEA
                     FMMHTSTSPSYPIVASIETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDSWF
                     FDIWQPEEVDEAECWPVTPGETWHGFTDADDDHMFLDPVKVTILTPGMDEQGNMSEEG
                     IPAALVAKFLDERGVVVEKTGPYNLLFLFSIGIDKTRAMGLLRGLTEFKRAYDLNLRV
                     KNMLPDLYAEDPDFYRNMRIQDLAQGIHKLIRQHDLPELMLRAFEVLPEMIMTPHQAW
                     QRQIKGEVETVALDQLPGRVSANMILPYPPGVPLLMPGERITQQSRAVLDFLLMLCSI
                     GQHYPGFETDIHGAKRNEDGVYQVRVLKHAC"
     gene            275810..276199
                     /locus_tag="STY_RS01190"
                     /old_locus_tag="STY0260"
     CDS             275810..276199
                     /locus_tag="STY_RS01190"
                     /old_locus_tag="STY0260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_000901086.1"
                     /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFDLLSEAWREERDSW
                     KGDLALNGQYVIELFSFPFPPARPSRPEACGLRHLAFSVENVENAVAHLEKHQVKCEP
                     IRIDPYTGKRFTFFNDPDGLPLELYEQ"
     gene            276262..277554
                     /gene="tilS"
                     /locus_tag="STY_RS01195"
                     /old_locus_tag="STY0261"
     CDS             276262..277554
                     /gene="tilS"
                     /locus_tag="STY_RS01195"
                     /old_locus_tag="STY0261"
                     /EC_number="6.3.4.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA lysidine(34) synthetase TilS"
                     /protein_id="WP_000210062.1"
                     /translation="MTTLTLNTSLLSSRRILAAFSGGLDSTVLLHQLVLWRERHPDVT
                     LRAIHIHHGLSPHADSWVRHCETVCERWQVPLVVERVTLADNGLGIEAHAREARYRAF
                     AQTLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGERSPFAGTLLLRPLLRET
                     RKTLEQWAVRHGLCWIEDESNQDDAYDRNFLRLRALPLLQQRWPHFPAAVARSATLCA
                     EQERLLDELLASDLTDCITTEGTLRLSPLMSMSDVRRAAILRRWLAMRNAPMPSRDAL
                     ERIWQEVALARDDASPCLRFGDHEIRRYQSQLWWIKTVAGQHETTVAWPVWQTPLALP
                     AGLGTVQLVPGGELRRPREEESVSIRFKAPGLLHIVGRHGGRKLKKIWQEQGIPPWRR
                     DTTPLLFYGETLIAAAGVFVTREGAAEDKEGVSLVWHA"
     gene            complement(277638..277898)
                     /gene="rof"
                     /locus_tag="STY_RS01200"
                     /old_locus_tag="STY0262"
     CDS             complement(277638..277898)
                     /gene="rof"
                     /locus_tag="STY_RS01200"
                     /old_locus_tag="STY0262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rho-binding antiterminator"
                     /protein_id="WP_000062330.1"
                     /translation="MSMNETYQPINCDDYDSLELACMHHLILTLTLKDGEVLQAKAND
                     LILRKNVEYLLAEVSGESCELRLDKIASFSHPEIGTVVVSES"
     gene            complement(277885..278103)
                     /locus_tag="STY_RS01205"
                     /old_locus_tag="STY0263"
     CDS             complement(277885..278103)
                     /locus_tag="STY_RS01205"
                     /old_locus_tag="STY0263"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YaeP family protein"
                     /protein_id="WP_000955207.1"
                     /translation="MLTGGHVEKYCELVRKRYAEIASGDLGYVPDALGCVLKVLNEVA
                     ADSALSESVREKAAYAAANLLVSDYVNE"
     gene            278283..278828
                     /locus_tag="STY_RS01210"
                     /old_locus_tag="STY0264"
     CDS             278283..278828
                     /locus_tag="STY_RS01210"
                     /old_locus_tag="STY0264"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YaeQ family protein"
                     /protein_id="WP_001185319.1"
                     /translation="MALKATIYKAVVNVADLDRNRFLDAALTLARHPSETQERMMLRL
                     LAWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQASDV
                     ALFAYNSRAAQIWWQQHQSKCAQFANLSVWYLDDGQLAQLSEFADRTMTLQATIQDGA
                     IWLSDARNNLEIQLTAWQQPS"
     gene            278825..279247
                     /gene="arfB"
                     /locus_tag="STY_RS01215"
                     /old_locus_tag="STY0265"
     CDS             278825..279247
                     /gene="arfB"
                     /locus_tag="STY_RS01215"
                     /old_locus_tag="STY0265"
                     /EC_number="3.1.1.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoacyl-tRNA hydrolase"
                     /protein_id="WP_000560526.1"
                     /translation="MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIR
                     ASGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQ
                     KSRRATRPTRASKERRLSSKAQKSSVKALRGKIRRPLD"
     gene            279279..279980
                     /gene="nlpE"
                     /locus_tag="STY_RS01220"
                     /old_locus_tag="STY0266"
                     /gene_synonym="cutF"
     CDS             279279..279980
                     /gene="nlpE"
                     /locus_tag="STY_RS01220"
                     /old_locus_tag="STY0266"
                     /gene_synonym="cutF"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006899150.1"
                     /note="NlpE, an outer membrane lipoprotein, interacts
                     directly with CpxA, the sensor histidine kinase of the Cpx
                     system for response to envelope stress; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="envelope stress response activation lipoprotein
                     NlpE"
                     /protein_id="WP_000252574.1"
                     /translation="MVRTAILSVAAACTLFALIGCNNRAEVDALQPAQAAELKPMQQS
                     WRGVLPCADCEGIETSLFLEKDGTWVMNERYQGVREEPSSFASYGTWARTADKLVLTD
                     SNGEKSYYRAKGNALEMLDREGNPVASQLNYTLVPVTASLPVTPMPLRGMYVYRADAA
                     TFTDCATGKRLPVASNAQLERGYLAAKGEAEKPVLLTVEGHFVFAANPDTGEPVKTLI
                     ADKNVKFAPGKDCTH"
     repeat_region   complement(279979..280698)
                     /note="IS200"
     gene            complement(280088..280546)
                     /locus_tag="STY_RS01225"
                     /old_locus_tag="STY0267"
     CDS             complement(280088..280546)
                     /locus_tag="STY_RS01225"
                     /old_locus_tag="STY0267"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605-like element IS200F family
                     transposase"
                     /protein_id="WP_000502118.1"
                     /translation="MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKL
                     CEWKNVRILEAECCADHIHMLLEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRN
                     REFWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLSIPYPGSLFTGRK"
     gene            complement(280765..282483)
                     /gene="proS"
                     /locus_tag="STY_RS01230"
                     /old_locus_tag="STY0269"
     CDS             complement(280765..282483)
                     /gene="proS"
                     /locus_tag="STY_RS01230"
                     /old_locus_tag="STY0269"
                     /EC_number="6.1.1.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012133963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline--tRNA ligase"
                     /protein_id="WP_001260683.1"
                     /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLP
                     TGLRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGER
                     PFVLGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDA
                     YSFHTSQESLQETYDAMYAAYSRIFSRMGLDFRAVQADTGSIGGNASHEFQVLAQSGE
                     DDIVFSDVSDYAANIELAEAIAPQTPRAAATQEMTLVDTPNAKTIAELVEQFNLPIEK
                     TVKTLLVKAVKDSKSPLVALLVRGDHELNEVKAEKLPHVASPLTFATEEEIRAVINAG
                     PGSLGPVNMPIPVIIDRTVAAMSDFAAGANIDGKHYFGINWDRDVATPVVADIRNVVA
                     GDPSPDGQGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTR
                     VVAAAIEQNFDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVL
                     MDDRKERPGVMFADMELIGIPHTIVIGDRNLDNDDIEYKYRRSGEKSLIKTGDIVDYL
                     VKAIKG"
     gene            complement(282594..283301)
                     /gene="tsaA"
                     /locus_tag="STY_RS01235"
                     /old_locus_tag="STY0270"
     CDS             complement(282594..283301)
                     /gene="tsaA"
                     /locus_tag="STY_RS01235"
                     /old_locus_tag="STY0270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase
                     TrmO"
                     /protein_id="WP_000093978.1"
                     /translation="MSSFQFDQIGVIRSPYKEKFAVPRQPGLVKSACGELHLIAPYNQ
                     ADAVRGLEAFSHLWVLFVFHQTMDGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGM
                     SLVALKGIECRKESVILKLGSLDLVDGTPVVDIKPYLPFAEALPDAAASYAQQAPIAE
                     MPVSFTAEVAQQLTTLERRYPQLRTFICDVLAQDPRPAYRKGEETGKTYAVWLHDFNV
                     RWRVVNTGFEVFALEPR"
     gene            complement(283298..283702)
                     /gene="rcsF"
                     /locus_tag="STY_RS01240"
                     /old_locus_tag="STY0271"
     CDS             complement(283298..283702)
                     /gene="rcsF"
                     /locus_tag="STY_RS01240"
                     /old_locus_tag="STY0271"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rcs stress response system protein RcsF"
                     /protein_id="WP_001202315.1"
                     /translation="MRALPICLLALMLGGCSMLSRSPVEPVQSTATPPKAEPEKPKAP
                     RAAPVRIYTNAEDLVGKPFRDLGEVSGESCQATNQDSPPNIPTARKRMQINASKMKAN
                     AVLLHSCEITSGTPGCYRQAVCIGSALNISAK"
     gene            complement(283821..284636)
                     /gene="metQ"
                     /locus_tag="STY_RS01245"
                     /old_locus_tag="STY0272"
     CDS             complement(283821..284636)
                     /gene="metQ"
                     /locus_tag="STY_RS01245"
                     /old_locus_tag="STY0272"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter substrate-binding
                     lipoprotein MetQ"
                     /protein_id="WP_000874217.1"
                     /translation="MAFKFKTFAAVGALIGSLALAGCGQDEKDPNHIKVGVIVGAEQQ
                     VAEVAQKVAKEKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQIKDRGYK
                     LVSVGKTFVYPIAGYSKKIKSLDELKDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDG
                     VSLLPTSLDIVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGI
                     FVEDKDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
     gene            complement(284675..285328)
                     /gene="metI"
                     /locus_tag="STY_RS01250"
                     /old_locus_tag="STY0273"
     CDS             complement(284675..285328)
                     /gene="metI"
                     /locus_tag="STY_RS01250"
                     /old_locus_tag="STY0273"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter permease MetI"
                     /protein_id="WP_001287483.1"
                     /translation="MSEAMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPG
                     QIMENARLYRSLSAVVNIFRSIPFIILLVWMIPFTRIIVGTSIGLQAAIVPLTVGAAP
                     FIARIVENALLEIPAGLIEASRAMGATPLQIVRKILLPEALPGLVNAATITLITLVGY
                     SAMGGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQLSGDRIVRAVTHK"
     gene            complement(285321..286352)
                     /gene="metN"
                     /locus_tag="STY_RS01255"
                     /old_locus_tag="STY0274"
     CDS             complement(285321..286352)
                     /gene="metN"
                     /locus_tag="STY_RS01255"
                     /old_locus_tag="STY0274"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014168731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter ATP-binding protein
                     MetN"
                     /protein_id="WP_000594016.1"
                     /translation="MIKLSNITKVFQQGARTIQALNNVSLHVPAGQIYGVIGASGAGK
                     STLIRCVNLLERPTEGSVMVGGQELTTLSESGLTKARRQIGMIFQHFNLLSSRTVFGN
                     VALPLELDNTPKEEIKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPK
                     VLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGE
                     LIEQDTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQARLKASPETDSVPMLRMEFTGQ
                     SVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQEETQAAIAWLQDHH
                     VKVEVLGYV"
     gene            286542..287108
                     /gene="gmhB"
                     /locus_tag="STY_RS01260"
                     /old_locus_tag="STY0275"
     CDS             286542..287108
                     /gene="gmhB"
                     /locus_tag="STY_RS01260"
                     /old_locus_tag="STY0275"
                     /EC_number="3.1.3.82"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-glycero-beta-D-manno-heptose 1,7-bisphosphate
                     7-phosphatase"
                     /protein_id="WP_001140158.1"
                     /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDAFEFIDGVIDAMRELKK
                     MGYALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSIEE
                     FRQVCDCRKPHPGMLISARDFLHIDMAASYMVGDKLEDMQAAAAANVGTKVLVRTGKP
                     VTAEAENAADWVLNSLADLPSAIKKQQK"
     gene            287479..289032
                     /locus_tag="STY_RS01265"
                     /old_locus_tag="STYr001"
     rRNA            287479..289032
                     /locus_tag="STY_RS01265"
                     /old_locus_tag="STYr001"
                     /product="16S ribosomal RNA"
     gene            289106..289181
                     /locus_tag="STY_RS01270"
                     /old_locus_tag="STYt001"
     tRNA            289106..289181
                     /locus_tag="STY_RS01270"
                     /old_locus_tag="STYt001"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:289140..289142,aa:Glu,seq:ttc)
     gene            289366..292392
                     /locus_tag="STY_RS01275"
                     /old_locus_tag="STYr002"
     rRNA            289366..292392
                     /locus_tag="STY_RS01275"
                     /old_locus_tag="STYr002"
                     /product="23S ribosomal RNA"
     gene            292483..292598
                     /gene="rrf"
                     /locus_tag="STY_RS01280"
                     /old_locus_tag="STYr003"
     rRNA            292483..292598
                     /gene="rrf"
                     /locus_tag="STY_RS01280"
                     /old_locus_tag="STYr003"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
     gene            292653..292729
                     /locus_tag="STY_RS01285"
                     /old_locus_tag="STYt002"
     tRNA            292653..292729
                     /locus_tag="STY_RS01285"
                     /old_locus_tag="STYt002"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:292687..292689,aa:Asp,seq:gtc)
     gene            292894..293697
                     /gene="dkgB"
                     /locus_tag="STY_RS01290"
                     /old_locus_tag="STY0276"
     CDS             292894..293697
                     /gene="dkgB"
                     /locus_tag="STY_RS01290"
                     /old_locus_tag="STY0276"
                     /EC_number="1.1.1.346"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-didehydrogluconate reductase DkgB"
                     /protein_id="WP_000154870.1"
                     /translation="MTIPAFGLGTFRLKDDVVIASVKTALELGYRAVDTAQIYDNEAA
                     VGQAIAESGVPRNELYITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTLIHWPSPG
                     DAVSVEEFMQALLEAKKQGLTREIGISNFTIPLMEKAIAAVGADHIATNQIELSPYLQ
                     NRKVVDWAKAHGIHITSYMTLAYGKALKDEVIARIAVKHNATPVQVILAWAMGEGYSV
                     IPSSTRRENLASNLLAQDLHLDAEDKNAIAALDCNDRLVSPEGLAPAWD"
     gene            complement(293718..294632)
                     /locus_tag="STY_RS01295"
                     /old_locus_tag="STY0277"
     CDS             complement(293718..294632)
                     /locus_tag="STY_RS01295"
                     /old_locus_tag="STY0277"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_000648539.1"
                     /translation="MKATSEELAIFVAVVESGSFSRAAEQLGQANSAVSRAVKKLEMK
                     LGVSLLNRTTRQLSLTEEGERYFRRVQQILQEMAAAETEIMESRNTPRGLLRIDAATP
                     VMLHFLMPLIKPFRERYPEITLSLVSSETFINLIERKVDVAIRAGTLTDSSLRARPLF
                     TSYRKVIASPDYIARFGKPESVEELKQHLCLGFSEPISLNTWPIACSDGQLHEIECGI
                     SSNSGETLKQLCLNGNGIACLSDYMIDKEIARGELVELLADKRLPVEMPFSAVYYSDR
                     AVSTRIRAFIDFLSEYIRTAPAGAVKEG"
     gene            294737..295912
                     /locus_tag="STY_RS01300"
                     /old_locus_tag="STY0278"
     CDS             294737..295912
                     /locus_tag="STY_RS01300"
                     /old_locus_tag="STY0278"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_001127546.1"
                     /translation="MPLALFALTISAFAIGTTEFVIVGLVPTIAQQLAVSLPSAGMLV
                     LIYALGVAIGAPVLTALTGRLPRKQLLVALMVLFTAGNLLAWQAPGYMTLIAARLLTG
                     LAHGVFFSIGSTIATSLVPKEKAASAIAIMFGGLTVALVTGVPLGTFIGQHFGWRETF
                     LAVSLLGVIALMSSQLLIPANIPGRAAASIRDQVKVLTHPRLLLIYAVTALGYGGVFT
                     AFTFLAPMMQDLAGFSPAAVSWILLGYGVSVAIGNIWGGKLADKHGAVPALKFIFAAL
                     FVLLMVFQVTASTQYAALATILVMGIFAFGNVPGLQVYVVQKAEQFTPNAVDVASGLN
                     IAAFNIGIALGSVIGGQTVAHYGLAQTPWIGALIVLVAFLLMGVSGRLDKPVRIALE"
     gene            296044..296844
                     /locus_tag="STY_RS01305"
                     /old_locus_tag="STY0279"
     CDS             296044..296844
                     /locus_tag="STY_RS01305"
                     /old_locus_tag="STY0279"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_414745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase family
                     protein"
                     /protein_id="WP_001230964.1"
                     /translation="MRKNTYAMRYVAGQPAERILPLGSFASIGQALPAGEPLSSEERI
                     RILVWNIFKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFV
                     LPQHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNVHAVNF
                     SLGVDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRPRMNALYRFAREMSLRQVRFTD
                     DQRRRAFGRPLDFVFYRGLNVNEASVLVTRASDHNPLLVEFSPGKPEQ"
     gene            296922..297692
                     /locus_tag="STY_RS01310"
                     /old_locus_tag="STY0280"
     CDS             296922..297692
                     /locus_tag="STY_RS01310"
                     /old_locus_tag="STY0280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_000207227.1"
                     /translation="MTTHSHHDNVEKQFGSQANAYLHSAVHAAGRDLARLAQRLSDFS
                     HASVLDMGCGAGHASFVAAQHVNSVVAYDLSASMLEVVAGAAEERHLSNITLRQGYAE
                     KLPFEDASFEVVISRYSAHHWHDVGQALREVYRVLKPGGVLIIMDVMSPGHPVRDIWL
                     QTVEALRDTSHVRNYSSGEWLAMVNNAMLVTNTVITDRLSLEFRSWVTRMRTPAPLVE
                     AIRLYQASAPVEVKRYFELQDDGSFSSDTIMLEAHKAV"
     gene            complement(297748..299115)
                     /gene="mltD"
                     /locus_tag="STY_RS01315"
                     /old_locus_tag="STY0281"
     CDS             complement(297748..299115)
                     /gene="mltD"
                     /locus_tag="STY_RS01315"
                     /old_locus_tag="STY0281"
                     /EC_number="4.2.2.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein transglycosylase D"
                     /protein_id="WP_000644706.1"
                     /translation="MKAKAILLASVLLVGCQTSQNTGNVQQHAQSLSAAGQGEAGKFT
                     SQARWMDDGTSIAPDQDLWAFIGDELKMGIPENSRIREQKQKYLRNKSYLHDVTLRAE
                     PYMYWIAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQT
                     RNYDARRDVVASTTAALDMMQRLNKMFDGDWLLTVAAYNSGEGRVMRAIKANKARGKP
                     TDFWSLSLPRETKLYVPKMLALSEILKNSKRYGVRLPTTDESRALARVRLNSPVEMAQ
                     VADMAGMSISKLKTFNAGVKGSTLGVSGPQYVMVPKKHAEQLRESLASGEIDAVQSQL
                     IADNTPLNSRSYKVRSGDTLSGIASRLGVSTKDLQQWNNLRGSRLKIGQSLTVGAGSS
                     AQRLANNSDSITYRVRKGDSLSSIARRHGVNIKDVMRWNHDTDNLQPGDQLTLFVKDN
                     STPDS"
     gene            complement(299187..299942)
                     /gene="gloB"
                     /locus_tag="STY_RS01320"
                     /old_locus_tag="STY0282"
     CDS             complement(299187..299942)
                     /gene="gloB"
                     /locus_tag="STY_RS01320"
                     /old_locus_tag="STY0282"
                     /EC_number="3.1.2.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyacylglutathione hydrolase"
                     /protein_id="WP_001052766.1"
                     /translation="MNLNSIPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAAHKW
                     MPEAIFLTHHHYDHVGGVKELLQHFPQMTVYGPAETQDKGATHLVGDGDTIRVLGEKF
                     TLFATPGHTLGHVCYFSHPYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTL
                     ICSAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLR
                     TEDIDLINEINKETILQQPEARFAWLRSKKDTF"
     gene            299977..300699
                     /locus_tag="STY_RS01325"
                     /old_locus_tag="STY0283"
     CDS             299977..300699
                     /locus_tag="STY_RS01325"
                     /old_locus_tag="STY0283"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_000801233.1"
                     /translation="MKPARLSQTVVAPGCWGELPWGNYYREALEQQLNPWFAKMYGFH
                     LLKIGNLSAEINSEACAVSHQVNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPW
                     CTDPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVLVLRKTPPYNSRMFTLMRQL
                     DWLSLLNFEVLHYSRFHVLPWKKQGGRLLNTHIPALGCLQLIVARKRTIPLTLNPLRH
                     NKSKTPIRQTVGATRQYRKPDG"
     gene            complement(300696..301163)
                     /gene="rnhA"
                     /locus_tag="STY_RS01330"
                     /old_locus_tag="STY0284"
     CDS             complement(300696..301163)
                     /gene="rnhA"
                     /locus_tag="STY_RS01330"
                     /old_locus_tag="STY0284"
                     /EC_number="3.1.26.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HI"
                     /protein_id="WP_000917872.1"
                     /translation="MLKQVEIFTDGSCLGNPGPGGYGAILRYRGHEKTFSEGYTLTTN
                     NRMELMAAIVALEALKEHCEVTLSTDSQYVRQGITQWIHNWKKRGWKTAEKKPVKNVD
                     LWKRLDAALGQHQIKWVWVKGHAGHPENERCDELARAAAMNPTQEDSGYQAEA"
     gene            301227..301958
                     /gene="dnaQ"
                     /locus_tag="STY_RS01335"
                     /old_locus_tag="STY0285"
     CDS             301227..301958
                     /gene="dnaQ"
                     /locus_tag="STY_RS01335"
                     /old_locus_tag="STY0285"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="WP_001670675.1"
                     /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVINRRLT
                     GNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPVFADVVDEFLDYIRGAELVIHNASF
                     DIGFMDYEFGLLKRDIPKTNTFCKVTDSLALARKMFPGKRNSLDALCSRYEIDNSKRT
                     LHGALLDAQILAEVYLAMTGGQTSMTFAMEGETQRQQGEATIQRIVRQASRLRVVFAS
                     EEELAAHESRLDLVQKKGGSCLWRA"
     gene            302092..302168
                     /locus_tag="STY_RS01340"
                     /old_locus_tag="STYt003"
     tRNA            302092..302168
                     /locus_tag="STY_RS01340"
                     /old_locus_tag="STYt003"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:302126..302128,aa:Asp,seq:gtc)
     gene            complement(302488..303542)
                     /locus_tag="STY_RS01345"
                     /old_locus_tag="STY0286"
                     /pseudo
     CDS             complement(302488..303542)
                     /locus_tag="STY_RS01345"
                     /old_locus_tag="STY0286"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459263.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ImpA family type VI secretion system protein"
     gene            complement(303553..304548)
                     /gene="tssG"
                     /locus_tag="STY_RS01350"
                     /old_locus_tag="STY0288"
     CDS             complement(303553..304548)
                     /gene="tssG"
                     /locus_tag="STY_RS01350"
                     /old_locus_tag="STY0288"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system baseplate subunit TssG"
                     /protein_id="WP_000145233.1"
                     /translation="MTGALDQAQKAPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKF
                     RLGQTPTMTFAPREIAQVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHD
                     PTLVHFSNIFHYRWLTQFWQAWRSGQSAGGGLDKPEHDRFAFYIASISGQDLRESAES
                     PLSDHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGT
                     PAQSSVLGNGALIGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIG
                     FEYCWEIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH"
     gene            complement(304545..306428)
                     /gene="tssF"
                     /locus_tag="STY_RS01355"
                     /old_locus_tag="STY0289"
     CDS             complement(304545..306428)
                     /gene="tssF"
                     /locus_tag="STY_RS01355"
                     /old_locus_tag="STY0289"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system baseplate subunit TssF"
                     /protein_id="WP_000371495.1"
                     /translation="MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADP
                     YVERMIEAFSFLSARTQLKIDAEFPRFTQRLLEVVNPNYVTPTPSMAVVKLYPDTQEG
                     DLAKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWPLSIEEVRLTAAPPDMPALHR
                     YLPPNIHVAGALRITLRTFGELAFSELAGPARLPFYLCGEERIASHLFELLHTSAVAT
                     LAGEPGHFDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFF
                     TPTGLSAGLQKVQGNVAEIVILLNRLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRI
                     EVTHSVTEQHLVVDRTRPLDYEVFSVQEVEGLEAETTRKMIFRPLYHTRNNDEGNHGR
                     YFSLRREPRRSSESARRYGTRTPYTGSEVFLSLVDQHEAPYPENLRHITVTAMVTNRD
                     LPCLIPRNGRDDLTVDAAIPVAGVGLIRPPRPPQPPLAEREMAWRLIRQLSFNYLPLA
                     DLDHRTGGQALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLVYGRGVS
                     CELTVDEEGFSGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGHVMTWPVRTGQR
                     GSV"
     gene            complement(306444..306938)
                     /gene="tssE"
                     /locus_tag="STY_RS01360"
                     /old_locus_tag="STY0290"
     CDS             complement(306444..306938)
                     /gene="tssE"
                     /locus_tag="STY_RS01360"
                     /old_locus_tag="STY0290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system baseplate subunit TssE"
                     /protein_id="WP_000108006.1"
                     /translation="MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEII
                     RRDLSFLLNTISHEGDIDARRYPQAAASVLNYGLPPLAGSFMYEHKWDDISEAIRRAI
                     IRFEPRLNAATLRVTPLLDEARQGSYNTLQFEIRGQILTQPYPTEFLVRSALDMELSR
                     ITFF"
     gene            complement(306935..307759)
                     /locus_tag="STY_RS01365"
                     /old_locus_tag="STY0291"
     CDS             complement(306935..307759)
                     /locus_tag="STY_RS01365"
                     /old_locus_tag="STY0291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000750542.1"
                     /translation="MKKTDTLPATLSALLQEYSIAEGIQMAEQQVRENPAKALCRHSL
                     FQLLCVAGDWARALHQLQLCARMEANYTQEARLYRELVCCEMFRHTVFQGEQRPGFLL
                     PQPVWVESLLAALACHDDTGEVDKHRNTALEAITDTGGQWNGGAFDWASDSDSRLGPV
                     LELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWLFTRYSGSE
                     SASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMTHCTFHAQENDGA"
     gene            complement(307746..308648)
                     /gene="tagK"
                     /locus_tag="STY_RS01370"
                     /old_locus_tag="STY0292"
     CDS             complement(307746..308648)
                     /gene="tagK"
                     /locus_tag="STY_RS01370"
                     /old_locus_tag="STY0292"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system-associated protein
                     TagK"
                     /protein_id="WP_000806676.1"
                     /translation="MKQDMWELRKIQSQGITDNAQYPAGTYIVFTAAAPYIPLFEQHG
                     KDDIALSLVRHEEAWWIVNHSDELCCAVNEQVMEPHHRMRLNDGDTIEWGLSSWCLAR
                     TNDESRPDVSFPQLVQSSESVAEYLDLDWFKQQQLNPQNPFDIIPVRETAPSYTGHEA
                     DSTLHQLYQEYQQALRPSGQEKPLRPKPFPRNEDAVTQDLTSLYDKKGDTDTLQDMVA
                     GAPGIDAILDTLDTTGEGEMHWLAMESMPDILQLLSPEMGGKTAHSEILPDLTRREHR
                     IIGIDSHYRITPTQKNGNTAHEKN"
     gene            309016..311679
                     /gene="tssH"
                     /locus_tag="STY_RS01375"
                     /old_locus_tag="STY0294"
     CDS             309016..311679
                     /gene="tssH"
                     /locus_tag="STY_RS01375"
                     /old_locus_tag="STY0294"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000449792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system ATPase TssH"
                     /protein_id="WP_000449770.1"
                     /translation="METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWGELTHWLH
                     QLTQQPDNDILHVLRHYQIPLSDVEKALLRQLDMLPAGASAISDFSHHIDLSVEKAWM
                     LASVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLATLPVDELTEILPSLIETSPE
                     AQERPYDGSGLASAIPGESSQAIPNGVQDGKSALAKYCQDMTAQARDGKIDPVTGREH
                     EIRTMTDILLRRRQNNPLLTGEAGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVG
                     ALLAGASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAGGASGTGDAANLLKP
                     ALACGTLRTIGATTWSEYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEK
                     HHNVLILDEAVRAAVQLSHRYIPARQLPDKAISLLDTAAVRVALTLHTPPASVQFLRQ
                     QLKAAEMERSLLQKQEKMGIQSDERCDALTARIFSLNDELTASESRWQRELELVHTLQ
                     ELRVAESDADDKTTLQQAETALREWQGDAPVVFPEVSAAIVAAIVADWTGIPAGRMVK
                     DEASQVLELPARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGK
                     TETALALAEAIYGGEQNLVTINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRH
                     PWSVVLLDEIEKAHHDVHELFYQVFDKGGMEDGEGTHVDFKNTTLLLTTNVGSDLISQ
                     MCEDPALMPDATGLKEALMPELRKHFPAAFLGRVTVIPYLPLDETSRGVIARLHLDRL
                     VARMGEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQHILPQLSRYWLQAMTE
                     KAAIRQIDIGVNGDEQIVFETTSQEGICQKS"
     gene            311765..312055
                     /locus_tag="STY_RS01380"
     CDS             311765..312055
                     /locus_tag="STY_RS01380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000175185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000175184.1"
                     /translation="MTLRDPALLTPLLMMFAFSVHGEPPLPQDVQHFLSNAEMCQHLA
                     GEWDSSLPEEDKKDIKKGINTWCPPAKKALPGLREKYKENKEIIKKLSEYDF"
     gene            312119..312661
                     /gene="tssB"
                     /locus_tag="STY_RS01385"
                     /old_locus_tag="STY0297"
     CDS             312119..312661
                     /gene="tssB"
                     /locus_tag="STY_RS01385"
                     /old_locus_tag="STY0297"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system contractile sheath
                     small subunit"
                     /protein_id="WP_000996818.1"
                     /translation="MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLA
                     DLAGKPREELPPVTDRKFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLE
                     NMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKAGAENLVNKLLQDPTLLKTLA
                     NAPKSAATQQGVSADNESAE"
     gene            312685..314193
                     /gene="tssC"
                     /locus_tag="STY_RS01390"
                     /old_locus_tag="STY0298"
                     /pseudo
     CDS             312685..314193
                     /gene="tssC"
                     /locus_tag="STY_RS01390"
                     /old_locus_tag="STY0298"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459271.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system contractile sheath
                     large subunit"
     gene            314246..314647
                     /locus_tag="STY_RS01395"
     CDS             314246..314647
                     /locus_tag="STY_RS01395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001147173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BPSL0067 family protein"
                     /protein_id="WP_001147174.1"
                     /translation="MPYVYANAKALQDTEKVGNHHQCVELIQHYIRVGQASTWQQGAA
                     VFGNKNIEVGTVIATFVNGRYPNHNSGNHAAFFLGQDTGGIWVMDQWKDDIAKPRVSK
                     RYIRKLHNGSVRSDGTYIRMSNNAEAYFIVE"
     gene            314619..315044
                     /locus_tag="STY_RS01400"
     CDS             314619..315044
                     /locus_tag="STY_RS01400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001171576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001171575.1"
                     /translation="MQKPILSLNSTCIVGGILWLLPVIVVHADEIVCPAVIHFSQAPI
                     ISSAEGWNVSSRAARMLNDGGFLSSGDPKEQADLKGEDAVVDGKKGHLWEIDPEDNRR
                     GIWFSCSYGQWAVLLARKVQGTVATCWSPDVLPAKLICK"
     gene            315281..315766
                     /locus_tag="STY_RS01405"
                     /old_locus_tag="STY0302"
     CDS             315281..315766
                     /locus_tag="STY_RS01405"
                     /old_locus_tag="STY0302"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system tube protein Hcp"
                     /protein_id="WP_000312802.1"
                     /translation="MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGS
                     GLGSGKVSVTNLDFDHYIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFT
                     DLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKE
                     I"
     gene            315833..316369
                     /gene="tssJ"
                     /locus_tag="STY_RS01410"
                     /old_locus_tag="STY0303"
     CDS             315833..316369
                     /gene="tssJ"
                     /locus_tag="STY_RS01410"
                     /old_locus_tag="STY0303"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system lipoprotein TssJ"
                     /protein_id="WP_001007105.1"
                     /translation="MNEWRNPTRWLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSV
                     KASDKVNPDNQKKAAPIEIRVYELKNDAAFTTADYWSLHDNDKSVLTDDLVRRDSFIL
                     RPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFIPGKGKV
                     QLEAELEQSAIVITERDK"
     gene            316373..317716
                     /gene="tssK"
                     /locus_tag="STY_RS01415"
                     /old_locus_tag="STY0304"
     CDS             316373..317716
                     /gene="tssK"
                     /locus_tag="STY_RS01415"
                     /old_locus_tag="STY0304"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system baseplate subunit TssK"
                     /protein_id="WP_000118739.1"
                     /translation="MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWG
                     FSHYNIDGEALNIGKLILKEASGIFPDGTPFNAPDHTPLPPPLTILPEHLNQQICLAV
                     PVRAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRGAQLLQLTHLRLRLLPEKAVT
                     GAWIGLPLTRITGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLIRMRADSLA
                     ERLTGSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELST
                     YVRPQTRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNA
                     VVAPSDLADFSTLVLAIKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVL
                     PVPPRQIPFQAGYIYYDIRREGALWEHIARYGGMAMHTAGEFPGLETELWGVRDK"
     gene            317713..319014
                     /gene="tssL"
                     /locus_tag="STY_RS01420"
                     /old_locus_tag="STY0305"
     CDS             317713..319014
                     /gene="tssL"
                     /locus_tag="STY_RS01420"
                     /old_locus_tag="STY0305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system protein TssL"
                     /protein_id="WP_000132484.1"
                     /translation="MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIV
                     EDGPDSKLRLAEISAAANPLLAAARPLLCALAAMPAKLDAALVEPYRNLLVREMHLYQ
                     TLCDQANLRREHVLAVRYCLCTALDEAANNTTWGRRGVWAGKSLLVTFHGESEGGIKL
                     FQIIGRLAASFQEHGNVLEVIYHLLGLGFEGRYSVQPDGRKQLDNIRQQLLTQLSQRR
                     DPVMPALSPDFQGAISGRLRRMRRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQ
                     HIDAIGIKLPPPVPVHKLRLKILLANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQKT
                     VSDAIRPVINKAAREIARVGGAVTVTGHTDSQPIHSAEFPSNLVLSEKRAAEVAALLT
                     SGGVPAGRVHIVGKGDTVPVADNGSKAGRAKNRRVEILVVE"
     gene            319019..319768
                     /locus_tag="STY_RS01425"
                     /old_locus_tag="STY0306"
     CDS             319019..319768
                     /locus_tag="STY_RS01425"
                     /old_locus_tag="STY0306"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001769329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001769329.1"
                     /translation="MIKKSTYDVSHHSAICGVTGDYYRISATYHIKRSIRVFLIILCC
                     LLPGGVFAGSLINAGLISPDNVNLSIRDFLGFYASDNLQEKDNTLMYVLGVADATEGK
                     TWCGYGQVDSITINHTVLAWLDRYSVKKPDARASVLIEEALVKNFPCQGTEPSVKIAS
                     RSSPVLSLTPDALNLSGNDFFKFWVSGNQLDKLRAGIYLLGVEDATEKKLWCGYDLFK
                     TLTLNEIVYVFLKIKHIKNLILARLSLLWIN"
     gene            319800..320294
                     /locus_tag="STY_RS01430"
     CDS             319800..320294
                     /locus_tag="STY_RS01430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000803074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000803074.1"
                     /translation="MKPLFSVLKSNHNSSSFESPDFVDSKDFYAGIGYDQGKLGAQFE
                     NTCAARMSVALIKSGVKFKGRLLPIKEGKWKGRSIETGAKNLADILSQATVFGKPAVW
                     RDPTKFQTELGNKKGVVFFWKIDGYNGGSGSHIDLIEPTSAGAVCHSHCYFSCKQIWF
                     WELR"
     gene            320531..324392
                     /gene="tssM"
                     /locus_tag="STY_RS01435"
                     /old_locus_tag="STY0308"
                     /pseudo
     CDS             320531..324392
                     /gene="tssM"
                     /locus_tag="STY_RS01435"
                     /old_locus_tag="STY0308"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459283.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system membrane subunit TssM"
     gene            324392..325159
                     /locus_tag="STY_RS01440"
                     /old_locus_tag="STY0310"
     CDS             324392..325159
                     /locus_tag="STY_RS01440"
                     /old_locus_tag="STY0310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2094 domain-containing protein"
                     /protein_id="WP_001254133.1"
                     /translation="MRRPAVVSAPAMFGRLPDQRDYVRWRVGAEEGRIWQDWLNRQTW
                     VGSGRHIVLPEGQTTDEERDGWMHLSPRGEHDMPAPEHHPLPWSFVMSPGFLPMGGTT
                     DWLTGVLMASRDSVGRPWPLVIYQRCGREWLDESLQETQGWLYWLARLAAQHITPDTM
                     RRGRLTEQVDQLWAMWQPGPWWAQWLRGLRRTSQRSWELTGLPDEAPVVELPGVRYLP
                     WPGWPGKTLGQATPGQGWFWQQNSEGRYVDALRLAEK"
     gene            325202..325672
                     /locus_tag="STY_RS01445"
                     /old_locus_tag="STY0311"
     CDS             325202..325672
                     /locus_tag="STY_RS01445"
                     /old_locus_tag="STY0311"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000501515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosaminidase domain-containing protein"
                     /protein_id="WP_000528840.1"
                     /translation="MGNYDKACNNTEAVRFIQKYKNDCEIIANQLEVPVEFILAVAAK
                     ESRYGQGRIATEYNNFFSMHGPAPLQLSKVHPQGSHDVWVATYTSFLNCAKSFAIRFG
                     SAVRKINDPKKFAQALIESRFNSGKSSNGGHTGYASELVAMIGMVKRRMACSVK"
     gene            325657..326130
                     /locus_tag="STY_RS01450"
                     /old_locus_tag="STY0312"
     CDS             325657..326130
                     /locus_tag="STY_RS01450"
                     /old_locus_tag="STY0312"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016506348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000491744.1"
                     /translation="MFSKIVSLLLFTILSVSSYAQVLVSNIPVFDLAKLNQEGLAETQ
                     AQALLVLSLKNKKYNITLPSVFMDEALKNDQGKPFHSGYYSFGVGYDSPSVGATDIWG
                     LFSVSPKTGDIWEEYSCERISFPALQKIQQEIMKKTGATFASEVVQRRGLGCTDE"
     gene            326234..326704
                     /locus_tag="STY_RS01455"
     CDS             326234..326704
                     /locus_tag="STY_RS01455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000528842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosaminidase domain-containing protein"
                     /protein_id="WP_000528845.1"
                     /translation="MGNYDKACNNVGAVRFVQEHMKVCEIIAKELDVPVENILGLAAA
                     ESQYGTGRIARGYNNYFSLQAPASFQSGRVHPKDSNKTWVAIFSSFSVCARSFAVKYG
                     DAVRGKKDALVFSEALVAAGFNSGSHITGGTDNYARITAGIIIMVGRRIACPVK"
     gene            326689..327150
                     /locus_tag="STY_RS01460"
     CDS             326689..327150
                     /locus_tag="STY_RS01460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001670388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001674711.1"
                     /translation="MPRKIMLVFFLFISEFCYAQAVVSEFNLSDINRGGMTKAQAEKL
                     LIIALKYQKYDLSLDGVFVDGDLQDKHGNPPHPGYYDFSLGYDTPTAGAIDYWGLFSV
                     SSQTGDIWEINKCERIIFPQLQKIQQEIMKKTGATFASEVVQRRGLGCTDE"
     gene            327278..327694
                     /locus_tag="STY_RS01465"
                     /old_locus_tag="STY0316"
     CDS             327278..327694
                     /locus_tag="STY_RS01465"
                     /old_locus_tag="STY0316"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2195 family protein"
                     /protein_id="WP_000759645.1"
                     /translation="MKKYAVEVLFMSACAGMFLPVFAWGGTDVNIDNPLAECVDIHPV
                     HRQEMDNLTILKTTVTLKKSTGECGCFSALISYTSLLAQDVEGYGRGSAYSLQEGNIS
                     LAKMQGRYPFSFVLSVDNQSVRDQKLALMIRCTPPL"
     gene            327721..328158
                     /locus_tag="STY_RS01470"
                     /old_locus_tag="STY0317"
     CDS             327721..328158
                     /locus_tag="STY_RS01470"
                     /old_locus_tag="STY0317"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000290976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2778 domain-containing protein"
                     /protein_id="WP_000290976.1"
                     /translation="MAVRLTFDGQKLTWPGIGIFKATTGLPDLQWPDKQCVPDAAIPE
                     GNYKLFIQFQGEAPIRNAADCDLGPSWGWSTIPRGQAAGTCEIYWANWGYNRIRLESA
                     DEKTRKACGGKRGGFYIHDSTKGYSHGCIEVEPVFFRILKQET"
     gene            328636..330825
                     /locus_tag="STY_RS01475"
                     /old_locus_tag="STY0319"
     CDS             328636..330825
                     /locus_tag="STY_RS01475"
                     /old_locus_tag="STY0319"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system tip protein VgrG"
                     /protein_id="WP_000011527.1"
                     /translation="MSFVSTNNKSGMGGLTTTTPPITGESGGVTADSVAGSVADAAEA
                     AVEQAAGSLFGALPEPSGLVKAAVAAAQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTV
                     SGSAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLNLGYVSPAANLPLKPMVGKDL
                     CVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWVKLLTHTSDYKAFQNKTV
                     VDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSED
                     SHTLVLADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFT
                     KPRSLLANTVANPRETGHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGG
                     NIRTLMTGYTFTLENYPTAEVNQEYLLMQTLLFVQDNAQHSGQDQHFTFSTRFELHPT
                     REVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQYGRVKVQFGWDRYGKMDENSSCW
                     IRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWGLPGMAS
                     QSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHAEKDLNTTVKNNETHTVMVDRTKTI
                     IKNETNSIGEDRNTTVTKNDGLSVKLAQTINIGTTYRLDVGDQFTLRCGNAALVLHKD
                     GSIEFCGKQLMLHTSDVMQLIGKGIDMNPDGGTAVTADDIAPLPTSE"
     gene            330849..331295
                     /locus_tag="STY_RS01480"
                     /old_locus_tag="STY0320"
     CDS             330849..331295
                     /locus_tag="STY_RS01480"
                     /old_locus_tag="STY0320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DcrB-related protein"
                     /protein_id="WP_000375832.1"
                     /translation="MDRPYRIQEGCFVLPETFTDRSVNIFILEGNERTSPSLNISRDT
                     LKPDEDLPAYIDRQIALMKKNLGQHRVLSRAPAQAGTGNDALMGEQIAATHKSGKTEV
                     YQRQAGFIATPGKVLVFTLTSPRPFDDKADLLWNTWLAGFQPDKNE"
     gene            331314..335378
                     /locus_tag="STY_RS01485"
                     /old_locus_tag="STY0321"
     CDS             331314..335378
                     /locus_tag="STY_RS01485"
                     /old_locus_tag="STY0321"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000272669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAAR domain-containing protein"
                     /protein_id="WP_000272669.1"
                     /translation="MYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFL
                     AGLILGFMADQIASGVLQLGEAIGRSIHHTAGKILTGSENVSTNSRPAARAVLSTVKC
                     DNHIAEKRIAQGSGNIYINSQPAARKDDHTECDAVVEDGSPNVFLGGGTQTVLEISSE
                     IPDWLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGELTGMAVSEAI
                     SGLFSNPVDVTTGQKILLPETDFTLPGRLPVTCSRFYASHLETVGLLGQGWRLNWETS
                     LREDDEHITLTGVQGRELRYPKMMLTPGHQIFGPKEQLYLSRLHDGRYVLHYTDRSYY
                     VFGDFDSDGMAYLLFMETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLS
                     RIELVQGGTCGNLVEYRYDDNGQLTGVVNRAGTQVRQFAYENGLMTAHSNAAGFTCRY
                     RWQELDGAPRVTEHDTSDGEHYRFDYDFAAGTTTVTGRQGESWQWWYDRETYITAHRT
                     PGGGMYRFTYNEDHFPVNIGLPGGRTVAYEYDIQNRVVKTTDPEGRVTQTQWNGEFDE
                     ITRTALDDDAVWKTQYNAHGQPVQETDPEGRVTQYAYDEQGQMCSRTDAAGGTVVTAF
                     DSRGQMTRYTDCSGRSTGYDHDEDGNLTRVTDAEGKVVRISYNRLGLPETVNSPGKQQ
                     DRYTWNALGLMSSHRRITGSVESWRYTPRGLLAAHTDEEKRETRWQYTPEGRVTALTN
                     GNGAQYRFSHDADGRLMREVRPDGLSRTFILDDSGYLTAIQTTGTQGGVRRETQQRDA
                     LGRLLRTENEHGQRTFSYNRLDQITAVTLTPTEAGQQQHRMQADTVRFEYDRSGWLTA
                     EHAGNGSICYQRDALGNPTDITLPDGQHLTHLYYGSGHLLQTALDGLTVSEYERDSLH
                     RQIMRTQGQLATYSGYDDDGLLSWQRSLAPGSAPVLPGQRPARQGCVTSRDYYWNNHG
                     EVGTIDDGLRGSVVYSYDRSGYLTGRSGQMYDHDRYYYDKAGNLLDNEGQGPVMNNRL
                     PGCGRDRYGYNEWGELTTRRDQQLEWNAQGQLTRVISGNTETHYGYDALGRRIRKATY
                     GRHTGHTARSRTDFVWEGFRLLQENVQQQGWRTYVYDAEQPYTPVASVTGRGESRQVW
                     YYHTDVTGTPQEVTAADGTLVWAGYIRGFGENAADISNSGAYFHQPLRLPGQYFDDET
                     GLHYNLFRYYAPECGRFVSQDPIGLRGGLNLYAYCPNPLTWIDPLGLDLHHIIPQEVW
                     KTFKTDLKKVTGYVQNVTKKAMDVTNLIDLDKPFHGNHPAYSAYVKDKISELIKNKKL
                     SLTELRNLQDELRSKINAAKASGKNLNDYFKGGC"
     gene            335381..336058
                     /locus_tag="STY_RS01490"
     CDS             335381..336058
                     /locus_tag="STY_RS01490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000875616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000875616.1"
                     /translation="MKYKKIRVSYDTEVTGNVNGVYSVEIKDSLSFKSKEDKKYFEGF
                     FLKNSKDYNRVMIDDFKCIDVNKIQEICFFPVRKKIKEIDMIDFCPFKLGLDFLISKK
                     LFDIMNNFNLPPVNKIPTRINTFNTEYFLIGFPMIPQERIDLNKSIFFDTKKRSEFNL
                     KSYDAFINTDFSVKPRKIYPDVFYDVDTIGFQGKGLFFSDRLIDAIQDAGIVGLHVDD
                     TEMEMNP"
     gene            complement(336104..336427)
                     /locus_tag="STY_RS01495"
     CDS             complement(336104..336427)
                     /locus_tag="STY_RS01495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001651551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I toxin-antitoxin system SymE family toxin"
                     /protein_id="WP_072073180.1"
                     /translation="MPDFTHCEFYSRVEGRSVRLCGEWMPQAGFINGVPVKIRVMKDC
                     IVITLQNTRELLGCIEGMGVTYINQRNVKAWLKDFPGALNDTGDIPVMSRDLQCITTN
                     CRFAH"
     gene            336466..338997
                     /locus_tag="STY_RS01500"
                     /old_locus_tag="STY0324"
     CDS             336466..338997
                     /locus_tag="STY_RS01500"
                     /old_locus_tag="STY0324"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001785801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RHS repeat protein"
                     /protein_id="WP_001688243.1"
                     /translation="MTMHREPGGERYYYTWAWFEGPDDAAWRVTGHHTDSGEQYRLDW
                     NLAERSLCVTDSMGRTRCHWWDAQGLVTAYRDEAGQMTTFRWSDEERLLLGMTDAQGG
                     KWRYVYDRLGHLTETHDPLGRVEQTQWHPVWHQPETEVDAAGVAWRYEYDERGNLQAV
                     SDPLHQRTVYGYDRHGQVVRITDARGGDKYLQWNEDGQLMRHTDCSGSQTAWFYDERT
                     RLERVTDAESNSTRYSYDGNGHLTEVMFADGRTERYQPDAAGRLVKYTSPAGQITRWQ
                     RDGQGRVRRQTDATGRRTAYEYDAYGRLTTLTNENGESYRFRYDVLDRVTEQTDPGGS
                     RRAYGYNALNAVTAVIYGGERGGEIRHGLERDAAGRLTAKITPETRTEYRYDAADRLL
                     EIRRRRHDAAEGGEPEVIRFSYDSAGNLLSEETAQGVLQHRYDVQGNRTETQMPDGRT
                     LRYLYYGSGHLQQINLGRDVISEFTRDHLHREVQRSQGRLDMRRMYDRTGRLTRKLTC
                     KGMRGVVPETFIDREYAYSGQDELLKKRHSRQGVTDYFYDTTGRITACRNEAYLDSWQ
                     YDAAANLLDRRQGETAQAGAGSVVPFNRITSYRGLHYRYDEYGRVVEKRGRNGTQHYR
                     WDAEHRLTEVAVTRGGTVRRYGYVYDAPGRRVEKHELDAEGKPYNRTTFLWDGMRLAQ
                     ECRLGRSSSLYIYSDRGSHEPLARVDRAAPGEADEVLYYHTDVNGAPEEMTDGGGNIV
                     WEAGYQVWGNLTHEKETRPVQQNLRFQGQYLDRETGLHYNLYRFYDPDIGKFISGDPI
                     GLAGGINLYQYAPNPLSYIDPLGLCKKFAGKGSPAERARNYRSTG"
     gene            339016..339336
                     /locus_tag="STY_RS01505"
     CDS             339016..339336
                     /locus_tag="STY_RS01505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010989117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_071525119.1"
                     /translation="MATSNYNINGQTGTADALSGMNTNNSPFLHTPADGSRKFTTFEV
                     GHDRAFDSEVKIFEHIANKFPTTAKGRIDLYSELKVCPSCSEVITQFKAMYPNIEVNV
                     TWGG"
     gene            339338..339781
                     /locus_tag="STY_RS01510"
     CDS             339338..339781
                     /locus_tag="STY_RS01510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000437847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SMI1/KNR4 family protein"
                     /protein_id="WP_000437847.1"
                     /translation="MEQRAFLIEIKKLIASITSKNMTVKGCSTEDILYLEENYGELPK
                     SYKLFLSLLGVESGDFKEGTDLLFKDINDINKYTVELMQENNISIPDGMYSFLLHQGY
                     SALFFIERDDDPSVYCYTEGKEIKKTKYVFSEYVLAEIELYNRYQ"
     gene            complement(339851..340156)
                     /locus_tag="STY_RS01515"
     CDS             complement(339851..340156)
                     /locus_tag="STY_RS01515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001555868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I toxin-antitoxin system SymE family toxin"
                     /protein_id="WP_010989118.1"
                     /translation="MARLCGILTYSRVERLSVRLYGEWMPQAGFINGMPVKVRVMRDC
                     IVITPQHTRGLFVCIEGMGVTFINQKKVKAWLKTFPGALNDTGDIPVIKRSRLEGGI"
     gene            340209..340913
                     /locus_tag="STY_RS01520"
                     /pseudo
     CDS             340209..340913
                     /locus_tag="STY_RS01520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611456.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS481 family transposase"
     gene            341669..342163
                     /locus_tag="STY_RS01525"
                     /old_locus_tag="STY0332"
     CDS             341669..342163
                     /locus_tag="STY_RS01525"
                     /old_locus_tag="STY0332"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000789624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_000789625.1"
                     /translation="MKNIKKLIIASVLSMITASCYAGSIVVGSEQQSSVDIGFASPQQ
                     LSVTFAPVAGLKAGVIKSNTEIATIAVSSVAAKQFAIAADFKAKNVMNGDTWTLYGKN
                     TGKGIKVYFYGETTSPKGNVNYNGHQWIIYDINDKLGVKLAGDQNVPADVFPMTVNIA
                     AYQA"
     gene            342296..342794
                     /locus_tag="STY_RS01530"
                     /old_locus_tag="STY0333"
                     /pseudo
     CDS             342296..342794
                     /locus_tag="STY_RS01530"
                     /old_locus_tag="STY0333"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000789648.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="Saf-pilin pilus formation protein SafA"
     gene            342869..343609
                     /gene="papD"
                     /locus_tag="STY_RS01535"
                     /old_locus_tag="STY0335"
     CDS             342869..343609
                     /gene="papD"
                     /locus_tag="STY_RS01535"
                     /old_locus_tag="STY0335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001676318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pili assembly chaperone PapD"
                     /protein_id="WP_000691915.1"
                     /translation="MKIISFGVMAAVLFVSNSITPPVYAAEQKLSLNTKSFSVKLGAT
                     RVIYHAGTVGATLSVSNPQNYPILVQSSVKAADKSSPAPFLVMPPLFRLEANQQSQLR
                     IVRTGGDMPTDRETLQWVCVKAVPPENEPSDTQAKGATLDLNLSINVCDKLIFRPDAV
                     KGTPEDVAGNLRWVEAGNKLKVENPTPFYMNLASVTVGGKPITGLEYIPPFADKTLNM
                     PGSAHGDVEWRVITDFGGESHPFHYVLK"
     gene            343633..346143
                     /locus_tag="STY_RS01540"
                     /old_locus_tag="STY0336"
     CDS             343633..346143
                     /locus_tag="STY_RS01540"
                     /old_locus_tag="STY0336"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial biogenesis outer membrane usher
                     protein"
                     /protein_id="WP_000669630.1"
                     /translation="MKFKQPALLLFIAGVVHCANAHTYTFDASMLGDAAKGVDMSLFN
                     QGVQQPGTYRVDVMVNGKRVDTRDVVFKLEKDGQGTPFLASCLTVSQLSRYGVKTEDY
                     PQLWKAAKTPDECADLTAIPQAKAVLDINNQQLQLSIPQLALRPEFKGIAPEDLWDDG
                     IPAFLMNYSARTTQTDYKMDMVGRDNSSWVQLQPGINIGAWRVRNATSWQRSSQLSGK
                     WQAAYTYAERGLYSLKSRLTLGQKTSQGEIFDSVPFTGVMLASDDNMVPYSERQFAPV
                     VRGIARTQARVEVKQNGYTIYNTTVAPGPFALRDLSVTDSSGDLHVTVWEADGSTQMF
                     VVPYQTPAIALHQGYLKYSLLAGRYRSSDSATDKAQIAQATLMYGLPWNLTAYGGIQS
                     ATHYQAASLGLGGSLGRWGSLSVDGSDTHSQRQGEAVQQGASWRLRYSNQLTATGTNL
                     FLTRWQYASQGYNTLSDVLDSYRHNGNRLWSWRENLQPSSRTTLMLSQSWGRHLGNLS
                     LIGSRTDWRNRPGHDDSYGLSWGTSIGGGSLSLNWNQNRTLWRNGGHRKENITSLWFS
                     MPLSRWTGNNVSASWQMTSPSHGGQTQQVGVNGEAFSQQLDWEVRQSYRADAPPGGGN
                     NSALHLAWNGAYGLLGGDYSYSRAMRQMGVNIAGGIVIHHHGVTLGQPLQGSVALVEA
                     PGASGVPVGPWPGVKTDFRGDTTVGNLSVYQENTVSLDPSQLPDDAEVTQTDVRVVPT
                     EGAVVEAKFHTRIGARALMTLKREDGSAIPFGAQVIVNGQDGSADLVDTDSQVYLTGL
                     ADKGELTVKWGAQQCRVNYHLPAHKGIAGLYQMSGLCR"
     gene            346165..346635
                     /locus_tag="STY_RS01545"
                     /old_locus_tag="STY0337"
     CDS             346165..346635
                     /locus_tag="STY_RS01545"
                     /old_locus_tag="STY0337"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilin structural protein SafD"
                     /protein_id="WP_000266939.1"
                     /translation="MWMKIQRVKTVIYSVSLLVAASSLVPIANAAEKLQTTLRVGTYF
                     RAGHVPDGMVLAQGWVTYHGSHSGFRVWSDEQKAGNTPTVLLLSGQQDPRHHIQVRLE
                     GEGWQPDTVSGRGAILRTAADNASFSVVVDGNQEVPADTWTLDFKACALAQEDT"
     gene            347043..347864
                     /locus_tag="STY_RS01550"
                     /old_locus_tag="STY0338"
     CDS             347043..347864
                     /locus_tag="STY_RS01550"
                     /old_locus_tag="STY0338"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase family protein"
                     /protein_id="WP_000119384.1"
                     /translation="MSYARHLPVLMYHHVSDKPGQITLSPRTFRAQMKWLAESGWKTV
                     TAAAVEAFYHGARLPRKSVMLTFDGGWLDNWLQVFPVLQEFNLHAHLFLVTSLISDGP
                     VRIPAGEPVYSHDECQMLVKQGRVDEVMLRWSEVREMHLSGLVEFHSHTHTHRRWDQK
                     PVSRNPSDLLRVDILLSRKRMREMLGYCSQHLCWPEGWYCSDYIHVAEELGFTYLYTT
                     ERRMNNPVIGSQRIGRINTKERKNVGWLKRRLFYHTTPGFSSLLARHKGARRIAD"
     gene            347947..348187
                     /locus_tag="STY_RS01555"
                     /old_locus_tag="STY0338a"
                     /pseudo
     CDS             347947..348187
                     /locus_tag="STY_RS01555"
                     /old_locus_tag="STY0338a"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309415.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="PerC family transcriptional regulator"
     gene            348679..349626
                     /locus_tag="STY_RS01560"
                     /old_locus_tag="STY0341"
     CDS             348679..349626
                     /locus_tag="STY_RS01560"
                     /old_locus_tag="STY0341"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_000970303.1"
                     /translation="MMELINNRGMRDWMIFIKVAEVGNLSRAARELDISISAVSKSLS
                     RLENSIEVTLLRRDSHHLELTGAGQTAYASMKRITSSFQSLLDELRNPDKIIRGSIKF
                     SAPAIVCEFLANKWIWEFTASYPDTKIYLDSRERSDFFSKSLEFDELVFKSGIIESED
                     LVYRKISPLKLVLCASPKYIRKYGRISHPGDLENHIIVGLHNHGLSGPLTLFRQEESY
                     TISGAVNVHLSSNNLLSVLNLVLEGKGINLMTPAWLATKYLKNNELEIILPEWRVPDL
                     PIYLVWRHRQYYSPLFQRFLSFIEDKWNNRPQIDFLNDD"
     gene            349746..349859
                     /locus_tag="STY_RS01565"
     CDS             349746..349859
                     /locus_tag="STY_RS01565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010989119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010989119.1"
                     /translation="MMPTDGNDNTRKQDGAVFGQPEVKPMPETLQCTEKWR"
     gene            349946..>350107
                     /locus_tag="STY_RS01570"
                     /old_locus_tag="STY0343"
                     /pseudo
     CDS             349946..>350107
                     /locus_tag="STY_RS01570"
                     /old_locus_tag="STY0343"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013365374.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(350172..350807)
                     /locus_tag="STY_RS01575"
                     /pseudo
     CDS             complement(350172..350807)
                     /locus_tag="STY_RS01575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001355627.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
     gene            351764..352474
                     /gene="tcfA"
                     /locus_tag="STY_RS01580"
                     /old_locus_tag="STY0345"
     CDS             351764..352474
                     /gene="tcfA"
                     /locus_tag="STY_RS01580"
                     /old_locus_tag="STY0345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001539136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein TcfA"
                     /protein_id="WP_001009503.1"
                     /translation="MNFKDTLPGVFLCVAMFACGHARANMLVYPMAAEINSSREEATS
                     LFVYSKSDHVQYIRTRIMRIEHPGMPQEKEVPAGNDIETGLVVSPEKFALSPGTKKTI
                     RVISTQAPEREEAWRVYFEAVPELEDDPQAGGKQNSSVSVNLVWGVLLRVSPSDPRPA
                     LVTDGHHLLNTGNTRLSLIRAGNCDTTCHWQNIGKSIYPGGSADIPAGIKSNAFRVEY
                     RTGANSPVISADLTAAGK"
     gene            352525..353100
                     /gene="tcfB"
                     /locus_tag="STY_RS01585"
                     /old_locus_tag="STY0346"
     CDS             352525..353100
                     /gene="tcfB"
                     /locus_tag="STY_RS01585"
                     /old_locus_tag="STY0346"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000287812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein TcfB"
                     /protein_id="WP_000287810.1"
                     /translation="MYTECTYITVINNKARLFFMNMKTSFIAAAVALATVYSFSVSAV
                     QKDITVTANIDSTLELLQADGSSLPSTMKLDFMPGKGLVHKSLQTRLYSNDQTKSVNV
                     KLLNAPQLINVLDPTKTIDMEVTLGGRSLTTTNSVLEAKTLFPDGKTGDASALLNLDI
                     GQKAGAALQNLPAGEYSGLVSLVISQAVTAG"
     gene            353209..355896
                     /gene="tcfC"
                     /locus_tag="STY_RS01590"
                     /old_locus_tag="STY0347"
     CDS             353209..355896
                     /gene="tcfC"
                     /locus_tag="STY_RS01590"
                     /old_locus_tag="STY0347"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000092509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial outer membrane usher protein TcfC"
                     /protein_id="WP_000092510.1"
                     /translation="MSRYFWMYYLLGLCSFTSQATLIPPPGFESLLEGQTEQIEVLLP
                     GHSLGLFPVVVKPDTVQFMSPLMVLESSGLAALPAAERQKALAALSRPLLRNSNLVCG
                     VSEAKDSSECGYVATDKEDVAVIFDENNAQLSLFLNRDWLPDEERRDKRWLTPTPEGV
                     SAFIHRQTLYLSDDLHSRNMTLNGSGALGLGDGRYLGGDWAAIWNQSEHYNNSQAWFD
                     NLFVRQDLGNQYYLQAGRMDQRNLSSATGGDFGFSLLPLSRFDGLRTGTTQAYVNHEV
                     DHNATPVMVQVTRNARIDIYRGSELLGSQFLTPGMHTLDTHSLPPGSYPLALRVYEDG
                     ILRRTETQPFSKGGNSFSAQTQWFIQGGLEDTGDKASHYDGETVMAAGFQTGLRKNIS
                     LTEGISLAHEAWYSETRLNSQHAVLDGTLDLSAGILHGTDSTSGNTEQVTYNDGFSAS
                     LWRNHTESDACSGRHPQSVHASMTCQTSMNASLSVSVGNWYALLGYSTSRTEGRPVYR
                     GYDDNSDKENVFWRQAYIPASHRESAQASATYSLNMAGMNINTHGGVWRTRNDGVNDD
                     GLFMSVSVSYASQPPTMTGSNRYTSAGTDIHSSRNQKTQTSWNVNHVRSWQQDLYREL
                     SVGFSGYNDDSWSGSLGGRMSGRMGELSATISNSHQRNAGSASSLTAGYSSSLALSRN
                     GLFWGGGQDGEPASGMAVNVESEGDEGSSGKVVSVRGSSQPFSLGFGQQSLLLMEGYN
                     ATEVTIEDAGVSSQGMAGVKAGGGSRCYFLTPGHLLVHNISASMSRLYVGRVLDKDGR
                     PLLDAQPLNYPFLSLGPSGRFSLQSEHKESSLWLLSKNRILRCPMSVHKRRDVMQVVG
                     DVRCELSDVDALPQALQISPRVIRLLNVAGLLRHSVQEA"
     gene            355919..356998
                     /gene="tcfD"
                     /locus_tag="STY_RS01595"
                     /old_locus_tag="STY0348"
     CDS             355919..356998
                     /gene="tcfD"
                     /locus_tag="STY_RS01595"
                     /old_locus_tag="STY0348"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000066477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein TcfD"
                     /protein_id="WP_000066477.1"
                     /translation="MSNKMKWTSMTAHWSAIINFIRKYVYPARIIAILLMAGATLPQV
                     ADAITVDLNYDKNNVAVITPVWSQEWSVANVLGGWVCRSNRNENEGACEETHLVWWYA
                     FGAYSKIRLRFREQISHAEITLILLGSVRDACYTGVINMNAAACQWGRSLKLRIPSEE
                     LAKIPTSGTWKATLVLDYLQWGGDDPLGTSTTDITLNVTDHFAENAAIYFPQFGTATP
                     RVDLNLHRMNASQMSGRANLDMCLYDGGVKARSLQMKIEGSNKSGTGFQVIKSDSADT
                     IDYAVSMNYGGRSIPVTRGVEFSLDNVDKAATRPVVLPGQRQAVRCVPVPLTLTTQPF
                     NIREKRSGEYQGTLTVTMLMGTQTP"
     gene            357131..357586
                     /locus_tag="STY_RS01600"
                     /old_locus_tag="STY0349"
     CDS             357131..357586
                     /locus_tag="STY_RS01600"
                     /old_locus_tag="STY0349"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000141548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lrp/AsnC family transcriptional regulator"
                     /protein_id="WP_000219490.1"
                     /translation="MTVYLDDKDKELLKEIQKDCAQTLWQLAYKVGLTPTPCFKRLKK
                     LKDRGVIIGQFALLDKEKLGLSLNVFIMINISEEQYASISEKIKSMPEVIAFYRISGS
                     FNYLMHTVFTDMNDYYSFYEKIILTNSSISGSASSFVLEQIKETNELPV"
     gene            357726..358343
                     /locus_tag="STY_RS01605"
     CDS             357726..358343
                     /locus_tag="STY_RS01605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001539141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000241754.1"
                     /translation="MVKYHPVHVTKNRIKTDDVTDIYFVEPFWKKGENHIIESLMFFE
                     ELQKSFNLFNHKYGLNKYILRIPWEFVLIHMERISKLNSVGLFAVSVDFNNNHKFLSE
                     YIRSRRDYGMEVWFDFCGKHSYSSEIKNLGFFFQACVVPRDPNFISSVYHYHKFQKIL
                     VGDINDVEQRAVYQNEVDYMYGMQWPSSYDGFFFRDHKKNETWCI"
     gene            359174..359302
                     /locus_tag="STY_RS01610"
     CDS             359174..359302
                     /locus_tag="STY_RS01610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001647971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001647971.1"
                     /translation="MQCTEKWRQVAPVQRFSEGAGVFITDILHCAFGNPQDQLFYR"
     gene            complement(359306..360025)
                     /gene="pagN"
                     /locus_tag="STY_RS01615"
                     /old_locus_tag="STY0351"
     CDS             complement(359306..360025)
                     /gene="pagN"
                     /locus_tag="STY_RS01615"
                     /old_locus_tag="STY0351"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adhesin/invasin protein PagN"
                     /protein_id="WP_000787614.1"
                     /translation="MKNFFAVCIIPLVVTWSATASAKEGIYITGKAGTSVVNVYGINS
                     TFSQEEIVNGHATLPDRTKGVFGGGVAIGYDFYDPFQLPVRLELDTTFRGETDAKGGQ
                     DIIAFGQPVHINVKNQVRMTTYIVNGYYDFHNSTAFTPYISAGVGLAHVKLSNNTIPV
                     GFGINETLSASKNNFAWGAGIGAKYAVTDNIMIDASYKYINAGKVSISKNHYAGDEHT
                     AYDADTKAASNDFMLGITYAF"
     gene            complement(360350..360757)
                     /locus_tag="STY_RS01620"
                     /old_locus_tag="STY0352"
     CDS             complement(360350..360757)
                     /locus_tag="STY_RS01620"
                     /old_locus_tag="STY0352"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Spy/CpxP family protein refolding chaperone"
                     /protein_id="WP_000788200.1"
                     /translation="MKNFVRTTLLAATLAGVSFGAFATAVPNPPLPAQDPIVQHLKLT
                     NDQITRIKKLHQQLETDVSQISMKGIKDGALIEVIKSGKWDDAAVKQQLAAFSNIEQQ
                     ARYYRVKYYFDLSKVLTPEQRQQVQQDLAQALE"
     gene            complement(361067..361834)
                     /locus_tag="STY_RS01625"
                     /old_locus_tag="STY0353"
     CDS             complement(361067..361834)
                     /locus_tag="STY_RS01625"
                     /old_locus_tag="STY0353"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_000015775.1"
                     /translation="MSGLKITLLQQPLVWMDGLANLRHFDRQLELVSGRDVIVLPEMF
                     TTGFAMEAANNSLSQDSVITWMQAKARQTDALIAGSAALQTERGAVNRFLLVEPEGKV
                     HLYDKRHLFRMADEHQHYAAGDKRIIVQWRGWRILPLICYDLRFPIWSRNRNDYDLAL
                     YVANWPAPRSLHWQTLLTARAIENQAYVAGCNRVGTDGNGLHYRGDSRIINPQGDIIA
                     TAEPHQATRIDADLSLVALQDYREKFPAWRDADPFTL"
     gene            complement(361943..364387)
                     /gene="fadE"
                     /locus_tag="STY_RS01630"
                     /old_locus_tag="STY0354"
     CDS             complement(361943..364387)
                     /gene="fadE"
                     /locus_tag="STY_RS01630"
                     /old_locus_tag="STY0354"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase FadE"
                     /protein_id="WP_000973055.1"
                     /translation="MMILSIIATVVLLGALFYHRVSLFLSSLILLAWTAALGVAGLWS
                     IWLLVPLAIILVPFNLTPMRKSMISAPVFRGFRKVMPPMSRTEKEAIDAGTTWWEGDL
                     FQGKPDWKKLHNYPQPQLTAEEQAFLDGPVEEACRMANDFQITHELADLPPELWAYLK
                     EHRFFAMIIKKEYGGLEFSAYVQSRVLQKLSGVSGILAITVGVPNSLGPGELLQHYGT
                     EEQKNHYLPRLARGQEIPCFALTSPEAGSDAGAIPDTGVVCMGEWQGQQVLGMRLTWN
                     KRYITLAPIATVLGLAFKLSDPDRLLGGEEELGITCALIPTSTPGVEIGRRHFPLNVP
                     FQNGPTRGNDIFVPIDYIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGVKSVALA
                     TGAYAHIRRQFKISIGKMEGIEEPLARIAGNAYVMDAAASLITYGIMLGEKPAVLSAI
                     VKYHCTHRGQQSIIDAMDITGGKGIMLGESNFLARAYQGAPIAITVEGANILTRSMMI
                     FGQGAIRCHPYVLEEMAAAQNNDVNAFDKLLFKHIGHVGSNTVRSFWLGLTRGLTSHT
                     PTGDATKRYYQHLNRLSANLALLSDVSMAVLGGSLKRRERISTRLGDVLSQLYLASAV
                     LKRYDDEGRHEADLPLVHWGVQDALYRAEQAMDDLLQNFPNRVVAGLLTAMIFPTGRH
                     YLAPSDKLDHAVAKILQVPNATRSRIGRGQYLTPAEHNPVGLLEEALRDVIAADPIHQ
                     RICKELGKNLPFTRLDELARNALAKGLIDKDEAAILAKAEESRLRSINVDDFEPEALA
                     TKPVKLPEKVRKVEAA"
     gene            364627..365205
                     /gene="lpcA"
                     /locus_tag="STY_RS01635"
                     /old_locus_tag="STY0355"
     CDS             364627..365205
                     /gene="lpcA"
                     /locus_tag="STY_RS01635"
                     /old_locus_tag="STY0355"
                     /EC_number="5.3.1.28"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017458774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-sedoheptulose 7-phosphate isomerase"
                     /protein_id="WP_000284051.1"
                     /translation="MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAG
                     GKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVSNDFGYDYIFS
                     RYVEAVGREGDVLLGISTSGNSGNVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEI
                     RVPHFGYADRIQEIHIKVIHILIQLIEKEMVK"
     gene            365369..366136
                     /locus_tag="STY_RS01640"
                     /old_locus_tag="STY0356"
     CDS             365369..366136
                     /locus_tag="STY_RS01640"
                     /old_locus_tag="STY0356"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class II glutamine amidotransferase"
                     /protein_id="WP_000333360.1"
                     /translation="MCELLGMSANVPMDICFSFTGLVQRGGGTGPHKDGWGITFYEGK
                     GCRTFKDPQPSYHSPIAKLVQNYPIKSCSVIAHIRQANRGEVALENTHPFTRELWGRN
                     WTYAHNGQLNGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMTAVFKYIA
                     TLATVLREKGVFNMLLSDGRYVMAFCSTHLHWITRRAPFGVATLVDQDMEIDFSSQTT
                     PNDVVTVIATQPLTGNETWQKIMPGEWALFCLGERII"
     gene            complement(366107..366847)
                     /locus_tag="STY_RS01645"
                     /old_locus_tag="STY0357"
     CDS             complement(366107..366847)
                     /locus_tag="STY_RS01645"
                     /old_locus_tag="STY0357"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein L,D-transpeptidase"
                     /protein_id="WP_001225658.1"
                     /translation="MRKIAFFLAMLLMPCVSFAGLLSSSSPVTPVSKEYKQQLMGSPV
                     YIQIFKEERTLDLYVKMGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQ
                     LKPDSRFYKAINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTA
                     ALVFGQPSVQVSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVD
                     GRYVVSKPLSHEVVQPQLASNYTLSEAK"
     gene            367097..368152
                     /gene="dinB"
                     /locus_tag="STY_RS01650"
                     /old_locus_tag="STY0358"
     CDS             367097..368152
                     /gene="dinB"
                     /locus_tag="STY_RS01650"
                     /old_locus_tag="STY0358"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV"
                     /protein_id="WP_001226198.1"
                     /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTA
                     NYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSL
                     DEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNG
                     QYVITPADVPDFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLLKRFGKF
                     GRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAI
                     VKPDLLIARQGVKLKFNDFQQTTQEHVWPQLNKEDLITTARKTWDERRGERGVRLVGL
                     HVTLLDPQLERQLVLGL"
     gene            368371..369510
                     /locus_tag="STY_RS01655"
                     /old_locus_tag="STY0359"
     CDS             368371..369510
                     /locus_tag="STY_RS01655"
                     /old_locus_tag="STY0359"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006895405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA ligase RtcB family protein"
                     /protein_id="WP_000528894.1"
                     /translation="MGNYIRPLSDVVFSIASDNLWIEDSAIQQLYTTAKLTGMKRVIG
                     MPDLHPGRGYPIGAAFFSRGRFYPALVGNDIGCGMALWQTDILGRKYNADKLEKRLAS
                     LPDVADAQWLEENVPAVMQHHSWRSALGSIGGGNHFAELQQVDRIVDADSFALSGLQK
                     AQLLLLVHSGSRGLGQAILRRHVEAFSHNGLPEDSDDARHYLAEHDDALAFARSNRAL
                     IARRILQQLRAEGEPRLDVAHNFVEPCTVAGEAGWLHRKGATPDGQGLVIIPGSRGDY
                     SWLVKPVVSEESLFSLAHGAGRKWMRTECKDRLSAKFTPRQLCRTGMGSRVICRDRQL
                     IYEEAPQAYKSIDSVVDCLADAGLITPVACLRPVLTLKTSGEKSA"
     gene            369507..370121
                     /locus_tag="STY_RS01660"
                     /old_locus_tag="STY0360"
     CDS             369507..370121
                     /locus_tag="STY_RS01660"
                     /old_locus_tag="STY0360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor H"
                     /protein_id="WP_000602086.1"
                     /translation="MILLQLSSAQGPDECCLAVKKALDCLTKEAAREKVSLTRLETEP
                     GRLPDTLRSALVSLDGEKAMAFSERWCGTLLWICTSPYRPHHGRKNWYVGIGRFSADE
                     HIQSDEIRFETLRSSGPGGQHVNKTDSAVRATHLASGISVKVQSERSQHANKRLARLL
                     IAWRLEQQRQNECAALKSERRLFHHQIERGNPLRIFKGMAFTPQ"
     gene            complement(370276..371733)
                     /gene="pepD"
                     /locus_tag="STY_RS01665"
                     /old_locus_tag="STY0361"
     CDS             complement(370276..371733)
                     /gene="pepD"
                     /locus_tag="STY_RS01665"
                     /old_locus_tag="STY0361"
                     /EC_number="3.4.13.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008783788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosol nonspecific dipeptidase"
                     /protein_id="WP_001292984.1"
                     /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEHIVSWAKEKG
                     LYVDRDQVGNILIRKPATAGMENRKPVVLQAHLDMVPQKNSDTVHDFTTDPIRPYIDG
                     EWVKARGTTLGADNGIGMASALAVLADDNVVHGPLEVLLTMTEEAGMDGAFGLQSGWL
                     QADILINTDSEEEGEIYMGCAGGIDFTSNLPLTREAVPAGFACFKLTLKGLKGGHSGG
                     EIHLGLGNANKLLARFLAGHAEELDLRLIDFNGGTLRNAIPREAFATLAVATDNVGAL
                     KTLVNAYQDILKNELAEKEKNLTLQLNEVASDKAALTAPSRDTFVRLLNATPNGVIRN
                     SDVAKGVVETSLNVGVVTMSDANVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEA
                     KGSYPGWQPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPDMDMVSIG
                     PTITGPHSPDEQVHIESVGHYWTLLTELLKAIPAK"
     gene            371982..372440
                     /gene="gpt"
                     /locus_tag="STY_RS01670"
                     /old_locus_tag="STY0362"
     CDS             371982..372440
                     /gene="gpt"
                     /locus_tag="STY_RS01670"
                     /old_locus_tag="STY0362"
                     /EC_number="2.4.2.22"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine phosphoribosyltransferase"
                     /protein_id="WP_001292018.1"
                     /translation="MSEKYVVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGA
                     LLARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIRE
                     MYPKAHFVTIFAKPAGRPLVDDYVIDIPQNTWIEQPWDMGVVFVPPISGR"
     gene            372529..373773
                     /gene="frsA"
                     /locus_tag="STY_RS01675"
                     /old_locus_tag="STY0363"
     CDS             372529..373773
                     /gene="frsA"
                     /locus_tag="STY_RS01675"
                     /old_locus_tag="STY0363"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase FrsA"
                     /protein_id="WP_000189584.1"
                     /translation="MTQANLSETLFKPRFKHTETSTLVRRFNRGSQPPMQSALDGKNV
                     PHWYRMINRLMWIWRGVDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWA
                     KQAMDWQQKACQEQDAMRSGRYWLHASTLYNIAAYPHLKGDELAEQAQALANRAYEEA
                     AQRLPGSLREMEFAVPGGSPVTAFLHMPKGDGPFPTVLMCGGLDAMQIDYYTLYERYF
                     APRGIAMLTLDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGA
                     NVAVRLAYLEAPRLKAVACLGPVVHALLSDPQRQSTVPEMYLDVLASRLGMHDASDEA
                     LRVELNRYSLKVQGLLGRRCPTPMLSGFWKNDPFSPEEESRLITTSSSDGKLIEIPFN
                     PVYRNFDHALQEITDWINHRLC"
     gene            373831..374232
                     /locus_tag="STY_RS01680"
                     /old_locus_tag="STY0364"
     CDS             373831..374232
                     /locus_tag="STY_RS01680"
                     /old_locus_tag="STY0364"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma factor-binding protein Crl"
                     /protein_id="WP_000174696.1"
                     /translation="MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNV
                     KPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTVVPINETEVVERLEYTLRE
                     FHEKLRDLLISMELALEPSDDFNDEPVKLSA"
     gene            complement(374283..375335)
                     /gene="phoE"
                     /locus_tag="STY_RS01685"
                     /old_locus_tag="STY0365"
     CDS             complement(374283..375335)
                     /gene="phoE"
                     /locus_tag="STY_RS01685"
                     /old_locus_tag="STY0365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoporin PhoE"
                     /protein_id="WP_001043666.1"
                     /translation="MNKSTLAIVVSIIASASVHAAEVYNKNGNKLDVYGKVKAMHYMS
                     DYDSKDGDQSYVRFGFKGETQINDQLTGYGRWEAEFAGNKAESDSSQQKTRLAFAGLK
                     LKDIGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFG
                     IVDGLDLTLQYQGKNEDRDVKKQNGDGFGTSVSYDFGGSDFAVSGAYTLSDRTREQNL
                     QRRGTGDKAEAWATGVKYDANDIYIATFYSETRNMTPVSGGFANKTQNFEAVIQYQFD
                     FGLRPSLGYVLSKGKDIEGVGSEDLVNYIDVGAIYYFNKNMSAFVDYKINQLDSDNTL
                     GINDDDIVAIGLTYQF"
     gene            375618..376721
                     /gene="proB"
                     /locus_tag="STY_RS01690"
                     /old_locus_tag="STY0366"
     CDS             375618..376721
                     /gene="proB"
                     /locus_tag="STY_RS01690"
                     /old_locus_tag="STY0366"
                     /EC_number="2.7.2.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate 5-kinase"
                     /protein_id="WP_001285275.1"
                     /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHR
                     IVIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQML
                     LTRADMEDRERFLNARDTLRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILA
                     GADKLLLLTDQQGLFTADPRSNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKL
                     QAADVACRAGIDTIIASGSKPGVIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAG
                     EITVDEGATAAMLERGSSLLPKGIKSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDA
                     LRRIAGHHSQQIDAILGYEYGPVAVHRDDMITR"
     gene            376733..377983
                     /gene="proA"
                     /locus_tag="STY_RS01695"
                     /old_locus_tag="STY0367"
     CDS             376733..377983
                     /gene="proA"
                     /locus_tag="STY_RS01695"
                     /old_locus_tag="STY0367"
                     /EC_number="1.2.1.41"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-5-semialdehyde dehydrogenase"
                     /protein_id="WP_000893213.1"
                     /translation="MLEQMGIAAKAASYKLALLSSCEKNRVLEKIADELEAQMESILS
                     ANVQDVEQARANGLSEAMLDRLALTPARLKAIADDVRQVCNLADPAGQVIDGGLLDSG
                     LRLERRRVPLGVVGVIYEARPNVTVDVASLCLKTGNAVILRGGKETHRTNAATVLVIQ
                     KALKACDLPEAAVQAIDNPDRSLVSEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVI
                     TGGIGVCHIFVDSSADIAPALKIIVNAKTQRPSTCNTVETLLVHQDIAERFLPALSKQ
                     MAESGVTLHGDETVMQALHGPAKLVALKPEELDNEFLSLDLNVVVVENMDGAIAHIRE
                     HGTQHSDAILTCDMHNAARFVNEVDSAAVYVNASTRFTDGGQFGLGAEVAVSTQKLHA
                     RGPMGLEALTTYKWIGFGDGTIRA"
     gene            378099..378174
                     /locus_tag="STY_RS01700"
                     /old_locus_tag="STYt004"
     tRNA            378099..378174
                     /locus_tag="STY_RS01700"
                     /old_locus_tag="STYt004"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:378132..378134,aa:Thr,seq:cgt)
     gene            378398..378796
                     /locus_tag="STY_RS01705"
     CDS             378398..378796
                     /locus_tag="STY_RS01705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000766839.1"
                     /translation="MKLIIILLLALFPLCSSASNHYALVFENNTILLVLNLKCSPCDL
                     NCANIQYQLFNKETESVISGAAKPVTTGIENNFRGYMMRNNNTFYSLIESDNKNVWDM
                     SVEEKGTQQNKDAVQKVKYQLNAIFDNGTC"
     gene            complement(378844..379602)
                     /locus_tag="STY_RS01710"
                     /old_locus_tag="STY0369"
     CDS             complement(378844..379602)
                     /locus_tag="STY_RS01710"
                     /old_locus_tag="STY0369"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial assembly chaperone"
                     /protein_id="WP_001247037.1"
                     /translation="MRNYRQWLVFSKVILTLLGLTGWYGPAQAAVNIDRTRIIFASDE
                     VAQSLTLSNDNTTPMLLQVWTDAGNIDASPDNSKTPLVALPPVFKMQPGELRTLRLLL
                     SSRQQLATDRESLFWLNIYQIPPVTQDIKNHPRKLVLPLRLRLKILIRPTGLKAPTEA
                     EEKKLRFIAKENTIRIVNPTSWYMSLTLTMDNKKSIGDIMVAPKTALDVPLTRSPTPG
                     ASINYAVINDSGNWRQYTAILEKYISKSNFIPEF"
     gene            complement(379568..380893)
                     /gene="stbD"
                     /locus_tag="STY_RS01715"
                     /old_locus_tag="STY0370"
     CDS             complement(379568..380893)
                     /gene="stbD"
                     /locus_tag="STY_RS01715"
                     /old_locus_tag="STY0370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial usher protein StbD"
                     /protein_id="WP_000899085.1"
                     /translation="MLFSFRTLLFITSLFVSAGTWSSCIKVTDKSALSDAAIKAGYTA
                     QNWIGALDTNTGNIGLPTVISISNSETFQPSGTLLASGIGNFLTAATGTPYSSKQVLY
                     RCDSADAGKLYEMYSTNGDSAFAGAFFTPEVEGAYYDVERNVAVRMTNLSTGEYYSRF
                     WKERQLTADSWFQDDKYIYIPASAFSNVLYEMFKIDSRKYFAYQNPMDRDTWTQPRGY
                     IAFKGPGLITERIKAGLDHASDYYGWPSYWPGAWSTYNSVTYVRGALCKITDYPAIVK
                     IPPVAVGILAAGGNSQAPFHVSLECESGAVSSALPSTSAANVAMGFVVNQPTAVAAAR
                     RLGLTTSAGGLSWLLDTHYGEPGVASGVGIRIYNDAGTPINLLPDRIKTGTGNARGWY
                     GYKDLTTRVSSGSVETYSGDFTASLEALGGQTVTAGSVNAQLQAVVSFQ"
     gene            complement(380898..383459)
                     /locus_tag="STY_RS01720"
                     /old_locus_tag="STY0371"
     CDS             complement(380898..383459)
                     /locus_tag="STY_RS01720"
                     /old_locus_tag="STY0371"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial outer membrane usher protein"
                     /protein_id="WP_000075318.1"
                     /translation="MSPTINLNRKSLALLIAIVCSGSAQGEEYYFDPALLQGATYGQN
                     IARFNEQQTPSGDYLADVYVNGTLVASSTNIRFNAVKEGQQAEPCLPLSVMKAAQIKS
                     LPETDAATECRPLREWVPHAGWQFDSATLRLLLTIPMTELTHKPRGYISPSEWDSGAL
                     ALFLRHNTNWTHTENTDSHYRYQYLWSGLNMGVNLGLWQVRHQSNLRYANSNQSGSAW
                     RYNSVRTWVQRPVASINSILSLGDSYTDSSLFGSLSFNGVKLVTDERMRPQGKRGYAP
                     EVRGVAASSAHVVVKQLGKVIYETNVPPGPFYIDDLYNTRYQGDLEVEVIEASGKTSR
                     FTVPYSSVPDSVRPGNWHYSLAFGRVRQYYDIENRFFEGTFQHGVNNTITLNLGSRIA
                     QRYQAWLAGGVWATGMGAFGLNATWSNARAEHNERQQGWRAELSYSKTFTTGTNLVLA
                     AYRYSTNGFRDLQDVLGVRREAKTGIDYYSDTLHQRNRLSATVSQPLGRLGTLNLSAS
                     TADYYNNQSRITQLQMGYSNQWRNISYGVNIARQRTTWDYDRFYHGVNEPLDVSSRQK
                     YTETTMSFNVSIPLDWGENRTSVAMNYNQSSQSRSSTVSMTGSSGENSDLSWSVYGGY
                     ERYRNSNSDSSAPTTFGGNLQQNTRFGALRANYDQGDNYRQEGLGASGTLVLHPGGLT
                     AGPYTSDTFALIHADGAQGAIVQNGQGAVVDRFGYAILPSLSPYRINNVTLDTRKMRS
                     DAELTGGNQQIVPYAGAIARVNFATISGKAVLISVKMPDGGIPPMGADVFNGEGTNIG
                     MVGQSGQIYARIAHPSGSLLVRWGTGANQRCRVAYQLDLHTKEPFLYLNKICEKE"
     gene            complement(383443..384204)
                     /locus_tag="STY_RS01725"
                     /old_locus_tag="STY0372"
     CDS             complement(383443..384204)
                     /locus_tag="STY_RS01725"
                     /old_locus_tag="STY0372"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial chaperone"
                     /protein_id="WP_000781490.1"
                     /translation="MKMDTRHSALYYLIVFLLLALPATASWASVTILGSRIIYPSTAS
                     SVDVQLKNNDAIPYIVQTWFDDGDMNTSPENSSAMPFIATPPVFRIQPKAGQVVRVIY
                     NNTKKLPQDRESVFWFNVLQVPPTNIGSDSGKNKMLVMLRSRIKLFYRPDGLGKPDNL
                     AKKLQIKTVNKGSGKSGIVIVNPQPWFASLSNLNVKVNGASYNLDADMIAPFSSQTWW
                     LPGKRSLKSFSGTVTVTLVNDLGARISESYDVPHH"
     gene            complement(384266..384802)
                     /locus_tag="STY_RS01730"
                     /old_locus_tag="STY0373"
     CDS             complement(384266..384802)
                     /locus_tag="STY_RS01730"
                     /old_locus_tag="STY0373"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_000062036.1"
                     /translation="MSMKKYLAMITGSLLVSSSAMAVSDNTITFQGEVSDETCSVVIN
                     GNQAKPVVLLPTVSTKELSEQGKTAGPITFDIGLSGCTGSKDKTTKISTVFVGNQVTS
                     NGNLGNTGSAKNVEVQLLDTSGEPINLTGGFTGDGDLQLEPNASEASATYTARYYSTG
                     KAEAGTVAATLQYAVSYK"
     gene            385465..386199
                     /locus_tag="STY_RS01735"
                     /old_locus_tag="STY0374"
     CDS             385465..386199
                     /locus_tag="STY_RS01735"
                     /old_locus_tag="STY0374"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001005860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001005856.1"
                     /translation="MNESIFLLDKRVVFDSTKMTLSHGNEIIRISEADTHLLLAFWHG
                     LYKKEDIIHFVWENRGGCVSESSYYKLINQMRNDFSSIGLQLSGIVTRPRVGVSLSVA
                     IEPIKKITSLKVSDENVKGPSTREKIFYKIKRHSVFVVLTGAILLALFYGVFTIYKTP
                     VRNSPDSFFTYLGEYNDYAIYKTKEDKVTLSEVVFAFNSLKIKIYRQNGRHLYYIREP
                     NMNIFLQCLNPVEMAVPKCITVKERY"
     gene            386172..386473
                     /locus_tag="STY_RS01740"
                     /pseudo
     CDS             386172..386473
                     /locus_tag="STY_RS01740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459337.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            386985..388559
                     /locus_tag="STY_RS01745"
                     /old_locus_tag="STY0376"
     CDS             386985..388559
                     /locus_tag="STY_RS01745"
                     /old_locus_tag="STY0376"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic diguanylate phosphodiesterase"
                     /protein_id="WP_000868284.1"
                     /translation="MKVRKLFLMLFIAVPLIVMILVGLLAGIFQLKRDIAVSANTLLR
                     FSADISAASWQVAGKAARLAESSCTDTLKELSRTRAFTPYVRDIGFLENGDITCSFVT
                     GTERYHFSRLAGLSLPASYPERWLRSIGSMAEGPDRLVVVYVKKVAADKAAFVIVDSQ
                     YVQELMEILAAERASAFSLIFGAGEAITSAATLRGKAFLTQRFTSTDHTIQLMVRTPF
                     STLSAYWLQNLFIFIPLSLCLSVGMILFYRRWYLKRLSLAREISRGITHNEFTVHYQP
                     VFNVKHGSCGGVEALMRWPQPDGRFITPDIFITAAENEGMIIPLSRHLFELIAHDVIN
                     WTVPDDFYISVNISPAHLMDDGFIQDIEALRTRLGTITLMLELTERSLIVEPSQVAEK
                     LSTLREKGVLIAIDDFGTGYCSLSYLQQLPVDSLKIDRTFIDTIDTSSDDVPVLDTII
                     TLSQRLGLNVVAEGVSTQHQLRYILSHGVGFVQGFLYARPMGTNDFMSWLGKSAQRQN
                     GLLKGESGSASDLVAE"
     gene            388659..389402
                     /locus_tag="STY_RS01750"
                     /old_locus_tag="STY0377"
     CDS             388659..389402
                     /locus_tag="STY_RS01750"
                     /old_locus_tag="STY0377"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_000081360.1"
                     /translation="MSQNNYLIDKRVILDCERMTLSCAGELITISESERSLLITFYEG
                     LFKKDDLINYVWGRKGVVVSDASYYKLINQLRGSFDKIGLKGESVVTRPRVGVLLSVS
                     IEPLSDEAQDMPLPAVAETELSTVEVRHDDTIIPPIPGAVNRKDWLYFCLAALLMFFM
                     IYKVKGENIDYFTLNGSYDGYTFYSVGHDKTHLADIIEAYSEMSNEIHKQNGKIIYYI
                     RVPNTNIFVQCLNQLDIAEPKCISIKERY"
     gene            389420..389923
                     /locus_tag="STY_RS01755"
                     /old_locus_tag="STY0378"
     CDS             389420..389923
                     /locus_tag="STY_RS01755"
                     /old_locus_tag="STY0378"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001766208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001766208.1"
                     /translation="MLAVSVVLMVVWVRNSNHSSINTNEFLCTTRTVTTIQPKDIHAD
                     GSLVLDFKMKRITLQYEIKTKDNGVKILYRDVYMKNLHRTAPGVYTFEVSQVKVFATD
                     TAGDLLSYLRVLHPEAANEIRISKVGEKTFFILLIGSFITFVPRSRSECCLNASESEL
                     RNCPRQG"
     gene            390264..390788
                     /locus_tag="STY_RS01760"
                     /old_locus_tag="STY0380"
     CDS             390264..390788
                     /locus_tag="STY_RS01760"
                     /old_locus_tag="STY0380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane beta-barrel protein"
                     /protein_id="WP_000830239.1"
                     /translation="MKRRSSFLVFLGLLLASPLALANDQHTVSFGYAQTHLSSLKNSD
                     SKDLRGFNFKYRYEFNETWGMLGSFTATRNEMENYTWKEGKLHKNGSDSVDYGSLMFG
                     PTYRFNDYVSLYGNAGIATMKFNKHSKEESFAYGAGVIFNPVKSISIDASWEASRFFA
                     VDTNTFGVSVGYRF"
     gene            390934..391575
                     /locus_tag="STY_RS01765"
                     /old_locus_tag="STY0381"
     CDS             390934..391575
                     /locus_tag="STY_RS01765"
                     /old_locus_tag="STY0381"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_000610819.1"
                     /translation="MINSLSEQLPLKTIGIVLTDDYYTYLGIASLFEDGKCFMFPLNG
                     EYNSCQISASEDIIIIIDGRVLIQGVWKGFKALMQHYPHARRIWLTRRDIGKLYPHGC
                     DRDPDIDPDLAKPVFIEHFIKYACANDVAVGEIAPLTKKEEELLWHFLYKKSMSQIAS
                     SYGISRKTLYIHRLRICRKYGFKRFFHLLFIYQRSRHIFASKICRVDKNADQA"
     gene            391586..391810
                     /locus_tag="STY_RS01770"
     CDS             391586..391810
                     /locus_tag="STY_RS01770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000737124.1"
                     /translation="MKKLTMRECESINPTLLLAIKILISALDEKTKIRLREHIEKTEQ
                     EIASSIHDSIMTETFLQQMKDIRYILNIVP"
     gene            391868..392227
                     /locus_tag="STY_RS01775"
                     /old_locus_tag="STY0383"
     CDS             391868..392227
                     /locus_tag="STY_RS01775"
                     /old_locus_tag="STY0383"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4156 domain-containing protein"
                     /protein_id="WP_000722977.1"
                     /translation="MKKILVCFVGLALTACSANSLNYGAEQVRVMTSEPGKECSYLGD
                     ITGSQGNFFTGGWTSNSNLETGARNDLKNKAYKMGDNTVVLLTQRAGQTGSSWHGSGS
                     SKQTNVTLSGNVYRCPR"
     gene            complement(392297..>392854)
                     /gene="mdsC"
                     /locus_tag="STY_RS01780"
                     /old_locus_tag="STY0384"
                     /pseudo
     CDS             complement(392297..>392854)
                     /gene="mdsC"
                     /locus_tag="STY_RS01780"
                     /old_locus_tag="STY0384"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001521068.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux transporter outer membrane
                     subunit MdsC"
     gene            392984..393178
                     /gene="golB"
                     /locus_tag="STY_RS01785"
                     /old_locus_tag="STY0386a"
     CDS             392984..393178
                     /gene="golB"
                     /locus_tag="STY_RS01785"
                     /old_locus_tag="STY0386a"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gold resistance metallochaperone GolB"
                     /protein_id="WP_001159469.1"
                     /translation="MQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDIETS
                     LSAEQIAAALQKAGFPPRER"
     gene            393469..394722
                     /locus_tag="STY_RS01790"
                     /old_locus_tag="STY0387"
     CDS             393469..394722
                     /locus_tag="STY_RS01790"
                     /old_locus_tag="STY0387"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_000288510.1"
                     /translation="MYTPLNWTTTQRHVAFASFTSWMLDAFDFFILVFVLSDLAEWFH
                     ASVSEVSIAIMLTLAVRPIGALLFGRMAEKYGRRPILMLNILFFTVFELLSAWSPTFM
                     AFLIFRVMYGVAMGGIWGVASSLAMETIPDRSRGLMSGIFQAGYPCGYLFASVIFGLF
                     YSMVGWRGMFLIGALPVVLLPYIWFKVPESPVWLAARARKENTALLPVLRKQWKLCLY
                     LVLVMAFFNFFSHGTQDLYPTFLKMQHGFDPHLISIIAIFYNIAAMLGGIFYGTLSER
                     IGRKKAIMIAAFLALPVLPLWAFSSGSFTIGLGAFLMQFMVQGAWGVVPTWLNELVPA
                     NARAVLPGFVYQLGNLLASVNATLQARIAETHGGNYGLAMAIVAGAVAILICVFVAFG
                     RETRGVVISGTDSDALPESAIGHRT"
     gene            394911..396869
                     /locus_tag="STY_RS01795"
                     /old_locus_tag="STY0388"
     CDS             394911..396869
                     /locus_tag="STY_RS01795"
                     /old_locus_tag="STY0388"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific DNA-methyltransferase"
                     /protein_id="WP_000910350.1"
                     /translation="MLKDNQKHNESVAPNSAFLSELQRALPEFFIADRYNEQGELIAK
                     GGFDLAKFERALKARNIDELTSGYQIDFIGKDYAKKQAGEKSVTVIVPDVEHNTLAEN
                     KNSHNLFLTGDNLDVLRHLQNNYADTVDMIYIDPPYNTGSDGFVYPDHFEYSDRALQD
                     MFGLNDTELARLKSIQGKSTHSAWLSFMYPRLFLARKLLKDTGFIFISIDDNEYANLK
                     LMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAKTGQGALRLEPLSKEY
                     IQKSYKEPTEQFPEGKWRPVPLTVSKGLSGGGYTYKITTPNGTVHERLWAYPEASYQK
                     LVADNLVYFGKDNGGIPQRVMYAHHSKGQPTTNYWDNVASNKEGKKEILDLFGDNVFD
                     TPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEEDGGQRTFILCTIDQAL
                     SNNTIAKKAGYNTIDEISRERITRVAAKIRANNPATNSDLGFKHYRFATPTQQTLDDL
                     DSFDIATGHFINTSGQLAAFTESGFTDMINPFSARGLGVPGGASGEETLLTTWLVADG
                     YKMDIDVQTVDFSGYCARYVDNTRLYLIDERWGTEQTRDLLNHIGTHQLPVQTIVIYG
                     YSFDLESIRELEIGLKQLDQKVNLVKRY"
     gene            396879..399850
                     /locus_tag="STY_RS01800"
                     /old_locus_tag="STY0389"
                     /pseudo
     CDS             396879..399850
                     /locus_tag="STY_RS01800"
                     /old_locus_tag="STY0389"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459353.3"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type III restriction-modification system
                     endonuclease"
     gene            400126..400227
                     /locus_tag="STY_RS01805"
     CDS             400126..400227
                     /locus_tag="STY_RS01805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000934834.1"
                     /translation="MLNRYYRFAVEKDDPSEAPESGDKPDSQPQKKS"
     gene            400342..401745
                     /locus_tag="STY_RS01810"
                     /old_locus_tag="STY0392"
     CDS             400342..401745
                     /locus_tag="STY_RS01810"
                     /old_locus_tag="STY0392"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome ubiquinol oxidase subunit I"
                     /protein_id="WP_000393706.1"
                     /translation="MEFDAFFLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKT
                     RNPVWRSLYQFWLKIFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVL
                     TAFFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEI
                     HNGQVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTPAIRRM
                     FSMALWMAVVVAPVQALIGDMHGLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPD
                     MEAERTRYALEIPALGSLILTHSLDKQVPALKDYPKEDRPNPTVVFWSFRLMVGMGVL
                     MIFLGLASLWLRYRRRLYHSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLL
                     RTRDAVSAHSTLQMSISLLAFFVVYSLVFGVGYIYMIRLIQKGPQPAETPTAETDGRP
                     ARPISAVGESLEQEKRE"
     gene            401742..402752
                     /gene="cydB"
                     /locus_tag="STY_RS01815"
                     /old_locus_tag="STY0393"
     CDS             401742..402752
                     /gene="cydB"
                     /locus_tag="STY_RS01815"
                     /old_locus_tag="STY0393"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome d ubiquinol oxidase subunit II"
                     /protein_id="WP_000151052.1"
                     /translation="MTIDLPVIWFAIIVFATLMYIVMDGFDLGVGILFPFIRDKHDRD
                     VMVNSVAPVWDGNETWLVLGGAGLFGAFPLAYAVITDALTIPLVVMLLGLIFRGVAFE
                     FRFKATESHRAFWDKSFIVGSILATFAQGVVVSAVVSGFQVEGRTFSGSQLDWLTPFN
                     LFCGVGLVVTYALLGATWLIMKSEDPLHSRMCALSRPLLIVLLLVMGGVSVWTPLTHD
                     DIAERWFTLPNLYYFLPVPVLVLAFSVWLWRSVKKPQSHARPFILTLGLIFLGFSGLG
                     ISIWPNIIPPDISLYAAAAPSQSQSFMLVGALIIIPIILAYTFWSYYVFRGKVRHGEG
                     YH"
     gene            402752..402883
                     /locus_tag="STY_RS01820"
     CDS             402752..402883
                     /locus_tag="STY_RS01820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459357.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2474 domain-containing protein"
                     /protein_id="WP_000241458.1"
                     /translation="MVKVKKWSRRVVWMVAIWCASVLLLAGVGMLFRLLMTSAGFRS"
     gene            403089..404093
                     /locus_tag="STY_RS01825"
                     /old_locus_tag="STY0395"
     CDS             403089..404093
                     /locus_tag="STY_RS01825"
                     /old_locus_tag="STY0395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_000074609.1"
                     /translation="MSPISCHSSAAPAMKKIFSVSDFIAFGERYGIDYRFPALPQYTQ
                     SSPVLHGDIEEIALPGGICITRSDVHVLQPYETTSRHSSPLYMLVVLEGNVALAVNEQ
                     TFLLSAGMAFCSQLSEQQTIRAHHGADSKLRTLSLGMYPDGGWRERLPVSLADEWERS
                     AASARVWQVPEFLLSGLRYAQQPGPHAASRQLMLEGIMLQLLGYALNLCQPATQKRGL
                     PVTGEYQRLELIRRLLEQTPEKAYTLNELARRAAMSPSSLRCKFRHAYGCTVFDYLRD
                     CRLARARRYLMEGYSVQQAAWMSGYQHATNFATAFRRRYGCSPGELRDASLTASRHCA
                     "
     gene            404239..406347
                     /gene="foxA"
                     /locus_tag="STY_RS01830"
                     /old_locus_tag="STY0396"
     CDS             404239..406347
                     /gene="foxA"
                     /locus_tag="STY_RS01830"
                     /old_locus_tag="STY0396"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrioxamine B receptor FoxA"
                     /protein_id="WP_100208312.1"
                     /translation="MPLEMFMFATTRMALLIGGAIGGATFPLFAQETTKNDTVIVTSP
                     VQSGATRLATPDIETPQSVSIITRQQFEEQGATSVRQAVSYTPGVYSNQIGASNRFDY
                     IVLRGFSDGSLDNVYLDGLKMMGDTNSHSSLVVDPWFLEDIEVVRGPASVLYGRSSPG
                     GIVSLTSRKPAFDAGGEVKLFAGNNNQRGAAFDVTGPLDDNERVAARLSGMTRYADSQ
                     FTPLKEERYALMPSLTWRITDRTRLDLMAYLHRDPQGGSHSGLPYQGTVVPYNGGKIS
                     NTFFEGEDDYDKYDRRENMVGYNIEHLFDNGWSVRQKLRYLHTKVTLNQVYAAGWLNE
                     TALNRGYSGSGEKMSAIALDNQLDGSVDTGAINHRLLVGIDYQDRSNHTTGYYGAFPP
                     IDAFNPVYGAQPDYITLYSREKHKLRQTGYYLQDQMSWDRWRFTLGGRYDRVSVSNID
                     KLHDSRSDLDKNNVSTRAALLYLFDNGVAPYLSYSTAFTSTSFADENGNVLEPMKGKQ
                     WEAGVKYEPLGGNSQFSAAVYRINQTNIATKEEPTDPYRSIGEIESKGVELEAISHLS
                     DSVRLQAAYTYTDIRYKKSSPQEQGKRAVYAPRNQASAWLSYDVKSGLLEWLTLGSGI
                     RYVNGVTSDRLNTHTLPSYTLVDMVVGYDLSSIGLNGLSAQLNVNNLTDKRYVAACNS
                     LSYCYFGAERSIVGSVSWAF"
     gene            complement(406388..407020)
                     /locus_tag="STY_RS01835"
                     /old_locus_tag="STY0397"
     CDS             complement(406388..407020)
                     /locus_tag="STY_RS01835"
                     /old_locus_tag="STY0397"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysE family transporter"
                     /protein_id="WP_000433130.1"
                     /translation="MEPFHAVVLTVSLFVLTFFNPGANLFVVVQTSLASGRRAGVITG
                     LGVATGDAFYSGLGLFGLATLITQCEAVFSLIKIVGGAYLLWFAWNSIRHQATPQMST
                     LQTPIAAPWTIFFRRGLMTDLSNPQTVLFFISIFSVTLSAETPTWARLMAWAGIVLSS
                     VIWRIFLSQAFSLPAVRRAYGRIQRIASRVIGAIIGMFALRLLYEGMTHR"
     gene            407252..407527
                     /locus_tag="STY_RS01840"
                     /old_locus_tag="STY0398"
     CDS             407252..407527
                     /locus_tag="STY_RS01840"
                     /old_locus_tag="STY0398"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1471 domain-containing protein"
                     /protein_id="WP_000848026.1"
                     /translation="MKTGYKVMLGALAFVVTNVYAAEIMKKTDFDKVASEYTKIGTIS
                     TTGEMSPLDAREDLIKKADEKGADVVVLTSGQTENKIHGTADIYKKK"
     gene            complement(407663..409288)
                     /gene="prpR"
                     /locus_tag="STY_RS01845"
                     /old_locus_tag="STY0399"
     CDS             complement(407663..409288)
                     /gene="prpR"
                     /locus_tag="STY_RS01845"
                     /old_locus_tag="STY0399"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="propionate catabolism operon regulatory protein
                     PrpR"
                     /protein_id="WP_000205290.1"
                     /translation="MTTAHSAPRDNSDKPVIWTVSVTRLFELFRDISLEFDHLATITP
                     IQLGFEKAVTYIRKKLATERCDAIIAAGSNGAYLKSRLSIPVILIKPSGFDVLQALAK
                     AGKLTSSIGIVTYQETIPTLLAFQKTFHLCLEQRSYVTEEDARGQINELKANGIEAVV
                     GAGLITDLAEEAGMTAIFIYSAATVRQAFHDALDMTRLTRRQRVDYPSGKGLQTRYEL
                     GDIRGQSPQMEQLRQTITLYARSRAAVLIQGETGTGKELAAQAIHQTFFHRQPHRQNK
                     PSPPFVAVNCGAITESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEM
                     PLPLQTRLLRVLEEKAVTRVGGHQPIPVDVRVISATHCDLDREIMQGRFRPDLFYRLS
                     ILRLTLPPLRERQADILPLAESFLKQSLAAMEIPFTESIRHGLTQCQPLLLAWGWPGN
                     IRELRNMMERLALFLSVDPAPTLDRQFMRQLLPELMVNTAELTPSTVDAHTLQDVLAR
                     FKGDKTAAARYLGISRTTLWRRLKAGAKDQSGN"
     gene            409554..410441
                     /gene="prpB"
                     /locus_tag="STY_RS01850"
                     /old_locus_tag="STY0400"
     CDS             409554..410441
                     /gene="prpB"
                     /locus_tag="STY_RS01850"
                     /old_locus_tag="STY0400"
                     /EC_number="4.1.3.30"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylisocitrate lyase"
                     /protein_id="WP_000052221.1"
                     /translation="MSLHSPGQAFRAALAKENPLQIVGAINANHALLAQRAGYQAIYL
                     SGGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCPLPLLVDADIGFGSSAFNVARTVK
                     SIAKAGAAALHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDARTDPNFVIMARTD
                     ALAVEGLEAALDRAQAYVDAGADMLFPEAITELSMYRQFADVAQVPILANITEFGATP
                     LFTTDELRSAHVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNELYES
                     INYYQFEEKLDALYRNKKS"
     gene            410564..411733
                     /gene="prpC"
                     /locus_tag="STY_RS01855"
                     /old_locus_tag="STY0401"
     CDS             410564..411733
                     /gene="prpC"
                     /locus_tag="STY_RS01855"
                     /old_locus_tag="STY0401"
                     /EC_number="2.3.3.16"
                     /EC_number="2.3.3.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-methylcitrate synthase"
                     /protein_id="WP_000132750.1"
                     /translation="MTDTTILQNNTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHY
                     RGYDILDLAEHCEFEEVAHLLIHGKLPTRDELNAYKSKLKALRGLPANVRTVLEALPA
                     ASHPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERI
                     QPETDDDSIGGHFLHLLHGEKPTQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSD
                     VYSAIIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVENKEVVIGFGHPV
                     YTIADPRHQVIKRVAKQLSEEGGSLKMYHIADRLETVMWETKKMFPNLDWFSAVSYNM
                     MGVPTEMFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYTGPEDRVFVPIEKRC"
     gene            411771..413222
                     /locus_tag="STY_RS01860"
                     /old_locus_tag="STY0402"
     CDS             411771..413222
                     /locus_tag="STY_RS01860"
                     /old_locus_tag="STY0402"
                     /EC_number="4.2.1.3"
                     /EC_number="4.2.1.79"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_414868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 2-methylcitrate
                     dehydratase/aconitate hydratase"
                     /protein_id="WP_001272709.1"
                     /translation="MSAHISNVRPDFDREIVDIVDYVMNYEITSKVAYDTAHYCLLDT
                     LGCGLEALEYPACKKLLGPIVPGTVVPNGARVPGTQFQLDPVQAAFNISAMIRWLDFN
                     DTWLAAEWGHPSDNLGGILATADWLSRNAVAAGKAPLTMKQVLSGMIKAHEIQGCIAL
                     ENAFNRVGLDHVLLVKVASTAVVAEMLGLTRDEILNAVSLAWVDGQSLRTYRHAPNTG
                     TRKSWAAGDATSRAVRLALMAKTGEMGYPSALTAKTWGFYDVSFKGETFRFQRPYGSY
                     VMENVLFKISFPAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVTIRTHEACLRIIDK
                     KGPLNNPADRDHCIQYMVAVPLLFGRLTAADYEDEVAQDKRIDALREKIVCYEDPAFT
                     ADYHDPEKRAIGNAITVEFTDGSRFGEVVVEYPIGHARRRADGIPKLIEKFKINLARQ
                     FLTRQQQRILDVSLDRARLEQMPVNEYLDLYII"
     gene            413263..415149
                     /gene="prpE"
                     /locus_tag="STY_RS01865"
                     /old_locus_tag="STY0403"
     CDS             413263..415149
                     /gene="prpE"
                     /locus_tag="STY_RS01865"
                     /old_locus_tag="STY0403"
                     /EC_number="6.2.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="propionate--CoA ligase"
                     /protein_id="WP_000010226.1"
                     /translation="MSFSEFYQRSINEPEAFWAEQARRIDWRQPFTQTLDHSRPPFAR
                     WFCGGTTNLCHNAVDRWRDKQPEALALIAVSSETDEERTFTFSQLHDEVNAVAAMLLS
                     LGVQRGDRVLVYMPMIAEAQITLLACARIGAIHSVVFGGFASHSVAARIDDARPALIV
                     SADAGARGGKILPYKKLLDDAIAQAQHQPKHVLLVDRGLAKMSWVDGRDLDFSTLRQQ
                     YLGASVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGV
                     FFCASDIGWVVGHSYIVYAPLLAGMATIVYEGLPTYPDCGVWWKIVEKYQVNRMFSAP
                     TAIRVLKKFPTAQIRNHDLSSLEALYLAGEPLDEPTASWVTETLGVPVIDNYWQTESG
                     WPIMALARALDDRPSRLGSPGVPMYGYNVQLLNEVTGEPCGINEKGMLVIEGPLPPGC
                     IQTIWGDDARFVKTYWSLFNRQVYATFDWGIRDAEGYYFILGRTDDVINIAGHRLGTR
                     EIEESISGYPNVAEVAVVGIKDALKGQVAVAFVIPKQSDTLADREAARDEEKAIMALV
                     DNQIGHFGRPAHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLQQIRQ
                     AIEE"
     gene            complement(415253..416227)
                     /gene="hemB"
                     /locus_tag="STY_RS01870"
                     /old_locus_tag="STY0404"
     CDS             complement(415253..416227)
                     /gene="hemB"
                     /locus_tag="STY_RS01870"
                     /old_locus_tag="STY0404"
                     /EC_number="4.2.1.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005125012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen synthase"
                     /protein_id="WP_000130724.1"
                     /translation="MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDY
                     KAIDAMPGVMRIPEKQLAREIERIANAGIRSVMTFGISHHTDDTGSDTWKEDGLVARM
                     SRICKQTVPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLANLGKQAVIAAAAGAD
                     FIAPSAAMDGQVQAIRQALDAAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKT
                     YQMNPMNRREAIRESLLDEAQGADCLMVKPAGAYLDVLREIRERTELPLGAYQVSGEY
                     AMIKFAAMAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKNILR"
     gene            416740..419625
                     /locus_tag="STY_RS01875"
                     /old_locus_tag="STY0405"
     CDS             416740..419625
                     /locus_tag="STY_RS01875"
                     /old_locus_tag="STY0405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter outer membrane beta-barrel
                     domain-containing protein"
                     /protein_id="WP_000556507.1"
                     /translation="MHSWKKKLVVSQLALACTLAITSQANATTYDTFGYHDDAATVFG
                     WDDTNDHDYLTYGGYVYNTPASDSGYFDTKFTGDTVNGVISTYYLNHDYANDTANTLD
                     VTNSTIHGMITSYQMGYGQYVWTNGSDYTTHDWVDDDTFNLNISNSTIDDDFEAFYFT
                     DTYLDSDGKTVKTDYDKLVTAGLGTAITLDVESNINITNNSHVAGIALYQNDLGNSTY
                     TTEAHQWDNTINVANSTVTSGSWSEDEEQGHFGNSSEPSDYNGNGWNKDDVALAFVDD
                     PYSNYRMVNNVTFTDSQLLGDVVLESSWNYNFYSNGRLVDDSTTVYTNGGWADDDQNV
                     DHLTLTLNNTKWVGAAVNDSQSMDPVQFYDVDANSLDPDSTNYDAWGRVNSAASFQSG
                     IFDVSLNNGSEWDTTKTSVIDTLAVNSGSQVDVANGSNLTADTITLNGGSAMNIGEGG
                     YVDTDHLTVDTFSTVTLADDVSSAWSDDALYANTITVTHGGMLDIQTNNTNADSVIDT
                     DTLELTSSNVADNNGNVYAGVFNIHSNDYTLNADLVNDRTWDTTQANYGYGVVAMNSD
                     GHLTINGNGDINNGDEADASSTTDNVVAATGNYKVRIDNATGAGSVADYKGNELIYVN
                     DINTDATFSAANKADLGAYTYQAKQEGNTVVLEQMELTDYANMALSIPSANTNIWNLE
                     QDTVGTRLTNARHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDTKVDGNN
                     AKWIVGAAAGFAKGDLSDRTGQVDQDSQSAYIYSSARFANNIFVDGNLSYSHFNNDLS
                     ANMSDGTYVDGNTSSDAWGFGLKLGYDLKLGDAGYVTPYGSVSGLFQSGDDYQLSNDM
                     KVDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDADVNGDSIDNGV
                     EGFAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
     gene            419711..420334
                     /gene="iprA"
                     /locus_tag="STY_RS01880"
                     /old_locus_tag="STY0406"
     CDS             419711..420334
                     /gene="iprA"
                     /locus_tag="STY_RS01880"
                     /old_locus_tag="STY0406"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogen peroxide resistance inhibitor IprA"
                     /protein_id="WP_000950094.1"
                     /translation="MLSLNKPLQEFNRLDKCLSKHGTRFEFVNDKEIICSPDESNTHT
                     FVILEGVVSLVRGDKVLIGIVQAPFIFGLADGVAKKEAQYKLIAESGCIGYRLSSSQT
                     LAIIEQNQLWREAFCWIVWKSQVLELRDKQLIGNNSYDQIRATLMTMIEWDEELRSRI
                     GVMNYIHQRTRVSRSVVAEVLAALRKGNYIEMNKGKLISINRLPSEY"
     gene            complement(420379..421536)
                     /gene="ampH"
                     /locus_tag="STY_RS01885"
                     /old_locus_tag="STY0407"
     CDS             complement(420379..421536)
                     /gene="ampH"
                     /locus_tag="STY_RS01885"
                     /old_locus_tag="STY0407"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_308453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine-
                     carboxypeptidase/endopeptidase AmpH"
                     /protein_id="WP_000830774.1"
                     /translation="MKRSLLFTAMLFAASLTSVQAAQPIADPVFASDIVDRYAEHIFY
                     GSGATGMALVVIDGNQRVFRSFGDTRPGNNVRPQLDSVIRIASLTKLMTSEMLVKLLD
                     QGTVKLNDPLSKYAPPGAHVPTYQGTPITLVNLATHTSALPREQPGGAAHRPVFVWPT
                     REQRWNWLSTATLKVAPGSQAAYSNLAFDLLADALATASGKPYTQLFEEKITRPLGMK
                     DTTFTPSPDQCKRLMVAEKGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYHR
                     SHQADRMQTLIYQRAQLKKIIGMDVPGKADALGLGWVYMAPKDGRPGIIQKTGGGGGF
                     ITYMAMIPQYNIGAFVVVTRSPLTRFTNMSDGINDLVTELSGNKPIAIPAS"
     gene            421872..423092
                     /gene="sbmA"
                     /locus_tag="STY_RS01890"
                     /old_locus_tag="STY0408"
     CDS             421872..423092
                     /gene="sbmA"
                     /locus_tag="STY_RS01890"
                     /old_locus_tag="STY0408"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide antibiotic transporter SbmA"
                     /protein_id="WP_000477016.1"
                     /translation="MFKSFFPKPGPFFMSAFVWALIAVIFWQAGGGDWVARLVGASDE
                     VPISAARFWLLDYLIFYAYYLICVGLFATFWFIYSPHRWQYWSILGTSLIIFVTWFLV
                     EVGVAVNAWYAPFYDLIQTALNSPHKVTLGQFYHEVGVFLGIALIAVVIGVLNNFFVS
                     HYVFRWRTAMNEHYMAHWQYLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIA
                     FLPVLVTLSAHVPNLPIVGHIPYGLVIAAIVWSLMGTGLLAVVGIKLSGLEFKNQRVE
                     AAYRKELVYGEDDASRATPPTVRELFSAVRHNYFRLYFHYMYFNIARILYLQVDNVFG
                     LFLLFPSIVAGTITLGLMTQITNVFGQVRGSFQYLINSWTTLVELMSIYKRLRSFERQ
                     LDGQPVQEVTHSFS"
     gene            423107..424201
                     /gene="yaiW"
                     /locus_tag="STY_RS01895"
                     /old_locus_tag="STY0409"
     CDS             423107..424201
                     /gene="yaiW"
                     /locus_tag="STY_RS01895"
                     /old_locus_tag="STY0409"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="surface-exposed outer membrane lipoprotein YaiW"
                     /protein_id="WP_001271423.1"
                     /translation="MSAASRLYPLPFLAVAILAGCSSQSGQPVSKGEKPVDVASVVRQ
                     KMPASVKDREAWAKDIATTFKSQGLAPTVENICSVLAVAQQESGYQADPVVPGLSKIA
                     WQEIDRRAERLHIPLFLVHTALKINSPNGKSYSERLDTVKTEKQLSAIFDDFINMVPM
                     GQTLFGSYNPVHTGGPMQVSIAFAEQHAKGYPWNMAGTVRQEVFTRRGGLWFGTYHLL
                     NYPANYSAPVFRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYNSKEPGKTE
                     LAVRKLAGQLGMSEREIRSQLEKGDNLAFEKTALYKKVYKLAEAKTGKTLAREMLPGI
                     QLESPKITRKLTTAWFAKRVDERRARCMGR"
     gene            complement(424239..424547)
                     /locus_tag="STY_RS01900"
                     /old_locus_tag="STY0410"
     CDS             complement(424239..424547)
                     /locus_tag="STY_RS01900"
                     /old_locus_tag="STY0410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2755 family protein"
                     /protein_id="WP_000763139.1"
                     /translation="MADFTLSKSLFSGKHRETSSTPGNIAYAIFVLFCFWAGAQLLNL
                     LVHAPGIYEHLMQVQDTGRPRVEIGLGVGTIFGLVPFLTGCLIFAVIAAFLRWRHRHQ
                     "
     gene            424815..425030
                     /locus_tag="STY_RS01905"
                     /old_locus_tag="STY0411"
     CDS             424815..425030
                     /locus_tag="STY_RS01905"
                     /old_locus_tag="STY0411"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2754 family protein"
                     /protein_id="WP_001239240.1"
                     /translation="MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVG
                     LVTWIISFWLAGFIIRRREDDEVKDAR"
     gene            complement(425056..426150)
                     /gene="ddlA"
                     /locus_tag="STY_RS01910"
                     /old_locus_tag="STY0412"
     CDS             complement(425056..426150)
                     /gene="ddlA"
                     /locus_tag="STY_RS01910"
                     /old_locus_tag="STY0412"
                     /EC_number="6.3.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--D-alanine ligase"
                     /protein_id="WP_001096588.1"
                     /translation="MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGID
                     KAGQWHVNDAENYLQNADDPAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVI
                     FPIVHGTLGEDGSLQGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFIT
                     LTRTNRHAFSFAEVESRLGLPLFVKPANQGSSVGVSKVANEAQYQQAVALAFEFDHKV
                     VVEQGIKGREIECAVLGNDNPQASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQIPS
                     EVNDKIRAIAIQAYQTLGCAGMARVDVFLTADNEVVINEINTLPGFTNISMYPKLWQA
                     SGLGYTDLISRLIELALERHTANNALKTTM"
     gene            426228..426941
                     /locus_tag="STY_RS01915"
                     /old_locus_tag="STY0413"
     CDS             426228..426941
                     /locus_tag="STY_RS01915"
                     /old_locus_tag="STY0413"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extensin family protein"
                     /protein_id="WP_000480796.1"
                     /translation="MFMGCENGGRVRGKGFLIIVLLGGIGGLGYRYLPSYYNPFAPLQ
                     LADPPGWITTFKLQRLTPSQCRELLTAANQQGLISSQPVADSAGECPLSHVVRVRDFG
                     QVKLSSSFLASCPLALRSALFVEQQAKPLTETWMQRRLTRIEHLGSYACRNIYHRPDA
                     RRSEHASAEALDVSGFQLSDGRKITVLRGWGREETGPWLRAMLNASCHYYGNGLRPDY
                     NAAHANHFHLGMRGYGVCR"
     gene            427110..428309
                     /locus_tag="STY_RS01920"
                     /old_locus_tag="STY0414"
     CDS             427110..428309
                     /locus_tag="STY_RS01920"
                     /old_locus_tag="STY0414"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux MFS transporter"
                     /protein_id="WP_000446769.1"
                     /translation="MESWKVNLISVWFGCFFTGLAISQILPFLPLYISQLGVSSHEAL
                     SMWSGLTFSITFLISAIVSPMWGSLADRKGRKLMLLRASLGMAIAILLQAFATHVWQL
                     FLLRGIMGLTSGYIPNAMALVASQVPRERSGWALSTLSTAQISGVIGGPLMGGFVADH
                     IGLRAVFLITAMLLVVSFLVTLFLIKEGVRPVIKKSERLSGKAVFASLPYPALVISLF
                     FTTMVIQLCNGSISPILALFIKSMMPDSNNIAFLSGLIASVPGISAPRLGKLGDRIGT
                     ERILMATLICAVLLFFAMSWVTTPFQLGLLRFLLGFADGAMLPAVQTLLVKYSSDQIT
                     GRIFGYNQSFMYLGNVVGPLMGATVSAMAGFRWVFIATAAIVLINIGQLTLALRHRRN
                     AQKAKGQ"
     gene            428600..428866
                     /gene="iraP"
                     /locus_tag="STY_RS01925"
                     /old_locus_tag="STY0415"
     CDS             428600..428866
                     /gene="iraP"
                     /locus_tag="STY_RS01925"
                     /old_locus_tag="STY0415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459378.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-adapter protein IraP"
                     /protein_id="WP_000245158.1"
                     /translation="MVMKNLIAELLLKLAQKEEESKELVAQVEALEIIVTAMLRNMAQ
                     NEQEMLIRQVEGALEGVKPDASVPDHDTELLRQYVKKLLRHPRH"
     gene            429218..429538
                     /gene="psiF"
                     /locus_tag="STY_RS01930"
                     /old_locus_tag="STY0417"
     CDS             429218..429538
                     /gene="psiF"
                     /locus_tag="STY_RS01930"
                     /old_locus_tag="STY0417"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate starvation-inducible protein PsiF"
                     /protein_id="WP_000705165.1"
                     /translation="MKITLLVTLLFGLVFLTAVGATEKPLTPQQQRMTTCNQQATAQA
                     LKGDARKTYLSDCLKNSQSAPGEKSLTPQQQKMRECNVQATEQSLKGDDRSKFMSACL
                     KKAA"
     gene            429630..430742
                     /gene="adrA"
                     /locus_tag="STY_RS01935"
                     /old_locus_tag="STY0418"
                     /gene_synonym="dgcC"
     CDS             429630..430742
                     /gene="adrA"
                     /locus_tag="STY_RS01935"
                     /old_locus_tag="STY0418"
                     /gene_synonym="dgcC"
                     /EC_number="2.7.7.65"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase AdrA"
                     /protein_id="WP_000484099.1"
                     /translation="MFPKIMNDENFYRKAVEQAVAPPDPSDDRQRSGLRFARRIRLPR
                     AVGLGGMLLPVAAVLVSQPVFGGWWLLLVGWSFVWPHLAWQWAAKALDPLRQEIYNLK
                     VDAILSGMWIALMGVNMLPAAALFMMMSMNLMGAGGRRLFTVGMGLLLASCLVTLQLT
                     GLPVAMRSSSLEVTLSLPVIMLYPLLFAWVSYQTAIKLAEHKRRLQAMSSRDGMTGVY
                     NRRHWEILLRNEFDHSRRHHREATLLIIDIDHFKSINDTWGHDAGDEAIIALTRQLQI
                     TLRGSDIIGRFGGDEFAVIMCGTPADSAITAMSRVHERLNTLRLPGAPQVMLRISVGV
                     APLTPQIGHYREWLKSADMALYKAKNAGRNRTEVAA"
     gene            complement(430757..431566)
                     /gene="proC"
                     /locus_tag="STY_RS01940"
                     /old_locus_tag="STY0419"
     CDS             complement(430757..431566)
                     /gene="proC"
                     /locus_tag="STY_RS01940"
                     /old_locus_tag="STY0419"
                     /EC_number="1.5.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="WP_000412190.1"
                     /translation="MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAA
                     LHDQYGINAAQSAQEVAQVADIVFGAVKPGIMVKVLSEISSSLNKDSLVVSIAAGVTL
                     DQLARALGHDRKIIRAMPNTPSLVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVI
                     AEPMIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKIVLET
                     GKHPGELKDMVCSPGGTTIEAVRVLEERGFRAAVIEAMTKCMEKSEALSKS"
     gene            431706..432161
                     /locus_tag="STY_RS01945"
                     /old_locus_tag="STY0420"
     CDS             431706..432161
                     /locus_tag="STY_RS01945"
                     /old_locus_tag="STY0420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YaiI/YqxD family protein"
                     /protein_id="WP_000158137.1"
                     /translation="MTIWVDADACPNVIKEILYRAAERMQLPLILVANQALRVPPSRF
                     IRTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEVLEKGAAALNPRGERYSDATI
                     RERLTMRDFMDTLRASGVQTGGPNTLSPRDRQHFAAELDKWWLESQRKK"
     gene            432346..432891
                     /gene="aroL"
                     /locus_tag="STY_RS01950"
                     /old_locus_tag="STY0421"
     CDS             432346..432891
                     /gene="aroL"
                     /locus_tag="STY_RS01950"
                     /old_locus_tag="STY0421"
                     /EC_number="2.7.1.71"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase AroL"
                     /protein_id="WP_000983569.1"
                     /translation="MMQPLYLVGPRGCGKTTIGMALAQATGFRFADTDRWLQSHVQMS
                     VADIVEKEGWGGFRARETAALEAVSAPSTVVATGGGIILTEYNRRYMHRVGVVIYLCA
                     PVSTLVNRLEAEPEADLRPTLTGKPLSEEVREVLEQRDALYRETAHYIIDATKAPAQV
                     VSEIIAALPPSTQRLQGDVYT"
     gene            432918..433109
                     /gene="yaiA"
                     /locus_tag="STY_RS01955"
                     /old_locus_tag="STY0422"
     CDS             432918..433109
                     /gene="yaiA"
                     /locus_tag="STY_RS01955"
                     /old_locus_tag="STY0422"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein YaiA"
                     /protein_id="WP_001143161.1"
                     /translation="MPTRPPYPREAYIVTIEKGTPGQTVTWYQLRADHPKPDSLISEH
                     PTAEEAMDAKKRYEDPDKS"
     gene            433360..434037
                     /locus_tag="STY_RS01960"
                     /old_locus_tag="STY0423"
     CDS             433360..434037
                     /locus_tag="STY_RS01960"
                     /old_locus_tag="STY0423"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AroM family protein"
                     /protein_id="WP_001276434.1"
                     /translation="MSASLAILTIGVVPMSEVLPLLTEYIDEQHITHHSLLGKMSRED
                     VMADYAVEPGDDLLLTLLNDNQIAHVSRQKVERDLQSVVEVLDNQGYDVIILMSTAAI
                     KSTAARNSILLEPLRIIPPLVASIVDGHQVGAIVPVAELLAAQEKKWQVLQMPPVYSL
                     ANPVHGSEQQLIDAGQALLDQGADVIMLDCLGFHQRHRDILQQALDVPVLLSNVLIAR
                     LASELLV"
     gene            434108..434392
                     /gene="ppnP"
                     /locus_tag="STY_RS01965"
                     /old_locus_tag="STY0424"
     CDS             434108..434392
                     /gene="ppnP"
                     /locus_tag="STY_RS01965"
                     /old_locus_tag="STY0424"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrimidine/purine nucleoside phosphorylase"
                     /protein_id="WP_000941953.1"
                     /translation="MLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGEYTFGTAEPEE
                     MTVVSGALKVLLPGTVEWKVYTAGEVFNVPGHSEFHLQVAEPTSYLCRYL"
     gene            complement(434430..435341)
                     /gene="rdgC"
                     /locus_tag="STY_RS01970"
                     /old_locus_tag="STY0425"
     CDS             complement(434430..435341)
                     /gene="rdgC"
                     /locus_tag="STY_RS01970"
                     /old_locus_tag="STY0425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005120935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombination-associated protein RdgC"
                     /protein_id="WP_000964305.1"
                     /translation="MLWFKNLMVYRLSRDITLRAEEMEKQLASMTFTPCGSQDMAKMG
                     WVPPMGSHSDALTHTANGQIIICARKEEKILPSPVIKQALEAKIQKLEADQGRKLKKT
                     EKDSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGS
                     LPVVPLALENPIELTLTEWVRSGTVAQGFQLLDEAELKAMLEDGGVIRAKKQDLVSDE
                     IAVHIEAGKVVTKLALDWQQRIQFVMCDDGSIKRLKFCDELRDQNEDIDREDFAQRFD
                     ADFILMTGELAALIQSLVEGLGGEAQR"
     gene            435467..436375
                     /gene="mak"
                     /locus_tag="STY_RS01975"
                     /old_locus_tag="STY0426"
     CDS             435467..436375
                     /gene="mak"
                     /locus_tag="STY_RS01975"
                     /old_locus_tag="STY0426"
                     /EC_number="2.7.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructokinase"
                     /protein_id="WP_001219273.1"
                     /translation="MRIGIDLGGTKTEVIALDDAGEQRFRHRLPTPREDYQQTIETIA
                     TLVDMAEQATGQTGSVGIGIPGSLSPYTGVVKNANSTWLNGQPFDSDVSRRLKREVRL
                     ANDANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVALNGRAHIGGNGTAGEWGHNPL
                     PWMDDDELRYREEIPCYCGKQGCIETFISGTGFATDYQRLSGKTLKGDEIIRLVDAQD
                     AVAELAISRYELRLAKALSHVVNILDPDVIVLGGGMSNVERLYKTVPSLMKSFVFGGE
                     CETPVRKARHGDSSGVRGAAWLWPLA"
     gene            complement(436395..437567)
                     /gene="araJ"
                     /locus_tag="STY_RS01980"
                     /old_locus_tag="STY0428"
                     /pseudo
     CDS             complement(436395..437567)
                     /gene="araJ"
                     /locus_tag="STY_RS01980"
                     /old_locus_tag="STY0428"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459389.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter AraJ"
     gene            complement(437771..440875)
                     /gene="sbcC"
                     /locus_tag="STY_RS01985"
                     /old_locus_tag="STY0429"
     CDS             complement(437771..440875)
                     /gene="sbcC"
                     /locus_tag="STY_RS01985"
                     /old_locus_tag="STY0429"
                     /EC_number="3.1.11.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011106941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease subunit SbcC"
                     /protein_id="WP_010989123.1"
                     /translation="MKILSLRLKNLNSLKGEWKVDFTAEPFASNGLFAITGPTGAGKT
                     TLLDAICLALYHETPRLNTVSQSQNDLMTRDTAECLAEVEFEVKGEAWRAFWSQNRAR
                     NRPDGNLQAPRVELARCSDGKIFADKVKDKLEMIATLTGLDYGRFTRSMLLSQGQFAA
                     FLNAKAKERAELLEELTGTEIYGQISAQVFEKHKSARLELEKLQAQASGVALLADEQL
                     QQLEASLQALTDEEKRLLADQQGQQQHLHWLTRKNELHTELHARQQALYAAQEAREKA
                     QPQLAALTLAQPARQLRPHWERIQEQTRAVERVRQHSDEVNARLQSAYRLRQRIRACA
                     HRQFTQLNATGQRLKTWLAEHDGIRVWRSELAGWRALLTQQSHDRAQLSQWQQQLLSD
                     MRQRDALPPLTLDLTPQALAEARALHTRQRPLRHRLAALQGQILPKQKRQAQLQAAIA
                     RHHQEQTQYTQRLADKRLSYKTKAQELADVRTICEQEARIKDLESQRAHLQSGQPCPL
                     CGSTTHPAIAAYQALELSANQTRRDALEKEVKTLAEEGAALRGQLDALTQQLQRDESE
                     AQSLLQEEQALTEEWQTLCATLGVQLQPQEDLAGWLTAAEEHEQQLDQLSQRHALQTQ
                     IAAHTEQVARFTAQIAQRQASLTADLAQYTLSLPAPEDEASWLNERADEAKIWQQRQT
                     EFADLQTQIDRLAPLLETLPQTDTADSDDDVPLDNWRQTHDECVSLQSQLQTLQEQTT
                     QEQQRAAEAIAHFDAALKNSPFDSQATFLAALLDEETVTRLEKQQQTLESQLQQAKAL
                     SAQSAQALADHQQQPPAGLDPTCTAEQLAQRLAQLAQQLRENTTRQGEIRQQIKQDAD
                     NRQRQRALMAEMKQASQQVEDWGYLNALIGSKEGDKFRKFAQGLTLDNLVWLANHQLT
                     RLHGRYLLQRKASDALELEVVDTWQADAVRDTRTLSGGESFLVSLALALSDLVSHKTR
                     IDSLFLDEGFGTLDSETLDAALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKNQ
                     WAWL"
     gene            complement(440872..442074)
                     /gene="sbcD"
                     /locus_tag="STY_RS01990"
                     /old_locus_tag="STY0430"
     CDS             complement(440872..442074)
                     /gene="sbcD"
                     /locus_tag="STY_RS01990"
                     /old_locus_tag="STY0430"
                     /EC_number="3.1.11.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease subunit SbcD"
                     /protein_id="WP_001221246.1"
                     /translation="MRILHTSDWHLGQNFYSKSRAAEHQAFLDWLLETAQAHQVDAII
                     VAGDIFDTDSPPSYARELYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDILAFLNT
                     TVIASAGYAPRLLHRRDGSPGAVLCPIPFLRPRDIITSQAGLSGSEKQQQLLHAIADY
                     YQQQYQEACLLRGERKLPVIATGHLTTVGASKSDAVRDIYIGTLDAFPAQHFPPADYI
                     ALGHIHRAQCVGGTEHIRYCGSPIALSFDECGKSKCVHLVTFDQGKWQSTESLAVPVT
                     QLLAVLKGDLASITEQLEQWRGVEQSPPVWLDIEITTDDYLHDIQRRIQALTESLPVE
                     VLLVRRSREQRERSLANERRETLSELSVEEVFARRLALEALDTPQRERLNQLFSSTLY
                     ALNEEHEA"
     gene            442289..442978
                     /gene="phoB"
                     /locus_tag="STY_RS01995"
                     /old_locus_tag="STY0432"
     CDS             442289..442978
                     /gene="phoB"
                     /locus_tag="STY_RS01995"
                     /old_locus_tag="STY0432"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000113934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate response regulator transcription
                     factor PhoB"
                     /protein_id="WP_000113921.1"
                     /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKLNE
                     PWPDLILLDWMLPGGSGLQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDY
                     ITKPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPGSHRVMTGDSPLDMGPTEF
                     KLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEHSGHDRMVQTV
                     RGTGYRFSTRF"
     gene            443048..444343
                     /gene="phoR"
                     /locus_tag="STY_RS02000"
                     /old_locus_tag="STY0433"
     CDS             443048..444343
                     /gene="phoR"
                     /locus_tag="STY_RS02000"
                     /old_locus_tag="STY0433"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate regulon sensor histidine kinase PhoR"
                     /protein_id="WP_000893648.1"
                     /translation="MLERLSWKRLVLELVLCCIPALILSAFFGYLPWFLLAAVTGLLV
                     WHFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRS
                     GAESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPDDNGQNILNLLRYPEFTQYLKTRD
                     FTRPLHLVLNTGRHLEIRVMPYTDKQLLMVARDVTQMHQLEGARRNFFANVSHELRTP
                     LTVLQGYLEMMQEQALEGATREKALHTMREQTYRMEGLVKQLLTLSKIEVAPALLLNE
                     KVDVPMMLRVVEREAQTLSQQKHTFTFAVDDSLSVLGNEEQLRSAISNLVYNAVNHTP
                     AGTHITVSWRRAAHGAEFCIQDNGPGIAAEHIPRLTERFYRVDKARSRQTGGSGLGLA
                     IVKHALNHHESRLEIDSSPGKGTRFSFVLPERLIAKNSD"
     gene            444752..446071
                     /gene="brnQ"
                     /locus_tag="STY_RS02005"
                     /old_locus_tag="STY0435"
     CDS             444752..446071
                     /gene="brnQ"
                     /locus_tag="STY_RS02005"
                     /old_locus_tag="STY0435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transporter carrier
                     protein BrnQ"
                     /protein_id="WP_000149625.1"
                     /translation="MTHQLKSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTA
                     AIGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGLLLATVCYLAVGPLFATPRT
                     ATVSFEVGIAPLTGDSAMPLLIYSVVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALV
                     ILSVAAIVWPAGPISNALDAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGV
                     TEARLLTRYTVWAGLMAGVGLTLLYLALFRLGSDSATLVDQSANGAAILHAYVQHTFG
                     GAGSFLLAALIFIACLVTAVGLTCACAEFFAQYIPLSYRTLVFILGGFSMVVSNLGLS
                     HLIQISIPVLTAIYPPCIALVVLSFTRSWWHNSTRIIAPAMFISLLFGILDGIKASAF
                     GDMLPAWSQRLPLAEQGLAWLMPTVVMVILAIIWDRAAGRQVTSSAH"
     repeat_region   446116..446840
                     /note="IS200"
     gene            446126..446308
                     /locus_tag="STY_RS02010"
     CDS             446126..446308
                     /locus_tag="STY_RS02010"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000431187.1"
                     /translation="MENPQLGWGFRKAFSFKPVIKTPFDLLKHLAVWQLQKFNKKSKG
                     GPNGGRKELSAHPMEL"
     gene            446265..446723
                     /locus_tag="STY_RS02015"
                     /old_locus_tag="STY0437"
     CDS             446265..446723
                     /locus_tag="STY_RS02015"
                     /old_locus_tag="STY0437"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605-like element IS200F family
                     transposase"
                     /protein_id="WP_000502119.1"
                     /translation="MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKL
                     CEWKNVRILEAECCADHIHMLLEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRN
                     REFWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
     gene            446857..448227
                     /gene="proY"
                     /locus_tag="STY_RS02020"
                     /old_locus_tag="STY0438"
     CDS             446857..448227
                     /gene="proY"
                     /locus_tag="STY_RS02020"
                     /old_locus_tag="STY0438"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline-specific permease ProY"
                     /protein_id="WP_000445555.1"
                     /translation="MESNNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSV
                     LLAYIIGGVAAYIIMRALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIV
                     AIADVTAFGIYMGVWFPAVPHWIWVLSVVLIICAINLMSVKMFGELEFWFSFFKVATI
                     IIMIVAGIGIIVWGIGNGGQPTGIHNLWSNGGFFSNGWLGMIMSLQMVMFAYGGIEII
                     GITAGEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTNGSPFVLTFQH
                     MGITFAASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKVFAKTSRRGIPWVT
                     VLVMTIALLFAVYLNYIMPENVFLVIASLVTFATVWVWIMILLSQIAFRRRLPPEEVK
                     ALKFKVPGGVVTTIAGLIFLVFIIALIGYHPNTRISLYVGFAWIVLLLIGWIFKRRRD
                     RQLAQA"
     gene            448389..450206
                     /gene="malZ"
                     /locus_tag="STY_RS02025"
                     /old_locus_tag="STY0439"
     CDS             448389..450206
                     /gene="malZ"
                     /locus_tag="STY_RS02025"
                     /old_locus_tag="STY0439"
                     /EC_number="3.2.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltodextrin glucosidase"
                     /protein_id="WP_000930730.1"
                     /translation="MLNAWHLPVAPFVKQHNDKLTITLWLSGENPPSRVTLRSEFDNE
                     EISLAMRKQRRQPQPGVTAWRATLNIALGQPRRRYSFKLLWHDRQRWFTPQGFSCFPP
                     ARLEQFAVDVPDSGPQWVADQIFYQIFPDRFARSATREADQDRVYYHHAAGQEIVLRD
                     WDDPLTPQAGGSTFYGGCLNGICEKLPYLKKLGVTALYLNPVFTAPSVHKYDTEDYRH
                     VDPQFGGDRALLRLRRETQAQGMRLVLDGVFNHSGDSHAWFDRHNRSTGGACHHPDSP
                     WRDWYSFSPQGVALDWLGYPSLPKLDYQSETLVDEIYRGEDSIVRHWLKAPWNMDGWR
                     LDVVHMLGEAGGARHNLQHVAGITRAAKEAQPEAYIVGEHFSDARQWLQADAEDAAMN
                     YRGFTFPLWGFLANTDIAYEPQHIDARTCIAWMDNYRAGLSHQQQLRMFNQLDSHDTA
                     RFKTLLGKDAARLPLAVVWLFTWPGVPCIYYGDEVGVDGANDPMCRKPFPWDERKQDG
                     NLLALYQRMAKLRQSSLALRRGGCQALYAEGDVVVFVRVYQQQRALVAINRGEACEVA
                     LEALPLLNVAGWQCKTGSGDIREGRLSLPAISATVWMNR"
     gene            complement(450278..450880)
                     /locus_tag="STY_RS02030"
                     /old_locus_tag="STY0440"
     CDS             complement(450278..450880)
                     /locus_tag="STY_RS02030"
                     /old_locus_tag="STY0440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006818745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_000244731.1"
                     /translation="MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPM
                     DFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDKGGIGPVKYAM
                     VADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
                     LQFHEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL"
     gene            complement(451090..451671)
                     /gene="acpH"
                     /locus_tag="STY_RS02035"
                     /old_locus_tag="STY0441"
     CDS             complement(451090..451671)
                     /gene="acpH"
                     /locus_tag="STY_RS02035"
                     /old_locus_tag="STY0441"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ACP phosphodiesterase"
                     /protein_id="WP_001009858.1"
                     /translation="MNFLAHLHLAHLADSSLSGNLLADFVRGNPATHYPPDVVEGIYM
                     HRRIDVMTDNLPEVREAREWFRHETRRVAPITLDVMWDHFLSRHWTQISPDFPLQAFV
                     GYAHAQVATILPDSPPRFVNLNDYLWSEKWLERYRDMDFIQNVLNGMANRRPRLDALR
                     DSWYDLDAHYDALEERFWHFYPRMMAQAARKAL"
     gene            451765..452829
                     /gene="queA"
                     /locus_tag="STY_RS02040"
                     /old_locus_tag="STY0442"
     CDS             451765..452829
                     /gene="queA"
                     /locus_tag="STY_RS02040"
                     /old_locus_tag="STY0442"
                     /EC_number="2.4.99.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA preQ1(34) S-adenosylmethionine
                     ribosyltransferase-isomerase QueA"
                     /protein_id="WP_001266528.1"
                     /translation="MRVTDFSFELPESLIAHYPQPERSRCRLLSLEGPTGALTHGTFT
                     DLLDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPK
                     PGTELLLGDDESIHATMTARHGALFEVEFNDPRPVLDILNAIGHMPLPPYIDRPDEDA
                     DRELYQTVYSEKPGAVAAPTAGLHFDEPLLAALREKGVEMAFVTLHVGAGTFQPVRVD
                     TIEDHIMHSEYAEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKSDLIEPF
                     FGDTQIFIYPGYQYKVIDALITNFHLPESTLIMLVSAFAGYQHTMNAYKTAVEQKYRF
                     FSYGDAMFITCNPQAISERP"
     gene            453026..454153
                     /gene="tgt"
                     /locus_tag="STY_RS02045"
                     /old_locus_tag="STY0443"
     CDS             453026..454153
                     /gene="tgt"
                     /locus_tag="STY_RS02045"
                     /old_locus_tag="STY0443"
                     /EC_number="2.4.2.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012904808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA guanosine(34) transglycosylase Tgt"
                     /protein_id="WP_000667304.1"
                     /translation="MKFELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPE
                     EVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIR
                     KITEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSME
                     MSLRWAKRSRDRFDSLGNKNALFGIIQGSVYEDLRDISVKGLVEIGFDGYAVGGLAVG
                     EPKADMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGH
                     LFVTDGVVKIRNAKHKSDISPLDAECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHN
                     LRYYQRLMAGLRKAIEEGKLESFVTEFYQRQGRPVPPLNVD"
     gene            454176..454508
                     /gene="yajC"
                     /locus_tag="STY_RS02050"
                     /old_locus_tag="STY0444"
     CDS             454176..454508
                     /gene="yajC"
                     /locus_tag="STY_RS02050"
                     /old_locus_tag="STY0444"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000007628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit YajC"
                     /protein_id="WP_000007628.1"
                     /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQK
                     RTKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAEAGYIAIALNDTTEVVIKRDFVAAVL
                     PKGTMKAL"
     gene            454536..456383
                     /gene="secD"
                     /locus_tag="STY_RS02055"
                     /old_locus_tag="STY0445"
     CDS             454536..456383
                     /gene="secD"
                     /locus_tag="STY_RS02055"
                     /old_locus_tag="STY0445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005125127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit SecD"
                     /protein_id="WP_000934811.1"
                     /translation="MLNRYPLWKYIMLVVVIIVGLLYALPNLYGEDPAVQITGVRGVA
                     ASEQTLIQVQKTLQEEKIPAKSVALEEGAILARFDTTDTQLRAREALMSVLGDKYVVA
                     LNLAPATPRWLAAIHADPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLRE
                     KGIPYTTVRKENNYGLSITFRDSKARDEAIAYLTPRHRDLVISSQSGNQLRAVMTDAR
                     LSEAREYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGAT
                     ATLEFRLVNTNVDQAAAAAGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQD
                     EYNQPQVNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEV
                     INIANIQSRLGNSFRITGISNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNI
                     KQGLEACLAGLVVSILFMIFFYKKFGLIATSALVANLVLIVGIMSLLPGATLSMPGIA
                     GIVLTLAVAVDANVLINERIKEELSNGRTVQQAINEGYAGAFSSIFDANITTLIKVII
                     LYAVGTGAIKGFAITTGIGVATSMFTAIIGTRAIVNLLYGGKRVTKLSI"
     gene            456394..457365
                     /gene="secF"
                     /locus_tag="STY_RS02060"
                     /old_locus_tag="STY0446"
     CDS             456394..457365
                     /gene="secF"
                     /locus_tag="STY_RS02060"
                     /old_locus_tag="STY0446"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit SecF"
                     /protein_id="WP_000046629.1"
                     /translation="MAQEYTVEQLNHGRKVYDFMRWDFWAFGISGLLLIAAIVIMGVR
                     GFNWGLDFTGGTVIEITLEKPAEMDVMREALQKAGYEEPQLQNFGSSHDIMVRMPPTE
                     GETGGQVLGSKVVTIINEATNQNAAVKRIEFVGPSVGADLAQTGAMALLVALISILVY
                     VGFRFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVS
                     DRIRENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLVVILMLYLFGGPVLEGFSLT
                     MLIGVSIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
     gene            457512..457877
                     /locus_tag="STY_RS02065"
                     /old_locus_tag="STY0447"
     CDS             457512..457877
                     /locus_tag="STY_RS02065"
                     /old_locus_tag="STY0447"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_000793035.1"
                     /translation="MKNLINWFEIPVTDMARAIAFYEQVMQISLRRETMDGADLAVFP
                     YAEPGPGGALIKQDDVAPVAQGVVIYLHTADLLASIERVVLAGGKCVLEPMVPGDDIG
                     TIALFIDSEGNRIGLHQPA"
     gene            457903..458595
                     /locus_tag="STY_RS02070"
                     /old_locus_tag="STY0448"
     CDS             457903..458595
                     /locus_tag="STY_RS02070"
                     /old_locus_tag="STY0448"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YafY family transcriptional regulator"
                     /protein_id="WP_000198318.1"
                     /translation="MTRRADRLFQIVQILRGRRLTTAALLAQRLAVSERTIYRDIRDL
                     SLSGVPVEGEAGSGYRLMAGFDLPPLMLTHRESEALMVAIRLLKTWGGDSLSRELESA
                     QEKVLAILPEESRRKAEQTRIYAPDLGTSPHSRSAFDLIHQAVSAQQVLALHYRDEAG
                     HLSSRDIQPLGLFFWGEHWLLVAWCERREDYRCFRLDRCLQITPLNRRFRETIDRSLR
                     DFLRKVEHEKMP"
     gene            458765..459112
                     /locus_tag="STY_RS02075"
                     /old_locus_tag="STY0449"
     CDS             458765..459112
                     /locus_tag="STY_RS02075"
                     /old_locus_tag="STY0449"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH nuclease family protein"
                     /protein_id="WP_000974818.1"
                     /translation="MAIIPKNYARLESGYREKALKLFPWVCGRCSREFVYSNLRELTV
                     HHIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGSTVIAGEDAQKDVGEATYN
                     PFADLKAMMNKKK"
     gene            459555..459662
                     /locus_tag="STY_RS02080"
     CDS             459555..459662
                     /locus_tag="STY_RS02080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000176312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I toxin-antitoxin system toxin Ldr family
                     protein"
                     /protein_id="WP_000176312.1"
                     /translation="MTLTELSITIWHDLAAPTLVGIATGLFLGWWHRRK"
     gene            complement(459745..460608)
                     /locus_tag="STY_RS02085"
                     /old_locus_tag="STY0451"
     CDS             complement(459745..460608)
                     /locus_tag="STY_RS02085"
                     /old_locus_tag="STY0451"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-specific channel-forming protein Tsx"
                     /protein_id="WP_000752021.1"
                     /translation="MKKTLLAVSAALALTSSFTANAAENDQPQYLSDWWHQSVNVVGS
                     YHTRFSPKLNNDVYLEYEAFAKKDWFDFYGYIDIPKTFDWGNGNDKGIWSDGSPLFME
                     IEPRFSIDKLTGADLSFGPFKEWYFANNYIYDMGDNKASRQSTWYMGLGTDIDTGLPM
                     GLSLNVYAKYQWQNYGASNENEWDGYRFKVKYFVPITDLWGGKLSYIGFTNFDWGSDL
                     GDDPNRTSNSIASSHILALNYDHWHYSVVARYFHNGGQWQNGAKLNWGDGDFSAKSTG
                     WGGYLVVGYNF"
     gene            complement(460908..461447)
                     /locus_tag="STY_RS02090"
                     /old_locus_tag="STY0452"
     CDS             complement(460908..461447)
                     /locus_tag="STY_RS02090"
                     /old_locus_tag="STY0452"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3251 domain-containing protein"
                     /protein_id="WP_000198480.1"
                     /translation="MTRRYLRILLVGSLLSLTACAPQSEVRQMHQSISTLNKEMTQLN
                     QETVKITQQNKLNADSTRGVYLLPGANTPARLESQIGTLRMTLLEITPVADGAHATLR
                     IQGKSRDPLPAFSATVEYGQIQGTTENYQEVNAQSLLVNAPASLLAPSDVNIPLPLKG
                     ITPAQLGFIRIHDIQPVNQ"
     gene            461599..462049
                     /gene="nrdR"
                     /locus_tag="STY_RS02095"
                     /old_locus_tag="STY0453"
                     /pseudo
     CDS             461599..462049
                     /gene="nrdR"
                     /locus_tag="STY_RS02095"
                     /old_locus_tag="STY0453"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017458860.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator NrdR"
     gene            462053..463156
                     /gene="ribD"
                     /locus_tag="STY_RS02100"
                     /old_locus_tag="STY0455"
     CDS             462053..463156
                     /gene="ribD"
                     /locus_tag="STY_RS02100"
                     /old_locus_tag="STY0455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     diaminohydroxyphosphoribosylaminopyrimidine
                     deaminase/5-amino-6-(5-phosphoribosylamino)uracil
                     reductase RibD"
                     /protein_id="WP_001150215.1"
                     /translation="MQDEFYMARALKLAQRGRFTTHPNPNVGCVIVNNGDIVGEGYHH
                     RAGEPHAEVHALRMAGAKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQD
                     PNPQVAGRGLYRLQQAGIAVSHGLMMSEAEALNKGFLKRMRTGFPYLQLKLGASVDGR
                     TAMASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWAELDASTQAS
                     YPQENLRQPVRIVIDSQNRVTPAHRIVQQPGETWIARTQEDSHAWPDSVRTISVPAHN
                     GHLDLVVLMMQLGRQQINSIWVEAGPGLAGALLQAGLVDELIVYVAPKLLGTQARGLC
                     ELPGLEKLADAPQFTFSEIRHVGPDVCLHMVSA"
     gene            463245..463715
                     /gene="ribE"
                     /locus_tag="STY_RS02105"
                     /old_locus_tag="STY0456"
     CDS             463245..463715
                     /gene="ribE"
                     /locus_tag="STY_RS02105"
                     /old_locus_tag="STY0456"
                     /EC_number="2.5.1.78"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="WP_001021372.1"
                     /translation="MNIIKANVAAPDARVAITIARFNQFINDSLLDGAVDALTRIGQV
                     KDDNITVVWVPGAYELPLATEALAKSGKYDAVVALGTVIRGGTAHFEYVAGGASNGLA
                     SVAQDSGVPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
     gene            463736..464155
                     /gene="nusB"
                     /locus_tag="STY_RS02110"
                     /old_locus_tag="STY0457"
     CDS             463736..464155
                     /gene="nusB"
                     /locus_tag="STY_RS02110"
                     /old_locus_tag="STY0457"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination factor NusB"
                     /protein_id="WP_000801120.1"
                     /translation="MKPAARHRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVD
                     VLYFRELLSGVATNSAYLDGLMKPYLSRLLEELGQVEKAVLRIALFELSKRSDVPYKV
                     AINEAIELAKTFGAEDSHKFVNGVLDKAAPVIRPNKK"
     gene            464234..465211
                     /gene="thiL"
                     /locus_tag="STY_RS02115"
                     /old_locus_tag="STY0458"
     CDS             464234..465211
                     /gene="thiL"
                     /locus_tag="STY_RS02115"
                     /old_locus_tag="STY0458"
                     /EC_number="2.7.4.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate kinase"
                     /protein_id="WP_000752139.1"
                     /translation="MACGEFSLIARYFDRVRSSRLDVETGIGDDCALLNIPEKQTLAI
                     STDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPEVDEPWLEA
                     FSDSLFALLNYYDMQLIGGDTTRGPLSMTLGIHGYIPAGRALKRSGAKPGDWIYVTGT
                     PGDSAAGLAVLQNRLQVSEETDAHYLIQRHLRPTPRILHGQALRDIASAAIDLSDGLI
                     SDLGHIVKASGCGARVDVDALPKSDAMMRHVDDGQELRWALSGGEDYELCFTVPELNR
                     GALDVAIGQLGVPFTCIGQMSADIEGLNFVRDGMPVTFDWKGYDHFATP"
     gene            465189..465704
                     /gene="pgpA"
                     /locus_tag="STY_RS02120"
                     /old_locus_tag="STY0459"
     CDS             465189..465704
                     /gene="pgpA"
                     /locus_tag="STY_RS02120"
                     /old_locus_tag="STY0459"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylglycerophosphatase A"
                     /protein_id="WP_000154063.1"
                     /translation="MTILPRHKDVAKSRLNLRNPWHLLATGFGSGLSPVVPGTMGSLA
                     AIPFWYLMTFLPWQLYSLVVMFGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITL
                     MALPTTDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILY
                     FIGHHWPLGII"
     gene            complement(465808..466782)
                     /locus_tag="STY_RS02125"
                     /old_locus_tag="STY0460"
     CDS             complement(465808..466782)
                     /locus_tag="STY_RS02125"
                     /old_locus_tag="STY0460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="WP_001199865.1"
                     /translation="MQYNTLGNTDLRVSRLCLGCMTFGEPSRGNHAWTLPEESSRPII
                     KRALEGGINFFDTANSYSDGSSEEIVGRALRDFARRDEVVVATKVFHRVGDLPEGLSR
                     AQILRSIDDSLTRLGMEYVDILQIHRWDYTTPIEETLEALNDVVKAGKARYIGASSMH
                     ASQFAQALALQKQHGWAPFVTMQDHYNLIYREEEREMLPLCWQEGVAVIPWSPLARGR
                     LTRPWGETTARLASDDVGKNLYDESDKNDAQIAERLAGVSEALGATRAQVALAWLLSK
                     RGVAAPIIGASREEQLDELLNAVDLTLKPEQIAELETPYKQHPVVGFK"
     gene            complement(466839..468701)
                     /gene="dxs"
                     /locus_tag="STY_RS02130"
                     /old_locus_tag="STY0461"
     CDS             complement(466839..468701)
                     /gene="dxs"
                     /locus_tag="STY_RS02130"
                     /old_locus_tag="STY0461"
                     /EC_number="2.2.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="WP_000006791.1"
                     /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVS
                     RSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKG
                     GLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMA
                     FEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLARLLSGKLYSSLREGGKKVFSG
                     VPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLKGPQ
                     FLHIMTKKGRGYEPAEKDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAA
                     KDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIY
                     STFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMT
                     PSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGLVKRHGEKLAI
                     LNFGTLMPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAG
                     SGVNEVLMAHRKPVPVLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKAWLA"
     gene            complement(468725..469624)
                     /gene="ispA"
                     /locus_tag="STY_RS02135"
                     /old_locus_tag="STY0462"
     CDS             complement(468725..469624)
                     /gene="ispA"
                     /locus_tag="STY_RS02135"
                     /old_locus_tag="STY0462"
                     /EC_number="2.5.1.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2E,6E)-farnesyl diphosphate synthase"
                     /protein_id="WP_000348078.1"
                     /translation="MDFTQQLQACVTQANQALSRFIAPLPFQNTPVVEAMQYGALLGG
                     KRLRPFLVYATGQMFGVSTATLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCH
                     IKFGEANAILAGDALQTLAFTIISDAPMPEVADRDRIAMIAELANASGIAGMCGGQAL
                     DLAAEGQRITLDALERIHRHKTGALIRAAVRLGALSAGDKGRNTLPILDRYAESIGLA
                     FQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARNKARDLIEDARQSLHQ
                     LAAQSLDTSALEALANYIIQRDK"
     gene            complement(469625..469867)
                     /gene="xseB"
                     /locus_tag="STY_RS02140"
                     /old_locus_tag="STY0463"
     CDS             complement(469625..469867)
                     /gene="xseB"
                     /locus_tag="STY_RS02140"
                     /old_locus_tag="STY0463"
                     /EC_number="3.1.11.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII small subunit"
                     /protein_id="WP_001124944.1"
                     /translation="MPKKNEAPASFETALSELEHIVTRLESGDLPLEDALNEFERGVQ
                     LARQGQAKLQQAEQRVQILLSDNEEASPEPFIADNE"
     gene            470077..471525
                     /gene="thiI"
                     /locus_tag="STY_RS02145"
                     /old_locus_tag="STY0464"
     CDS             470077..471525
                     /gene="thiI"
                     /locus_tag="STY_RS02145"
                     /old_locus_tag="STY0464"
                     /EC_number="2.8.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014168857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA 4-thiouridine(8) synthase ThiI"
                     /protein_id="WP_000668658.1"
                     /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVV
                     RHWDNIEVRAKDENQRLAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAQYREQL
                     EGKTFCVRVKRRGKHEFSSIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLL
                     LIKGRYEGIGGFPIGTQEDVLSLISGGFDSSVSSYMLMRRGCRVHYCFFNLGGAAHEI
                     GVRQVAHYLWNRFGSSHRVRFVAINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVA
                     ERYGVQALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTE
                     DFARTMPEYCGVISKSPTVKAIKAKIEAEEENFDFSILDKVVEEANNVDIREIAQQTQ
                     QEVVEVETVSGFGANDVILDIRSVDEQDDKPLKVEGVDVVSLPFYKLSTKFGDLDQSK
                     TWLLWCERGVMSRLQALYLREQGFANVKVYRP"
     gene            complement(471575..472366)
                     /gene="phnV"
                     /locus_tag="STY_RS02150"
                     /old_locus_tag="STY0465"
     CDS             complement(471575..472366)
                     /gene="phnV"
                     /locus_tag="STY_RS02150"
                     /old_locus_tag="STY0465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoethylphosphonate ABC transport system,
                     membrane component PhnV"
                     /protein_id="WP_000909802.1"
                     /translation="MLIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQRWNGIL
                     PSGFTLNHFVNALHGAAWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLS
                     MVFYLPSAIPSVSVGLGILVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLAR
                     ISADIENVASSLGASPWYRLRHVTLPLLMPWMVSELALSLSLSMGELGATVMIYPPGW
                     TTLPVAIFSLTDRGNIADGAALTIVLVAITLLLMMKLERIAKRLG"
     gene            complement(472360..473229)
                     /gene="phnU"
                     /locus_tag="STY_RS02155"
                     /old_locus_tag="STY0466"
     CDS             complement(472360..473229)
                     /gene="phnU"
                     /locus_tag="STY_RS02155"
                     /old_locus_tag="STY0466"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000052714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoethylphosphonate ABC transporter permease
                     subunit"
                     /protein_id="WP_000052708.1"
                     /translation="MSLILPLEKPALNLRPLLWLLLPLLALATLFFWPLSLIVEQALR
                     GANGEIGLETFRQVVDSKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSE
                     LIGRVVDTFIALPTFLITLAFTFIYGSAGLLNGALMSLFAFELPPVDFLYSMQGVILA
                     EITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIGQVIFPAALPALMASGSLC
                     LLLTTNEFGIVLFIGAKGVNTLPMMVYSKAILESDYTVACMIALINIVLSLGLFSLYR
                     LAASRTGVRSQPC"
     gene            complement(473232..474341)
                     /gene="phnT"
                     /locus_tag="STY_RS02160"
                     /old_locus_tag="STY0467"
     CDS             complement(473232..474341)
                     /gene="phnT"
                     /locus_tag="STY_RS02160"
                     /old_locus_tag="STY0467"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoethylphosphonate ABC transport system
                     ATP-binding subunit PhnT"
                     /protein_id="WP_000928794.1"
                     /translation="MLMKTTAVHAPASQGTSGIVLDSLRVAYHGNVVLKPLSLTIEPG
                     EVLALIGPSGSGKTTVLRAVAGFVQPAGGRILIGDTDVTHLPPYKRGLAMVVQNYALF
                     PHLKVEDNVAFGLRAQKQPKALINERVTQALKTVGMSDYATRYPHQLSGGQQQRVAIA
                     RAIAVRPRVLLLDEPLSALDAQIRHNMVEEIARLHRELPELTILYVTHDQTEALTLAD
                     KIGIMKDGSLIAHGETRALYHHPPNRFAAEFLGRANILSAIALGITEVPGLVDVSCGG
                     AVIRAFSQGSHHGYNKLLCIRPQHLSLTPRSAYSNRFNATLQSVHWQGDLTHLLCDVA
                     GETVRMVLTHVNPLPRVGDKLALWFEPDDAVLIEV"
     gene            complement(474347..475360)
                     /gene="phnS"
                     /locus_tag="STY_RS02165"
                     /old_locus_tag="STY0468"
     CDS             complement(474347..475360)
                     /gene="phnS"
                     /locus_tag="STY_RS02165"
                     /old_locus_tag="STY0468"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoethylphosphonate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_000778002.1"
                     /translation="MKLSRLALLSVFALASAPSWAESVVTVYSIDGLHDGDNSWYQVQ
                     FDAFTKATGITIRYVEGGGGVVVERLAKERTNPQADVLVTAPPFIQRAAAEKLLANFN
                     TDAASAIPDANNLYSPLVKNYLSFIYNSKLLKTAPASWQDLLDGKFKNKLQYSTPGQA
                     ADGTAVMLQAFHSFGSKDASFAYLGKLQANNVGPSASTGKLTALVNKGEIYVANGDLQ
                     MNLAQMERNPNVKIFWPANDKGERSALAIPYVIGLVQGAPQSENGKKLINFLLSKEAQ
                     TRVSELSWGMPVRSDVTPSDEHYKAATAALEGVQSWQPNWDDVAVSLSADISRWHKVT
                     ESE"
     gene            complement(475558..476277)
                     /gene="phnR"
                     /locus_tag="STY_RS02170"
                     /old_locus_tag="STY0469"
     CDS             complement(475558..476277)
                     /gene="phnR"
                     /locus_tag="STY_RS02170"
                     /old_locus_tag="STY0469"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate utilization transcriptional
                     regulator PhnR"
                     /protein_id="WP_000836268.1"
                     /translation="MKSIPGDIPQYLLIKAQLQARIQSGALKSGDKLPSERELCAIFN
                     TTRITIRESLAQLESSGLIWRADRRGWFVTPERLWLDPTQNTNFHKLCREQGREPKTA
                     LLSGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRAVCYCENHCLPARVPELLQYD
                     LNGSLTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRRLNYDQHGR
                     VLDLDIEYWRHDSLRIEVDTH"
     gene            476417..477520
                     /gene="phnW"
                     /locus_tag="STY_RS02175"
                     /old_locus_tag="STY0470"
     CDS             476417..477520
                     /gene="phnW"
                     /locus_tag="STY_RS02175"
                     /old_locus_tag="STY0470"
                     /EC_number="2.6.1.37"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoethylphosphonate--pyruvate transaminase"
                     /protein_id="WP_000203965.1"
                     /translation="MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIR
                     QQLTALATASEGYTSVLLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMVEMAGL
                     MGIAHHAYDCGEVARPNVQAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHR
                     YGKTYIVDAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGR
                     SRSLSLDLYAQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQ
                     RSLVAGMRALGFNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVS
                     QSDCFRIGNIGEVYAADITALLTAIRTAMYWTK"
     gene            477530..478339
                     /locus_tag="STY_RS02180"
                     /old_locus_tag="STY0471"
     CDS             477530..478339
                     /locus_tag="STY_RS02180"
                     /old_locus_tag="STY0471"
                     /EC_number="3.11.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonoacetaldehyde hydrolase"
                     /protein_id="WP_001079741.1"
                     /translation="MNRIHAVILDWAGTTVDFGSFAPTQIFVEAFRQAFDVEITLAEA
                     RVPMGLGKWQHIEALGKLPTVDARWQAKFGRAMSAADIDAIYAAFMPLQIAKVVDFSS
                     PIAGVIDTIATLRAEGIKIGSCSGYPRAVMERLVPAAAEHGYRPDHWVATDDLVAGGR
                     PGPWMALQNVIALGIDAVAHCVKVDDAAPGISEGLNAGMWTVGLAVSGNEFGATWDAY
                     QTMSKEDVAVRREHAASKLYAAGAHYVVDSLADLPEVIAHINARLAQGERP"
     gene            complement(478436..479026)
                     /gene="yajL"
                     /locus_tag="STY_RS02185"
                     /old_locus_tag="STY0472"
     CDS             complement(478436..479026)
                     /gene="yajL"
                     /locus_tag="STY_RS02185"
                     /old_locus_tag="STY0472"
                     /EC_number="3.5.1.124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein deglycase YajL"
                     /protein_id="WP_001275809.1"
                     /translation="MSAQALVCLAPGSEETEAVTTIDLLVRGGIHVTTASVASDGNLT
                     IVCSRGVKLLADAPLVEVADGDYDIIVLPGGIKGAECFRDSPLLVETVKQFHRSGRIV
                     AAICAAAATVLVPHDIFPIGNMTGFPALKDKIPAEQWQDKRVVWDARVKLLTSQGPGT
                     AIDFGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE"
     gene            complement(478989..479900)
                     /gene="panE"
                     /locus_tag="STY_RS02190"
                     /old_locus_tag="STY0473"
     CDS             complement(478989..479900)
                     /gene="panE"
                     /locus_tag="STY_RS02190"
                     /old_locus_tag="STY0473"
                     /EC_number="1.1.1.169"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="WP_000705818.1"
                     /translation="MKITVLGCGALGQLWLSALCKHGHDVQGWLRVPQPYCSVNLIDT
                     DGSFFNESLTANDPDFLAKSELLLVTLKAWQVSDAVRTLASTLPVTSPILLIHNGMGT
                     IEELQSIQQPMLMGAITHAARRDGNIIIHVANGTTHIGPAREQDGDYSYLAEILQGVL
                     PDVAWHNNIRAEMWRKLAVNCVINPLTALWNCPNGELRHHTDEINAICEEVAAVIERE
                     GYHTSADDLCYYVEQVIDSTAENISSMLQDVRAMRHTEIDYITGYLLKRARVHGLAVP
                     ENSRLFEMVKRKESEYERSGTGMPRPW"
     gene            480026..480517
                     /locus_tag="STY_RS02195"
                     /old_locus_tag="STY0474"
     CDS             480026..480517
                     /locus_tag="STY_RS02195"
                     /old_locus_tag="STY0474"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015965590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YajQ family cyclic di-GMP-binding protein"
                     /protein_id="WP_001138911.1"
                     /translation="MPSFDIVSEVDLQEARNGVDNAVREVESRFDFRGVEATIELNDA
                     NKTIKVLSESDFQVNQLLDILRAKLLKRGIEGASLDVPDEFVHSGKTWYVEAKLKQGI
                     ESAVQKKIVKLIKDSKLKVQAQIQGEEIRVTGKSRDDLQSVMALVRGDDLGQPFQFKN
                     FRD"
     gene            complement(480564..481928)
                     /locus_tag="STY_RS02200"
                     /old_locus_tag="STY0475"
     CDS             complement(480564..481928)
                     /locus_tag="STY_RS02200"
                     /old_locus_tag="STY0475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016507029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_001000935.1"
                     /translation="MNDYKMTPGELRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQG
                     ASEALIGIAIGIYGLAQAIFQIPFGLLSDRIGRKPLIVGGLAVFVAGSVIAALSHSIW
                     GIILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIVTH
                     SLGLNALFWMIAALATLGILLTIWVVPNSTNHVLNRESGMVKGSFSKVLAEPRLLKLN
                     FGIMCLHILLMSTFVALPGQLADAGFPAAEHWKVYLATMVIAFAAVVPFIIYAEVKRR
                     MKQVFLFCVGLIIVAEIVLWGAGQHFWELVIGVQLFFLAFNLMEALLPSLISKESPAG
                     YKGTAMGVYSTSQFLGVALGGSLGGWIDGTFDGQTVFLAGAVLAMVWLAVASTMKEPP
                     YVSSLRVEIPADIVADDRLKQRLLAMKGVSEALIVAEEHSAYVKIDSKVTNRFEVEQL
                     ISKG"
     gene            complement(<482159..482289)
                     /locus_tag="STY_RS02205"
                     /pseudo
     CDS             complement(<482159..482289)
                     /locus_tag="STY_RS02205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_032491235.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS5/IS1182 family transposase"
     gene            482464..483135
                     /locus_tag="STY_RS02210"
     CDS             482464..483135
                     /locus_tag="STY_RS02210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001672612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sel1 repeat family protein"
                     /protein_id="WP_000693738.1"
                     /translation="MKIKFLSLCILAGVLFANQVNASENNSKDDVKYAALTQKDFDAL
                     PVEKRASVLDELGFIHEYGLNVPMNREQALQYYKQACELGGNYGCYNVKYAYQHGDGV
                     AKDSAQANKYAKKMNLDNLLIEQEYIDKFSQEIYVAKALADMDKSQRAAFISILIHAL
                     NNRPESDALFLVVSDLIRKKRSALLRYGGRTAIHKWIINWGYSPLMISLAIMWMSLIK
                     PGRPR"
     gene            483132..483973
                     /locus_tag="STY_RS02215"
                     /pseudo
     CDS             483132..483973
                     /locus_tag="STY_RS02215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000870959.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="sel1 repeat family protein"
     gene            483985..484248
                     /locus_tag="STY_RS02220"
     CDS             483985..484248
                     /locus_tag="STY_RS02220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000595917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SEL1-like repeat protein"
                     /protein_id="WP_000595917.1"
                     /translation="MIKRKWNLLLLLGFSFASVCQAGDDIDALYSRIAQKDVQALNEL
                     KALAKDNNAQALAELGFIYEYGVAVPKDTIQAIKYYEQACHVE"
     gene            484300..485454
                     /locus_tag="STY_RS02225"
     CDS             484300..485454
                     /locus_tag="STY_RS02225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001150187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sel1 repeat family protein"
                     /protein_id="WP_001150187.1"
                     /translation="MQDDVLAKELADKTSKADIDTDAQTVTRLIADEIDTAKQAAESD
                     ITQRSRFIETLRQYAGGGSAMAARITRLGYSKADILHLAELWAQERDPELNFIVGSLY
                     DSGFVEVDDKEARSLQWFRKAAELGQADAQNILGYFYLNGKRGIKRDLQKGGQWYELA
                     AAQGNVDALINLGEIYYSGTRVPLDYARAFEFFERAAKMGKSRALNYLAWMYTNGQFV
                     DTDCRKAAELFAQGRTSFADDPHFQVTCEKDRQARAEAVAMREKNLPKLTFNRDRVFG
                     ASQGSGYACELEFVVKTDRVSSIENLRVSLALKNKAGAMSQQVIAFEPFGLNMQNRNL
                     QGYKSDTLRESTLQPIYQPEFCDVDSYSVTAVTGIVNGKEMDILKAGIFI"
     gene            complement(485502..486392)
                     /gene="cyoE"
                     /locus_tag="STY_RS02230"
                     /old_locus_tag="STY0481"
     CDS             complement(485502..486392)
                     /gene="cyoE"
                     /locus_tag="STY_RS02230"
                     /old_locus_tag="STY0481"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="WP_000971351.1"
                     /translation="MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLV
                     GVSLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPGVSLVYATLLGIAGFMLLW
                     FGANPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDS
                     GAAILLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVIKGISVAKNHITLYIIAFAV
                     ATLMLTLGGYAGYKYLVVAAAVSVWWLGMALRGYKVEDDKVWARKLFGFSIIAITALS
                     IMMSVDFMVPNSQNLLTYVW"
     gene            complement(486404..486733)
                     /locus_tag="STY_RS02235"
                     /old_locus_tag="STY0482"
     CDS             complement(486404..486733)
                     /locus_tag="STY_RS02235"
                     /old_locus_tag="STY0482"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase subunit IV"
                     /protein_id="WP_000019878.1"
                     /translation="MSHSTESGGASHGSVKTYMTGFILSVILTVIPFWMVMTGAASPA
                     VILGSILAMAVVQILVHLVCFLHMNTKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNL
                     NYNMMMH"
     gene            complement(486733..487347)
                     /locus_tag="STY_RS02240"
                     /old_locus_tag="STY0483"
     CDS             complement(486733..487347)
                     /locus_tag="STY_RS02240"
                     /old_locus_tag="STY0483"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase subunit III"
                     /protein_id="WP_000179831.1"
                     /translation="MATDTLTHATAHAHEHGHHDAGQNKIFGFWVYLMSDCILFSILF
                     ATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMHKNNKSQVISWL
                     ALTFLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVL
                     MVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM"
     gene            complement(487337..489328)
                     /gene="cyoB"
                     /locus_tag="STY_RS02245"
                     /old_locus_tag="STY0484"
     CDS             complement(487337..489328)
                     /gene="cyoB"
                     /locus_tag="STY_RS02245"
                     /old_locus_tag="STY0484"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002444673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase subunit I"
                     /protein_id="WP_000467158.1"
                     /translation="MFGKLSLDAVPFHEPIVMVTIAAIIVGGLAILAAITYFGKWTYL
                     WKEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQI
                     FTAHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNLSL
                     GVGEFAQTGWLAYPPLSGIEYSPSVGVDYWIWALQLSGIGTTLTGINFFVTILKMRAP
                     GMTMFKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYI
                     NLIWAWGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHH
                     FFTMGAGANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMMWTIGFIVTFS
                     VGGMTGVLLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNE
                     TWGKRAFWFWIIGFFVAFMPLYVLGFMGMTRRLSQQIDPQFHTMLMVAAAGAALIALG
                     ILCQLIQIFVSIRDRDQNRDLTGDPWGGRTLEWSTSSPPPFYNFAVVPHVHERDAFWE
                     MKEKGEAYQQPGQYEEIHMPKNSGAGIVIAAFATVFGFAMIWHIWWLAIVGFAGMIIS
                     WIVKSFDEDVDYYVPVPEVEKLENQHFDEITKAGLKNGN"
     gene            complement(489339..490295)
                     /gene="cyoA"
                     /locus_tag="STY_RS02250"
                     /old_locus_tag="STY0485"
     CDS             complement(489339..490295)
                     /gene="cyoA"
                     /locus_tag="STY_RS02250"
                     /old_locus_tag="STY0485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase subunit II"
                     /protein_id="WP_001239449.1"
                     /translation="MRLRKYNKSLGWLSLIAGTALLSGCNSALLDPKGQIGLEQRSLI
                     LTAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIF
                     LAVLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTP
                     VYFKVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGM
                     KFKAIATKDRAEFDQWVAKAKQSPNTMNDMAAFEKVAMPSEYNKVEYFSSVKPDLFKD
                     VINKFMGHGKSMDMTQPEGEHSSHEGMEGMDMSHAESANSKG"
     gene            complement(490748..492223)
                     /gene="ampG"
                     /locus_tag="STY_RS02255"
                     /old_locus_tag="STY0486"
     CDS             complement(490748..492223)
                     /gene="ampG"
                     /locus_tag="STY_RS02255"
                     /old_locus_tag="STY0486"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="muropeptide MFS transporter AmpG"
                     /protein_id="WP_000098484.1"
                     /translation="MSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVENI
                     DLKTIGFFSLVGQAYVFKFLWSPLMDRYTPPFLGRRRGWLLATQLLLLAAIAAMGFLE
                     PGTQLRWMAALAVVIAFCSASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSG
                     GLALWLADRWLGWQGMYWLMAALLIPCIIATLLAPEPTDTIPSPKSLEQAVVAPLRDF
                     FGRNNAWLILLLIVLYKLGDAFAMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGA
                     LYGGILMQRLSLFRALLIFGILQGASNAGYWLLSITDKNMFSMGAAVFFENLCGGMGT
                     AAFVALLMTLCNKSFSATQFALLSALSAVGRVYVGPVAGWFVEAHGWPTFYLFSVVAA
                     VPGLLLLLVCRQTLEYSWQSERFIPRTQYRGTYNFALSILLAGVALLAVWVLLLTMNA
                     LDYTNFSFLPELLETAVAIAVCGIVFGGLLDYLALRKTRLL"
     gene            complement(492267..492845)
                     /locus_tag="STY_RS02260"
                     /old_locus_tag="STY0487"
     CDS             complement(492267..492845)
                     /locus_tag="STY_RS02260"
                     /old_locus_tag="STY0487"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016535187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_001539323.1"
                     /translation="MLKKLLFPLVALFMLAGCATPPTTIDVAPKITLPQQDPSLMGVT
                     VSITGADQRQDQALAKVTRNNQLVTLTASRDLRFLLQEVLEKQMTARGYMIGPNGAVN
                     LQIIVNQLYADVSQGSVRYNIATKADIAIIATAANGNKMTKNYRANYSIEGAFQASNQ
                     NIADAVNSVLTDTIADMSQDTSIHDFIKQNAR"
     gene            493149..493466
                     /gene="bolA"
                     /locus_tag="STY_RS02265"
                     /old_locus_tag="STY0488"
     CDS             493149..493466
                     /gene="bolA"
                     /locus_tag="STY_RS02265"
                     /old_locus_tag="STY0488"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator BolA"
                     /protein_id="WP_000973433.1"
                     /translation="MMIREQIEEKLRTAFDPVFLEVVDESYRHNVPAGSESHFKVVLV
                     SDRFTGERFLNRHRMIYGTLTAELSTTVHALALHTYTLKEWEGLQDTIFASPPCRGAG
                     SIA"
     gene            493813..495111
                     /gene="tig"
                     /locus_tag="STY_RS02270"
                     /old_locus_tag="STY0489"
     CDS             493813..495111
                     /gene="tig"
                     /locus_tag="STY_RS02270"
                     /old_locus_tag="STY0489"
                     /EC_number="5.2.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001716227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="WP_001198406.1"
                     /translation="MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGF
                     RKGKVPMNIVAQRYGASVRQDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEYKVGED
                     FTYSVEFEVYPEVELTGLESIEVEKPVVEVTDADVDVMLDTLRKQQATWKEKDGAADA
                     EDRVTIDFTGSVDGEEFEGGKATDFVLAMGQGRMIPGFEDGVKGHKAGEEFTIDVTFP
                     EEYHAENLKGKAAKFVINLKKVEERELPELTEEFIKRFGVEDGSVAGLRAEVRKNMER
                     ELKGAVRNRVKSQAIEGLVKANDIDVPSALIDSEIDVLRRQAAQRFGGNEKQALELPR
                     ELFEEQAKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNK
                     ELMDNMRNVALEEQAVEAVLAKAKVSEKATSFNELMNQQA"
     gene            495358..495981
                     /gene="clpP"
                     /locus_tag="STY_RS02275"
                     /old_locus_tag="STY0490"
     CDS             495358..495981
                     /gene="clpP"
                     /locus_tag="STY_RS02275"
                     /old_locus_tag="STY0490"
                     /EC_number="3.4.21.92"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp endopeptidase proteolytic
                     subunit ClpP"
                     /protein_id="WP_000122257.1"
                     /translation="MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIF
                     LTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVS
                     TICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVK
                     GRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
     gene            496233..497504
                     /gene="clpX"
                     /locus_tag="STY_RS02280"
                     /old_locus_tag="STY0491"
     CDS             496233..497504
                     /gene="clpX"
                     /locus_tag="STY_RS02280"
                     /old_locus_tag="STY0491"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001396736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease ATP-binding subunit ClpX"
                     /protein_id="WP_000130316.1"
                     /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLC
                     NDIIREEIKEVAPHRERSALPTPHEIRTHLDDYVIGQEQAKKVLAVAVYNHYKRLRNG
                     DTSNGVELGKSNILLTGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVEN
                     IIQKLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGT
                     VAAVPPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVIANRVETGSGIGFGATVKA
                     KSDKASEGELLSQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALVQILKEPKNALT
                     KQYQALFNLEGVDLEFRDEALNAIARKAMARKTGARGLRSIVEAALLDTMYDLPSMED
                     VEKVVIDESVIAGQSKPLLIYGKPEAQASGE"
     gene            497690..500044
                     /gene="lon"
                     /locus_tag="STY_RS02285"
                     /old_locus_tag="STY0492"
     CDS             497690..500044
                     /gene="lon"
                     /locus_tag="STY_RS02285"
                     /old_locus_tag="STY0492"
                     /EC_number="3.4.21.53"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001469947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endopeptidase La"
                     /protein_id="WP_001067728.1"
                     /translation="MNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAM
                     DHDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISA
                     LSDNGEHFSAKAEYLDSPAIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSID
                     DPARLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVK
                     KQMEKSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKEAKEKAEAELQ
                     KLKMMSPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHYGLERVKDRI
                     LEYLAVQSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYVRMALGGVRDEAEIR
                     GHRRTYIGSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNV
                     AFSDHYLEVDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLP
                     KQIERNALKKGELTVDDSAIIGIIRYYTREAGVRSLEREISKLCRKAVKQLLLDKSLK
                     HIEINGDNLHDYLGVQRFDYGRADSENRVGQVTGLAWTEVGGDLLTIETACVPGKGKL
                     TYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGI
                     AMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFEN
                     KRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEPSGMQVVTAK"
     gene            500253..500525
                     /gene="hupB"
                     /locus_tag="STY_RS02290"
                     /old_locus_tag="STY0493"
     CDS             500253..500525
                     /gene="hupB"
                     /locus_tag="STY_RS02290"
                     /old_locus_tag="STY0493"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016535194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein HU-beta"
                     /protein_id="WP_001043544.1"
                     /translation="MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVAL
                     VGFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
     gene            500816..502687
                     /gene="ppiD"
                     /locus_tag="STY_RS02295"
                     /old_locus_tag="STY0494"
     CDS             500816..502687
                     /gene="ppiD"
                     /locus_tag="STY_RS02295"
                     /old_locus_tag="STY0494"
                     /EC_number="5.2.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_000969436.1"
                     /translation="MMDSLRTAANSLVLKIIFVIIIVSFILTGVSGYLIGGSNNYAAK
                     VNGQEISRAQFENAFNNERNRMQQQLGDRYSELAANEGYMKSLRQQVLNRLIDEALLD
                     QYSRELKLGISDEQVKQAIFATPAFQVDGKFDNNRYNAIVNQMGMTADQYTQALRNQL
                     TTQQLINGVAGTDFMLKGETDELAALVSQQRVVREAVIDVNALAAKQQVTDQEVSSYY
                     DQNKVRFMTPEQFRVSYIKLDAATMQAPVSDADIQAYYDQHVDQFTQPERIRYSIIQT
                     KTEDDAKAVLDALNKGEDFATLAKEKSTDIISARNGGDMGWLEESATVPELKNAGLKE
                     KGQISGVIKSSVGFLVARLDDIQPAKVKPLSEVRDDIAAKVKQEKALDAYYALQQKVS
                     DAASNDNESLAGAEQVAGVKAVETGWFSRDTLPEELNFKPVADAIFNGGLVGENGTPG
                     PNSDIITVDGDRAFVVRVSEHKPEAVKPLAEVKEQVTALVKHNKAEQQAKLDAEKLLV
                     ELKAGKGAEAMKAAGLSFGEPKTLSRTSQDPVSQAAFALSLPTKDKPVYGVANDMQGN
                     VVLLAFDEVKAGAMPEAQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
     gene            502837..503211
                     /locus_tag="STY_RS02300"
                     /old_locus_tag="STY0495"
     CDS             502837..503211
                     /locus_tag="STY_RS02300"
                     /old_locus_tag="STY0495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-hairpin-helix domain-containing protein"
                     /protein_id="WP_000680322.1"
                     /translation="MKHGIKALLITLSLTCAGMAHSALAATPVAKNAAVETKADTPSS
                     SSAKAALPAKASDDEGTRVSINTASAEDLARVMNGVGLKKAQAIVSYREEYGPFKTVD
                     DLKQVPGMGSALVERNLAVLTL"
     gene            503315..503713
                     /gene="fadM"
                     /locus_tag="STY_RS02305"
                     /old_locus_tag="STY0496"
     CDS             503315..503713
                     /gene="fadM"
                     /locus_tag="STY_RS02305"
                     /old_locus_tag="STY0496"
                     /EC_number="3.1.2.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain acyl-CoA thioesterase FadM"
                     /protein_id="WP_001194543.1"
                     /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWM
                     TARNIAFVVVNININYRRPAVLSDLLTVTSQVQQLNGKSGVLSQTITLEPEGQVVADA
                     LITFVCIDLKTQKALPLEGELREKLEQMVQ"
     gene            complement(503820..504515)
                     /gene="queC"
                     /locus_tag="STY_RS02310"
                     /old_locus_tag="STY0497"
     CDS             complement(503820..504515)
                     /gene="queC"
                     /locus_tag="STY_RS02310"
                     /old_locus_tag="STY0497"
                     /EC_number="6.3.4.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-cyano-7-deazaguanine synthase QueC"
                     /protein_id="WP_000817201.1"
                     /translation="MKRAVVVFSGGQDSTTCLAQARHQYDEVHCVTFDYGQRHRAEID
                     VARALALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPNADGIPNTFVPGRNIL
                     FLTLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVNLGMAKDIRFETPL
                     MWIDKAETWALADYWGQLDLVREETLTCYNGIKGDGCGHCAACNLRANGLNHYLSNKA
                     AVMAAMKQKTGLR"
     gene            complement(504580..506280)
                     /locus_tag="STY_RS02315"
                     /old_locus_tag="STY0498"
     CDS             complement(504580..506280)
                     /locus_tag="STY_RS02315"
                     /old_locus_tag="STY0498"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SgrR family transcriptional regulator"
                     /protein_id="WP_001238179.1"
                     /translation="MRLLNRLNQYQRLWQPSAGETQHVTVSELAERCFCSERHLRTLL
                     RQAQQAGWLRWEAQSGRGKRGRLQFLVTPESLRTAMMEQALEKGQQLNVLELAQLAPG
                     ELRAMLQPFMGGQWQNDTPTLRIPYYRPLDPLQPGFLPGRAEQHLAGQVFSGLTRFDR
                     DSQYPCGDLAHHWKVSADGLRWDFYIRSTLHWHNGDAVDTAQLHERLERLLTLPALSK
                     LFISVARIEVTHPQCLTFLLHRPDYWLAHRLASYCSGLAHPDLPLIGTGPFRLALFTP
                     ELVRLESHDHYHLSHPLLKAIEFWITPQLFAQDLGTSCRHPVQIAIGKPEELATLSQV
                     SSGISLGFCYLTLKKGSRLNVQQARRLIHIIHHTSLLKTLPVDENLIMPSQGLLPGWT
                     IPQWQDVDETPLPKKLTLAYHLPVELHTMAEQLRHYLATLGCELTLIFHNAKNWNNCP
                     ALAQADLMMGDRLIGEAPEYTLEQWLRCDQIWSHVLDAPAFSHLQATLDALQIQPNEK
                     DRRAALQQVFANLMDDATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFSEAWLPPPSP
                     "
     gene            506380..507198
                     /gene="cof"
                     /locus_tag="STY_RS02320"
                     /old_locus_tag="STY0499"
     CDS             506380..507198
                     /gene="cof"
                     /locus_tag="STY_RS02320"
                     /old_locus_tag="STY0499"
                     /EC_number="3.6.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HMP-PP phosphatase"
                     /protein_id="WP_000113040.1"
                     /translation="MARLAAFDMDGTLLMPDHHLGRETIATLSRLRERDITLTFATGR
                     HVLEMRHILGTLSLDAYLITGNGTRIHSLEGDVLHRQDLDPQVADTVMHHAWDTRASM
                     HVFNDNGWFTGQEIPALLQAHVYSGFRYQVIDIKSIPAHQVTKICFCGDHDDLIRLRI
                     QLNEALEERAHLCFSAVDCLEVLPLGCNKGSALAVLSNHLGLSLADCMAFGDAMNDRE
                     MLGSVGRGLIMGNAMPQLIAALPHLSVIGHCGNQAVSHFLTHWLDNPHLPYSPE"
     gene            507246..507428
                     /locus_tag="STY_RS02325"
     CDS             507246..507428
                     /locus_tag="STY_RS02325"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000431186.1"
                     /translation="MENPQLGWGFRKAFSFKPVIKTPFDLLKHLAVWQLQKFNKKSKG
                     GPNEGRKELSAHPMEL"
     gene            507385..507843
                     /gene="tnpA"
                     /locus_tag="STY_RS02330"
                     /old_locus_tag="STY0500"
     CDS             507385..507843
                     /gene="tnpA"
                     /locus_tag="STY_RS02330"
                     /old_locus_tag="STY0500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605 family transposase"
                     /protein_id="WP_010989125.1"
                     /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKL
                     CEWKNVRILEAECCADHIHMLLEIPTKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRN
                     REFWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLSIPYPGSLFTGRK"
     gene            complement(507959..509014)
                     /locus_tag="STY_RS02335"
                     /old_locus_tag="STY0501"
     CDS             complement(507959..509014)
                     /locus_tag="STY_RS02335"
                     /old_locus_tag="STY0501"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PLP-dependent cysteine synthase family protein"
                     /protein_id="WP_000987843.1"
                     /translation="MMSSNWVKNAINEINADHQRSADTHLIRLPLSAFPGIQLYLKDE
                     STHPTGSLKHRLARSLFLYGLCNGWIKEDTPIIEASSGSTAISEAWFARLLGLPFIAA
                     MPACTAKRKIEQIQFYGGHCHFVESACEIYAASERLAHELNGHYMDQFTYAERATDWR
                     GNNNIADSIFRQMRNEPHPVPRFIVMSAGTGGTSATIGRYIRCQGYDTQLMVVDPENS
                     VFLPYWQDRDASLRSPVGSKIEGIGRPRVEPSFIPDVVDEMLRVPDAASVATAHWLET
                     QLGRKVGASTGTNMWGALQLAARMREAGETGAIVTLLCDSGDRYLDTYYHPAWVSDHI
                     GDLTPWSAAIAKLLTGD"
     gene            509127..509585
                     /gene="decR"
                     /locus_tag="STY_RS02340"
                     /old_locus_tag="STY0502"
     CDS             509127..509585
                     /gene="decR"
                     /locus_tag="STY_RS02340"
                     /old_locus_tag="STY0502"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator DecR"
                     /protein_id="WP_000884593.1"
                     /translation="MLDKIDRKLLCLLQQDCTLSLQALADAVNLTTTPCWKRLKRLED
                     DGILLGRVALLDPEKLGLGLTAFVLIKTQHHSSEWYCRFVTVVSEMPEVLGFWRMAGE
                     YDYLMRVQVADMKRYDDFYKRLVNSVPGLSDVTSSFAMEQIKYTTSLPIE"
     gene            509626..511398
                     /locus_tag="STY_RS02345"
                     /old_locus_tag="STY0503"
     CDS             509626..511398
                     /locus_tag="STY_RS02345"
                     /old_locus_tag="STY0503"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SmdA family multidrug ABC transporter
                     permease/ATP-binding protein"
                     /protein_id="WP_001235563.1"
                     /translation="MRLFAQLSWYFRREWRRYLGAVALLMLIAMLQLIPPKVVGIVVD
                     GVTAQHFTPGRIAMWIGTIALIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSR
                     QHPEFYQRHRTGDLIARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIVMSTQISWQL
                     TLLALLPMPIMALMIKRYGDRLHDYFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDR
                     QSSLFAADAEDTGKKNMRVARIDARFDPTIYIAIGMANLLAISGGSWMVVNGSLTLGE
                     LTSFMMYLGLMIWPMLALAWMFNIVERGSAAYSRIRAMLAEAPVVKDGEEPVPAGRGE
                     LTAAIREFCYPQTTHPALENVNFRLKPGQMLGICGPTGAGKSTILSLIQRHFDVTQGE
                     IRFHDMPLTHLQLDSWRSRLAVVSQTPFLFSDSIANNIALGRPEATQEEIERVARLAS
                     VHEDILRLPQGYDTQVGERGVMLSGGQKQRISIARALLLNAEILLLDDALSAVDGRTE
                     HQILHNLRQWGEGRTVIISAHRLSALTDANEIIVMQHGHVVQRGDHDQLAQQIGWYRD
                     MYRYQQLEAALDDAPERGEEAVNA"
     gene            511391..513172
                     /locus_tag="STY_RS02350"
                     /old_locus_tag="STY0504"
     CDS             511391..513172
                     /locus_tag="STY_RS02350"
                     /old_locus_tag="STY0504"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SmdB family multidrug efflux ABC transporter
                     permease/ATP-binding protein"
                     /protein_id="WP_001256093.1"
                     /translation="MRSFGQLWPTLKRLLAYGSPWRKPLSVAVMMLWIAVAAEVSGPL
                     LISYFIDNMVARHHLPLGKVAGLAAAYVGLQFLAAGLHYAQSLLFNRAAVGVVQSLRT
                     DVMDAALRQPLSAFDTQPVGQLISRVTNDTEVIRDLYVTVVATVLRSAALIGAMLVAM
                     FSLDWRMALVAVLIFPAVLTVMVIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQ
                     QFRQQARFGERMGEASRSHYMARMQTLRLDGFLLRPLLSLFSALILCGLLMLFSFTSA
                     GTIEVGVLYAFISYLSRLNEPLIELTTQQSMLQQAVVAGERVFELMDRPRQRYGSDDR
                     PLQSGAIDIDHLSFAYRDDNLVLQDITLSVPSRSFVALVGHTGSGKSTLASLLMGYYP
                     LTQGEIRLDGREIASLNHRVLRQGVAMVQQDPVVMADTFLANVTLGRDVSEAQVWQAL
                     ETVQLADLARGLSDGLHTHLGEQGNTLSVGQKQLLALARVLVDAPQILILDEATASID
                     SGTEQAIQQALAAIRERTTLVVIAHRLSTIVEADTILVLYRGQAVERGTHQQLLAAQG
                     RYWQMYQLQLVGEELAASVHEESGPTA"
     gene            513385..513723
                     /gene="glnK"
                     /locus_tag="STY_RS02355"
                     /old_locus_tag="STY0506"
     CDS             513385..513723
                     /gene="glnK"
                     /locus_tag="STY_RS02355"
                     /old_locus_tag="STY0506"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-II family nitrogen regulator"
                     /protein_id="WP_000780341.1"
                     /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAE
                     LYRGAEYSVNFLPKVKIDVAIADDQLEEVIDIISKAAYTGKIGDGKIFVAELMRVIRI
                     RTGEADEAAL"
     gene            513755..515041
                     /gene="amtB"
                     /locus_tag="STY_RS02360"
                     /old_locus_tag="STY0507"
     CDS             513755..515041
                     /gene="amtB"
                     /locus_tag="STY_RS02360"
                     /old_locus_tag="STY0507"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter AmtB"
                     /protein_id="WP_000684912.1"
                     /translation="MKIAMIKTTLASLALLPGLTIAAPAVADKADSAFMMICTALVLF
                     MTIPGIALFYGGLIRAKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNHFFGNADG
                     AMLKNIALTAVTGTIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWFTL
                     SYIPIAHMVWGGGLLAAHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPH
                     NLPMVFTGTAILYIGWFGFNAGSAGSANEIAALAFVNTVVATAAAILGWIIGEWTLRG
                     KPSLLGACSGAIAGLVGVTPACGYVGVGGALVIGVIAGLAGLWGVTMLKRLLRVDDPC
                     DVFGVHGVCGIVGCILTGVFAASSLGGVGFVDGVTMGHQVMVQLESIAITVVWSGVVA
                     FVGYKLADILVGLRVPEEQEREGLDVNSHGENAYNA"
     gene            complement(515141..516001)
                     /gene="tesB"
                     /locus_tag="STY_RS02365"
                     /old_locus_tag="STY0508"
     CDS             complement(515141..516001)
                     /gene="tesB"
                     /locus_tag="STY_RS02365"
                     /old_locus_tag="STY0508"
                     /EC_number="3.1.2.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA thioesterase II"
                     /protein_id="WP_000084179.1"
                     /translation="MSQTLNNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQAL
                     YAAKETVPEARLVHSFHSYFLRPGDSQKPIIYDVEVLRDGNSFSARRVAAIQNGKPIF
                     YMTASFQAPEPGFEHQKTMPTAVGPEGLPSETEIAQSLAHLLPPILKEKFLCDRPLEI
                     RPVEFHNPLKGHVSAPVRQVWIRANGTVPDDIRVHQYLLGYASDLNFLPVALQPHGIG
                     FLEKGIQIATIDHSMWFHRPFNFNEWLLYSVESTSASSARGFVRGEFYTQDGALVAST
                     VQEGVMRNHN"
     gene            516216..516785
                     /locus_tag="STY_RS02370"
                     /old_locus_tag="STY0509"
     CDS             516216..516785
                     /locus_tag="STY_RS02370"
                     /old_locus_tag="STY0509"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YbaY family lipoprotein"
                     /protein_id="WP_000779802.1"
                     /translation="MKLVHIVSGLAVAISLAACADKSADIQTPAPNPNMSITANQSTI
                     QQPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLSQKAVRTEGKQAPFSFVL
                     PFNPSDIQPNARILLSAAITVDNKLVFITDSVKPVINNGGTKADLTLVPVQQTAVPVQ
                     ASGGATTTVPSTSPTQVNPSSAVPAPTQY"
     gene            complement(516818..517207)
                     /locus_tag="STY_RS02375"
                     /old_locus_tag="STY0510"
     CDS             complement(516818..517207)
                     /locus_tag="STY_RS02375"
                     /old_locus_tag="STY0510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MGMT family protein"
                     /protein_id="WP_000961285.1"
                     /translation="MLVSCASGLSSPLIPDYPEALTQDSIMDIQDTFPQRVWQIVASI
                     PEGFVTTYGDVARLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGAISLTGPDLQR
                     QRQALLAEGVVVSGSGQIDLQRYRWVY"
     gene            517292..517388
                     /gene="ffs"
                     /locus_tag="STY_RS02380"
                     /old_locus_tag="STYs001"
     ncRNA           517292..517388
                     /ncRNA_class="SRP_RNA"
                     /gene="ffs"
                     /locus_tag="STY_RS02380"
                     /old_locus_tag="STYs001"
                     /product="signal recognition particle sRNA small type"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00169"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00169"
     gene            complement(517438..518988)
                     /locus_tag="STY_RS02385"
                     /old_locus_tag="STY0511"
     CDS             complement(517438..518988)
                     /locus_tag="STY_RS02385"
                     /old_locus_tag="STY0511"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_000213129.1"
                     /translation="MTTRHLVSLVTGVLILSVLFPIGLSLWLAHRQVEKRFNEELDIF
                     SSRVALRTERVSDQAKAALTHIASFKGEPCSSAHLLAMRRVSYSFRYVQEVLYLKNSI
                     PVCSSLEKESHIPAFPPPMKITRDGYRAWFTAQNDLGIKRYMAALGSDSYIVMIDPAS
                     FIDVIPFGAWPIDVAIIGRERNTVVASSGNLDHAILPLIHHETPLRLENRGIQYAIHP
                     FPEMGITIVSWAPTAPLERSWYRQAFIWLPAGIVTGLLAAAFILRILRRLQSPRHRLQ
                     DAIDNREINVHYQPIVSLSSGKIVGAEALARWQQADGTFLSPEIFIALAEQTGLTEPL
                     TRLIIDTVFEDMGSWLKSHPEQHISINLEASDLASETLPTLLSTLLNRSQISPSQIAL
                     ELTEREFADPKTSAPIVARYRNAGHSIYIDDFGTGYSSLSYLQNLDVDVLKIDKSFVD
                     ALEYKNVTPHIIEMAKTLKLKMVAEGIETTRQEQWLRQHGVHYGQGWLYSKPLPATAF
                     ILWVEQRL"
     gene            519213..519473
                     /locus_tag="STY_RS02390"
                     /old_locus_tag="STY0512"
     CDS             519213..519473
                     /locus_tag="STY_RS02390"
                     /old_locus_tag="STY0512"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type B 50S ribosomal protein L31"
                     /protein_id="WP_000801415.1"
                     /translation="MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIELDGVTYPY
                     VTIDVSSKSHPFYTGRQKTFDSESSAARFQKRFGHFIGAKRG"
     gene            519479..519619
                     /gene="rpmJ"
                     /locus_tag="STY_RS02395"
                     /old_locus_tag="STY0513"
     CDS             519479..519619
                     /gene="rpmJ"
                     /locus_tag="STY_RS02395"
                     /old_locus_tag="STY0513"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="WP_001197749.1"
                     /translation="MQVLNSLRNAKQRHPDCQIVKRKGRLYVICKTNPRFKAVQGRKK
                     RR"
     gene            complement(519675..520145)
                     /locus_tag="STY_RS02400"
                     /old_locus_tag="STY0514"
     CDS             complement(519675..520145)
                     /locus_tag="STY_RS02400"
                     /old_locus_tag="STY0514"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000136183.1"
                     /translation="MTEIQRLLSETIDDLNVREKRDNRPRFSISFIRKHPGLFIAMYA
                     AWFATLAVMLQSETLVGSVWLLVVLFIAFNGFFFFDIAPRYHYNDIDVLDLRVCYNGE
                     WYNTRFVPPTLIETILQSPQVDNEHKVQLQKMVARKGELSFYDIFTLARAEASR"
     gene            complement(520263..520814)
                     /gene="maa"
                     /locus_tag="STY_RS02405"
                     /old_locus_tag="STY0515"
     CDS             complement(520263..520814)
                     /gene="maa"
                     /locus_tag="STY_RS02405"
                     /old_locus_tag="STY0515"
                     /EC_number="2.3.1.79"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose O-acetyltransferase"
                     /protein_id="WP_001278793.1"
                     /translation="MSDEKQKMIAGALYCPTDETLCQDRLRARQLIHQYNYTTPDEIN
                     KRQAILRDLLGRCEDAYIEPSFRCDYGYNIFLGHSFYANFDCVMLDVCPIHIGDNCML
                     APGVHIYTATHPLDAVERNSGRELGKPVTIGNNVWIGGRAVVNPGVTIGDNVVVASGA
                     VVTKNVPPDVVVGGNPARIIKKL"
     gene            complement(520993..521211)
                     /gene="hha"
                     /locus_tag="STY_RS02410"
                     /old_locus_tag="STY0516"
     CDS             complement(520993..521211)
                     /gene="hha"
                     /locus_tag="STY_RS02410"
                     /old_locus_tag="STY0516"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin expression modulator Hha"
                     /protein_id="WP_001280991.1"
                     /translation="MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFY
                     SAADHRLAELTMNKLYDKIPSSVWKFIR"
     gene            complement(521239..521613)
                     /gene="tomB"
                     /locus_tag="STY_RS02415"
                     /old_locus_tag="STY0517"
     CDS             complement(521239..521613)
                     /gene="tomB"
                     /locus_tag="STY_RS02415"
                     /old_locus_tag="STY0517"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001741190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hha toxicity modulator TomB"
                     /protein_id="WP_000344807.1"
                     /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAV
                     NLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYLDDTFMLFSSYGINTQDLQKWRK
                     SGNRLFRCFVNATRANPVSLSC"
     gene            complement(522109..525258)
                     /locus_tag="STY_RS02420"
                     /old_locus_tag="STY0519"
     CDS             complement(522109..525258)
                     /locus_tag="STY_RS02420"
                     /old_locus_tag="STY0519"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter permease
                     subunit"
                     /protein_id="WP_001132507.1"
                     /translation="MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVT
                     ISATYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADI
                     AQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAA
                     NMKDPISRTSGVGDVQLFGSQYAMRIWMNPTELTKYQLTPVDVINAIKAQNAQVAAGQ
                     LGGTPPVKGQQLNASIIAQTRLTSTDEFGKILLKVNQDGSQVRLRDVAKIELGGENYD
                     VIAKFNGQPASGLGIKLATGANALDTATAIRAELKKMEPFFPPGMKIVYPYDTTPFVK
                     ISIHEVVKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINT
                     LTMFGMVLAIGLLVDDAIVVVENVERVMTEEGLPPKEATRKSMGQIQGALVGIAMVLS
                     AVFIPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPVAKGDHGEG
                     KKGFFGWFNRLFDKSTHHYTDSVGNILRSTGRYLLLYLIIVVGMAYLFVRLPSSFLPD
                     EDQGVFLTMVQLPAGATQERTQKVLDEVTDYYLNKEKANVESVFAVNGFGFAGRGQNT
                     GIAFVSLKDWADRPGEKNKVEAITQRATAAFSQIKDAMVFAFNLPAIVELGTATGFDF
                     ELIDQAGLGHEKLTQARNQLFGEVAKYPDLLVGVRPNGLEDTPQFKIDIDQEKAQALG
                     VSISDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDINDWYVRGSDGQM
                     VPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMAMMEELASKLPSGIG
                     YDWTGMSYQERLSGNQAPALYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALL
                     AATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDKEGKGLVEAMLEAVRMRL
                     RPILMTSLAFMLGVMPLVISSGAGSGAQNAVGTGVLGGMVTATVLAIFFVPVFFVVVR
                     RRFSRKSEDIEHSHSTEHR"
     gene            complement(525281..526474)
                     /gene="acrA"
                     /locus_tag="STY_RS02425"
                     /old_locus_tag="STY0520"
     CDS             complement(525281..526474)
                     /gene="acrA"
                     /locus_tag="STY_RS02425"
                     /old_locus_tag="STY0520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter periplasmic
                     adaptor subunit AcrA"
                     /protein_id="WP_001039199.1"
                     /translation="MNKNRGLTPLAVVLMLSGSLALTGCDDKQDQQGGQQMPEVGVVT
                     LKTEPLQITTELPGRTVAYRIAEVRPQVSGIILKRNFVEGSDIEAGVSLYQIDPATYQ
                     ATYDSAKGDLAKAQAAANIAELTVKRYQKLLGTQYISKQEYDQALADAQQATAAVVAA
                     KAAVETARINLAYTKVTSPISGRIGKSSVTEGALVQNGQASALATVQQLDPIYVDVTQ
                     SSNDFLRLKQELANGSLKQENGKAKVDLVTSDGIKFPQSGTLEFSDVTVDQSTGSITL
                     RAIFPNPDHTLLPGMFVRARLQEGTKPTALLVPQQGVTRTPRGDATVLVVGADNKVET
                     RQIVASQAIGDKWLVTDGLKAGDRVVVSGLQKVRPGAQVKVQEITADNKQQAASGDQP
                     AQPRS"
     gene            526616..527269
                     /gene="acrR"
                     /locus_tag="STY_RS02430"
                     /old_locus_tag="STY0521"
     CDS             526616..527269
                     /gene="acrR"
                     /locus_tag="STY_RS02430"
                     /old_locus_tag="STY0521"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux transporter transcriptional
                     repressor AcrR"
                     /protein_id="WP_000101755.1"
                     /translation="MARKTKQQALETRQHILDVALRLFSQQGVSATSLAEIANAAGVT
                     RGAIYWHFKNKSDLFSEIWELSESNIGELEIEYQAKFPDDPLSVLREILVHILEATVT
                     EERRRLLMEIIFHKCEFVGEMVVVQQAQRSLCLESYDRIEQTLKHCINAKMLPENLLT
                     RRAAILMRSFISGLMENWLFAPQSFDLKKEARAYVTILLEMYQLCPTLRASTVNGSP"
     gene            527388..530750
                     /gene="mscK"
                     /locus_tag="STY_RS02435"
                     /old_locus_tag="STY0522"
     CDS             527388..530750
                     /gene="mscK"
                     /locus_tag="STY_RS02435"
                     /old_locus_tag="STY0522"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive channel MscK"
                     /protein_id="WP_000178244.1"
                     /translation="MTMLQLYKRSQHFVFITISVLIILLSCQSLAFARGQTNGDLPSK
                     ADVQNQLDTLNKQKDLSAQDKLVQQDLIDTLATLEKIERVKEETVQLRQKVAQAPEKM
                     RQATAALNALSDVDNDDEMRKTLSALSLRQLELRVAQVLDDLQNSQNDLAAYNSQLVS
                     LQTQPERVQNAMYTASQQIQQIRNRLDGNNVGEAALRPSQQVLLQAQQALLNAQIDQQ
                     RKSLEGNTVLQDTLQKQRDYVTANSNRLEHQLQLLQEAVNSKRLTLTEKTAQEAISPD
                     ETARIQANPLVKQELDINHQLSQRLIVATENGNMLMQQNIKVKNWLDRALQSERNIKE
                     QIAVLKGSLLLSRILYQQQQTLPSADELEDMTNRIADLRLEQFEINQQRDALFQSDAF
                     VDKLEEGHTSEVNDEVHDALLQVVEMRRELLDQLNKQLGNQLMMAINLQVNQQQLMSV
                     SKNLKAILTQQIFWVNSNRPMDWDWLKAFPQTLKEQFSAMKITVNWQKAWPAVFIAFL
                     AGLPLLLIAGLIRWRLKWLKAYQQKLAAAVGSLRNDSQLNTPKAILIDLIRALPVCLI
                     ILAIGLILLTMQLNISDLLWAFSKKLAMFWLVFGLCWKVLEKEGVAIRHFGMPAQLTS
                     HWRRQIVRISLALLPLHFWSVVAELSPLNLMDDVLGQAVIFLNLLVITLLVWPLCRES
                     WRDKESHGIRLVTVTILSIIPVALMVLTATGYFYTTLRLAGRWIETVYLVIIWNLLYQ
                     TVLRGLSVAARRIAWRRALARRQNLVKEGAEGAEPQEEPTIALEQINQQTLRITMLLM
                     LALFGVMFWAIWSDLITVFSYLDSITLWHYNGSEAGAAVVKSVTMGSLLFAIIAAMVA
                     WALIRNLPGLLEVLVLSRLNMRQGASYAITTILNYVIIAVGAMTVFGSLGVSWDKLQW
                     LAAALSVGLGFGLQEIFGNFVSGLIILFERPVRIGDTVTIGTYSGTVSKIRIRATTIT
                     DFDRKEVIIPNKAFVTERLINWSLSDTTTRLVIRLGVAYGSDLEKVKRVLLQAAMEHP
                     KVMHDPEPAVFFTTFGASTLDHELRLYVRELRDRSHTVDELNRAIDRLCRENDINIAF
                     NQLEVHLHNAKGDEVTEVKRDLNGGDLAPAAS"
     gene            complement(530792..531715)
                     /locus_tag="STY_RS02440"
                     /old_locus_tag="STY0523"
     CDS             complement(530792..531715)
                     /locus_tag="STY_RS02440"
                     /old_locus_tag="STY0523"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rpn family recombination-promoting
                     nuclease/putative transposase"
                     /protein_id="WP_000440515.1"
                     /translation="MERLPTTPHDAVFRQMLMQKEVARDFLAIHLPEDFLAICDLDSL
                     KLESGSFVEDNLRSRYSDILYSLHTQHGPGYVYALIEHQSKSDRLMAFRLMRYAIAAM
                     QRHLDAGHDTLPLVVPILFYHGPESPWPYSLNWHNMFVKPDMAKALYSHEFALVDLTI
                     MPDNQLLQHRRIAMLELLQKHIRQRDLSELLDPLITLLTQDHLTDAQLSVLINYMLKA
                     GNAAEPGALIRQLAQGAPQYKEQLMTIAEWLEEKGRTEGLRKGLEQGLAQGREAEARA
                     IARKMLANGLEPGLIASVTGITPEELSTLSH"
     gene            complement(531785..531952)
                     /gene="rsmS"
                     /locus_tag="STY_RS02445"
                     /old_locus_tag="STY0524"
     CDS             complement(531785..531952)
                     /gene="rsmS"
                     /locus_tag="STY_RS02445"
                     /old_locus_tag="STY0524"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pleiotropic regulatory protein RsmS"
                     /protein_id="WP_000051161.1"
                     /translation="MSLENAPDEVKLAVDLIVLLEENRLPARTVLRALEIVMRDYENK
                     LKSTEDDSQTE"
     gene            complement(531966..532481)
                     /gene="priC"
                     /locus_tag="STY_RS02450"
                     /old_locus_tag="STY0525"
                     /pseudo
     CDS             complement(531966..532481)
                     /gene="priC"
                     /locus_tag="STY_RS02450"
                     /old_locus_tag="STY0525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459476.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal replication protein N''"
     gene            532562..532939
                     /locus_tag="STY_RS02455"
                     /old_locus_tag="STY0526"
     CDS             532562..532939
                     /locus_tag="STY_RS02455"
                     /old_locus_tag="STY0526"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF454 family protein"
                     /protein_id="WP_001189860.1"
                     /translation="MQRTILIIIGWLAVVLGTLGVVLPLLPTTPFILLAAWCFARSSP
                     RFHAWLLYRSWFGGYLRHWQRYRAMPPGAKPRAIALILLTFGISLWLVNMMWVRVLLL
                     VILACLLIFMWRIPVIDEKQQKR"
     gene            533092..533643
                     /gene="apt"
                     /locus_tag="STY_RS02460"
                     /old_locus_tag="STY0527"
     CDS             533092..533643
                     /gene="apt"
                     /locus_tag="STY_RS02460"
                     /old_locus_tag="STY0527"
                     /EC_number="2.4.2.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005125198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="WP_000127348.1"
                     /translation="MTATAQQLEFLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALS
                     IELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYEL
                     EYGTDQLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFIINLFD
                     LGGEQRLEKQGITCYSLMPFPGH"
     gene            533757..535685
                     /gene="dnaX"
                     /locus_tag="STY_RS02465"
                     /old_locus_tag="STY0528"
     CDS             533757..535685
                     /gene="dnaX"
                     /locus_tag="STY_RS02465"
                     /old_locus_tag="STY0528"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="WP_000121969.1"
                     /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFS
                     GTRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVE
                     DTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQ
                     KLPVTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLSRAADGSLRDAL
                     SLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAVVDANGERVMSLINEAAARGI
                     EWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRMRELARTVPPGDLQLYYQTLLI
                     GRKELPWAPDRRMGVEMTLLRALAFHPRMPLPEPETPRQSFAPVAPTAVMTPPQVQQP
                     SAPAPQTSPAPLPASTSQVLAARNQLQRAQGVTKTKKSEPAAASRARPVNNSALERLA
                     SVSERVQARPAPSALETTPVKKEAYRWKATTPVVQTKEVVATPKALKKALEHEKTPEL
                     AAKLAAEAIERDPWAAQVSQLSLPKLVEQVALNAWKEQNGNAVCLHLRSTQRHLNSSG
                     AQQKLAQALSDLTGTTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQ
                     TLRRFFDAELDEESIRPI"
     misc_feature    535018..535082
                     /gene="dnaX"
                     /locus_tag="STY_RS02465"
                     /old_locus_tag="STY0528"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00382"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="DnaX frameshifting element; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /db_xref="RFAM:RF00382"
     gene            535731..536060
                     /locus_tag="STY_RS02470"
                     /old_locus_tag="STY0529"
     CDS             535731..536060
                     /locus_tag="STY_RS02470"
                     /old_locus_tag="STY0529"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001364632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YbaB/EbfC family nucleoid-associated protein"
                     /protein_id="WP_000467098.1"
                     /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKV
                     TINGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLP
                     PGFKMPF"
     gene            536060..536665
                     /gene="recR"
                     /locus_tag="STY_RS02475"
                     /old_locus_tag="STY0530"
     CDS             536060..536665
                     /gene="recR"
                     /locus_tag="STY_RS02475"
                     /old_locus_tag="STY0530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein RecR"
                     /protein_id="WP_001195023.1"
                     /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLA
                     QALTRAMSEIGHCADCRTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFS
                     GRYFVLMGHLSPLDGIGPDDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAEL
                     CAEAGVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIIF"
     gene            536776..538650
                     /gene="htpG"
                     /locus_tag="STY_RS02480"
                     /old_locus_tag="STY0531"
     CDS             536776..538650
                     /gene="htpG"
                     /locus_tag="STY_RS02480"
                     /old_locus_tag="STY0531"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003903109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone HtpG"
                     /protein_id="WP_001682145.1"
                     /translation="MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAAD
                     KLRFRALSNPDLYEGDGELRVRVSFDKDKRTLTIADNGVGMNRDEVIDHLGTIAKSGT
                     KSFLESMGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGDKPENGVFWESAGEG
                     EYTVADITKNDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDG
                     ETVISWEKINKAQALWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTS
                     LLYIPSQAPWDLWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLNV
                     SREILQDSTVTRNLRSALTKRVLQMLEKLAKDDAEKYQTFWKQFGLVLKEGPAEDHAN
                     QEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKNSPHLELL
                     RKKGIEVLLLSDRIDEWMMNYLTEFDGKAFQSVAKADESIEKLADEVDENAKEAEKAL
                     EPFVERVKTLLGDRVKEVRLTHRLTDTPAIVTTDADEMSTQMAKLFAAAGQSVPEVKY
                     IFELNPDHVLVKRTADTKDEAQFKEWVELLLDQALFAERGTLEDPNQFIRRMNQLLVS
                     "
     gene            539066..539710
                     /gene="adk"
                     /locus_tag="STY_RS02485"
                     /old_locus_tag="STY0532"
     CDS             539066..539710
                     /gene="adk"
                     /locus_tag="STY_RS02485"
                     /old_locus_tag="STY0532"
                     /EC_number="2.7.4.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="WP_001220237.1"
                     /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSE
                     LGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGIV
                     VDYVLEFDVPDELIVDRIVGRRVHAASGRVYHVKFNPPKVEGKDDVTGEDLTTRKDDQ
                     EETVRKRLVEYHQMTAPLIGYYQKEAEAGNTKYAKVDGTQAVADVRAALEKILG"
     gene            539940..540902
                     /gene="hemH"
                     /locus_tag="STY_RS02490"
                     /old_locus_tag="STY0533"
     CDS             539940..540902
                     /gene="hemH"
                     /locus_tag="STY_RS02490"
                     /old_locus_tag="STY0533"
                     /EC_number="4.99.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="WP_001250076.1"
                     /translation="MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRVVDTPRLL
                     WWPLLRGVILPLRSPRVAKLYQSIWMDGGSPLMVYSREQQQALAARLPDTPVALGMSY
                     GSPSLESAVDELLASDVDHIVVLPLYPQYSCSTVGAVWDELGRILARKRRIPGISFIR
                     DYADDGAYIDALAKSARESFARHGEPDLLLLSYHGIPQRYADEGDDYPQRCRDTTREL
                     VSALGLPPEKVMMTFQSRFGREPWLTPYTDETLKMLGEKGTGHIQVMCPGFAADCLET
                     LEEIAEQNREIFLEAGGKKYAYIQALNATPEHIDMILKLTAPYR"
     gene            complement(540899..541870)
                     /gene="aes"
                     /locus_tag="STY_RS02495"
                     /old_locus_tag="STY0534"
     CDS             complement(540899..541870)
                     /gene="aes"
                     /locus_tag="STY_RS02495"
                     /old_locus_tag="STY0534"
                     /EC_number="3.1.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl esterase"
                     /protein_id="WP_000801788.1"
                     /translation="MKPENKIPVLTRLSDEMTAVVNFQQPGLPPWPADGDIETQRQYY
                     LLERRFWNADAPSMTTRTCAVSTPYGDVTTRLYSPQPTSQATLYYLHGGGFILGNLDT
                     HDRIMRLLARYTGCTVIGIDYSLSPQARYPQAIEETVAVCSYFSQHADEYSLNVEEIG
                     FAGDSAGAMLALASALWLRDKHIRCGNVIAILLWYGLYGLQDSVSRRLFGGAWDGLTR
                     EDLDMYEKAYLRNDEDRESPWYCLFNNDLTRDVPPCFIASAEFDPLIDDSRLLHQTLQ
                     AHQQPCEYKMYPGTLHAFLHYSRMMTIADDALQDGARFFMARMKTPR"
     gene            542023..543327
                     /gene="gsk"
                     /locus_tag="STY_RS02500"
                     /old_locus_tag="STY0535"
     CDS             542023..543327
                     /gene="gsk"
                     /locus_tag="STY_RS02500"
                     /old_locus_tag="STY0535"
                     /EC_number="2.7.1.73"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine/guanosine kinase"
                     /protein_id="WP_001766867.1"
                     /translation="MKFPGKRKSKHYFPVNARDPLLQQIQPEQETNASWVVGIDQTLV
                     DIEAKVDDDFITRYGLSAGHSLVIEDELAEKLYQELTRENLITHQFAGGTIGNTMHNY
                     SVLADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQAVDGPIGRCFTLIGESG
                     ERTFAISPGHMNQLRAESIPEAVIAGASALVLTSYLVRCKPGEPMPDATMKAIEYAKK
                     HNVPVVMTLGTKFVIADNPQWWQAFLKENVSILAMNEEEAEALTGENDPLLAADKALD
                     WVDLVLCTAGPIGLYMAGFTEEEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCTNPL
                     RVYSHIAPYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYS
                     SLAQVCKYANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
     gene            complement(543376..545052)
                     /locus_tag="STY_RS02505"
                     /old_locus_tag="STY0536"
     CDS             complement(543376..545052)
                     /locus_tag="STY_RS02505"
                     /old_locus_tag="STY0536"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Kef family K(+) transporter"
                     /protein_id="WP_000546202.1"
                     /translation="MHHATPLITTIVGGLVLAFILGMIANKLRISPLVGYLLAGVLAG
                     PFTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKSIAIPGAVAQIAVATLL
                     GMALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLLDSQRGQIAIGWLIVEDLV
                     MVLTLVLLPAVAGMVEKGDVGIASLAVDMGITIGKVVAFIAIMMLVGRRLVPWIMARS
                     AATGSRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLP
                     LRDAFAVLFFVSVGMLFDPLVLIQQPLAVLATLAIIVFGKSIAAFFLVRMFGHSPRTA
                     LTIAASLAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFTLLEKYLA
                     KTETLEEQTLEEAIEEEKQIPVDICNHALLVGFGRVGSLLGEKLLAAGIPLVVIETSR
                     TRVDELRERGIRAVLGNAANEEIMNLAHLDCARWLLLTIPNGYEAGEIVASAREKSPD
                     IEIIARAHYDDEVKYITERGANQVVMGEREIARAMLELLETPPAGEVVAS"
     gene            complement(545267..546487)
                     /locus_tag="STY_RS02510"
                     /old_locus_tag="STY0538"
     CDS             complement(545267..546487)
                     /locus_tag="STY_RS02510"
                     /old_locus_tag="STY0538"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_001251598.1"
                     /translation="MAMSEPTQPLAGAPAAAAKARTSFGILGAISLSHLLNDMIQSLI
                     LAIYPLLQAEFSLTFVQIGLITLTFQLASSLLQPVVGYWTDKYPMPWSLPVGMCFTLS
                     GLVLLAMAGSFGGVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFG
                     SSLGPLLAAVIIAPYGKGNVAWFVLATLLAIVVLAQISRWYAAQHRIAKGKPKAIIAN
                     PLPRNKVVLAVSVLLLLIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAV
                     AAGTVIGGPVGDKIGRKYVIWGSILGVAPFTLVLPYATLYWTGILTVIIGFILASAFS
                     AILVYAQELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIYLVYKICAFLPLL
                     GILTIFLPDNRHKA"
     gene            546660..547460
                     /locus_tag="STY_RS02515"
     CDS             546660..547460
                     /locus_tag="STY_RS02515"
                     /inference="COORDINATES: protein motif:HMM:NF007109.0"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_015606167.1"
                     /translation="MKFLKRGVALALLAAFALTTQPAQAYEKDKTYKITILHTNDHHG
                     HFWRSEYGEYGLAAQKTLVDSIRKEVAQEGGSVLLLSGGDINTGVPESDLQDVEPDFR
                     GMNLIGYDAMAVGNHEFDNPLTVLRQQEKWAKFPFLSANIYQKSTGERLFKPWAIFTR
                     QDIKIAVIGLTTDDTAKIGNPEYFTDIEFRKPAEEAKVVIQELNMNEKPDVIIATTHM
                     GHYDNGDHGSNAPGDVEMARSLPAGSLAMIVGGHSQDPVCMASENKNR"
     gene            547457..548311
                     /locus_tag="STY_RS02520"
     CDS             547457..548311
                     /locus_tag="STY_RS02520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001746770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleotidase C-terminal domain-containing
                     protein"
                     /protein_id="WP_001803092.1"
                     /translation="MNYVTGTPCAPDKQNGIWSVQAHEWGKYVGHADFEFRNGEMKMV
                     NYQLIPVNLKKKVTWDNGKSERVLYTPEIAENPQMLSLLTPFQNKGKAQLEVKIGSVN
                     GLLEGDRSKVRFVQTNMGRVILAAQIARTGADFGVMSGGGIRDSIEAGDITYKSVLKV
                     QPFGNIVVYADMSGKEVVDYLTAVAQMKPDSGAYPQFANVSFVAKEGKLTDLKIKGEP
                     VDPAKTYRMATLSFNATGGDGYPRIDNKPGYVNTGFIDAEVLKEFIQQNSPLDAAAFT
                     PNGEVNWL"
     gene            complement(548428..548907)
                     /gene="ybaK"
                     /locus_tag="STY_RS02525"
                     /old_locus_tag="STY0541"
     CDS             complement(548428..548907)
                     /gene="ybaK"
                     /locus_tag="STY_RS02525"
                     /old_locus_tag="STY0541"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006818871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK"
                     /protein_id="WP_000186620.1"
                     /translation="MTPAVKLLEKNKIPFNIHTYDHDPNETNFGDEVVRKLGLNADQV
                     YKTLLVAVNGDMKQLAVAVTPVAGQLDLKKVAKALGAKKVDMADPMVAQRTTGYLVGG
                     ISPLGQKKRLPTLIDAPARTFATIYVSGGKRGLDIELAADDLAAILSAKFADIARRD"
     gene            complement(549108..549902)
                     /locus_tag="STY_RS02530"
                     /old_locus_tag="STY0542"
     CDS             complement(549108..549902)
                     /locus_tag="STY_RS02530"
                     /old_locus_tag="STY0542"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TraB/GumN family protein"
                     /protein_id="WP_000421856.1"
                     /translation="MELLNQLKRLCRALRGTPNSWPAIDLSLPGGRHLHLVGSIHMGT
                     RDIAPLPAKLVKKLRQADALVVEADISGNETPFSNLPKCPPLVERLSAGLLNTLEKRV
                     SELGMPLIHFDNQPLWQIAMVLQATQAQRLGLRPDYGIDYQLLQAAREMSLPVQELEG
                     AKHQLELLCDLPDGGMALLDDTLTHWHTNARLLQVMIGWWLEQPPTSIGASLPRTFSQ
                     PLYDVLMVKRNEAWRDALLALPPGRYVVAVGALHLYGEGNLPQILK"
     gene            complement(549979..550815)
                     /locus_tag="STY_RS02535"
                     /old_locus_tag="STY0543"
     CDS             complement(549979..550815)
                     /locus_tag="STY_RS02535"
                     /old_locus_tag="STY0543"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000488538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1311 domain-containing protein"
                     /protein_id="WP_000488556.1"
                     /translation="MFRKAVTLLFLLSPAVSYAGLFDSTPELKCGNDNAVTAAKEWIY
                     NEALGRLQQDYIKEPSTLFFDIPQTQYEQQLRAIPVQFSDVITQNPQPENANLRTCSA
                     TVAMSIPQPLFKLMKDLPNTLFYISQGDGQVINNTVTWKQVNYNIQLADNNKDIVVTP
                     VQKTDKLARSIYVMARMTVSGDSIIKKKNNSLIEIAAKKFESRDRELNQVWNSLPTSA
                     RTALKQEQRVWVTKKEQQCGKLSDAKSEDIPAEKRISIYKCQLEMTIARTTYLDGSEL
                     PD"
     gene            complement(551169..553670)
                     /gene="copA"
                     /locus_tag="STY_RS02540"
                     /old_locus_tag="STY0544"
     CDS             complement(551169..553670)
                     /gene="copA"
                     /locus_tag="STY_RS02540"
                     /old_locus_tag="STY0544"
                     /EC_number="7.2.2.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-exporting P-type ATPase CopA"
                     /protein_id="WP_000083904.1"
                     /translation="MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVT
                     GTASADALIETIKQAGYGATLSHPKAKPLTESSIPSEALAAVPHELPVATADEESQQL
                     LLSGMSCASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGA
                     EAIEDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRSLW
                     LAIGLITLAVMVFAGGHFYRNAWKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWF
                     PMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLTPPTARVVTEDGEKS
                     VPLADVQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTV
                     VQDGSILFRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFS
                     AAIWYFFGPAPQIVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDAD
                     ALQRASTLDTLVFDKTGTLTEGKPQVVAVKTFNGVDEAQALRLAAALEQGSSHPLAHA
                     ILEKAGDDKLPQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITAQ
                     ASQGSTPVLLAIDGKAAALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAI
                     AKEAGIDEVIAGVLPDGKADAIKRLQSQGRQVAMVGDGINDAPALAQADVGIAMGGGS
                     DVAIETAAITLMRHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPF
                     TGTLLNPVVAGAAMALSSITVVSNANRLLRFKPKA"
     gene            553780..554196
                     /gene="cueR"
                     /locus_tag="STY_RS02545"
                     /old_locus_tag="STY0545"
     CDS             553780..554196
                     /gene="cueR"
                     /locus_tag="STY_RS02545"
                     /old_locus_tag="STY0545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cu(I)-responsive transcriptional regulator"
                     /protein_id="WP_001026762.1"
                     /translation="MNISDVAKKTGLTSKAIRFYEEKGLVTPPLRSENGYRTYTQKHL
                     NELTLLRQARQVGFNLEECGELVNLFNDPRRHSADVKKRTLEKVAEIERHISELQSMR
                     DQLLAMAESCPGDDSADCPIIDNLSGCCHHKAQKLR"
     gene            complement(554197..554649)
                     /locus_tag="STY_RS02550"
                     /old_locus_tag="STY0546"
     CDS             complement(554197..554649)
                     /locus_tag="STY_RS02550"
                     /old_locus_tag="STY0546"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NfeD family protein"
                     /protein_id="WP_000561177.1"
                     /translation="MIAMILVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGL
                     TVWLLPLGWEWQGVLFAALTLLAAWLWWRWLARRVREQKPTDSRLNQRGQQLVGRRFM
                     LDAALVNGRGHMRVGDSSWPVCADEDLRAGTHVEVIAVEGITLRIRAV"
     gene            complement(554646..555563)
                     /locus_tag="STY_RS02555"
                     /old_locus_tag="STY0547"
     CDS             complement(554646..555563)
                     /locus_tag="STY_RS02555"
                     /old_locus_tag="STY0547"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SPFH/Band 7/PHB domain protein"
                     /protein_id="WP_000906145.1"
                     /translation="MLILIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPG
                     LSLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVS
                     NLELAIINLTMTNIRTVLGSMELDEMLSQRDSINARLLHIVDEATNPWGIKVTRIEIR
                     DVRPPAELISSMNAQMKAERTKRAYILEAEGVRQAEILKAEGEKQSQILKAEGERQSA
                     FLQAEARERSAEAEARATQMVSEAIAAGDIQALNYFVAQKYTEALQQIGSANNSKVVM
                     MPLDASSLMGAIAGISELVKDSASERKKA"
     gene            555710..556387
                     /gene="fetA"
                     /locus_tag="STY_RS02560"
                     /old_locus_tag="STY0548"
     CDS             555710..556387
                     /gene="fetA"
                     /locus_tag="STY_RS02560"
                     /old_locus_tag="STY0548"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein FetA"
                     /protein_id="WP_000166987.1"
                     /translation="MTKRSMLLELKQVGYQTATTKIVNNISFTLQRGEFKLITGPSGC
                     GKSTLLKMVASLISPDIGVILFEGRDITTLSPEAYRQQVSYCAQTPALFGDTVYDNLI
                     FPWQIRHQRPQPTAFADDLARFELPETILQKPIAALSGGEKQRIALIRNLQFLPKILL
                     LDEITSALDEHNKRNVNDIIHRYVRDKQVAVLWVTHDKDEIQHADKVITLTPSAGEMQ
                     EARYERA"
     gene            556374..557153
                     /gene="fetB"
                     /locus_tag="STY_RS02565"
                     /old_locus_tag="STY0549"
     CDS             556374..557153
                     /gene="fetB"
                     /locus_tag="STY_RS02565"
                     /old_locus_tag="STY0549"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron export ABC transporter permease subunit
                     FetB"
                     /protein_id="WP_001002130.1"
                     /translation="MNEHNITNTSLALSMLLVVVAMLISHKEKLALEKDILWSVCRAV
                     IQLIIVGYVLKYIFGVNHAALTLLMVLFICFNAAWNAQKRSKYIDKAFLSSFIAITVG
                     AGLTLTVLVLTGSIEFAPMQVIPIAGMVAGNAMVAVGLCYNQLGLRFHSEQQQIQEKL
                     SLGATPKMASAGLIRDSIRASLIPTIDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQ
                     IMVTFMLLSTASLSTIIACYLTYRKFYNSRHQLVVMPLKKS"
     gene            complement(557239..558093)
                     /gene="cnoX"
                     /locus_tag="STY_RS02570"
                     /old_locus_tag="STY0550"
     CDS             complement(557239..558093)
                     /gene="cnoX"
                     /locus_tag="STY_RS02570"
                     /old_locus_tag="STY0550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperedoxin"
                     /protein_id="WP_000116065.1"
                     /translation="MSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQHCLQLTPV
                     LESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAI
                     RALLDKVLPREEELKAQQAMQLMQEGNYVDALPLLKDAWQLSSQNSEIGLLLAEAQIA
                     LNRSEEAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVADNPQDAAL
                     ATQLALQLHQVGRNEEALELLFSHLRKDLAAAEGQTRKTFQEILAALGTGDALASKYR
                     RQLYALLY"
     gene            complement(558153..558923)
                     /locus_tag="STY_RS02575"
                     /old_locus_tag="STY0551"
     CDS             complement(558153..558923)
                     /locus_tag="STY_RS02575"
                     /old_locus_tag="STY0551"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_001172802.1"
                     /translation="MQKSVLITGCSSGIGLDSALELKRQGFQILAGCRKPDDVARMNS
                     MGFTGVLIDLDSPESVDRAADEVIALTDNRLYGIFNNAGYGVYGPLSTISREQMEQQF
                     SSNFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASKYALEAWSDAL
                     RMELRHTGIKVSLIEPGPIRTRFTDNVNQTQRDKPVENPGIAARFTRDPDAVVAKVRH
                     AFASDKPRLRYPVTLVTWAVMALKRILPGRMLDKILQS"
     gene            complement(559078..559692)
                     /gene="tesA"
                     /locus_tag="STY_RS02580"
                     /old_locus_tag="STY0552"
     CDS             complement(559078..559692)
                     /gene="tesA"
                     /locus_tag="STY_RS02580"
                     /old_locus_tag="STY0552"
                     /EC_number="3.1.1.5"
                     /EC_number="3.1.2.14"
                     /EC_number="3.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multifunctional acyl-CoA thioesterase I/protease
                     I/lysophospholipase L1"
                     /protein_id="WP_001010578.1"
                     /translation="MNFNTVFRWHLPFLFLILLTFRAAAADTLLILGDSLSAGYRMTA
                     SAAWPSLLNDKWQNKTSVVNASISGDTSQQGLARLPALLQQHHPRWVVVELGGNDGLR
                     GFAPAQTEQTLRKIIQTVKAADAQPLLMQIHLPANYGRRYNESFSAIYPKLAKEFDIP
                     LLPFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLTPFLS"
     gene            559663..560349
                     /locus_tag="STY_RS02585"
                     /old_locus_tag="STY0553"
     CDS             559663..560349
                     /locus_tag="STY_RS02585"
                     /old_locus_tag="STY0553"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_001110598.1"
                     /translation="MPAENSVEVHRLRKSVGQGEHELSILTGVELVVKRGETIALIGE
                     SGSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQLRAQHVGFVFQSFMLIPT
                     LNALENVELPALLRGENSGQSKAGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARA
                     FNGRPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDPALAARCDRRLR
                     LVNGQLQEEA"
     gene            560346..562760
                     /locus_tag="STY_RS02590"
                     /old_locus_tag="STY0554"
     CDS             560346..562760
                     /locus_tag="STY_RS02590"
                     /old_locus_tag="STY0554"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_000561782.1"
                     /translation="MIARWFWREWRSPSLIIVWLALSLAVACVLALGSISDRMEKGLS
                     QQSREFMAGDRTLQSSREVPKAWLEEARKRGLNVGEQLTFATMTFAGDTPQLASVKAV
                     DSVYPMYGELQTRPGGVKPQPGSVLLAPRLMALLNLKTGDTIDVGDVTLRIAGEVVQE
                     PDSGFNPFQMAPRLMMNMADVAKTGAIQPGSRVMWRYKFGGTPQQLAGYESWLLPQLK
                     PEHRWYGLEQDDGALGKSLERSQQFLLLSALLTLLLAVAAVAVAMSHYCRSRYDLVAI
                     LKTLGAGRAQLRKLIIGQWLMVLGLSAVTGGAIGLLFENILLVLLKPVLPADLPPASL
                     WPWLWALGAMTVISLLVGLRPYRLLLASQPLRVLRRDVVARVWSLKIYLPVACAVVVA
                     LLAGLMGESMLLWAVLAGAVILALLCGLVGWMLLNVLRGMTLTSLPLRLAVSRLLRQP
                     WSTLSQLSAFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIASEQVAPLKAF
                     LAEHQVIPQTFYPIVRARLTEINGNPTEGQQDESLNRELNLTWQDTRPAHNPLVAGHW
                     PPKPGEVSMEEGLAKRLNVKLGDSVTFMGDTQAFSAKVTSLRQVDWESLRPNFFFIFP
                     SGALDGQPQSWLTSFRWENGNGMLTQLNREFPTVSLLDIGAILKQVGQVLEQVSRALE
                     VMVVLVTLCGMLLLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGLVAG
                     LVAAIGAETALAILQINVFDFPWEPDWRLWVALPFCGALLLSVCGGWLGVRLLKGKAL
                     FRQFSG"
     gene            562946..564079
                     /locus_tag="STY_RS02595"
                     /old_locus_tag="STY0556"
     CDS             562946..564079
                     /locus_tag="STY_RS02595"
                     /old_locus_tag="STY0556"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_000152873.1"
                     /translation="MTIKITALAASIGAAVAFMPFATQAEITVLKQDPQAGNPLSRLN
                     FTVGGSIRPQFQNMTGNDGANGYKRNGFDGGTRFRFAADYYLFDDISWISYYELGVNI
                     PAVFDWDNHYAKGTTDTTRRMLYTGFKSATWGTLTFGQQNSIYYDVVGVKTDIWDYDM
                     IGQAPGNGINGDYDGSYRTRKSLKYKKSIGNVDLYASYLFSDDYNANNGLNYKRKGGG
                     SLGADYHLTDDLTWGTAWNYTRAEMRGNGNKTYDQNIVGTALSWTPENWTIAAGGGWY
                     QNFMTTKKVSVNDYFAGDAWGLEYFVGYAFPIGQYAVKAIQPYFMGDRIEYVNGRDYL
                     RTDNGVGITFQLDYGFRVDYEHVFTSSTDNLGDMNLVRLRYDF"
     gene            564336..565166
                     /locus_tag="STY_RS02600"
                     /old_locus_tag="STY0558"
     CDS             564336..565166
                     /locus_tag="STY_RS02600"
                     /old_locus_tag="STY0558"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter substrate-binding protein"
                     /protein_id="WP_000524312.1"
                     /translation="MGLRQSLRIAASTLLLACGLQFAHADGSPQTIVFGVAPGPYGDM
                     VKQAIAPTLKEKGYKVVVREFSDYVQPNMALANGSIDANLFQHTLYFDKFTADKGLKL
                     SKLIVVPTAGMGFYSRKINSLDALKKGDIITLSNDPTNLARGLRFLQSLGLITIKHNI
                     DPTKASERDIASNPKGLVFKPLEAAQLPRTLDGVTGALVNGNFAVAAGLDLSSAIKQE
                     HLDENLKNIIAVRSEDADKPFAKDIVEAVKSPAYRAVIDDPKNIYSAFQKPEWMTATP
                     "
     gene            565203..566219
                     /gene="sfbB"
                     /locus_tag="STY_RS02605"
                     /old_locus_tag="STY0559"
     CDS             565203..566219
                     /gene="sfbB"
                     /locus_tag="STY_RS02605"
                     /old_locus_tag="STY0559"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence-associated ABC transporter ATP-binding
                     protein SfbB"
                     /protein_id="WP_000569655.1"
                     /translation="MIEIEKVCVDFTAGRGTPTRAVDDVSLHIAAGEIFGIVGTSGAG
                     KSTLLRTLNALTRPSQGRVNVNGVEISALDGKALRQARQRIGMIFQHFNLMHTRTVAK
                     NVAFSLKAAGWERSKIAPRVAEILTLVGLADKANCFPVQLSGGQKQRVGIARAIANHP
                     DVLLCDEPTSALDLETSATILALLRQINAQLGITIVLITHEMNVIKSICDRVAVMSGG
                     KVVESGEVFDVFAHPQHAFTQQLVSHTLNLTLPERLREHLPGQLLKILFIGDSAEQPV
                     LSEVAIKFGVAVNILHGKIEYIGERALGILVVQLTAPHNPTAVAAAVEHIRQRTAQVE
                     VIRG"
     gene            566212..566871
                     /locus_tag="STY_RS02610"
                     /old_locus_tag="STY0560"
     CDS             566212..566871
                     /locus_tag="STY_RS02610"
                     /old_locus_tag="STY0560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_000342247.1"
                     /translation="MDDLLPDLTLAFNETFQMLSISTVLAILGGLPLGFLIFVTDRHL
                     FWQNRFIYLVASVLVNIIRSVPFVILLVLLLPLTQLLLGNTIGPIAASVPLSVAAIAF
                     YARLVDSALREVDKGIIEAALAFGASPMRIICTVLLPEASAGLLRGLTITLVSLIGYS
                     AMAGIVGGGGVGDLAIRYGYYRYETEVMVVTVVALIVLVQVVQMLGDWLAKRADKRDR
                     H"
     gene            complement(566910..568004)
                     /gene="mnmH"
                     /locus_tag="STY_RS02615"
                     /old_locus_tag="STY0561"
     CDS             complement(566910..568004)
                     /gene="mnmH"
                     /locus_tag="STY_RS02615"
                     /old_locus_tag="STY0561"
                     /EC_number="2.5.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA 2-selenouridine(34) synthase MnmH"
                     /protein_id="WP_001154074.1"
                     /translation="MQDRQKAQDYRALLLADTPLIDVRAPIEFEQGAMPGAINLPLMM
                     DDERAAVGTCYKRQGADAALALGHRLVCGDIRQQRLEAWKAAYQRFPNGYLCCARGGQ
                     RSHIVQRWLQETGIDCPLIEGGYKALRQTAIQATWQLAQKPILLIGGCTGSGKTQLVR
                     QQPNGVDLEGLARHRGSSFGRTLKPQLSQASFENKLAVELLKINARQTLKRWVLEDEG
                     RTIGANHLPECLRERMAQAPIAVVEDPFALRLERLREEYFIRMHHDFTHAYGDGAGWQ
                     AYSEYLHHGLFAIRRRLGLQRFAELTDTLDRALAEQLSSGSTDGHMAWLVPLLNEYYD
                     PMYRYQLEKKAANIVFRGTWQDVANWLKAQ"
     gene            complement(568074..569000)
                     /gene="allS"
                     /locus_tag="STY_RS02620"
                     /old_locus_tag="STY0562"
     CDS             complement(568074..569000)
                     /gene="allS"
                     /locus_tag="STY_RS02620"
                     /old_locus_tag="STY0562"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional activator AllS"
                     /protein_id="WP_000460171.1"
                     /translation="MFDPETLRTFISVAETGSFSKAAERLCKTTATTSYRIKLLEENT
                     GVGLFFRTTRSVSLTAAGSHLLSQAKDWLAWLDSMPDELRQVNDGVERQVNIVVNNLL
                     YSPQAVASLLSWLNARYPFTQFHFSRQIYMGVWDSLLYEGFSLAIGVTGTEPLANTFM
                     LDPLGSVQWRFVMSADHPLAHVSGPLTEAQLRRFPAINIEDSARTLTKRVAWRLPGQK
                     EIIVPDMETKIAAHLAGVGIGFVPQPLCQTLIDKNELVSCTIPTMRPPSPLSLAWHKF
                     GGGKAVEDIVKLFTQRQPEIAGFLSIFNTVRC"
     gene            569227..569708
                     /gene="allA"
                     /locus_tag="STY_RS02625"
                     /old_locus_tag="STY0563"
                     /pseudo
     CDS             569227..569708
                     /gene="allA"
                     /locus_tag="STY_RS02625"
                     /old_locus_tag="STY0563"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459510.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ureidoglycolate lyase"
     gene            569787..570605
                     /gene="allR"
                     /locus_tag="STY_RS02630"
                     /old_locus_tag="STY0564"
     CDS             569787..570605
                     /gene="allR"
                     /locus_tag="STY_RS02630"
                     /old_locus_tag="STY0564"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional repressor AllR"
                     /protein_id="WP_000141266.1"
                     /translation="MTEVRRRGRPGQAEPTAQKGAQALERGIAILQYLERSGGSSSVS
                     DISGSLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGLGVFNVGSAYIHNRDVLSVA
                     GPFMHRLMLLSGETVNVAIRNGNEAVLIGQKECKSMVRMCAPLGSRLPLHASGAGKAL
                     LYPLTEEELVGIVVNTGLRRFTPTTLVDLPILLKNLERAREQGYTVDQEEHVVGLNCI
                     ASAIYDDAGSVVAAISISGPASRLTEDRFISQGELVRDTAKDISTALGLKPPVA"
     gene            570690..572471
                     /gene="gcl"
                     /locus_tag="STY_RS02635"
                     /old_locus_tag="STY0565"
     CDS             570690..572471
                     /gene="gcl"
                     /locus_tag="STY_RS02635"
                     /old_locus_tag="STY0565"
                     /EC_number="4.1.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxylate carboligase"
                     /protein_id="WP_001096863.1"
                     /translation="MAKMRAVDAAMYVLEKEGITTAFGVPGAAINPFYSAMRKHGGIR
                     HILARHVEGASHMAEGYTRAAAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITG
                     QAPRARLHKEDFQAVDIEAIAKPVSKMAVTVREAALVPRVLQQAFHLMRSGRPGPVLV
                     DLPFDVQVAEIEFDPDMYEPLPVYKPAASRVQIEKALEMLIQSERPVIVAGGGVINAD
                     AAPLLQQFAELINVPVIPTLMGWGCTLDDHPLMAGMVGLQTAHRYGNATLLASDMVFG
                     IGNRFANRHTGSVEKYTQGRKIIHIDIEPTQIGRVLCPDLGIVSDAKAALTLLIDVAQ
                     EMQKAGRLPCRKTWVDECQQRKRTLLRKTHFDNVPVKPQRVYEEMNKAFGRDVCYVTT
                     IGLSQIAAAQMLHVFKDRHWINCGQAGPLGWTIPAALGVCAADPQRNVVAISGDFDFQ
                     FLIEELAVGAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSSEVNGYG
                     VDHVKVAEGLGCKAIRVFKPEDIAPAFEQAKALMAQYRVPVVVEVILERVTNISMGDE
                     LDNVTEFEEVADSAKDAPTETCFMKYE"
     gene            572484..573260
                     /gene="hyi"
                     /locus_tag="STY_RS02640"
                     /old_locus_tag="STY0566"
     CDS             572484..573260
                     /gene="hyi"
                     /locus_tag="STY_RS02640"
                     /old_locus_tag="STY0566"
                     /EC_number="5.3.1.22"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxypyruvate isomerase"
                     /protein_id="WP_000943597.1"
                     /translation="MLRFSANLSMLFTEYDFLERFDKAAQSGFRGVEFMFPYDDDIEV
                     LKRKLRDNNLEHTLHNLPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKKI
                     NCLVGKTPSGFSATEIYDTLVENLRYAANMLAKEDILLLIEPINHFDMPGFHLTGTQQ
                     ALVLIKDIGSDNIKIQYDIYHMQRMEGELTQTMTAWADKIGHLQIADNPRRGEPGTGE
                     INYDFIFNVIKQSDYDGWVGCEYKPLTTAEAGLSWINQYR"
     gene            573361..574239
                     /gene="glxR"
                     /locus_tag="STY_RS02645"
                     /old_locus_tag="STY0567"
     CDS             573361..574239
                     /gene="glxR"
                     /locus_tag="STY_RS02645"
                     /old_locus_tag="STY0567"
                     /EC_number="1.1.1.60"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxy-3-oxopropionate reductase"
                     /protein_id="WP_000765818.1"
                     /translation="MKLGFIGLGIMGSPMAINLARAGHQLHVTTIGPVADELLSLGAV
                     NVETARQVTEFADIIFIMVPDTPQVEEVLFGEHGCAKTSLQGKTIVDMSSISPIGTKR
                     FAQRVNEMDADYLDAPVSGGEIGAREGTLSIMVGGEQKVFDRVKPLFDILGKNITLVG
                     GNGDGQTCKVANQIIVALNIEAVSEALVFASKAGADPVRVRQALMGGFASSRILEVHG
                     ERMINRTFEPGFKIALHQKDLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDH
                     SAMVQALELMANHKLS"
     gene            574305..575552
                     /locus_tag="STY_RS02650"
                     /old_locus_tag="STY0568"
     CDS             574305..575552
                     /locus_tag="STY_RS02650"
                     /old_locus_tag="STY0568"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_000005062.1"
                     /translation="MSETKKSGIDYWKQIVVVMSLGWVAIWIYRTVLTPIYPEIQASL
                     DNVSNAEIGAIASFYFFAYCSMQIPCGILVDKFGQKIMLMAGFTLFIIGTLCIAKANG
                     LAMIYTGSLMAGGGCASFFSSAYSLSSANVPQARRALANAIINSGSAIGMGIGLIGSS
                     VLVKNMSMAWQNVLYIVAAILVIMLCVFTLVIRGKAKSDSAQAEKQTQTVTEDEKRAP
                     LFSGLLCSVYFLYFCTCYGYYLIVTWLPSYLQTERGFDGGAIGLASALVAVVGVPGAL
                     FFSHLSDKFRNSKVKVILGLEIVAAAMLAFTVLSPNTTMLMVSLTLYGLLGKMAVDPI
                     LISFVSEQASAKSLGRAFSLFNFFGMSSAVVAPTLTGFISDVTGSKEISFVISACLVV
                     TGTLIFAAVTLYKKKATQRIASA"
     gene            575648..577102
                     /locus_tag="STY_RS02655"
                     /old_locus_tag="STY0569"
                     /pseudo
     CDS             575648..577102
                     /locus_tag="STY_RS02655"
                     /old_locus_tag="STY0569"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_415044.4"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="putative allantoin permease"
     gene            577181..578542
                     /gene="allB"
                     /locus_tag="STY_RS02660"
                     /old_locus_tag="STY0571"
     CDS             577181..578542
                     /gene="allB"
                     /locus_tag="STY_RS02660"
                     /old_locus_tag="STY0571"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allantoinase AllB"
                     /protein_id="WP_000006865.1"
                     /translation="MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVL
                     DATGLIVSPGMVDAHTHISEPGRTHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDR
                     ETIELKFDAAKGKLTIDAAQLGGLVSYNLDRLHELDEVGVVGFKCFVATCGDRGIDND
                     FRDVNDWQFYKGAQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVF
                     TEVEAIRRVLYLAKAAGCRLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTD
                     QFEEIGTLAKCSPPIRDQENQKGMWEKLFNGEIDCLVSDHSPCPPEMKAGNIMQAWGG
                     IAGLQNCMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLKHKGRIAPGKDADLVFIQ
                     PDSSYVLKNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFILK
                     HQQ"
     gene            578601..579899
                     /locus_tag="STY_RS02665"
                     /old_locus_tag="STY0572"
     CDS             578601..579899
                     /locus_tag="STY_RS02665"
                     /old_locus_tag="STY0572"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil/xanthine transporter"
                     /protein_id="WP_000484506.1"
                     /translation="MFPVINRESVLSGFQWFFFIFCNTVVVPPTLLSAFHLPADNLLM
                     LTQYAFLTTALACLVQAFCGHRRAIMEGPTGLWWGAILTITLGEASRGTPLNDIASSL
                     SVGIAISAMVTIFIGISGLGHRLARLFTPAVMVFFMLLLGAQLTSIFFKGMLGLPFGI
                     ADTSARIKLAPFGLAVAVMCFILAMIIFLQQRISRYALLVGTVVGWGLWRLCFPSSHL
                     PPGELSWRWFPLGSHGTLMPGIIVTAVMTGLVNISNTYGAIRGTDIFYPHQGSGSSRY
                     RRSFMISGLMTLVTVPFAVVPFSPFVSSIGLLTQTGDSSRKSFICGSALCLLVAIITP
                     LTRLFCAIPLAISSAVMLVSYLPLLYSGLVFSQQITFTARNIYRLALPLFVGIFLMGL
                     PPVYLQDLPLMIRPLLSNGLLVGILLAVLMENLIPWERIK"
     gene            579922..581070
                     /gene="glxK"
                     /locus_tag="STY_RS02670"
                     /old_locus_tag="STY0573"
     CDS             579922..581070
                     /gene="glxK"
                     /locus_tag="STY_RS02670"
                     /old_locus_tag="STY0573"
                     /EC_number="2.7.1.31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate 3-kinase"
                     /protein_id="WP_000706333.1"
                     /translation="MKIVIAPDSFKESLSADKCCQAIKAGFSTVFPDARYVCLPIADG
                     GEGTVDAMVAATGGKRVSVDVSGPMGEKVNGFYGLTGDGKTAIIEMAAASGLMLVAPE
                     ARNPLRASSFGTGELIRHALDAGIRHIILGIGGSATVDGGMGVAQALGVRFLDAQGTP
                     LGAEGGNLSRLASIDLQGRDPRISECRIEVACDVDNPLVGPRGAAAVFGPQKGATPEM
                     VETLENGLRNYARILHALTGRDMSQIPGGGAAGGMGIAAIVFLEAEMKPGIEIVMQAV
                     KLEEAVKEASLVITGEGRIDSQTAGGKAPIGVASVAKRHHVPVIGIAGVLGDGVEVVH
                     RHGIDAVFSILPRLAPLPEVLANGEQNLYHSACNIARVIKLGQDIGTR"
     gene            complement(581149..581934)
                     /gene="allE"
                     /locus_tag="STY_RS02675"
                     /old_locus_tag="STY0574"
     CDS             complement(581149..581934)
                     /gene="allE"
                     /locus_tag="STY_RS02675"
                     /old_locus_tag="STY0574"
                     /EC_number="3.5.3.26"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(S)-ureidoglycine aminohydrolase"
                     /protein_id="WP_000540981.1"
                     /translation="MGYLNNVTGYRDDLLANRAIVKHGNYALLTPDGLVKNIIPGFEN
                     CDVTILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVIAGNIEAKAEGKTFS
                     LTQGGYLYCPPGEMMTFSNAQTEDSQLFLYKRRYTPVEGHAPWLVSGNASQLERIHYE
                     GMEDVILLDFLPKELGFDMNMHILSFEPGASHGYIETHVQEHGAYILSGQGVYNLDNN
                     WVPVKKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVMI"
     gene            complement(581945..583180)
                     /gene="allC"
                     /locus_tag="STY_RS02680"
                     /old_locus_tag="STY0575"
     CDS             complement(581945..583180)
                     /gene="allC"
                     /locus_tag="STY_RS02680"
                     /old_locus_tag="STY0575"
                     /EC_number="3.5.3.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allantoate deiminase"
                     /protein_id="WP_000589772.1"
                     /translation="MIKHFRHAIEETLPWLSSIGADPTGGMTRLLYSPEWLETQQQFK
                     KRMAESGLETRFDDVGNLYGRLCGTQFPEQVILSGSHIDTVVNGGNLDGQFGALAAWL
                     ALDWLKATYGAPLRTVEVVSMAEEEGSRFPYVFWGSKNIFGLANPEEVRYIQDAKGTG
                     VVDAMQACGFTLPAAPLAARTDIRAFVELHIEQGCVLESNGQSIGVVNAIVGQRRYTV
                     TLNGESNHAGTTPMGYRRDTVHAFSRICSQSIEKAKQHGDPLVLTFGKVEPQPNTVNV
                     VPGKTTFTIDCRHTDAAVLREFTEQLENNMRAICDEMDISIDIDLWMDEAPVPMNAEL
                     VAALTRLCETEQLNYRIMHSGAGHDAQIFAPRVPTCMIFVPSINGISHNPAERTNIND
                     LAEGVKTLALMLHQLAWQK"
     gene            complement(583202..584251)
                     /gene="allD"
                     /locus_tag="STY_RS02685"
                     /old_locus_tag="STY0576"
     CDS             complement(583202..584251)
                     /gene="allD"
                     /locus_tag="STY_RS02685"
                     /old_locus_tag="STY0576"
                     /EC_number="1.1.1.154"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ureidoglycolate dehydrogenase"
                     /protein_id="WP_000703940.1"
                     /translation="MKISRETLHQLIENKLYKAGLKREHAAIVADVLVYADARGIHSH
                     GAVRVEYYAERISKGGTNREPTFRIENTGPCTAILHADNAAGQVAAKMGMEHAIEIAK
                     KNGVAVVGISRMGHSGAISYFVRQAAREGLIGLSICQSDPMVVPFGGADIYYGTNPLA
                     FAAPSEGDDIITFDMATTVQAWGKVLDARSRNESIPESWAVDKNGAPTHDPFAVNALL
                     PAAGPKGYGLMMMIDILSGILLGLPFGRQVSSMYEDLHAGRNLGQLHLVINPAFFSSC
                     ELFRKHISQTMQELNSVKPAPGFKQVYYPGQDQDIKQKNADMNGIDIVDDIYQYLISD
                     ALYLKSYETKNPFAQ"
     gene            584567..586231
                     /locus_tag="STY_RS02690"
                     /old_locus_tag="STY0577"
     CDS             584567..586231
                     /locus_tag="STY_RS02690"
                     /old_locus_tag="STY0577"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase FdrA"
                     /protein_id="WP_000580919.1"
                     /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKS
                     LLETTGFWHDDFHGATPNDICVAIRTEAVDDGITQVIVRQLEEALQQLAQGSSGSQSL
                     IQVRRWESACQKLPEANLALVSVAGEYAAELAEQALARSLNVMIFSDNVTLDDEIRLK
                     RRARDKGLLVMGPDCGTAMIANTPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGE
                     GITHAIGLGGRDLSAEVGGISALTALDILSADEKSQVLAFVSKPPADAVRQHIIAAMK
                     ATGKPVVALFLGFSSPVAREENVWFASTLDEAARLACLLSRVTSQRKEMVSTGGVIRG
                     LYTGGTLAAEAAGLLAGYLGVATDTEHHHGMMLDADGHQIIDLGDDFYTVGRPHPMID
                     PALRNQLIAGLGAQPQVRVLLVDVVIGFGATADPAASLIQAWQKACAARASDQPLFAI
                     ATVTGTERDPQCRSQQIAALEDAGITVVDSLPEATLLAAELIRPTLSSTHPSAPRLLE
                     AVAVINAGLRSFALDLQAAGMPVVHYQWAPVAGGNKKLARLLERLQ"
     gene            586241..587500
                     /locus_tag="STY_RS02695"
                     /old_locus_tag="STY0578"
     CDS             586241..587500
                     /locus_tag="STY_RS02695"
                     /old_locus_tag="STY0578"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1116 domain-containing protein"
                     /protein_id="WP_024131192.1"
                     /translation="MFTSVAQANAAVIEQIRRARPHWLDVKPASSLISVLNQGKTLLH
                     AGPPMRWQEMTGPMKGACIGACLFEGWAKDEMSALALLEQGKVNFIPCHHVNAVGPMG
                     GITSASMPMLVVENITDGNRAYCNLNEGIGKVMRFGAYGEDVQQRLRWMRDVLMPVLS
                     AALGRLERGLDLTAMMAQGITMGDEFHQRNIASSALLMRTLAPHIARLQHDKQQIAEV
                     MDFLSVTDQFFLNLAMAYCKAAMDAGAQIRAGSIVTAMTRNGDMFGIRVSGLGDRWFT
                     APVNTPQGLFFTGFSQDQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGAGGMEAAK
                     SVSEEMAEIYLERNMQLQIPGWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQ
                     IGAGTVRAPLACFEQALEALAESMGVS"
     gene            587512..588321
                     /locus_tag="STY_RS02700"
                     /old_locus_tag="STY0579"
     CDS             587512..588321
                     /locus_tag="STY_RS02700"
                     /old_locus_tag="STY0579"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2877 domain-containing protein"
                     /protein_id="WP_000821188.1"
                     /translation="MKRIHPLMASRQSADYRQPWQMSGVWRRSINFVAKSGELLTLHR
                     RGSGFSPGGWILRGGDFDALRDVLTDGEKPQLTAAGIQIGEFLLCEPERRCSLRVPRY
                     LASPRLNATYMQRSEETGLFGPLTVAAAQPLCPELRQFCHCFQSALAGAATDWRLWLG
                     KGPGLTPSHEDTLTGMLLAAWYFGAIDERAGRNFFAQSGSLDRATTLVSVSYLRYAAM
                     GYFASPLLHFIHALRRDARTETAIDGLLALGHTSGADTLLGFWLGQQIVKG"
     gene            588325..589218
                     /locus_tag="STY_RS02705"
                     /old_locus_tag="STY0580"
     CDS             588325..589218
                     /locus_tag="STY_RS02705"
                     /old_locus_tag="STY0580"
                     /EC_number="2.7.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamate kinase"
                     /protein_id="WP_000855341.1"
                     /translation="MKTLVVALGGNALLQRGEALTAENQYRNIADAVPALARLARSYR
                     LAIVHGNGPQVGLLALQNLAWKAVEPYPLDVLVAESQGMIGYMLAQRLALEPDMPPVT
                     AVLTRIKVSADDPAFLEPEKFIGPVYSPEEQMALEATYGWHMKRDGKYLRRVVASPAP
                     RQIIESTAIELLLKEGHVVICSGGGGVPVAGEGEGVEAVIDKDLAAALLAEQIAADGL
                     IILTDADAVYEHWGTPQQRAIRQASPDELAPFAKADGAMGPKVTAVSGYVKRCGKPAW
                     IGALSRIDDTLAGRAGTCICL"
     gene            complement(589259..590326)
                     /gene="purK"
                     /locus_tag="STY_RS02710"
                     /old_locus_tag="STY0581"
     CDS             complement(589259..590326)
                     /gene="purK"
                     /locus_tag="STY_RS02710"
                     /old_locus_tag="STY0581"
                     /EC_number="6.3.4.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide
                     synthase"
                     /protein_id="WP_000815594.1"
                     /translation="MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPTAVPVQQS
                     VITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLGLATAPWQLLSS
                     ADEWSGIFDRLGELAIIKRRVGGYDGRGQWRLRADETGQLPDDCYGECIVERGIHFSG
                     EVSLVGARAHDGSTVFYPLTHNLHQDGILRTSVAFPQANAEQQEQAESMLSAIMQALN
                     YVGVMAMECFITPEGLLINELAPRVHNSGHWTQNGASISQFELHLRAITGLPLPAPVI
                     NAPSVMINLIGSELNYDWLKLPLVHLHWYDKAVRPGRKVGHLNLTDSDTSRLSATLEA
                     LSPLLPGEYASGIIWAQSKLK"
     gene            complement(590323..590832)
                     /gene="purE"
                     /locus_tag="STY_RS02715"
                     /old_locus_tag="STY0582"
     CDS             complement(590323..590832)
                     /gene="purE"
                     /locus_tag="STY_RS02715"
                     /old_locus_tag="STY0582"
                     /EC_number="4.1.1.21"
                     /EC_number="5.4.99.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide mutase"
                     /protein_id="WP_000098739.1"
                     /translation="MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILDVPHHVEVVSA
                     HRTPDKLFSFAETAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVD
                     SLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDSALHRRIADWRKAQTDEVL
                     ENPDPRGTL"
     gene            complement(590950..591672)
                     /gene="lpxH"
                     /locus_tag="STY_RS02720"
                     /old_locus_tag="STY0583"
     CDS             complement(590950..591672)
                     /gene="lpxH"
                     /locus_tag="STY_RS02720"
                     /old_locus_tag="STY0583"
                     /EC_number="3.6.1.54"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-2,3-diacylglucosamine diphosphatase"
                     /protein_id="WP_000212291.1"
                     /translation="MATLFIADLHLQTEEPAIVAGFLRFLAVEARQADALYILGDLFE
                     AWIGDDDPNPLHREMAVAIKSLVDSGVPCFFIHGNRDFLIGKRFARESGMTLLPQEKV
                     LDLYGRNVLIMHGDTLCTDDAGYQAFRAKVHNPWVQRPFLTLPLFIRRRIAARMRAGS
                     KAANSSKSLDIMDVNAQTVVAEMEKHRVQWLIHGHTHRPAVHELSANGQPAFRVVLGA
                     WHHEGSMVKVTPDNVELIAFPL"
     gene            complement(591675..592169)
                     /gene="ppiB"
                     /locus_tag="STY_RS02725"
                     /old_locus_tag="STY0584"
     CDS             complement(591675..592169)
                     /gene="ppiB"
                     /locus_tag="STY_RS02725"
                     /old_locus_tag="STY0584"
                     /EC_number="5.2.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017465360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase B"
                     /protein_id="WP_000255991.1"
                     /translation="MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRV
                     INGFMIQGGGFEPGMKQKATKEAIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINV
                     ADNDFLNFSGESLQGWGYCVFAEVVEGMDVVDKIKGVATGRSGMHQDVPKEDVIIENV
                     TVSE"
     gene            592342..593727
                     /gene="cysS"
                     /locus_tag="STY_RS02730"
                     /old_locus_tag="STY0585"
     CDS             592342..593727
                     /gene="cysS"
                     /locus_tag="STY_RS02730"
                     /old_locus_tag="STY0585"
                     /EC_number="6.1.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005125243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine--tRNA ligase"
                     /protein_id="WP_000912377.1"
                     /translation="MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTF
                     VAFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVALVDRMIAEMHQDFDA
                     LNILRPDSEPRATHHIQEIIELTRTLIEKGHAYVADNGDVMFDVPTDPTYGQLSRQDL
                     EQLQAGARVDVVDVKRNPMDFVLWKMSKEGEPSWPSPWGEGRPGWHIECSAMNCKQLG
                     NHFDIHGGGSDLMFPHHENEIAQSTCAHDGEYVNYWMHSGMVMVDREKMSKSLGNFFT
                     VRDVLKYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERLYTALRGTDKSAAPAG
                     GEAFEARFVEAMNDDFNTPEAYSVLFDMAREVNRLKGEDMTAANAMASHLRKISGVLG
                     LLEQEPDVFLQSGAQADDGEVAEIEALIQQRLDARKAKDWAAADAARDRLTEMGIILE
                     DGPQGTTWRRK"
     gene            complement(593818..594366)
                     /locus_tag="STY_RS02735"
                     /old_locus_tag="STY0586"
     CDS             complement(593818..594366)
                     /locus_tag="STY_RS02735"
                     /old_locus_tag="STY0586"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001523363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="WP_001143573.1"
                     /translation="MPTVITHAAVPLCLGAGLGLKVIPPRLLFAGVVLAMLPDADVLA
                     FKFGVAYGNVFGHRGFTHSLLFAFVLPLLCVLAGRRWFRAGQVRCWLFLTVSLLSHSL
                     LDSITTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSSYITPYGHQVIVSELLWVWLP
                     GGVLIGILGWHRWRIGDEKRTR"
     gene            complement(594450..594662)
                     /gene="ybcJ"
                     /locus_tag="STY_RS02740"
                     /old_locus_tag="STY0587"
     CDS             complement(594450..594662)
                     /gene="ybcJ"
                     /locus_tag="STY_RS02740"
                     /old_locus_tag="STY0587"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated protein YbcJ"
                     /protein_id="WP_000190278.1"
                     /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIADGLVKVDGA
                     VETRKRCKIVAGQTVSFEGQSVNVVA"
     gene            complement(594664..595530)
                     /gene="folD"
                     /locus_tag="STY_RS02745"
                     /old_locus_tag="STY0588"
     CDS             complement(594664..595530)
                     /gene="folD"
                     /locus_tag="STY_RS02745"
                     /old_locus_tag="STY0588"
                     /EC_number="1.5.1.5"
                     /EC_number="3.5.4.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006818895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional methylenetetrahydrofolate
                     dehydrogenase/methenyltetrahydrofolate cyclohydrolase
                     FolD"
                     /protein_id="WP_000729163.1"
                     /translation="MAAKIIDGKTIAQQVRSEVAQKVQARVAAGLRAPGLAVVLVGSN
                     PASQIYVASKRKACDEVGFVSHSYDLPETTSEAELLALIDTLNADNTIDGILVQLPLP
                     AGIDNVKVLERIAPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTYGL
                     NAVVIGASNIVGRPMSMELLLAGCTTTVTHRFTKDLRHHVEHADLLIVAVGKPGFIPG
                     EWIKEGAIVIDVGINRLENGKVVGDVVFDEAAARASYITPVPGGVGPMTVATLIENTL
                     QACIEYHDPQGK"
     gene            596077..596631
                     /gene="fimA"
                     /locus_tag="STY_RS02750"
                     /old_locus_tag="STY0589"
     CDS             596077..596631
                     /gene="fimA"
                     /locus_tag="STY_RS02750"
                     /old_locus_tag="STY0589"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459538.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein subunit FimA"
                     /protein_id="WP_000681037.1"
                     /translation="MKHKLMTSTIASLMFVAGAAVAADPTPVSVSGGTIHFEGKLVYA
                     ACAVSTKSADQTVTLGQYRTASFTAIGDTTAQVPFSIVLNDCDPKVAATAAVAFSGQA
                     DNTNTNLLAVSSADNSTTATGVGIEILDNTSSPLKPDGATFSAKQALVEGTNTLRFTA
                     RYKATAAATPGQANADATFIMKYE"
     gene            596706..597239
                     /gene="fimI"
                     /locus_tag="STY_RS02755"
                     /old_locus_tag="STY0590"
                     /pseudo
     CDS             596706..597239
                     /gene="fimI"
                     /locus_tag="STY_RS02755"
                     /old_locus_tag="STY0590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459539.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein subunit FimI"
     gene            597283..597975
                     /gene="fimC"
                     /locus_tag="STY_RS02760"
                     /old_locus_tag="STY0592"
     CDS             597283..597975
                     /gene="fimC"
                     /locus_tag="STY_RS02760"
                     /old_locus_tag="STY0592"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbria chaperone FimC"
                     /protein_id="WP_001764009.1"
                     /translation="MLNSIKLGFIVLLTLFTSLNVQAAGGIALGATRVIYPSAAKQTS
                     LAISNSDTQERYLVNSWIENNAGQKEKTFIVTPPLFVSEPKSENTLRIIYAGQPLPED
                     RESLFWMNVKAIPSVDKSHIEGKNVLQLAILSRIKLFVRPANLPQTPEDAPTLLKFSR
                     VGNHLKITNPSAYYLTLVNISVGAKKIDNVMIAPKSDMQIPLPTGAQGSVTFQTVNDY
                     GALTSATTASLG"
     gene            598006..600618
                     /locus_tag="STY_RS02765"
                     /old_locus_tag="STY0593"
     CDS             598006..600618
                     /locus_tag="STY_RS02765"
                     /old_locus_tag="STY0593"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial biogenesis usher protein"
                     /protein_id="WP_000754216.1"
                     /translation="MKKTTWFAGRFPGYVSPLSGVALSVLAALCPLTSRGESYFNPAF
                     LSADTASVADLSRFEKGNHQPPGIYRVDIWRNDEFVATQDIRFEAGAVGAGDKSGGLM
                     PCFTPERIKRLGVNTAVFPVSDKGVDTTCIHLPEKIPGAEVAFDFASMRLNISLPQAS
                     LLNSARGYIPPEEWDEGIPAALINYSFTGSRGTDSDSYFLSLLSGLNYGPWRLRNNGA
                     WSYSKGDGYHSQRWNNIGTWVQRAIIPLKSELVMGDSHTGNDVFDSVGFRGARLYSSD
                     NMYPDSLQGYAPTVRGIARTAAKLTIRQNGYVIYQSYVPPGAFAITDLNPTSSSGDLE
                     VTVDEKDGSQQRYTVPYSTVPLLQREGRVKYDLVAGDFRSGNSQQSSLFFFQGTVIAG
                     LPAGLTAYGGTQLADRYRAVVVGAGQNLGDWGAVSVDVTHARSQLADDSTHQGQSLRF
                     LYAKSLNNYGTNFQLLGYRYSTRGFYTLDDVAYRSMEGYDYEYDSDGRRHKVPVAQSY
                     HNLRYSKKGRFQVNISQNLGNYGSLYLSGSQQNYWNTADTNTWYQLGYASGWQGISYS
                     LSWSWSESVGISGADRILAFNMSVPFSVLTGRRYARDTILDRTYATFNANRNRDGDNS
                     WQTGVGGTLLEGRNLSYSVTQGRSSTNGHSGSASASWQATYGTLGVGYNYDRDQHDYN
                     WQLSGGVVGHTDGITFSQPLGDTNVLIKAPGAKGVRIENQTGVKTDWRGYAVMPYATV
                     YRYNRVALDTNTMDNHTDVENNVSSVVPTEGALVRAAFDTRIGVRAIITARLGGRPLP
                     FGAIVRETASGITSMVGDDGQIYLSGLPLKGELFIQWGEGKNARCIAPYALAEDSLKQ
                     AITIASATCIRPSS"
     gene            600633..601640
                     /gene="fimH"
                     /locus_tag="STY_RS02770"
                     /old_locus_tag="STY0594"
     CDS             600633..601640
                     /gene="fimH"
                     /locus_tag="STY_RS02770"
                     /old_locus_tag="STY0594"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrin D-mannose specific adhesin FimH"
                     /protein_id="WP_000708646.1"
                     /translation="MKIYSALLLAGTALFFTHPALATVCRNSNGTATDIFYDLSDVFT
                     SGNNQPGQVVTLLKKSDWCGVNATCPAGTTVNYTYRSYVSELPVQSTEGNFKYLKLND
                     YLLGAMSITDSVAGVFYPPRNYIRMGVDSNVSQQKPFGVQDSKLVFKLKVIRPFINIV
                     TIPRQTMFTVYVTTSTGDALSTPVYTISYSGKVEVPQNCEVNAGQVVEFDFGDIGAPL
                     FSQAGAGNRPQGVTPQAKTIAIKCTNVAAQAYLSMRLEAEKASGQAMVSDNPDLGFVV
                     ANSNGTPLTPNNLSSKIPFHLDDNAAARVGIRAWPISVTGNKPAEGPFTARGYLRVDY
                     D"
     gene            601650..602168
                     /gene="sfmF"
                     /locus_tag="STY_RS02775"
                     /old_locus_tag="STY0595"
     CDS             601650..602168
                     /gene="sfmF"
                     /locus_tag="STY_RS02775"
                     /old_locus_tag="STY0595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria assembly protein"
                     /protein_id="WP_000603408.1"
                     /translation="MILRRVFIAIGCVLLSPLSQANSSLGEVNIELRGNVVDFTCAVV
                     AGDSNKSVNLGTWPTKQLHVAGDATQPVAFSLKLEGCPPGSASITFSGTPAPGTALLA
                     LADTAMAQKLAIEIRDGDQRRLPLEQASKAVDIDNNGNATLKFYANYIALADGVQPGL
                     ANADATFLINYN"
     gene            complement(602214..602846)
                     /gene="fimZ"
                     /locus_tag="STY_RS02780"
                     /old_locus_tag="STY0596"
     CDS             complement(602214..602846)
                     /gene="fimZ"
                     /locus_tag="STY_RS02780"
                     /old_locus_tag="STY0596"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria biosynthesis transcriptional regulator
                     FimZ"
                     /protein_id="WP_000801270.1"
                     /translation="MKPASVIIMDEHPIVRMSIEVLLGKNSNIQVVLKTDDSRTAIEY
                     LRTYPVDLVILDIELPGTDGFTLLKRIKSIQEHTRILFLSSKSEAFYAGRAIRAGANG
                     FVSKRKDLNDIYNAVKIILSGYSFFPSETLNFISNTRPPKGGHHDMPLSNREVTVLRY
                     LANGMSNKEIAEQLLLSNKTISAHKANIFSKLGLHSIVELIDYAKSHELL"
     gene            complement(603450..604172)
                     /gene="fimY"
                     /locus_tag="STY_RS02785"
                     /old_locus_tag="STY0598"
     CDS             complement(603450..604172)
                     /gene="fimY"
                     /locus_tag="STY_RS02785"
                     /old_locus_tag="STY0598"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria biosynthesis regulator FimY"
                     /protein_id="WP_001258098.1"
                     /translation="MRSVPCRERHRRLRNAKDCACRYHSPTPQIFDRLELLNQQLNYA
                     LPVGIISQAIITTDNYLGYSLSHYLFSGKRTAAFRSLDDISLWIEKGSLRQLIVDMET
                     LPVSCIEALNQLHALSWQQSDIQIYLLVSDKTPAIAQFIRMAGRFFVLSRRQNLASVR
                     EALLSAAEPRLSESFSRTDWLMIETLAQGASLKEIARQQSVPYHRVVYRLKQLITLLN
                     LPHRQSFLRLIQQLNVTFHDIF"
     gene            complement(604191..604502)
                     /locus_tag="STY_RS02790"
                     /old_locus_tag="STY0599"
     CDS             complement(604191..604502)
                     /locus_tag="STY_RS02790"
                     /old_locus_tag="STY0599"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_000226497.1"
                     /translation="MVAQGTLLKERINPPHLASSPTRHSYLNSGLLKSEPIVHLSTAQ
                     LIGYEVLTQLPSEHDSEVFFQQLMLMEGIETSEQRGIAFYAGATMGQGYLWPAILPDI
                     Y"
     gene            complement(604664..605260)
                     /gene="fimW"
                     /locus_tag="STY_RS02795"
                     /old_locus_tag="STY0600"
     CDS             complement(604664..605260)
                     /gene="fimW"
                     /locus_tag="STY_RS02795"
                     /old_locus_tag="STY0600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria biosynthesis transcriptional regulator
                     FimW"
                     /protein_id="WP_000948632.1"
                     /translation="MLSIAIKEQNSHFEHGLKIIMTRLANQWQQKIDFLPPEEIDNAD
                     IAFLTLDDDWFSAGCYQIPMHTQHQLRVIICNKCDKEKLMFRPCLYMLPHIYREDDVE
                     EITRKMILILHKRALRHSVPSGICHYCTTRHFSVTERHLLKLIASGYHLSETAALLSL
                     SEEQTKSLRRSIMRKLHVKTEQQFLKYIRVNLHFLLSK"
     gene            605515..605591
                     /locus_tag="STY_RS02800"
                     /old_locus_tag="STYt005"
     tRNA            605515..605591
                     /locus_tag="STY_RS02800"
                     /old_locus_tag="STYt005"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:605549..605551,aa:Arg,seq:tct)
     gene            complement(<605613..>605735)
                     /locus_tag="STY_RS02805"
                     /old_locus_tag="STY0602"
                     /pseudo
     CDS             complement(<605613..>605735)
                     /locus_tag="STY_RS02805"
                     /old_locus_tag="STY0602"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_415069.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
     gene            complement(605707..606374)
                     /locus_tag="STY_RS02810"
                     /pseudo
     CDS             complement(605707..606374)
                     /locus_tag="STY_RS02810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611920.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(606760..608412)
                     /locus_tag="STY_RS02815"
                     /old_locus_tag="STY0605"
     CDS             complement(606760..608412)
                     /locus_tag="STY_RS02815"
                     /old_locus_tag="STY0605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_077905070.1"
                     /translation="MGRKMVNNRLKMVIAILIVFSLVYSIGFITPMNSDDYTYALREL
                     SLSSVKMHYLGWSGRVVSDTLSTSLLKFFSPHIYNAINSAALTLMVLCWTMIPATLTK
                     SSPSPYVMIFLFFLYFIANPALGQTNFWLVGLANYLWTNMFIAIYILISIYLSNAKKS
                     NLILFVYAISSIFAGCSNENTSLVVVLISVAYFFIMNRNKYLLIGVFGSAIGAGVLLL
                     APGNLSRASTIQDWYNQPLAWRVLEHFSERLPSAMGAYWQVYIAFIILLISVVLSRNS
                     SSKLMFGSFLFILGAIAANVAFLASPAMPSRALNGALCFMILSISFVAHSAFTKFNKA
                     SIYLSITTYAMAFLYFIPSYILYYSSIKSISKQTEIREEIIDRAKDNKQDQAIIPDYY
                     FPPVLHAGPSLDTFNSEAMSRYYGIDVKITAPGFFDYSRAFNLKPLNINAKICNNVYI
                     KSLWIYKQQMGIKTFVIFEFNKNPADSLDENTAMFISLKTKDGKVINADVDKKTFQID
                     GRWLSGRAINGIDSNELESITSGTWDVRTGARTNENITEIIK"
     gene            complement(608393..609319)
                     /locus_tag="STY_RS02820"
                     /old_locus_tag="STY0606"
     CDS             complement(608393..609319)
                     /locus_tag="STY_RS02820"
                     /old_locus_tag="STY0606"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_000703607.1"
                     /translation="MKISLVVPVFNEEATIPIFYKTVREFEELKPYEVEIVFINDGSK
                     DATESIINKIAASDPLVIPLSFTRNFGKEPALFAGLDHATGDAVIPIDVDLQDPIEVI
                     PHLIEKWQAGADMVLAKRSDRSTDGRMKRKTAEWFYKLHNKISNPKIEENVGDFRLMS
                     RDVVENIKQMPERNLFMKGVLSWVGGKTDVVGYARAERVAGDSKFNGWKLWNLALEGI
                     TSFSTFPLRIWTYIGLFIAGMSFLYGTWMIIDKLIFGNNVPGYPSLLVSVLFLGGVQL
                     IGIGILGEYIGRIYIETKKRPKYIIKNGKKNG"
     gene            complement(609316..609678)
                     /locus_tag="STY_RS02825"
                     /old_locus_tag="STY0607"
     CDS             complement(609316..609678)
                     /locus_tag="STY_RS02825"
                     /old_locus_tag="STY0607"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GtrA family protein"
                     /protein_id="WP_000915523.1"
                     /translation="MLKLFAKYTSIGVLNTLIHWGVFAFCVYGMHTHQALANFSGFVI
                     AVSFSFYANARFTFNASTTTLRYMMYVGFMGTLSAVVGWMADKCSLPPLLTLVTFSAI
                     SLICGFIYSKFIVFRDAK"
     gene            complement(610081..610392)
                     /locus_tag="STY_RS02830"
                     /old_locus_tag="STY0609"
     CDS             complement(610081..610392)
                     /locus_tag="STY_RS02830"
                     /old_locus_tag="STY0609"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001032257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031624284.1"
                     /translation="MNKFTSLLAVVFISAGVHTAEKMESRQLSATAHEMMNNGDAFAH
                     QQMAQTQKPSAPTTVENATPFSEMDDYEKAMVIHQSMNNAHSFSHEIQAEEHHKQIKR
                     N"
     gene            complement(610524..>610719)
                     /locus_tag="STY_RS02835"
                     /old_locus_tag="STY0609a"
                     /pseudo
     CDS             complement(610524..>610719)
                     /locus_tag="STY_RS02835"
                     /old_locus_tag="STY0609a"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459553.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            610623..610835
                     /locus_tag="STY_RS02840"
                     /old_locus_tag="STY0610"
     CDS             610623..610835
                     /locus_tag="STY_RS02840"
                     /old_locus_tag="STY0610"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_095075270.1"
                     /translation="MPGLYRGLPLYAGGREQRDKNDRKGAGSEVMSRIATPMIGGMIT
                     APLLSLFIIPAAYKLMWLRRHRRLAA"
     gene            complement(610886..611740)
                     /locus_tag="STY_RS02845"
                     /old_locus_tag="STY0611"
     CDS             complement(610886..611740)
                     /locus_tag="STY_RS02845"
                     /old_locus_tag="STY0611"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_000339629.1"
                     /translation="MDALSRLLTLNAPQGSIDKNCPLGGDWQLPHAAGELSVIRWHTV
                     TQGEAQLEMPTGDAMTLTPGKVVILPQNSAHRLRQSGEAPTHIVCGSLRLHTTSRYFL
                     TALPEVLCLAPPPHSPASIWLNAAISLLQQESERHLPGADVLYSQQCATLFTLAIRDW
                     LSQAGTAKSVLNLLLHPRLGRVILHMLETPAHPWTVETLVQRVHMSRASFAQLFRDVS
                     ATTPLAVLTTLRLQIAAQTLSREALPVMVIAESVGYASESSFHKAFVREFGCTPGEYR
                     KRVNALGR"
     gene            611956..613281
                     /locus_tag="STY_RS02850"
                     /old_locus_tag="STY0612"
     CDS             611956..613281
                     /locus_tag="STY_RS02850"
                     /old_locus_tag="STY0612"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="WP_000195937.1"
                     /translation="MTQYQALIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCI
                     NIGCIPTKTLVYDAEREGDFSVAMQRKAAVVNFLRDKNFHNLADLDNVDVIEGRAEFI
                     DNHTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGVFDSTGLLSLSQRPAR
                     LGILGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDRDIAQAITHILQEKGVELIL
                     NANVQAVSSTEGAVQVETPEGAHLVDALLVASGRKPATAGLQLQNAGVAVNERGGIIV
                     DDYLRTTADNIWAMGDVTGGLQFTYISLDDFRIVRDGLLGDGKRSTRDRQNVPYSVFM
                     TPPLSRVGLTEEQARASGATVQVVTLPVAAIPRARVMNDTRGVLKAVVDVNTQRIVGV
                     SLLCVDSHEMINIVKTVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK"
     gene            613438..613674
                     /locus_tag="STY_RS02855"
                     /old_locus_tag="STY0613"
     CDS             613438..613674
                     /locus_tag="STY_RS02855"
                     /old_locus_tag="STY0613"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1471 domain-containing protein"
                     /protein_id="WP_000922170.1"
                     /translation="MLKVTTLIASLLAAPLAFSASAQPLTDVEYISVSAVSATPSMLE
                     DAIARLAQSKQASSWKITSMRIDNTGYATAILYK"
     gene            613687..614247
                     /locus_tag="STY_RS02860"
                     /old_locus_tag="STY0614"
     CDS             613687..614247
                     /locus_tag="STY_RS02860"
                     /old_locus_tag="STY0614"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YkgB family protein"
                     /protein_id="WP_000362177.1"
                     /translation="MDKYLRLLSQGDRLGLTLIRLSIAIVFIWIGLLKFVPYEADSIT
                     PFVANSPFMSFFYEHPEEYRQHLTHEGELKPEERAWQTANNTYAFSDGLGVVELIIAA
                     LVLANPVSRWLGLAGGVLAFLTPFVTLSFLITTPEAWVMPLGDAHYGFPYLSGAGRLV
                     LKDTLMLAGAVMIMADSARSLLLQRQ"
     gene            complement(614326..615501)
                     /locus_tag="STY_RS02865"
                     /old_locus_tag="STY0615"
                     /pseudo
     CDS             complement(614326..615501)
                     /locus_tag="STY_RS02865"
                     /old_locus_tag="STY0615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459559.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein"
     gene            615827..617221
                     /gene="pheP"
                     /locus_tag="STY_RS02870"
                     /old_locus_tag="STY0617"
     CDS             615827..617221
                     /gene="pheP"
                     /locus_tag="STY_RS02870"
                     /old_locus_tag="STY0617"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanine transporter"
                     /protein_id="WP_000786293.1"
                     /translation="MKNASTASGASVSDAASKNEPTLQRGLQNRHIQLIALGGAIGTG
                     LFLGIGPAIQMAGPAVLLGYGVAGIIAFLIMRQLGEMVVEEPVSGSFAHFAWKYWGPF
                     AGFLSGWNYWVMFVLVGMAELTAAGIYMQYWLPDVPTWVWAAVFFIIINAVNLVNVRL
                     YGETEFWFALIKVLAIIGMIGFGLWLLFSGHGGEHASIDNLWRYNGFFATGWHGLLLS
                     LAVIMFSFGGLELIGITAAEARDPQKSIPKAVNQVVYRILLFYIGSLVVLLALYPWVE
                     VKSNSSPFVMIFHNLDSNVVASALNFVILVASLSVYNSGVYSNSRMLFGLSVQGNAPK
                     FLTRVSHRGVPVNSLMLSGAITSLVVLINYLLPQKAFSLLMALVVATLLLNWIMICLA
                     HLRFRAAMRRKGRETQFKALFYPAGNYLCIAFLALILVLMCTMDDMRLSAILLPVWIV
                     FLFIAFTVLRRKAH"
     gene            complement(617263..618510)
                     /locus_tag="STY_RS02875"
                     /old_locus_tag="STY0618"
     CDS             complement(617263..618510)
                     /locus_tag="STY_RS02875"
                     /old_locus_tag="STY0618"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel family protein"
                     /protein_id="WP_001156971.1"
                     /translation="MQELISQVEDLAGIEMNHTTSLVVIFGIIFLTAVVVHIILHWIV
                     LRAFEKRASASSRLWLQIITQNKLFHRLAFTLQGIIVNIQAALWLQKGSEAADILTTC
                     AQLWIMTYALLSLFSLLDVIFNLSQKWPAASQLPLKGIFQGIKLIGAIIVGILMISLL
                     IGQSPAILISGLGAMAAVLMLVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGA
                     VIDIGLTTVKVRNWDNTITTIPTWSLVSDSFKNWSGMSASGGRRIKRSINIDATSIHF
                     LDDDEKQRLLTAQLLKPYLTSRHQEIDEWNKQLDAPESALNHRRMTNIGTFRAYLNEY
                     LRHHPRIRKDMTLMVRQLAPDDHGLPIEIYAFTNTVVWLEYESIQADIFDHIFAVVEE
                     FGLRIHQTPTGSDIRALSGTLRH"
     gene            618821..620791
                     /locus_tag="STY_RS02880"
                     /old_locus_tag="STY0619"
     CDS             618821..620791
                     /locus_tag="STY_RS02880"
                     /old_locus_tag="STY0619"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter domain-containing protein"
                     /protein_id="WP_000192421.1"
                     /translation="MTQKRTLLKYGILSLALAAPLSACAFDSLTVIGDSLSDTGNNGR
                     WTWDSGQNKLYDEQLAERYGLALSPSSNGGSNYAAGGAMTAPELNPQDNTADQVRQWL
                     ANTGGKADHNGLYIHWVGGNDLAAAIARPAMAQQIAGNSATSAAAQVGLLLDAGAGLV
                     VVPNVPDISATPELLEAVITAGLGAAAPPALKAALEALAEGATPDFASRQQAIRKALL
                     AAAATVSSNPFIQQLLVEQLLAGYEKVAEQASALTDYYNQMEEKGLEQHGGNIARADI
                     NGLFKEILANPQAFGLTNTVGMACPPGVSASVCSSAMPGFNASQDYLFADHLHPGPQV
                     HTIIAQYIQSIIAAPVQATYLNQSVQSMAQGSRTTLDSRYQQLRQGENPVGSLGMFGG
                     YSGGYQRYDNNEADGNGNHNNLTVGVDYQLNEQVLLGGLIAGSLDKQHPDDNYRYDAR
                     GFQAAVFSHLRAGQAWLDGDLHYLSAKFSNIQRSITLGALRRVEEGETNGRLWGARLT
                     SGYDFVMMPWLTTGPMLQYAWDYSHVNGYSEKLNTSTSMRFGDQNAHSQMGSVGWRLD
                     LRHSIIHSWAQINYRRQFGDDTYVANGGLKSTALTFSRAGKAQDKNWVDIAIGADFPL
                     SATVSAFAGLAQTAGLSDGNQTRYNVGFSARF"
     gene            complement(<620821..620946)
                     /locus_tag="STY_RS02885"
                     /pseudo
     CDS             complement(<620821..620946)
                     /locus_tag="STY_RS02885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459569.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="PTS mannose transporter subunit IIAB"
     gene            complement(621146..621799)
                     /gene="nfsB"
                     /locus_tag="STY_RS02890"
                     /old_locus_tag="STY0620"
     CDS             complement(621146..621799)
                     /gene="nfsB"
                     /locus_tag="STY_RS02890"
                     /old_locus_tag="STY0620"
                     /EC_number="1.5.1.34"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-insensitive NAD(P)H nitroreductase"
                     /protein_id="WP_000355874.1"
                     /translation="MDIVSVALKRYSTKAFDPSKKLTAEEADKVKTLLQYSPSSTNSQ
                     PWHFIVASTEEGKARVAKSAAGNYTFNERKMLDASHVVVFCAKTAMDDAWLQRVVDQE
                     DADGRFATPEAKAANDKGRRFFADMHRVSLKDDHQWMAKQVYLNVGNFLLGVAAMGLD
                     AVPIEGFDAEVLDAEFGLKEKGYTSLVVVPVGHHSIEDFNAGLPKSRLPLETTLTEV"
     gene            complement(621896..622264)
                     /locus_tag="STY_RS02895"
                     /old_locus_tag="STY0621"
     CDS             complement(621896..622264)
                     /locus_tag="STY_RS02895"
                     /old_locus_tag="STY0621"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MmcQ/YjbR family DNA-binding protein"
                     /protein_id="WP_000348987.1"
                     /translation="MDGQTLHACAKRFALELPFTEHCWPFGPQYDVFKVGGKIFMLFT
                     EHHCRPVVNLKSAPQKSLVNQQIYPSIAPGYHMNKKHWISVYAGEDITVSLLNDLIND
                     SWNLVVDGLPKREQLRLRPR"
     gene            complement(622264..622845)
                     /locus_tag="STY_RS02900"
                     /old_locus_tag="STY0622"
     CDS             complement(622264..622845)
                     /locus_tag="STY_RS02900"
                     /old_locus_tag="STY0622"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_000113603.1"
                     /translation="MARPKSEDKKQALLEAATQAIAQSGIAASTAVIARNAGIAEGTL
                     FRYFATKDELINTLYLHLKQNLCQSMIMELDRSITDAKTMTRFIWNSYISWGLNHPAR
                     HRAIRQLAVSEKITKETEQRADDMFPELRDLCHRSVLMVFMSDEYRAFGDGLFLALAE
                     TTMDFAARDPARAGEYIALGFEAMWRALTREEQ"
     gene            623134..623475
                     /gene="ramA"
                     /locus_tag="STY_RS02905"
                     /old_locus_tag="STY0624"
     CDS             623134..623475
                     /gene="ramA"
                     /locus_tag="STY_RS02905"
                     /old_locus_tag="STY0624"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RamA family antibiotic efflux transcriptional
                     regulator"
                     /protein_id="WP_000155638.1"
                     /translation="MTISAQVIDTIVEWIDDNLNQPLRIDDIARHAGYSKWHLQRLFM
                     QYKGESLRRYVRERKLKLAARDLRDTDQKVYDICLKYGFDSQQTFTRIFTRTFNLPPG
                     AYRKEKHGRTH"
     gene            complement(623481..623729)
                     /locus_tag="STY_RS02910"
                     /old_locus_tag="STY0625"
     CDS             complement(623481..623729)
                     /locus_tag="STY_RS02910"
                     /old_locus_tag="STY0625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1158 family protein"
                     /protein_id="WP_000682500.1"
                     /translation="MKHPLESLMTAAGILLMALLSSLLLPAPSLGLALAQKLVGIFHL
                     MDLNQLYTLLFCLWFLLLGTLEYYVIRFIWRRWFSLAD"
     gene            complement(623796..624914)
                     /locus_tag="STY_RS02915"
                     /old_locus_tag="STY0626"
     CDS             complement(623796..624914)
                     /locus_tag="STY_RS02915"
                     /old_locus_tag="STY0626"
                     /EC_number="6.3.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_001196914.1"
                     /translation="MALNDFHVSEPYTLGIELEMQVINPPGYDLSQDSSTLIDAVKPQ
                     LTAGEIKHDITESMLEMATGVCRDIDQVAAQLSAMQHVILQAASEHHLGICGGGTHPF
                     QKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCANGDDAIYLLHGLSHFVPH
                     FIALSAASPYMQGSDTRFACARLNIFSAFPDNGPMPWVSNWQEFAGLFRRLSYTTMID
                     SIKDLHWDIRPSPAFGTVEVRVMDTPLTLDHAINMAGLIQATAHWLLTERPFKPQEQD
                     YLLYKFNRFQACRYGLEGVLTDVYTGDRRRLADDTLRLLDNVTPSARKLGADSAIDAL
                     RLQVKKGGNEAQYMREFIADGGSLIGLVQKHCEIWAGQ"
     gene            complement(624926..625630)
                     /gene="entD"
                     /locus_tag="STY_RS02920"
                     /old_locus_tag="STY0627"
     CDS             complement(624926..625630)
                     /gene="entD"
                     /locus_tag="STY_RS02920"
                     /old_locus_tag="STY0627"
                     /EC_number="6.3.2.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin synthase subunit EntD"
                     /protein_id="WP_001681620.1"
                     /translation="MLTSHFPLPFAGHRLHIVDFDASSFHEHDLLWLPHHDRLRSAGR
                     KRKAEHLAGRIAAVHALREVGVRAVPGIGDKRQPLWPDGLFGSISHCASTALAVISRQ
                     RVGVDIEKIMSQHTATELAPSIIDSDERQILQASSLPFPLALTLAFSAKESVYKAFSD
                     RVTLPGFDSAKITSLNATHISLHLLPAFAAMMAERTVRTEWFQRGNSVITLVSAITRF
                     PHDRSAPASILSAIPR"
     gene            complement(625677..627932)
                     /locus_tag="STY_RS02925"
                     /old_locus_tag="STY0628"
     CDS             complement(625677..627932)
                     /locus_tag="STY_RS02925"
                     /old_locus_tag="STY0628"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="WP_001034967.1"
                     /translation="MNKKIHSLTLLVNLGIYGAALPVMAEEKTDSAALTNEDTIVVTA
                     AQQNLQAPGVSTITADEIRKNPPARDVSEIIRTMPGVNLTGNSTSGQRGNNRQIDIRG
                     MGPENTLILIDGKPVTSRNSVRLGWRGERDTRGDTAWVPPEMIERIEVLRGPAAARYG
                     NGAAGGVVNIITKKGGSEWHGSWNTYFNAPEHKDEGATKRTNFSLNGPLGGDFSFRLY
                     GNLDKTQADARNINQGHQSERTGSYADTLPAGREGVINKDINGVVRWDFAPLQSLELE
                     AGYSRQGNLYAGDTQNTNTNQLVKDNYGKETNRLYRQNYSLTWNGGWDNGVTTSNWVQ
                     YEHTRNSRMPEGLAGGTEGIFDPKASQKYADADLNDVTLHSEVSLPFDLLVNQNLTLG
                     TEWAQQRMKDQLSNSQTFMGGNIPGYSSTNRSPYSKAEIFSLFAENNMELTDSTMLTP
                     GIRFDHHSIVGDNWSPSLNLSQGLGDDFTLKMGIARAYKAPSLYQTNPNYILYSKGQG
                     CYATGAGTGIGCYMMGNDDLKAETSINKEIGLEFKRDGWLAGVTWFRNDYRNKIEAGT
                     VPLQRINNGKTDVYQWENVPKAVVEGLEGTLNVPVSDTVNWTNNVTYMLQSKNKETGE
                     RLSIIPQYTLNSTLSWQVRQDVSLQSTFTWYGKQEPKKYDYQGNPVTGTDKQAVSPYS
                     IVGLSATWDVTKNVSLTGGVDNLFDKRLWREGNAQTVRDTQTGAYMAGAGAYTYNEPG
                     RTWYMSINTHF"
     gene            628121..629335
                     /gene="fes"
                     /locus_tag="STY_RS02930"
                     /old_locus_tag="STY0629"
     CDS             628121..629335
                     /gene="fes"
                     /locus_tag="STY_RS02930"
                     /old_locus_tag="STY0629"
                     /EC_number="3.1.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enterochelin esterase"
                     /protein_id="WP_000656592.1"
                     /translation="MKEALATGSEAWWRTKTGPEWIREKDGNYRVTFWWRDPQGNETH
                     SPIRRVWVYITGVTDHHQNAQPQTMARIAGTDVWRWSTALSANWRGSYCFIPTERDDV
                     FAAFAPGETPDRNALREGWRQLLPQAIADPLNSQSWRGGRGHAVSALEMPDAPRQPGW
                     DRPETSYSPPLMMQWHSERLGNSRRVWILTTGDEATEERPLAILLDGQFWAENMPVWP
                     ALASLTHQRLLPGAVYLLIDAIDTQHRNQELPCNADFWLAVQQELLPQVRAVTPFSDD
                     AGRTVVAGQSFGGLSALYAGLNWPTRFGCVLSQSGSFWWPHRITPPEGEVITRLKTGA
                     LCARGLRIVLEAGVREPIVFQANQALYAQLNTSQQSIFWRQVDGGHDALCWRGGLTQG
                     LMLLWQPLIDTL"
     gene            629366..629584
                     /locus_tag="STY_RS02935"
                     /old_locus_tag="STY0630"
     CDS             629366..629584
                     /locus_tag="STY_RS02935"
                     /old_locus_tag="STY0630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MbtH family protein"
                     /protein_id="WP_000396011.1"
                     /translation="MEFSNPFDNPQGQFYILQNAQRQFSLWPAACALPAGWGVVCEPQ
                     SQDACQQWLNTRWTTLNPAHYADKQEAK"
     gene            629581..633465
                     /gene="entF"
                     /locus_tag="STY_RS02940"
                     /old_locus_tag="STY0631"
     CDS             629581..633465
                     /gene="entF"
                     /locus_tag="STY_RS02940"
                     /old_locus_tag="STY0631"
                     /EC_number="6.3.2.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin non-ribosomal peptide synthetase
                     EntF"
                     /protein_id="WP_000194158.1"
                     /translation="MTQRLPLVAAQPGIWMAEKLSDLPSAWSVAHYVELNGELDAPLL
                     AKAVAVGMQQADTLRMRFTEENGEVWQWIDPEHTFGEPPIADLRDQPDPHLAALALMQ
                     ADLRQNLRADSGKPLAFHQLIRIDDTRWYWYQRYHHLLVDGFSFPAITRQIAAIYRAW
                     QSDAPTPESPFTPFVDVVEEYQRYRQSEAWQRDGAFWAQQRRELPPPASMSAAPLPGR
                     SASADILRMKLSAPAGAFRQLAAHMPEIPRADLALALVTLWLGRLCGRMDYAAGFIFM
                     RRMGSAALTATGPVLNVLPLAVNLHATEDLPTLAKRLAAQLKKMRRHQRYDAEQIVRD
                     SGRAAGETPLFGPVLNIKVFDYHLDFPGIQAQTHTLATGPVNDLELALFPDENGGLDI
                     ELLANAQRYDDATLSRHALRLMALITQFADNPALRCGDAQMLLAEEQTQLTHLNNTAV
                     TIPAATLSDLVAQQAQKTPEASALADAHYHFTYREMREQVVALAYALRERGVQPGDSV
                     AVALPRSVFLTLALHGIVEAGAAWLPLDTGYPDDRLRMMLEDAQPKLLITTQAQLARF
                     HDIPGMEYLCYSQPLPVSDATPLGLSLPHHTAYIIFTSGSTGRPKGVMVGQTAIVNRL
                     LWMQDHYPLTADDVVAQKTPCSFDVSVWEFFWPFIAGAKLVMAEPEAHRDPLAMQRFF
                     AQYGVTTTHFVPSMLAAFIASLTPASAGKSCASLKRVFCSGEALPTALCREWETLTNA
                     PLHNLYGPTEAAVDVSWYPACGDELAAVDGNSIPIGYPVWNTGLRILDAHMQPVPPGV
                     AGDLYLTGIQLAQGYLGRPDLTASRFIADPFAPGERMYRTGDVARWLDSGVVEYLGRS
                     DDQLKIRGQRIELGEIDRVMQTLPDVEQAVAHACVFNQAAATGGDARQLVGYLVSHSG
                     LPLDLPALQDKLRQKLPAHMVPVVLLQLASLPLSANGKLDRKALPLPDLTPRVKGRAP
                     QSATEIAVAAAFSRLLGCEINDVESDFFALGGHSLLAMKLAAQLSQTFNRQVTPGQVM
                     VASDVAQLSKLLDTDDDERSRNLGFGPLLPLRESDGPTLFCFHPASGFAWQFSVLSRY
                     LSPSWSIMGIQSPRPVGPMQIATTLDEVCEHHLATLLARQPHGPYYLLGYSLGGTLAQ
                     GIAARLRARGETVAFLGLLDTWPPETQNWRGKEANGLNPDVLAEIERERAAFVAAQQG
                     NASDALFTAIEGNYADAVRLLTTAHSAPFDGHATLFVADKTVPEDVSPEQSWSPWIAS
                     LAIYRQPCAHVDIISPSAFETIGPIISELINK"
     gene            633715..634851
                     /gene="fepE"
                     /locus_tag="STY_RS02945"
                     /old_locus_tag="STY0632"
                     /pseudo
     CDS             633715..634851
                     /gene="fepE"
                     /locus_tag="STY_RS02945"
                     /old_locus_tag="STY0632"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459581.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="LPS O-antigen length regulator"
     gene            complement(634904..635698)
                     /gene="fepC"
                     /locus_tag="STY_RS02950"
                     /old_locus_tag="STY0634"
     CDS             complement(634904..635698)
                     /gene="fepC"
                     /locus_tag="STY_RS02950"
                     /old_locus_tag="STY0634"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-enterobactin ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_000140620.1"
                     /translation="MTESVARLRGDQLTLGYGSYTVAKNLNVSIPDGHFTAIIGPNGC
                     GKSTLLRTLSRLMTPVDGHVWLDGEQIQRYASKEVARRIGLLAQNATTPGDITVQELV
                     ARGRYPHQPLFTRWRKEDADAVASAMRATGITSLAAQSVDTLSGGQRQRAWIAMVLAQ
                     ETSIMLLDEPTTWLDISHQIDLLELLSDLNREKGYTLAAVLHDLNQACRYATHLIALR
                     EGNIVAQGAPKEIVTAELIEKIYGLRCMIIDDPVAGTPLVVPLGRR"
     gene            complement(635695..636684)
                     /gene="fepG"
                     /locus_tag="STY_RS02955"
                     /old_locus_tag="STY0635"
     CDS             complement(635695..636684)
                     /gene="fepG"
                     /locus_tag="STY_RS02955"
                     /old_locus_tag="STY0635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-enterobactin ABC transporter permease"
                     /protein_id="WP_000480067.1"
                     /translation="MFLSRRLIVSCLLLAAGCFAIGLWSLQSGAVPLETGQIIAALLG
                     DAPRNITLVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSG
                     VLVAMVLFGQHLTAIALAAMAGGIVTSLIVWLLAWRNGIETFRLIIIGIGIRAMLVAF
                     NTWLLLQASLETALTAGLWNAGSLNGLTWAKTWPSAPLIMVMLTGAALLVRRMRLLEM
                     GDDSACALGVSVERSRLMLMLVAVSLTAAATALAGPISFIALVAPHIARRLSGTARWG
                     LTQSALCGALLLLAADACAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
     gene            complement(636684..637691)
                     /gene="fepD"
                     /locus_tag="STY_RS02960"
                     /old_locus_tag="STY0636"
     CDS             complement(636684..637691)
                     /gene="fepD"
                     /locus_tag="STY_RS02960"
                     /old_locus_tag="STY0636"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe(3+)-siderophore ABC transporter permease"
                     /protein_id="WP_001277880.1"
                     /translation="MSCSFSVTRAFAVPGLLLLLSLAAVLSLVIGAKPLPAAVVLEAF
                     TGVCQSADCTIVLDARLPRTLAGLLAGGALGLAGALMQTLTRNPLADPGILGVNNGAS
                     FAIVLGAALFGFSTPLEQLFMAFSGALIASLIVAFTGSQGGGQLSPVRLTLAGVALGA
                     VLEGLTSGIALLNPEVYDQLRFWQAGSLDIRSLQTLKVALAPVVIAGIVALFLSRALN
                     SLSLGSDTATALGSKVARTQLIGLLAITVLCGSATALVGPIAFIGLMMPHMARWLVGA
                     DHRWSLPVTLLATPALLLFADIIGRLLVPGELRVSVVSAFIGAPVLIFLVRRKSSGGG
                     L"
     gene            637802..639046
                     /gene="entS"
                     /locus_tag="STY_RS02965"
                     /old_locus_tag="STY0637"
     CDS             637802..639046
                     /gene="entS"
                     /locus_tag="STY_RS02965"
                     /old_locus_tag="STY0637"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin transporter EntS"
                     /protein_id="WP_001081657.1"
                     /translation="MNRQSWLLNLSLLKTHPAFRAVFLARFISIVSLGLLGVAVPVQI
                     QMMTHSTWQVGLSVTLTGGAMFIGLMVGGVLADRYERKKVILLARGTCGIGFIGLCVN
                     ALLPEPSLLAIYLLGLWDGFFASLGVTALLAATPALVGRENLMQAGAITMLTVRLGSV
                     ISPMLGGILLASGGVAWNYGLAAAGTFITLLPLLTLPRLPVPPQPRENPFIALLAAFR
                     FLLASPLIGGIALLGGLVTMASAVRVLYPALAMSWQMSAAQIGLLYAAIPLGAAIGAL
                     TSGQLAHSVRPGLIMLVSTVGSFLAVGLFAIMPIWIAGVICLALFGWLSAISSLLQYT
                     LLQTQTPENMLGRMNGLWTAQNVTGDAIGAALLGGLGAMMTPVASASVSGFGLVIIGL
                     LLLLVLGELRRFRQTPPVSDAG"
     gene            complement(639109..640065)
                     /gene="fepB"
                     /locus_tag="STY_RS02970"
                     /old_locus_tag="STY0638"
     CDS             complement(639109..640065)
                     /gene="fepB"
                     /locus_tag="STY_RS02970"
                     /old_locus_tag="STY0638"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe2+-enterobactin ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_001239614.1"
                     /translation="MRLSAFYRWLLLVVGLSISGISLAQDAGWPRQIQDSRGVHTLDH
                     KPARIVSTSVTLTGSLLAIDAPVVASGATTPNNRFADDQGFMRQWSDVAKARHVARLY
                     IGEPNAETVAAQMPDLILISATGGDSALALYDQLSAIAPTLVINYDDKSWQSLLTQLG
                     EITGQEKQAAARIAEFEAQLTTVKQRIALPPQPVSALVYTPAAHSANLWTPESAQGKL
                     LTQLGFTLATLPQGLQTSKSQGKRHDIIQLGGENLAAGLNGESLFLFAGDNNDVAALY
                     ANPLLAHLPAVQNKRVYALGTETFRLDYYSATLLLNRLAALF"
     gene            640373..641548
                     /gene="entC"
                     /locus_tag="STY_RS02975"
                     /old_locus_tag="STY0639"
     CDS             640373..641548
                     /gene="entC"
                     /locus_tag="STY_RS02975"
                     /old_locus_tag="STY0639"
                     /EC_number="5.4.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase EntC"
                     /protein_id="WP_000367596.1"
                     /translation="MDMSLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAV
                     AGDSPDSPFQQKLRQQFAEAKSQGIANPILVGAIPFDTRQPSSLFIPMAWQSFSRQQK
                     QRTARYFTDHQPLTVTARKAIPEQDAFEAMVARAAMLTATPDVDKVVLSRLIDITTDV
                     AVDSGALLERLVAQNPVSYNFHVPLADGGVLLGASPELLLRKEGERFSSLPLAGSARR
                     QPDDVLDREAGNRLLASQKDRHEHELVTQAMKQILRDRSTELQLPSSPQLITTPTLWH
                     LGTPFEGKANAGENALTLACLLHPTPALSGFPHQVAKKLIAELEPFDRELFGGIVGWC
                     DAEGNGEWVVTIRCAKLHGNQVRLFAGAGIVPASSPVGEWRETGVKLSTMLNVFGLH"
     gene            641558..643168
                     /gene="entE"
                     /locus_tag="STY_RS02980"
                     /old_locus_tag="STY0640"
     CDS             641558..643168
                     /gene="entE"
                     /locus_tag="STY_RS02980"
                     /old_locus_tag="STY0640"
                     /EC_number="2.7.7.58"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2,3-dihydroxybenzoyl)adenylate synthase"
                     /protein_id="WP_001222444.1"
                     /translation="MRIPFTRWPDEFARRYREKGYWQDVPLTDILTRHADSDKTAVIE
                     GERAFSYRQLNQAADNLACSLRRQGIKPGETALVQLGNVPELYITFFALLKLGVAPVL
                     ALFSHQRTELNAYAMQIAPTLVIADRQHTLFAGEDFLNRFVAEHRSARVVLLRNDDGD
                     HSLDAAMRQAAEGFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSNEIC
                     GFNEETRFLCAIPAAHNYAMSSPGALGVFLAKGTVVLATDPGATLCFPLIEKHQINAT
                     ALVPPAVSLWLQAIQEWGGNAPLASLRLLQVGGARLSATLAARIPAEIGCQLQQVFGM
                     AEGLVNYTRLDDSPERIINTQGRPMCPDDEVWVADADGNPLPPGEIGRLMTRGPYTFR
                     GYFNSPQHNVSAFDANGFYCSGDLISIDQDGYITVHGREKDQINRGGEKIAAEEIENL
                     LLRHPAVIHAALVSMEDELLGEKSCAYLVVKEPLRAVQVRRFLREQGVAEFKLPDRVE
                     CVASLPLTPVGKVDKKQLRQRLASRSPL"
     gene            643182..644039
                     /locus_tag="STY_RS02985"
                     /old_locus_tag="STY0641"
     CDS             643182..644039
                     /locus_tag="STY_RS02985"
                     /old_locus_tag="STY0641"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase"
                     /protein_id="WP_001007162.1"
                     /translation="MAIPKLQSYALPTALDIPTNKVNWAFEPERAALLIHDMQDYFVS
                     FWGRNCPMMDQVIANIAALRQYCKEHHIPVYYTAQPKEQSDEDRALLNDMWGPGLTRS
                     PEQQKVVEALTPDEADTVLVKWRYSAFHRSPLEQMLKDTGRNQLIITGVYAHIGCMTT
                     ATDAFMRDIKPFMVADALADFSREEHLMALNYVAGRSGRVVMTESLLPTPIPASKAAL
                     RALILPLLDETDEPLDDENLIDYGLDSVRMMGLAARWRKVHGDIDFVMLAKNPTIDAW
                     WALLSRGVE"
     gene            644039..644794
                     /gene="dhbA"
                     /locus_tag="STY_RS02990"
                     /old_locus_tag="STY0642"
     CDS             644039..644794
                     /gene="dhbA"
                     /locus_tag="STY_RS02990"
                     /old_locus_tag="STY0642"
                     /EC_number="1.3.1.28"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase"
                     /protein_id="WP_000135726.1"
                     /translation="MASFDFSDKTVWVTGAGKGIGYATALAFVDAGARVIGFDREFTQ
                     ENYPFATEVMDVADAAQVAQVCQRVLQKTPRLDVLVNAAGILRMGATDALNVDDWQQT
                     FAVNVGGAFNLFSQTMAQFRRQQGGAIVTVASDAAHTPRIGMGAYGASKAALKSLALT
                     VGLELAGCGVRCNVVSPGSTDTDMQRTLWVSEDAEQQRIRGFGEQFKLGIPLGKIARP
                     QEIANTILFLASDLASHITLQDIVVDGGSTLGA"
     gene            644797..645210
                     /gene="entH"
                     /locus_tag="STY_RS02995"
                     /old_locus_tag="STY0643"
     CDS             644797..645210
                     /gene="entH"
                     /locus_tag="STY_RS02995"
                     /old_locus_tag="STY0643"
                     /EC_number="3.1.2.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proofreading thioesterase EntH"
                     /protein_id="WP_000637966.1"
                     /translation="MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDA
                     RTHQPFGLLHGGASAALAETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVC
                     LPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAVMG"
     gene            645392..647497
                     /gene="cstA"
                     /locus_tag="STY_RS03000"
                     /old_locus_tag="STY0644"
     CDS             645392..647497
                     /gene="cstA"
                     /locus_tag="STY_RS03000"
                     /old_locus_tag="STY0644"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon starvation protein CstA"
                     /protein_id="WP_001043112.1"
                     /translation="MNKSGKYLVWTALSVLGAFALGYIALNRGEQINALWIVVASVCV
                     YLIAYRFYGLYIAKKVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPL
                     VGPVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGATAG
                     VIVLVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLAIFMGIYLRYLRPGRI
                     GEVSVIGLVFLIFAIISGGWVAASPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLL
                     APRDYLSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGDLFPFLFITIA
                     CGAVSGFHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFA
                     MNSPMAVLAPAGTADVVASAAQVVSSWGFAITPDTLHQIANEVGEQSIISRAGGAPTL
                     AVGMAYILHGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPG
                     LKRTDSLPANLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLC
                     AVVLFKMKRQRYAWVALVPTAWLLICTLTAGWQKAFSPDAKIGFLAIANKFQAMIDSG
                     NIPPQYTESQLAQLVFNNRLDAGLTIFFMVVVVVLAVFSIKTALAALKIDKPTANETP
                     YEPMPENVDEIVTQAKGAH"
     gene            647561..647758
                     /locus_tag="STY_RS03005"
                     /old_locus_tag="STY0645"
     CDS             647561..647758
                     /locus_tag="STY_RS03005"
                     /old_locus_tag="STY0645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012904950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YbdD/YjiX family protein"
                     /protein_id="WP_000460619.1"
                     /translation="MFDTLSKAGKYLGQAAKMMIGVPDYDNYVEHMRITHPDQTPMTY
                     EEFFRERQDARYGGKGGARCC"
     gene            complement(647794..648882)
                     /locus_tag="STY_RS03010"
                     /old_locus_tag="STY0646"
     CDS             complement(647794..648882)
                     /locus_tag="STY_RS03010"
                     /old_locus_tag="STY0646"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_001016858.1"
                     /translation="MNHTEIRVVTGPANYFSHAGSLERLTDFFTPEQLSHAVWVYGER
                     AIAAARPYLPEAFERAGAKHLQFTGHCSERHVAQLAHACNDDRQVVIGVGGGALLDTA
                     KAHARRLALPFVAIPTIAATCAAWTPLSVWYNDAGQALQFEIFDDANFLVLVEPRIIL
                     QAPDDYLLAGIGDTLAKWYEAVVLAPQPETLPLTVRLGINSACAIRDLLLTSSEQALA
                     DKQQRRLTQAFCDVVDAIIAGGGMVGGLGERYTRVAAAHAVHNGLTVLPQTEKFLHGT
                     KVAYGILVQSALLGQDDVLAQLITAYRRFHLPTRLSELDVDIHNTAEIDRVIAHTLRP
                     VESIHYLPVTLTPDTLRAAFEKVEFFRI"
     gene            649009..650169
                     /locus_tag="STY_RS03015"
                     /old_locus_tag="STY0647"
     CDS             649009..650169
                     /locus_tag="STY_RS03015"
                     /old_locus_tag="STY0647"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal phosphate-dependent aminotransferase"
                     /protein_id="WP_001245604.1"
                     /translation="MRNNPLIPKSKLPNLGTTIFTQMSALAQKHQAINLSQGFPDFDG
                     PSYLHERLAYHVAQGANQYAPMTGAQALREAIADKTAEIYGYRPDDVSDITVTAGATE
                     ALYAAITALVRAGDEVICFDPSYDSYAPAVALSGGVLKRIALTPPHFRVDWQAFSALL
                     SERTRLVILNTPHNPTATVWRQADIEALWQAIGEREIYVLSDEVYEHICFAAEGHASV
                     LAHPQLRERAVAVSSFGKTFHMTGWKIGYCVAPAAISAEIRKVHQYLTFCVNTPAQLA
                     LADMLRAAPEHYRALPDFYRKKRDVLVNALAQSRLKVLPCEGTYFLLIDYSAVSTLND
                     VEFCQWLTEEVGVAAIPLSVFCAAPFPHQLIRLCFAKQESTLLAAAERLCKL"
     gene            complement(650170..650787)
                     /locus_tag="STY_RS03020"
                     /old_locus_tag="STY0648"
     CDS             complement(650170..650787)
                     /locus_tag="STY_RS03020"
                     /old_locus_tag="STY0648"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParB-like nuclease domain-containing protein"
                     /protein_id="WP_001164761.1"
                     /translation="MQHRLTTEITHFLSGLPEEERIAAINEFRRAIHNVSPFRDEPVD
                     CVLWVKNDHISPNDYNPNNVAPPEKKLLLKSIEKDGFTQPIVVVKANTEEYEIVDGFH
                     RHELGKGKAVLKRRLKGYLPVACLDRERHERMAATIRHNRARGRHQIHAMSEIVRELS
                     QLGWDESKIGQELGMDADEVLRLKQINGLQELFADRRFSRAWTVK"
     gene            complement(650760..651995)
                     /locus_tag="STY_RS03025"
                     /old_locus_tag="STY0649"
     CDS             complement(650760..651995)
                     /locus_tag="STY_RS03025"
                     /old_locus_tag="STY0649"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoadenosine phosphosulfate reductase"
                     /protein_id="WP_000118148.1"
                     /translation="MSVYKVPLEQNVLEAAQERITWTLETLPRVCVSFSGGKDSGLML
                     HLTATLARKMNKKIHVLFIDWEAQFSCTIAYIESLREYYADVIERFYWVALPLTTQNS
                     LSQYQPEWQCWQPGTDWVRQPPEDAITDPAFFSFYQHGMTFEQFVRDFADWFSEKRPA
                     AMLVGIRSDESYNRFVAIANSHKLRFADDKPWTTLAPKGHTWYIYPIYDWKTADIWTW
                     FAKTGKSCNPLYNLMYQAGVPVRYMRICEPFGPEQRQGLWLYHVIEPERWAAMYARVS
                     GVLSGGIYAGQDSHFYGHRKILKPDHLNWEEYALLLLHSMPEVTAEHYRNKIAVYLQW
                     YKKKGMNTIPQTQQGDIGSRDIPSWRRICKVLLNNDYWCRALSFSPTKPKSYQRYNER
                     MKAKRQEWGILCNTDSQPK"
     gene            complement(652161..653063)
                     /locus_tag="STY_RS03030"
                     /old_locus_tag="STY0651"
     CDS             complement(652161..653063)
                     /locus_tag="STY_RS03030"
                     /old_locus_tag="STY0651"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016506006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_000002489.1"
                     /translation="MANLYDLKKFDLNLLVIFECIYQHLSISKAAETLYITPSAVSQS
                     LQRLRTQFNDPLFIRSGKGITPTVTGINLHYHLENNLNSLEQTINIMNQSSLKKKFII
                     YSPQLLITQYAMKLVKYIRKDPQVEIEHHDILTTDELPEDLLAYRKADVVVSMAPLNN
                     RSIVCTHFNRLECILVCSENHPRLGDTATIDEILQESFTQLVSRATGMKEYHSLIDDV
                     LGERIIGLRSKSVMTIANSISSTELIGFLPQTFVDYYSSSIKLKKVATPFTIAPIQFY
                     LMYNRASLNNSGFAELIEYITKKR"
     gene            complement(653380..654126)
                     /gene="dsbG"
                     /locus_tag="STY_RS03035"
                     /old_locus_tag="STY0652"
     CDS             complement(653380..654126)
                     /gene="dsbG"
                     /locus_tag="STY_RS03035"
                     /old_locus_tag="STY0652"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein DsbG"
                     /protein_id="WP_000597117.1"
                     /translation="MIKRTLLLAMLPILAHAEELPALVKAIEKQSITILKSFEAPGGM
                     KGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNALIEKEIYAPAGREMWQKME
                     KASWILDGKKDAPVVLYVFADPFCPYCKQFWQQARPWVESGKVQLRTLLVGVIKPESP
                     ATAAAILAAKNPAKTWHDYEASAGKMKLEVPASIPPAQMKVINQNQQLMDDLGANATP
                     AIYYMNKDKILQQVVGLPEKAQLDAMMGQP"
     gene            654566..655129
                     /gene="ahpC"
                     /locus_tag="STY_RS03040"
                     /old_locus_tag="STY0653"
     CDS             654566..655129
                     /gene="ahpC"
                     /locus_tag="STY_RS03040"
                     /old_locus_tag="STY0653"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003858764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase subunit C"
                     /protein_id="WP_000052802.1"
                     /translation="MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFT
                     FVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTG
                     ALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAA
                     HPGEVCPAKWKEGEATLAPSLDLVGKI"
     gene            655371..656936
                     /gene="ahpF"
                     /locus_tag="STY_RS03045"
                     /old_locus_tag="STY0655"
     CDS             655371..656936
                     /gene="ahpF"
                     /locus_tag="STY_RS03045"
                     /old_locus_tag="STY0655"
                     /EC_number="1.8.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase subunit F"
                     /protein_id="WP_000887645.1"
                     /translation="MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIA
                     ELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPS
                     KEAQSLLEQIRDIDGDFEFETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQ
                     NEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIV
                     GSGPAGAAAAVYSARKGIRTGLMGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAH
                     VSDYDVDVIDSQSASKLVPAATEGGLHQIETASGAVLKARSIIIATGAKWRNMNVPGE
                     DQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKA
                     DQVLQDKVRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHSVALAGIFVQIG
                     LLPNTHWLEGVLERNRMGEIIIDAKCETSVKGVFAAGDCTTVPYKQIIIATGEGAKAS
                     LSAFDYLIRTKIA"
     repeat_region   657097..657815
                     /note="IS200"
     gene            657107..657289
                     /locus_tag="STY_RS03050"
     CDS             657107..657289
                     /locus_tag="STY_RS03050"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000431187.1"
                     /translation="MENPQLGWGFRKAFSFKPVIKTPFDLLKHLAVWQLQKFNKKSKG
                     GPNGGRKELSAHPMEL"
     gene            657246..657704
                     /locus_tag="STY_RS03055"
                     /old_locus_tag="STY0657"
     CDS             657246..657704
                     /locus_tag="STY_RS03055"
                     /old_locus_tag="STY0657"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605-like element IS200F family
                     transposase"
                     /protein_id="WP_000502118.1"
                     /translation="MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKL
                     CEWKNVRILEAECCADHIHMLLEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRN
                     REFWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLSIPYPGSLFTGRK"
     gene            657980..658462
                     /locus_tag="STY_RS03060"
                     /old_locus_tag="STY0658"
     CDS             657980..658462
                     /locus_tag="STY_RS03060"
                     /old_locus_tag="STY0658"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000377432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_000377432.1"
                     /translation="MDSIYESLTELEKTGLTLRDFFNSHDSHSLKSAYVRLNPSAAVN
                     LTDRAWLEAEYDFNALFVGPGKLLAAPFASVYLEEDALVMGKATLEIRDFMAALGLSV
                     NQESNIPDDHISCVLELTTLLLANTRQTSQYCSTLTQYINNYLTKWVPLYIEKIKTHA
                     "
     gene            658533..660812
                     /locus_tag="STY_RS03065"
                     /old_locus_tag="STY0659"
     CDS             658533..660812
                     /locus_tag="STY_RS03065"
                     /old_locus_tag="STY0659"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-dependent oxidoreductase"
                     /protein_id="WP_000064331.1"
                     /translation="MSNETGHLNRRSFLKGIVALGTVAALPGGLLTSRCALAQPPVPF
                     NPKTYKIYRNACPRNCYDTCSLKTWVKDGVITFVEGAPESTFTHGTPYVKGLSYPRRV
                     YSPDRIKYPMAQDVRGSGNWRRISWEEAMQRIAAKMLEIKKKDSSMLGLALTKYSGKF
                     GVLNYAVEGMMSSLGYTTRFAGTPCWPAGIDAQNYDMGDMWCNDPEDMVKAKYIIIWG
                     ANPAWCSMHSMKYIYQAREKGAKVVVIDPLLSQTAAKADLYLRVRPGSDGALALGMAR
                     HLVDKGLVDQDFVNNDAHGYPEFEAYLRNHVTVEWAAEICGLSAQVIRQLAEEFTAVN
                     PATAWIGYGMQRHVNGGANVRAIDAFVAMSGNIGVEGGGARYGHLHTWGFNYNAMLQK
                     PPVGAIGIPGAAGTTSEFGAAAGSDAVQYSDRSLNINQTAQGILEANDPPVRMLWVAC
                     KNPFAQDFDRSKMKKAFEKLEMVVCADQFFNETVQHADIVLPVTTAFEEWNVDASYWH
                     YWLSINQPAIKPMYEAKCDLEIATMLSRTINKMAPGSCTFPQEFDHKRWLDQEFNDGM
                     AKMFGISSWDDLLDGPKKAILPSSAAWYDRKFKTPSGKYEFKSELAEKNGHTALPEYK
                     PEAESKLPFHLFTPHVQFGLHSQFINLDWMQVFYPEPFVYIHPSSAKKKGISENDRVK
                     VFNNIGEVELRAKVTTNVPEDFLVMYEAWFPKRQYNVQNVVADTPADMGLMKTGAPGA
                     AIHSQFADVVLIGKGESVA"
     gene            660809..661366
                     /locus_tag="STY_RS03070"
                     /old_locus_tag="STY0660"
     CDS             660809..661366
                     /locus_tag="STY_RS03070"
                     /old_locus_tag="STY0660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S dicluster domain-containing protein"
                     /protein_id="WP_001250378.1"
                     /translation="MRRAFLVNSDKCIGCRGCAMACKSFNQLEPDRFWRYVYPLDKDI
                     YPHEERAFYSLACNHCEHPACVAACPVEAYTKREDGVVVHNPERCIGCKNCIRNCPYG
                     APRFNEETRKAEKCSICYERLDIGMNPACVNACPVGALSIIDLDADPVPDNAVQYPPG
                     FPHMPQLNPGTRFILARQPKQPEDK"
     gene            661366..662133
                     /locus_tag="STY_RS03075"
                     /old_locus_tag="STY0661"
     CDS             661366..662133
                     /locus_tag="STY_RS03075"
                     /old_locus_tag="STY0661"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyl sulfoxide reductase anchor subunit
                     family protein"
                     /protein_id="WP_000417104.1"
                     /translation="MEKYELPLVFFTVLSQMSVGMALVLTWRTLRGEVEGQRFYWLAT
                     GLVLALASIAAILHLAHPDRAYNALINLRHAWLSREILGATLFGAAVGVTFLAKGHKA
                     MALIASVFGVLLVAVQGMTYAAPAMVAIANGFTMLLFFITVWVMGCAAIPLLRLRPAV
                     PALRQGIVVCIAVLIAAPLVWLSGGTVMQMTARSWLASPFYLASLVCLALAFVASRHG
                     DSRPKLLFVLLFVGVFLSRLVFFGDTVSTIVNIGHLY"
     gene            complement(662201..662629)
                     /gene="uspG"
                     /locus_tag="STY_RS03080"
                     /old_locus_tag="STY0662"
     CDS             complement(662201..662629)
                     /gene="uspG"
                     /locus_tag="STY_RS03080"
                     /old_locus_tag="STY0662"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein UspG"
                     /protein_id="WP_000278499.1"
                     /translation="MYKTIIMPVDVFEMELSDKAIRHAEFLAQQDGVIHLLHVLPGSA
                     SMSLHRFAADVRRFEEHLQHEAETRLQTMVGHFSIDPSRIKTHVRFGSVRDVVNEMGE
                     ELDADVVVIGSRNPSITTHLLGSNASSVVRHATLPVLVVR"
     gene            662852..664090
                     /locus_tag="STY_RS03085"
                     /old_locus_tag="STY0663"
     CDS             662852..664090
                     /locus_tag="STY_RS03085"
                     /old_locus_tag="STY0663"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-dependent formaldehyde
                     dehydrogenase"
                     /protein_id="WP_000646123.1"
                     /translation="MKALTYHGPHHVKVENVPDPGIEQPDDIILRVTATAICGSDLHL
                     YRGKIPQVKHGDIFGHEFMGEVVETGHDVKNIRKGDRVVIPFVIACGDCFFCRLQQYS
                     ACENTNDGHGAAMNKKQIPPPAALFGYSHLYGGVPGGQAEYVRVPKGNVGPFKVPPLL
                     SDDKALFLSDILPTAWQAAKNAQIQQRSSVAVFGAGPVGLLTIACARLLGAEQIFVVD
                     HHAWRLRFAEERYGAIPINFDDENDPAEKIIEQTAGHRGVDAVIDAVGFEAKGSMTET
                     VLTNLKLEGSSGKALRQCIAAVGRGGVVSVPGVYAGFIHGFLFGDAFDKGLTFKMGQT
                     HVHAWLGELLPLIEKGLLKPEEIVTHYMPFEEAARGYEIFEKREEECRKVILVPGAMS
                     AQAAQKQATGVINPMPGGVV"
     gene            complement(664173..664583)
                     /gene="rnk"
                     /locus_tag="STY_RS03090"
                     /old_locus_tag="STY0664"
     CDS             complement(664173..664583)
                     /gene="rnk"
                     /locus_tag="STY_RS03090"
                     /old_locus_tag="STY0664"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase regulator"
                     /protein_id="WP_000089748.1"
                     /translation="MSRPTIIINDLDAERIDRLLEQPAYADLPIADALNAELDRAQMC
                     SPQEMPNDVVTMNSRVKFRNLSDGETRVRTLVYPANMTDSSTQLSVMAPVGAALLGLR
                     VGDTIHWELPGGASTHLEVLELEYQPEAAGDFLR"
     gene            complement(664818..665624)
                     /gene="rna"
                     /locus_tag="STY_RS03095"
                     /old_locus_tag="STY0666"
     CDS             complement(664818..665624)
                     /gene="rna"
                     /locus_tag="STY_RS03095"
                     /old_locus_tag="STY0666"
                     /EC_number="4.6.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease I"
                     /protein_id="WP_001092588.1"
                     /translation="MNTIWHYSPLLAVLLTPIFAANADELQAQQYGDFTDYVLALSWQ
                     TGFCQSQHERRHREPDECRLQKEPANKADFLTVHGLWPGLPKSIAARGVDQRRWQRFG
                     CATRPIPNLPEVKASRKCSAPAPGLSPDIATALKEVMPGAGGNSCLERYEYAKHGACF
                     GFDPNAYFGTMIRLDKAIKDSALGQFLADNYGKTVSRAEFDSVVAQTWGQDNVKAVKV
                     NCHGNPAYLTEIQFSLKASMINAPLSSASFQPQPHPGNCGKQFIIDKAGY"
     gene            complement(665734..667239)
                     /locus_tag="STY_RS03100"
                     /old_locus_tag="STY0667"
     CDS             complement(665734..667239)
                     /locus_tag="STY_RS03100"
                     /old_locus_tag="STY0667"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anion permease"
                     /protein_id="WP_000059033.1"
                     /translation="MSLSKDNIWKLLAPLVVMGVMLLIPVPDGMPPQAWHYFAVFVAM
                     IVGMILEPIPATAISFIAVTICVIGSNYLLFDASELADPAFKASKQALKWGLAGFSST
                     TVWLVFGAFIFALGYEVTGLGRRIALFLVKFMGKRTLTLGYAIVIIDILLAPFTPSNT
                     ARTGGTVFPVIKNLPPLFKSFPNDPSARRIGGYLMWMMVISTSLSSSMFVTGAAPNVL
                     GLEFVSKIAGVQISWLQWFLSFLPVGIILLIVAPWLSYVLYKPEVTHSAEVAAWAGGE
                     LKNMGRLSRKEWTLIGLVLLSLGLWVFGGKIINATAVGLLAVSLMLALHVVPWKDITR
                     YNSAWNTLVNLATLVVMANGLTRSGFIDWFANTMSTHLEGFSPDATVIVLVLVLVLVL
                     VLVLVLVLVFYFAHYLFASLSAHTATMLPVILAVGKGIPGVPMEQLCILLVLSIGIMG
                     CLTPYATGPGVIIYGCGYVKSRDYWRLGAIFGVIYIAMLLLVGWPILAMWN"
     repeat_region   complement(666037..666090)
                     /locus_tag="STY_RS03100"
                     /old_locus_tag="STY0667"
                     /note="(taccag)9"
     gene            complement(667277..668173)
                     /gene="citG"
                     /locus_tag="STY_RS03105"
                     /old_locus_tag="STY0668"
     CDS             complement(667277..668173)
                     /gene="citG"
                     /locus_tag="STY_RS03105"
                     /old_locus_tag="STY0668"
                     /EC_number="2.4.2.52"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triphosphoribosyl-dephospho-CoA synthase CitG"
                     /protein_id="WP_000982670.1"
                     /translation="MMPIPVNPTNASIQPQSLYDAWADLAWRAMLTEVNLSPKPGLVD
                     RLNCGAHKDMALADFHRSAEAIRHWLPRFMEYGASCTRLPPESVLAGLRPLGMACEAA
                     MFRATAGVNTHKGSIFSLGLLCAAIGRLYQLRQPIAAETLCATAADFCRGLTTRELRQ
                     NNLQLTAGQRLYQQLGLTGARGEAEAGYPLVIRHALPHYRALLAQGRDPELALLDTLL
                     LLMSLNGDTNVASRGGADGLRWLQQQAAVLLHQGGIRTPDDLVYLHRFDQQCIERNLS
                     PGGSADLLIVTWFLAQISQVNH"
     gene            complement(668145..>668591)
                     /gene="citX"
                     /locus_tag="STY_RS03110"
                     /old_locus_tag="STY0669"
                     /pseudo
     CDS             complement(668145..>668591)
                     /gene="citX"
                     /locus_tag="STY_RS03110"
                     /old_locus_tag="STY0669"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459612.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase holo-[acyl-carrier protein]
                     synthase"
     gene            complement(668594..670123)
                     /gene="citF"
                     /locus_tag="STY_RS03115"
                     /old_locus_tag="STY0670"
     CDS             complement(668594..670123)
                     /gene="citF"
                     /locus_tag="STY_RS03115"
                     /old_locus_tag="STY0670"
                     /EC_number="2.8.3.10"
                     /EC_number="4.1.3.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase subunit alpha"
                     /protein_id="WP_000192347.1"
                     /translation="MTQKNESQRQDRVVAWSRHAESELSAYQSAAKLDLQAQKPRDHK
                     LCASLEEAIRRSGLRDGMTLSFHHAFRGGDLTINLVMETIAKMGFKNLTLASSSLSDC
                     HAPLVEHIRNGVVSRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNID
                     VAFLGVPSCDEFGNANGYTGKACCGSLGYAMVDADSAKQVVMLTEQLLPYPHNPASIA
                     QDQVDLIVQIEEVGDANKIGAGATRMTTNPRELLIARSAAEVIAHSGYFNEGFSLQTG
                     TGGASLAVTRFLEDKMRSRNIVANFALGGITATMVNLHEKGLIRKLLDVQSFDRNAAQ
                     SLARNPNHIEISANQYANWGSKGASVDRLDVVVLSALEVDTHFNVNVLTGSDGVLRGA
                     SGGHCDTAVAAALSIIVAPLVRGRIPTLVDNVTTCVTPGSSVDILVTDHGIAVNPARP
                     ELAERLKAAGMKVVSIEWLRERAQLLTGQPRPIEFTDRVIAVVRYRDGSVIDVVHQVK
                     E"
     gene            complement(670133..671041)
                     /locus_tag="STY_RS03120"
                     /old_locus_tag="STY0671"
     CDS             complement(670133..671041)
                     /locus_tag="STY_RS03120"
                     /old_locus_tag="STY0671"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HpcH/HpaI aldolase/citrate lyase family protein"
                     /protein_id="WP_000622336.1"
                     /translation="MISASLQQRKTRTRRSMLFVPGANAAMVNNSFIYPADALMFDLE
                     DSVALREKHAARRLVYHALQHPLYRDVETIVRVNALDSEWGVNDLEAVVRGGADVVRL
                     PKTDTAQDVIDIENEILRIENACGREPGSTGLLAAVESPLGITRAVEIAHASERLIGI
                     ALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA
                     AHIKQLGFDGKSLINPRQIELLHNLYAPTRKEVAHARLVVEAAEAAAREGLGVVSLNG
                     KMVDSPVIERARLVLSRAELSGIREE"
     gene            complement(671038..671334)
                     /gene="citD"
                     /locus_tag="STY_RS03125"
                     /old_locus_tag="STY0672"
     CDS             complement(671038..671334)
                     /gene="citD"
                     /locus_tag="STY_RS03125"
                     /old_locus_tag="STY0672"
                     /EC_number="4.1.3.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase acyl carrier protein"
                     /protein_id="WP_000700679.1"
                     /translation="MKINQLAVAGTLESGDVMIRIAPLDTQDIDLQINSSVEKQFGEA
                     IRATILEVLSRYDVRGVQLNVDDKGALDCILRARLETLLARASGIAALPWEDRQ"
     gene            complement(671331..672406)
                     /gene="citC"
                     /locus_tag="STY_RS03130"
                     /old_locus_tag="STY0673"
                     /pseudo
     CDS             complement(671331..672406)
                     /gene="citC"
                     /locus_tag="STY_RS03130"
                     /old_locus_tag="STY0673"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459616.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="[citrate (pro-3S)-lyase] ligase"
     gene            672791..674452
                     /gene="dpiB"
                     /locus_tag="STY_RS03135"
                     /old_locus_tag="STY0674"
     CDS             672791..674452
                     /gene="dpiB"
                     /locus_tag="STY_RS03135"
                     /old_locus_tag="STY0674"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase DpiB"
                     /protein_id="WP_000121811.1"
                     /translation="MSYQKNKKLFPFFRQLAFPLRIFLLILVVSVFIVAALAQYLSAS
                     FEDYLASHVRDMAMNQAKIIASNDSIIAAVKNRDYKRLAIIANKLQRGTDFDYVVIGD
                     RHSIRLYHPNPEKIGYPMQFTKPGALERGESYFITGKGSIGMAMRAKTPIFDNEGNVI
                     GVVSIGYLVSKIDSWRLDFLLPMAGVFVLLLVVLMLLSWFFAAHIRRQMLGMEPKQIA
                     RVVRQQEALFSSVYEGLIAVDPEGHITAINRNARKMLGLPSPGRQWLGKLIAEVVNPA
                     DFFTCQIAERRQDVMANFNGLSVIANREAIRSGEELLGAIISFRSKDEIATLNAQLTQ
                     IKQYVESLRTLRHEHLNWMSTLNGLLQMKEYDRVREMVQGESQAQQQLIDSLRGAFAD
                     RQVAGLLFGKVQRARELGLKMVIVPGSQLHQLPEGLDSTEFAAIVGNLLDNAFEASLR
                     TQEGDNTIELFLSDEGDEVVIEVADQGCGVPEALREKIFEQGVSTRADEPGEHGIGLY
                     LIASYVGRCGGVITLEDNDPCGTLFSLFLPKVKKNDDRTINPIDR"
     gene            674421..675101
                     /gene="dpiA"
                     /locus_tag="STY_RS03140"
                     /old_locus_tag="STY0675"
                     /gene_synonym="citB"
     CDS             674421..675101
                     /gene="dpiA"
                     /locus_tag="STY_RS03140"
                     /old_locus_tag="STY0675"
                     /gene_synonym="citB"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator DpiA"
                     /protein_id="WP_000138786.1"
                     /translation="MTEPLTLLIVEDETLLAEMHAEYIRHIPGFNQIWLAGNLAQARM
                     MIDRFKPGLILLDNYLPDGKGITLLHELMQSRYPGGVVFTTAASDMETVAEAVRSGAF
                     DYLVKPIAYERLGQTLTRYQQRRRMLASADSASQKQIDEMFNAYARGEPKGDLPTGID
                     ALTLNAVMKLFADPTVRHTAETVAQALTISRTTSRRYLEYCASRHLIVAEIIHGKVGR
                     PQRIYHGG"
     gene            complement(675155..676540)
                     /gene="dcuC"
                     /locus_tag="STY_RS03145"
                     /old_locus_tag="STY0676"
     CDS             complement(675155..676540)
                     /gene="dcuC"
                     /locus_tag="STY_RS03145"
                     /old_locus_tag="STY0676"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic C4-dicarboxylate transporter DcuC"
                     /protein_id="WP_000958619.1"
                     /translation="MLTVIELLIGVVVIVGVARYIIKGYSATGVLFVGGLVLLIISAL
                     MGHKVLPASETSTGYTATDIVEYIKILLMSRGGDLGMMIMMLCGFAAYMTHIGANDMV
                     VKLASKPLQYINSPYLLMIAAYFVACLMSLAVSSATGLGVLLMATLFPVMVNVGISRG
                     AAAAICASPAAIILSPTSGDVVLAAKAAEMPLIDFAFKTTLPISIAAIIGMAIAHFFW
                     QRYLDKKENISHEMLDVAEITTTAPAFYALLPFTPIIGVLIFDGKWGPQLHIITILVI
                     CMLLAAVLEFVRGFNTQNVFSGLEVAYRGMADAFAGVVMLLVAAGVFAQGLSTIGFIQ
                     SLISIATSFGSASIILMLVLVILTMLAAMTTGSGNAPFYAFVEMIPKLAHSSGINPAY
                     LSIPMLQASNLGRTISPVSGVVVAVAGMAKISPFEVVKRTSVPVIVGLLIVIIATEIM
                     VPGASSAVTGG"
     gene            676919..677491
                     /gene="pagP"
                     /locus_tag="STY_RS03150"
                     /old_locus_tag="STY0677"
     CDS             676919..677491
                     /gene="pagP"
                     /locus_tag="STY_RS03150"
                     /old_locus_tag="STY0677"
                     /EC_number="2.3.1.251"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid IV(A) palmitoyltransferase PagP"
                     /protein_id="WP_001784638.1"
                     /translation="MYVAMIIRKYFLIIALLVMPWLAIPSVSAADKGWFNTFTDNVAE
                     TWRQPEYYDLYVPAITWHARFAYDKEKTDRYNERPWGVGFGQSRWDDKGNWHGLYMMA
                     FKDSFNKWEPIGGYGWEKTWRPLEDDNFRLGLGFTAGVTARDNWNYIPIPVLLPLASI
                     GYGPATFQMTYIPGSYNNGNVYFAWMRFQF"
     gene            677679..677888
                     /gene="cspE"
                     /locus_tag="STY_RS03155"
                     /old_locus_tag="STY0678"
                     /gene_synonym="gicA; msmC"
     CDS             677679..677888
                     /gene="cspE"
                     /locus_tag="STY_RS03155"
                     /old_locus_tag="STY0678"
                     /gene_synonym="gicA; msmC"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antiterminator/RNA stability
                     regulator CspE"
                     /protein_id="WP_000034826.1"
                     /translation="MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTL
                     AEGQRVEFEITNGAKGPSAANVTAL"
     gene            complement(677946..678329)
                     /gene="crcB"
                     /locus_tag="STY_RS03160"
                     /old_locus_tag="STY0679"
     CDS             complement(677946..678329)
                     /gene="crcB"
                     /locus_tag="STY_RS03160"
                     /old_locus_tag="STY0679"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fluoride efflux transporter CrcB"
                     /protein_id="WP_000939753.1"
                     /translation="MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLG
                     AFIIGMGFAWFNRMTHIDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLN
                     VLINLLGSFAMTALAFWLFSAAAAR"
     gene            678420..679207
                     /locus_tag="STY_RS03165"
                     /old_locus_tag="STY0680"
                     /pseudo
     CDS             678420..679207
                     /locus_tag="STY_RS03165"
                     /old_locus_tag="STY0680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003022696.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="deaminated glutathione amidase"
     gene            679335..679538
                     /gene="tatE"
                     /locus_tag="STY_RS03170"
                     /old_locus_tag="STY0682"
     CDS             679335..679538
                     /gene="tatE"
                     /locus_tag="STY_RS03170"
                     /old_locus_tag="STY0682"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase subunit TatE"
                     /protein_id="WP_000503938.1"
                     /translation="MGEISITKLLVVAALVVLLFGTKKLRTLGGDLGTAIKGFKKAMN
                     DEDAGVKKDVDGSVQAEKLSHKE"
     gene            complement(679625..680590)
                     /gene="lipA"
                     /locus_tag="STY_RS03175"
                     /old_locus_tag="STY0683"
     CDS             complement(679625..680590)
                     /gene="lipA"
                     /locus_tag="STY_RS03175"
                     /old_locus_tag="STY0683"
                     /EC_number="2.8.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012904980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoyl synthase"
                     /protein_id="WP_000042639.1"
                     /translation="MSKPIVMERGVKYRDADKMALIPVKNVVTERDALLRKPEWMKIK
                     LPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCD
                     VAHGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKS
                     PEIKIETLVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLL
                     ERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQ
                     RYVSPEEFDEMKAEALAMGFTHAACGPCVRSSYHADLQAKGMEVK"
     gene            complement(680796..681749)
                     /locus_tag="STY_RS03180"
                     /old_locus_tag="STY0684"
     CDS             complement(680796..681749)
                     /locus_tag="STY_RS03180"
                     /old_locus_tag="STY0684"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator"
                     /protein_id="WP_001282817.1"
                     /translation="MSDNNQAERQPADQHLQDKPQIFRTLRNIDLNLLTIFEAVYVHK
                     GIVNAAKILNLTPSAISQSIQKLRTIFPDPLFIRKGQGVTPTTYATHLHEYISQGLES
                     ILGALDLTGSYDKQRTITIGTTPSVGALVMPIIYQAIRPRYPQLLLRNIPVDDAESQL
                     SQFQTDLIINTHSYNNRSIQHHVLFSDTLEIVCRQHHPCLANAITEERLNSADHTFLM
                     LEGQHLSLLRQRLQETFPDQQISFSSYNIFTIASLIASSDLLGLMPTRFYDLFSRCWP
                     LERLPYAPVNSEQVEFSLHYNKLSLRDPVLENVIDIIREAF"
     gene            complement(682051..682692)
                     /gene="lipB"
                     /locus_tag="STY_RS03185"
                     /old_locus_tag="STY0686"
     CDS             complement(682051..682692)
                     /gene="lipB"
                     /locus_tag="STY_RS03185"
                     /old_locus_tag="STY0686"
                     /EC_number="2.3.1.181"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000284017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoyl(octanoyl) transferase LipB"
                     /protein_id="WP_000284017.1"
                     /translation="MYQDKILVRQLGLQPYEAISQAMHNFTDMRDENSHDEIWLVEHY
                     PVFTQGQAGKAEHILMPGDIPVVQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRDLV
                     TLLEQTVVNTLAEMGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDL
                     SPFLRINPCGYAGMEMAKITQWKEDATTDNIAPRLLANILALLNNPPYEYIAT"
     gene            complement(682792..683055)
                     /locus_tag="STY_RS03190"
                     /old_locus_tag="STY0687"
     CDS             complement(682792..683055)
                     /locus_tag="STY_RS03190"
                     /old_locus_tag="STY0687"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YbeD family protein"
                     /protein_id="WP_000850547.1"
                     /translation="MKTKLNELLEFPTPFTYKVMGQALPELVDQVVEVVQRHAPGDYS
                     PTVKPSSKGNYHSVSITINATHIEQVETLYEELGNIDIVRMVL"
     gene            complement(683163..684374)
                     /gene="dacA"
                     /locus_tag="STY_RS03195"
                     /old_locus_tag="STY0688"
     CDS             complement(683163..684374)
                     /gene="dacA"
                     /locus_tag="STY_RS03195"
                     /old_locus_tag="STY0688"
                     /EC_number="3.4.16.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase DacA"
                     /protein_id="WP_000858714.1"
                     /translation="MKTTFSARFMQRMALTTALCATFISTAHADDLNIKTMIPGVPQI
                     DAESYILIDYNSGKVLAEQNADERRDPASLTKMMTSYVIGQAMKAGKFKETDLVTVGN
                     DAWATGNPVFKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVG
                     LMNSYVNALGLKNTHFQTVHGLDADGQYSSARDMALIGQALIRDVPNEYAVYKEKEFT
                     FNGIRQLNRNGLLWDNSLNVDGIKTGHTSKAGYNLVASATEGQMRLISAVMGGRTYKG
                     RETESKKLLTWGFRFFETVNPLKAGKEFASEPAWFGNTDRASLGVDKDVYLTIPRGRM
                     KDLKASYVLNTAELHAPLQKNQVVGTINFQLDGKTIEQRPLVVLQEIPEGNFFGKIID
                     YIKLMFHHWFG"
     gene            complement(684513..685646)
                     /gene="rlpA"
                     /locus_tag="STY_RS03200"
                     /old_locus_tag="STY0689"
     CDS             complement(684513..685646)
                     /gene="rlpA"
                     /locus_tag="STY_RS03200"
                     /old_locus_tag="STY0689"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endolytic peptidoglycan transglycosylase RlpA"
                     /protein_id="WP_000549517.1"
                     /translation="MHKQLPVICVAAGIVLLAACTNDGGQQQTTVAPQPAVCNGPTVE
                     ISGAEPRYEPLNPTANQDYQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEM
                     FDPMQLTAAHPTLPIPSYARITNLANGRMIVVRINDRGLYGTDRVISLSRAAADRLNT
                     SNNTKVRIDPIIVAPDGSLSGPGMACTTVAKQTYALPPRPDLSGGMGSASSAPAQPQG
                     DVLPVSNSTLKSDDTTGAPVSSSGFLGAPTTLAPGVLEGNEPTPAPQTAPVSAPVTAP
                     ATATPVSAPAAAAPVSAPVSAPAAAASGRFVVQVGAVSDQTRAQQYQQRLSQQFSVPG
                     RVIQNGAVWRIQLGPFASKAEASALQQRLQTEAQLQSFIASAQ"
     gene            complement(685657..686769)
                     /gene="mrdB"
                     /locus_tag="STY_RS03205"
                     /old_locus_tag="STY0690"
                     /gene_synonym="rodA"
     CDS             complement(685657..686769)
                     /gene="mrdB"
                     /locus_tag="STY_RS03205"
                     /old_locus_tag="STY0690"
                     /gene_synonym="rodA"
                     /EC_number="2.4.1.129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004885876.1"
                     /note="rod shape-determining protein RodA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan glycosyltransferase MrdB"
                     /protein_id="WP_000131713.1"
                     /translation="MTDNPNKKTFWDKIHIDPTMLLILLALLVYSALVIWSASGQDIG
                     MMERKIGQIAMGLVVMVVMAQIPPRVYEGWAPYLYIICIILLVAVDAFGAISKGAQRW
                     LDLGIVRFQPSEIAKIAVPLMVARFINRDVCPPSLKNTAIALVLIFMPTLLVAAQPDL
                     GTSILVALSGLFVLFLSGLSWRLIGVAIVLIAAFIPILWFFLMHDYQRQRVMMLLDPE
                     TDPLGAGYHIIQSKIAIGSGGLRGKGWLHGTQSQLEFLPERHTDFIFAVLAEELGLVG
                     ILILLALYILLIMRGLWIAARAQTTFGRVMAGGLMLILFVYVFVNIGMVSGILPVVGV
                     PLPLVSYGGSALIVLMAGFGIVMSIHTHRKMLSKSV"
     gene            complement(686772..688673)
                     /gene="mrdA"
                     /locus_tag="STY_RS03210"
                     /old_locus_tag="STY0691"
     CDS             complement(686772..688673)
                     /gene="mrdA"
                     /locus_tag="STY_RS03210"
                     /old_locus_tag="STY0691"
                     /EC_number="3.4.16.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan DD-transpeptidase MrdA"
                     /protein_id="WP_000828701.1"
                     /translation="MKRQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQI
                     LRFTDYQTRSNENRIKLVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTL
                     DALRSVVDLNDDDIAAFKKERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKG
                     YKRRYYPYGSALTHVIGYVSKINDKDVERLDRENKLANYAATHDIGKLGIERYYEDIL
                     HGQTGYEEVEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVIVT
                     DPRTGGVLSLVSMPSYDPNLFVDGISSKDYSGLLNDPNTPLVNRATQGVYPPASTVKP
                     YVAVSALSAGVITRNTSLFDPGWWQLPGSEKRYRDWKKWGHGHLNITKSLEESADTFF
                     YQVAYDMGIDRLSEWMGKFSYGHYTGIDLAEERSGNMPTREWKQKRFKKPWYQGDTIP
                     VGIGQGYWTATPIQMSKALMILINDGVVKVPHLLMSTAENGKQVPWVQPHEPPVGDIH
                     SGYWEIAKDGMYGVANRPNGTAHKYFASAPYKIAAKSGTAQVFGLKANETYNAHKIAE
                     RLRDHKLMTAFAPYNNPQVAVAIILENGGAGPAVGTIMRQILDHIMLGDNNTHLPAEN
                     PVVAAAEDQ"
     gene            complement(688704..689171)
                     /gene="rlmH"
                     /locus_tag="STY_RS03215"
                     /old_locus_tag="STY0692"
     CDS             complement(688704..689171)
                     /gene="rlmH"
                     /locus_tag="STY_RS03215"
                     /old_locus_tag="STY0692"
                     /EC_number="2.1.1.177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010618862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA
                     (pseudouridine(1915)-N(3))-methyltransferase RlmH"
                     /protein_id="WP_000776107.1"
                     /translation="MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRG
                     KNADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLANELERWKQDGRDVSLLI
                     GGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE"
     gene            complement(689175..689492)
                     /gene="rsfS"
                     /locus_tag="STY_RS03220"
                     /old_locus_tag="STY0693"
                     /gene_synonym="rsfA"
     CDS             complement(689175..689492)
                     /gene="rsfS"
                     /locus_tag="STY_RS03220"
                     /old_locus_tag="STY0693"
                     /gene_synonym="rsfA"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome silencing factor"
                     /protein_id="WP_001161670.1"
                     /translation="MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTS
                     SRHVMSIADHVVQSSRAAGMLPLGVEGENAADWIVVDLGDVIVHVMQEESRRLYELEK
                     LWS"
     gene            complement(689821..690429)
                     /locus_tag="STY_RS03225"
                     /old_locus_tag="STY0694"
     CDS             complement(689821..690429)
                     /locus_tag="STY_RS03225"
                     /old_locus_tag="STY0694"
                     /EC_number="3.1.3.73"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylcobalamin/alpha-ribazole phosphatase"
                     /protein_id="WP_001241920.1"
                     /translation="MRLWLVRHGETEANVAGLYSGHAPTPLTEKGIGQAKTLHTLLRH
                     APFDRVLCSELERARHTARLVLEGRDTPQHILPELNEMYFVDWEMRHHRDLTHEDAES
                     YAAWCTDWQNAVPTNGEGFQAFTRRVERFISRLGAFSDCQNLLIVSHQGVLSLLIARL
                     LAMPAASLWHFRVEQGCWSTIDICEGFATLKVLNSRAVWRPE"
     gene            690526..691620
                     /locus_tag="STY_RS03230"
                     /old_locus_tag="STY0695"
     CDS             690526..691620
                     /locus_tag="STY_RS03230"
                     /old_locus_tag="STY0695"
                     /EC_number="4.1.1.81"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine-phosphate decarboxylase"
                     /protein_id="WP_001173241.1"
                     /translation="MALFNSAHGGNIREAATVLGISPDQLLDFSANINPLGMPVSVKR
                     ALIDNLDCIERYPDADYFHLHQALARHHQVPASWILAGNGETESIFTVASGLKPRRAI
                     IVTPGFAEYGRALAQIGCEIRRWSLREADGWQLTDAILEALTPDLDCLFLCTPNNPTG
                     LLPERQLLQAIADRCKSLNINLILDEAFIDFIPHETGFIPALKDNPHIWVLRSLTKFY
                     AIPGLRLGYLVNSDDAAVARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREE
                     GARFYQALCQLPLLTVYPGRANYLLLRCEREDIDLQRRLLTQRILIRSCANYPGLDSR
                     YYRVAIRSAAQNERLLAALRNVLTGITPAD"
     gene            complement(691595..692236)
                     /gene="nadD"
                     /locus_tag="STY_RS03235"
                     /old_locus_tag="STY0696"
     CDS             complement(691595..692236)
                     /gene="nadD"
                     /locus_tag="STY_RS03235"
                     /old_locus_tag="STY0696"
                     /EC_number="2.7.7.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide adenylyltransferase"
                     /protein_id="WP_010989126.1"
                     /translation="MKSLQALFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNVPP
                     HRPQPEASSAQRKYMLELAIADKPLFTLGERELQRNAPSYTAQTLKAWREEQGPEAPL
                     AFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEMTQAQHQQWLEQHLTHTPDD
                     LHQLPAGKIYLAETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYR"
     gene            complement(692238..693269)
                     /gene="holA"
                     /locus_tag="STY_RS03240"
                     /old_locus_tag="STY0697"
     CDS             complement(692238..693269)
                     /gene="holA"
                     /locus_tag="STY_RS03240"
                     /old_locus_tag="STY0697"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta"
                     /protein_id="WP_000620491.1"
                     /translation="MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAIRLAAAS
                     QGFEEHHAFTLDPSTDWGSLFSLCQAMSLFASRQTLVLQLPENGPNAAMNEQLATLSE
                     LLHDDLLLIVRGNKLTKAQENAAWYTALADRSVQVSCQTPEQAQLPRWVAARAKAQNL
                     QLDDAANQLLCYCYEGNLLALAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWV
                     DALLMGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKH
                     RVWQNRRPMIGDALQRLHPAQLRQAVQLLTRTEITLKQDYGQSVWADLEGLSLLLCHK
                     ALADVFIDG"
     gene            complement(693269..693859)
                     /gene="lptE"
                     /locus_tag="STY_RS03245"
                     /old_locus_tag="STY0698"
     CDS             complement(693269..693859)
                     /gene="lptE"
                     /locus_tag="STY_RS03245"
                     /old_locus_tag="STY0698"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS assembly lipoprotein LptE"
                     /protein_id="WP_001269949.1"
                     /translation="MRYLVTLLLSLAVLVTAGCGWHLRSTTQVPASMKTMILDSGDPN
                     GPLSRAVRNQLRLNNVNLLDKDTTRKDVPSLRLGTVTISQDTASVFQDGQTAEYQMVM
                     TVNASVLIPGHDIYPISTKVYRSFFDNPQMALAKDNEQAMIVQEMYDKAAEQLIRKLA
                     SVRAADIQATKEEATADNETAAPASTPARVSTTLSN"
     gene            complement(693874..696456)
                     /gene="leuS"
                     /locus_tag="STY_RS03250"
                     /old_locus_tag="STY0699"
     CDS             complement(693874..696456)
                     /gene="leuS"
                     /locus_tag="STY_RS03250"
                     /old_locus_tag="STY0699"
                     /EC_number="6.1.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008456064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine--tRNA ligase"
                     /protein_id="WP_001157907.1"
                     /translation="MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYP
                     SGRLHMGHVRNYTIGDVVARYQHMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTY
                     DNIAYMKNQLKTLGFGYDWSREIATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCP
                     NDQTVLANEQVIDGCCWRCDTKVERKEIPQWFIKITAYADELLRDLDKLDHWPDTVKT
                     MQRNWIGRSEGVEITFDVKGYDNTLTVYTTRPDTFMGATYLAVAAGHPLAQKAAANNA
                     ELAAFIDECRNTKVAEAEMATMEKKGVDTGYKAIHPLTGEEIPVWAANFVLMEYGTGA
                     VMAVPGHDQRDYEFASKYGLTIKPVILAADGSEPDLSEQALTEKGVLFNSGEFDGLAF
                     EAAFNAIADKLAEKGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVLPTPEDQL
                     PVILPEDVVMDGITSPIKADPEWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPQY
                     QEGMLDSKAANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVTSDEPAKQLLCQ
                     GMVLADAFYYVGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSK
                     NNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFIKRVWKLVYEHTA
                     KGPVAALNVDALSEDQKALRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAP
                     QEGEQDRALLQEALQAVVRMLNPFTPHVCFTLWQELGGEGDIDNAPWPVADEQAMVEN
                     TTLVVVQVNGKVRGKITVAVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLN
                     LVVG"
     gene            696693..697034
                     /locus_tag="STY_RS03255"
     CDS             696693..697034
                     /locus_tag="STY_RS03255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_447100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UxaA family hydrolase"
                     /protein_id="WP_001574029.1"
                     /translation="MARLLIREDRTKAKELIVKKNAVVIHPQDCVATAITALKAGETA
                     TMFIGEREISVVLHQDVPFGHKFAICDVPFHGEVYKYGESIGRATQEIKSGDYVHVHN
                     VESERGRGDWK"
     gene            697051..698223
                     /locus_tag="STY_RS03260"
     CDS             697051..698223
                     /locus_tag="STY_RS03260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_447101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UxaA family hydrolase"
                     /protein_id="WP_001775656.1"
                     /translation="MIMSNETFLGFRRPDGRFGIRNYVLILPTSVCANKVAQDIARQV
                     KGATWVNNDFGCCQVAGDARLTEKTLINVANNPNVGAIVVVGLGCEGAEPLRIAEEIT
                     AFGKPTSCITIQEEGGTLKCQARGISLARDYAQQLSMQKPQQAPVSELLLAMECGGSD
                     TTSGLASNPSCGVASDKLIRCGGSSILSETTEFIGAEHVMAKRAVTPEVGQQLIDLVV
                     GCEARAKALGEDIRGGQPTPGSIKGGLTTIEEKSLGCMHKAGHAPLQGVLEYADSPTH
                     PGLWIMDTPGQDIESISGMVAGGAQIVIFTTGRGTPAGNPIAPVIKITGNKATWEMMQ
                     DNIDIDVSAIMSGEASITQMGEEIYQEILRVANGKTTKSEDLGHNEFSIYKIAPTF"
     gene            698273..699226
                     /locus_tag="STY_RS03265"
                     /old_locus_tag="STY0702"
     CDS             698273..699226
                     /locus_tag="STY_RS03265"
                     /old_locus_tag="STY0702"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-3-deoxygluconate permease"
                     /protein_id="WP_000694473.1"
                     /translation="MKIKKTLERFPGGMMVVPLIIGALFKTFAPEALEIGGFVISISH
                     GAMAILGMFLVCMGADIQFKAAPKALKKGAAITFAKFASGVIIGILVGKFCGPDGLLG
                     LSALAIISAMTNSNSGLYAALVGEYGDETDGGAIAVISLNDGPFFTMLALGSAGMVSI
                     PFMNLVAVIIPIIIGMILGNLDEDMRKFLKQGSVVTIPFFAFGLGYSIDFARLITAGS
                     SGILLGLMTVAIGGFFNIFADRVTGGSGVAGAAVSTTSGNAVATPAAIALLDPHFTDL
                     ASTAAAQVAASTIITALCAPFLTVWIKKRYDRKLNPAAAGG"
     gene            699294..701222
                     /locus_tag="STY_RS03270"
                     /old_locus_tag="STY0703"
     CDS             699294..701222
                     /locus_tag="STY_RS03270"
                     /old_locus_tag="STY0703"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent transcriptional regulator"
                     /protein_id="WP_001044179.1"
                     /translation="MNKTKDIAASPLCFVSPYPQLAKAAEALVAQLDYAVTIHQTTLN
                     RILDELPLLESRGHQVLISRGGCAEILKKHSKLPVVEIKMSGYDILDALIPFKGQKGT
                     VGIVGFSSVIKGCARVAEQLNINYKIFTLQGNDKETISCLKRQLASTPLDCIVGDTVC
                     QDYFSPLGSQFRLLDSSPASITEALEEARSLYLAFRSQLLERHHLQLILDQFDKAVIT
                     LDDTGALLHYNKYASQLFKINASGEIYDASFLKQVLHQERHTLREGKTVSAKVVDTPQ
                     GAMVVNLYPVFAARQLSRVVLTMQTVSSLQGAEHHVRRQELSRRGLSARYHFDDLLTE
                     NPEMLRRLAIIKNYAGTDATILINGESGTGKEVLAQSIHNASQRVNGLFVAINCGAMA
                     TQILESELFGYVAGAFTGASPKGKIGLFELAHHGTIFLDEISELDKPLQTRLLRVLQE
                     RQIMRLGSDQMIPVDIRVIAATNQTLTKLIADGTFREDLYYRLNVLKVTTIPLRKRPE
                     DIKAIGLSLLTSFSQHYKRPALTLTPALWQELQRFAWPGNVRQLSNIIERLVLSIDHS
                     PATLDEGRLLLDDLEEGSRREPSTCHDCQMLAGDYKTIRLRILRKLLEAERDNKSLVA
                     KRLNVDRTSLTRWIRESA"
     gene            701315..701788
                     /locus_tag="STY_RS03275"
                     /old_locus_tag="STY0704"
     CDS             701315..701788
                     /locus_tag="STY_RS03275"
                     /old_locus_tag="STY0704"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ribbon-containing protein"
                     /protein_id="WP_001044885.1"
                     /translation="MNKVAQYYRELVASLSERLRNGERDIDALVEQARQRVMQTGELT
                     RTEVDELTRAVRRDLEEFAMSYEESQEDSVFLRVIKESLWQELADITDKTQLEWREVF
                     QDLNHHGVYHSGEVVGLGNLVCEKCHYHLAVYTPDVLPLCPKCGHDQFQRRPFEP"
     gene            complement(701827..702120)
                     /locus_tag="STY_RS03280"
                     /old_locus_tag="STY0705"
     CDS             complement(701827..702120)
                     /locus_tag="STY_RS03280"
                     /old_locus_tag="STY0705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001785127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001785127.1"
                     /translation="MLRPCIIHDPDSDAGIHMLSWHGSPLIRFYTEAWCPTCAEFVYA
                     GFSNDDEGAAQFLSSLAEWNQPGVGLNEAFTALTPLFSLFADGYYRLEAQLHS"
     gene            complement(702239..703174)
                     /gene="rihA"
                     /locus_tag="STY_RS03285"
                     /old_locus_tag="STY0706"
     CDS             complement(702239..703174)
                     /gene="rihA"
                     /locus_tag="STY_RS03285"
                     /old_locus_tag="STY0706"
                     /EC_number="3.2.2.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrimidine-specific ribonucleoside hydrolase
                     RihA"
                     /protein_id="WP_001207423.1"
                     /translation="MALPIIIDCDPGHDDAIALVLALASPELEVKAITSSAGNQTPEK
                     TLRNVLRMLTLLKRPDIPVAGGAVKPLMRELIIADNVHGESGLDGPALPEPSFAPQSG
                     TAVELMAKTLRESAQPVTIVSTGPQTNVALLLNSHPELHTKIARIVIMGGAMALGNWT
                     PAAEFNIYVDPEAAEIVFQSGIPVVMAGLDVTHKAQIHAADIERFRDIGNPISTIVAE
                     LLDFFFEYHKDEKWGFVGAPLHDPCTIAWLLKPEIFTTVERWVGVETQGKYTQGMTVV
                     DYYFLTGNKPNATVMVDVDRQGFVDLLAERLQYYA"
     gene            complement(703291..704016)
                     /gene="gltL"
                     /locus_tag="STY_RS03290"
                     /old_locus_tag="STY0707"
     CDS             complement(703291..704016)
                     /gene="gltL"
                     /locus_tag="STY_RS03290"
                     /old_locus_tag="STY0707"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020457015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/aspartate ABC transporter ATP binding
                     protein GltL"
                     /protein_id="WP_000631369.1"
                     /translation="MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLI
                     KTVNGLEPVQKGEITVNGIIVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQ
                     VKVLKRDKAAARDKGLKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLF
                     DEPTSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDS
                     PKEEFFANPSSDRAKDFLAKILH"
     gene            complement(704016..704690)
                     /gene="gltK"
                     /locus_tag="STY_RS03295"
                     /old_locus_tag="STY0708"
     CDS             complement(704016..704690)
                     /gene="gltK"
                     /locus_tag="STY_RS03295"
                     /old_locus_tag="STY0708"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000272794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/aspartate ABC transporter permease
                     GltK"
                     /protein_id="WP_000272799.1"
                     /translation="MYEFDWSSIIPSLPYLLAGLVITLKITVTAVVVGIVWGTILAVM
                     RLSSFAPIAWFAKAYVNVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKTDIRLISAMV
                     AFSMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLT
                     QGIVLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGAVYFVISLSASLLVSY
                     LKKRTV"
     gene            complement(704690..705430)
                     /gene="gltJ"
                     /locus_tag="STY_RS03300"
                     /old_locus_tag="STY0709"
     CDS             complement(704690..705430)
                     /gene="gltJ"
                     /locus_tag="STY_RS03300"
                     /old_locus_tag="STY0709"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/aspartate ABC transporter permease
                     GltJ"
                     /protein_id="WP_000020930.1"
                     /translation="MSIDWNWGIFLQEAPFGNTTYLGWLWSGFQVTVALSITAWIIAF
                     LVGSIFGILRTVPNRFLSGLGTLYVELFRNVPLIVQFFTWYLVVPELLPEDLGMWFKA
                     ELDPNIQFFLSSMICLGLFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVL
                     LPNAYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAAQAGKLLDYSAHAWESFTAITLA
                     YVLINAVIMLVMSLVERKVRLPGNVGSK"
     gene            complement(705590..706498)
                     /locus_tag="STY_RS03305"
                     /old_locus_tag="STY0710"
     CDS             complement(705590..706498)
                     /locus_tag="STY_RS03305"
                     /old_locus_tag="STY0710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_308721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_001682194.1"
                     /translation="MQLRKLTTAMLVMGLSAGLAHAEDGAPAAGSTLDKIAKNGVIVV
                     GHRESSVPFSYYDNQQKVVGYSQDYSNAIVEVVKKKLNKPDLQVKLIPITSQNRIPLL
                     QNGTFDFECGSTTNNLERQKQAAFSDTIFVVGTRLLTKKGGDIKDFPDLKGKAVVVTS
                     GTTSEILLHKLNEEQKMGMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKK
                     PDNWEIVGKPQSQEAYGCMLRKNDPEFKKLMDDTIAQAQTSGEAEKWFDKWFKNPIPP
                     KNLNMNFELSDEMKALFKAPNDKALN"
     gene            complement(706916..708454)
                     /gene="lnt"
                     /locus_tag="STY_RS03310"
                     /old_locus_tag="STY0711"
     CDS             complement(706916..708454)
                     /gene="lnt"
                     /locus_tag="STY_RS03310"
                     /old_locus_tag="STY0711"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="WP_000853074.1"
                     /translation="MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIVSLIGL
                     QALTFNRRPLQSAAIGYCWGLGLFGSGINWVYVSIAQFGGMPGPVNVFLVVLLAAYLS
                     LYTGLFAGILSRLWPKTNWLRVAIAAPAIWQITEFLRGWVLTGFPWLQFGYSQVDGPL
                     KGLAPVMGVEAINFLLMMVSGLLALALATRNWRPLAVAVILFALPFPLRYIQWFTLEP
                     TKATQVSLVQGDIPQSLKWDENQLLNTLNIYLNETRPELGKSQIIIWPESAIPDLEIN
                     QQPFLRSLDEMLREKNSTLITGIVDARLNKQNRYDTYNTIITLGKDNPYSYDSPNRYN
                     KNHLVPFGEFVPLESILRPLAPFFDLPMSSFSRGPYIQPQLHAHDYKLTAAICYEIIL
                     GEQVRDNFRPDTDYLLTISNDAWFGKSIGPWQHFQMARMRSLELARPLLRSTNNGITA
                     VIGPQGEIQAMIPQFTRQVLTTKVTPTTGLTPYARTGDWTVWLITVLFGFGALVMSLR
                     QRRK"
     gene            complement(708474..709352)
                     /gene="corC"
                     /locus_tag="STY_RS03315"
                     /old_locus_tag="STY0712"
     CDS             complement(708474..709352)
                     /gene="corC"
                     /locus_tag="STY_RS03315"
                     /old_locus_tag="STY0712"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459659.1"
                     /note="CorC(YbeX) belongs to the Cyclin M Mg2+ Exporter
                     (CNNM) family, and was characterized as belonging to a set
                     of three proteins, at least one of which must be present
                     for CorA to function; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CNNM family magnesium/cobalt transport protein
                     CorC"
                     /protein_id="WP_001278615.1"
                     /translation="MSDDNSHSSDTVNSKKGFFSLLLSQLFHGEPKNRDELLALIRDS
                     GQNELIDEDTRDMLEGVMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSR
                     FPVISEDKDHIEGILMAKDLLPFMRSDAEAFSMDKVLRTAVVVPESKRVDRMLKEFRS
                     QRYHMAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTIRALA
                     SIEDFNDAFGTHFSDEEVDTIGGLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQ
                     VHVRIPDDSPQPKLDE"
     gene            complement(709510..709983)
                     /gene="ybeY"
                     /locus_tag="STY_RS03320"
                     /old_locus_tag="STY0714"
     CDS             complement(709510..709983)
                     /gene="ybeY"
                     /locus_tag="STY_RS03320"
                     /old_locus_tag="STY0714"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA maturation RNase YbeY"
                     /protein_id="WP_000084477.1"
                     /translation="MSQVILDLQLACENHAGLPDEAQFQRWLDGVIPQFQEEAEVTIR
                     LVDEAESHDLNLTYRGKDKPTNVLSFPFEAPPGIEMPLLGDLIICRQVVEQEAQEQSK
                     PLEAHWAHMVVHGSLHLLGYDHIDDDEAEEMESLETEIMLAMGYEDPYIAEKIAE"
     gene            complement(709980..711065)
                     /locus_tag="STY_RS03325"
                     /old_locus_tag="STY0715"
     CDS             complement(709980..711065)
                     /locus_tag="STY_RS03325"
                     /old_locus_tag="STY0715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459661.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoH family protein"
                     /protein_id="WP_000493272.1"
                     /translation="MFSVRRYRHKRNSLNIDTREITLEPADNARLLSLCGPFDDNIKQ
                     LERRLGIEINRRDNHFKLTGRPICVTAATDILRSLYVDTAPMRGQTQDIEPEQIHLAI
                     KEARVLEQSAESVPDYGKAINIKTKRGVIKPRTPNQAQYIANILDHDITFGVGPAGTG
                     KTYLAVAAAVDALERQEIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFE
                     MLGFEKVEKLIERNVIEVAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNS
                     KAVITGDVTQIDLPRNTKSGLRHAIEVLAEVDEISFNFFHSEDVVRHPVVARIVNAYE
                     AWEEAEQKRKAALAAERKREAQEQEQK"
     gene            complement(711231..712655)
                     /gene="miaB"
                     /locus_tag="STY_RS03330"
                     /old_locus_tag="STY0716"
     CDS             complement(711231..712655)
                     /gene="miaB"
                     /locus_tag="STY_RS03330"
                     /old_locus_tag="STY0716"
                     /EC_number="2.8.4.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (N6-isopentenyl
                     adenosine(37)-C2)-methylthiotransferase MiaB"
                     /protein_id="WP_001519200.1"
                     /translation="MTKKLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVL
                     LLNTCSIREKAQEKVFHQLGRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDII
                     FGPQTLHRLPEMINSVRGDRSPVVDISFPEIEKFDRLPEPRAEGPTAFVSIMEGCNKY
                     CTYCVVPYTRGEEVSRPSDDILFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTF
                     ADLLRLVAAIDGIDRIRFTTSHPIEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNL
                     MGRTHTALEYKAIIRKLRAARPDIQISSDFIVGFPGETTDDFEKTMKLIADVNFDMSY
                     SFIFSARPGTPAADMVDDVPEEEKKQRLYILQERINQQAMAWSRRMLGTTQRILVEGT
                     SRKNIMELSGRTENNRVVNFEGTPEMIGKFVDVEITDVYPNSLRGKVVRTEDEMGLRV
                     AETPESVIARTRKENELGVGFYQP"
     gene            712799..713974
                     /gene="ubiF"
                     /locus_tag="STY_RS03335"
                     /old_locus_tag="STY0717"
     CDS             712799..713974
                     /gene="ubiF"
                     /locus_tag="STY_RS03335"
                     /old_locus_tag="STY0717"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
                     hydroxylase"
                     /protein_id="WP_000184625.1"
                     /translation="MTNQPTEIAIVGGGMVGGALALGLAQQGFTVMVIEHAAPAPFVA
                     DSQPDVRISAISAASVALLKGLGVWEAVQGMRSHPYRRLETWEWENAHVVFDAAELKL
                     PLLGYMVENNVLQQALWQALEAHPGVTLRVPASLAALHRRHDGYALELADGEWVTPKL
                     VIGADGANSQVRQMAGIGIHAWQYAQSCMLITVKCENAPGDSTWQQFTPTGPRAFLPL
                     FDDWASLVWYDAPARIRQLQSLSMTQLQVEINQHFPARLGAVMPVAAGAFPLTRRHAL
                     QYAQPGLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLASARSYGESWASHSVLKRY
                     QTRRMADNFMMQSGMDLFYAGFSNELPPLRILRNMGLMAAQRAGVLKRQALKYALGL"
     gene            complement(714107..714181)
                     /locus_tag="STY_RS03340"
                     /old_locus_tag="STYt006"
     tRNA            complement(714107..714181)
                     /locus_tag="STY_RS03340"
                     /old_locus_tag="STYt006"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(714147..714149),aa:Gln,seq:ctg)
     gene            complement(714228..714304)
                     /locus_tag="STY_RS03345"
                     /old_locus_tag="STYt007"
     tRNA            complement(714228..714304)
                     /locus_tag="STY_RS03345"
                     /old_locus_tag="STYt007"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(714268..714270),aa:Met,seq:cat)
     gene            complement(714320..714394)
                     /locus_tag="STY_RS03350"
                     /old_locus_tag="STYt008"
     tRNA            complement(714320..714394)
                     /locus_tag="STY_RS03350"
                     /old_locus_tag="STYt008"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(714360..714362),aa:Gln,seq:ttg)
     gene            complement(714430..714504)
                     /locus_tag="STY_RS03355"
                     /old_locus_tag="STYt009"
     tRNA            complement(714430..714504)
                     /locus_tag="STY_RS03355"
                     /old_locus_tag="STYt009"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(714470..714472),aa:Gln,seq:ttg)
     gene            complement(714528..714612)
                     /locus_tag="STY_RS03360"
                     /old_locus_tag="STYt010"
     tRNA            complement(714528..714612)
                     /locus_tag="STY_RS03360"
                     /old_locus_tag="STYt010"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(714576..714578),aa:Leu,seq:tag)
     gene            complement(714621..714697)
                     /locus_tag="STY_RS03365"
                     /old_locus_tag="STYt011"
     tRNA            complement(714621..714697)
                     /locus_tag="STY_RS03365"
                     /old_locus_tag="STYt011"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(714661..714663),aa:Met,seq:cat)
     gene            complement(714919..716583)
                     /gene="asnB"
                     /locus_tag="STY_RS03370"
                     /old_locus_tag="STY0718"
     CDS             complement(714919..716583)
                     /gene="asnB"
                     /locus_tag="STY_RS03370"
                     /old_locus_tag="STY0718"
                     /EC_number="6.3.5.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthase B"
                     /protein_id="WP_000337026.1"
                     /translation="MCSIFGVFDIKTDAAELRKKALELSRLMRHRGPDWSGIYACDNA
                     ILAHERLSIVDVNAGAQPLYNAKKTHVLAVNGEIYNHQTLRAEYGDRYAFQTGSDCEV
                     ILALYQEKGPDFLDDLQGMFAFALYDSEKDAYLIGRDHIGIIPLYMGYDEFGNFYVAS
                     EMKALTPVCRTIKEFPAGSYLWSKDGEIRQYYQRDWFDYDAVKDNVTDKNALRQALEE
                     SVKSHLMSDVPYGVLLSGGLDSSVISAITKKFAARRVEDQERSEAWWPQLHSFAVGLE
                     GSPDLKAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMS
                     RKIKAMGIKMVLSGEGSDEVFGGYLYFHKAPNAKELHEETVRKLQALHMYDCTRANKA
                     MSAWGVEARVPFLDKKFLDVAMRINPQDKMCGNGKMEKHVLRECFESYLPASVAWRQK
                     EQFSDGVGYSWIDTLKEVAAKQISDQQLETARFRFPYNTPSSKEAYLYREIFEELFPV
                     PSAAECVPGGPSVACSSAKAIEWDEAFKTMDDPSGRAVGVHQSAYQ"
     gene            complement(716873..717625)
                     /gene="nagD"
                     /locus_tag="STY_RS03375"
                     /old_locus_tag="STY0719"
     CDS             complement(716873..717625)
                     /gene="nagD"
                     /locus_tag="STY_RS03375"
                     /old_locus_tag="STY0719"
                     /EC_number="3.1.3.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide monophosphatase NagD"
                     /protein_id="WP_000153143.1"
                     /translation="MTIKNVICDIDGVLMHDNVAVPGAAEFLTGILEKGLPLVLLTNY
                     PSQTGQDLANRFATAGVNVPDSVFYTSAMATADFLRRQEGKKAYVVGEGALIHELYKA
                     GFTITDVNPDFVIVGETRSYNWDMMHKAAFFVANGARFIATNPDTHGRGFYPACGALC
                     AGIEKISGRKPFYVGKPSPWIIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETI
                     LVLSGVSTINDIDSMPFRPSWIYPSVAEIDVI"
     gene            complement(717672..718892)
                     /gene="nagC"
                     /locus_tag="STY_RS03380"
                     /old_locus_tag="STY0720"
                     /gene_synonym="nagR"
     CDS             complement(717672..718892)
                     /gene="nagC"
                     /locus_tag="STY_RS03380"
                     /old_locus_tag="STY0720"
                     /gene_synonym="nagR"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator NagC"
                     /protein_id="WP_000187578.1"
                     /translation="MTPGGQAQIGNVDLVKQLNSAAVYRLIDQHGPISRIQIAEQSQL
                     APASVTKITRQLIERGLIKEVDQQASTGGRRAISIVTETRNFHAIGVRLGRHDTTLTL
                     YDLSSKVVAEEHYPLPERTQETLEHALLNTIAVFIDSCQRKIRELIAISVILPGLVDP
                     ESGVIRYMPHIQVENWGLVEALEKRFHVTCFVGHDIRSLALAEHYFGASQDCEDSILV
                     RVHRGTGAGIISNGRIFIGRNGNVGEIGHIQVEPLGERCHCGNFGCLETIAANAAIEQ
                     RVLNLLKQGYQSRVPLDDCTIKTICKAANRGDSLASEVIEHVGRHLGKTIAIAINLFN
                     PQKIVIAGEIIEADKVLLPAIESCINTQALKAFRKNLPVVRSTLDHRSAIGAFALVKR
                     AMLNGTLLQRLLES"
     gene            complement(718897..720051)
                     /gene="nagA"
                     /locus_tag="STY_RS03385"
                     /old_locus_tag="STY0721"
     CDS             complement(718897..720051)
                     /gene="nagA"
                     /locus_tag="STY_RS03385"
                     /old_locus_tag="STY0721"
                     /EC_number="3.5.1.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-6-phosphate deacetylase"
                     /protein_id="WP_000271187.1"
                     /translation="MYALTQGRIFTGHEILDDHALVVANGLIDRVCPMAELPPGIEQR
                     SLNGAILSPGFIDVQLNGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNFLPTLITT
                     SDELMKQGIRVMREYLEKHPHQALGLHLEGPWLNLVKKGTHNPDFVRKPDAALVDFLC
                     DNADVITKVTLAPEMVPADVIAKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLF
                     NAMPYITGREPGLAGAVLDEADIYCGVIADGLHVDYANIRNAKRLKGDKLCLVTDATA
                     PAGANIEQFIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVAHCGIALDEVLRM
                     ATLYPARAIGVDKHLGSIAPSKVANLTAFTHDFKIIKTIVNGDEVVDLSK"
     gene            complement(720111..720911)
                     /gene="nagB"
                     /locus_tag="STY_RS03390"
                     /old_locus_tag="STY0722"
     CDS             complement(720111..720911)
                     /gene="nagB"
                     /locus_tag="STY_RS03390"
                     /old_locus_tag="STY0722"
                     /EC_number="3.5.99.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008805656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine-6-phosphate deaminase"
                     /protein_id="WP_001237064.1"
                     /translation="MRLIPLSTAEQVGKWAARHIVNRINAFKPTTDRPFVLGLPTGGT
                     PLTAYKALVEMHKAGEVSFKHVVTFNMDEYVGLPKEHPESYHSFMHRNFFDHVDIPAE
                     NINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIK
                     TLTHDTRVANSRFFDGDVNQVPKYALTVGVGTLLDAEEVMILVLGHQKAQALQAAVEG
                     NVNHMWTISCLQLHPKAVVVCDEPSTMELKVKTLKYFNELEAENIKGL"
     gene            721238..723190
                     /gene="nagE"
                     /locus_tag="STY_RS03395"
                     /old_locus_tag="STY0723"
     CDS             721238..723190
                     /gene="nagE"
                     /locus_tag="STY_RS03395"
                     /old_locus_tag="STY0723"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS N-acetyl glucosamine transporter subunit
                     IIABC"
                     /protein_id="WP_001023150.1"
                     /translation="MNILGFFQRLGRALQLPIVVLPVAALLLRFGQPDLLNMPFIAQA
                     GGSIFDNLALVFAIGVASSWSKDSAGAAALAGAVGYFVMTKAMVTINPEINMGVLAGI
                     ITGLVGGAVYNRWSGIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHGIH
                     AGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTVFHGDINR
                     FYAGDGTAGMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAITAFLTGV
                     TEPLEFLFMFLAPLLYLLHAILTGISLFVATLLGIHAGFSFSAGAIDYVLMYNLPAAS
                     NNVWMLLVMGVVFFIIYFLLFSAVIRMFNLKTPGREDKVDEMVTEEANSNTEEGLTQL
                     ATSYIAAVGGTDNLKAVDACITRLRLTVNDSARVNDAACKRLGASGVVKLNKQTIQVI
                     VGAKAESIGDEMKKVVARGPVAAASADAAHVATPAPAAKPQAVPNAVTIAELVSPITG
                     EVVALDQVPDEAFASKAVGDGVAVKPTDKTVVSPAAGTIVKIFNTNHAFCLETEKGAE
                     IVVHMGIDTVALNGQGFKRLVEEGAEVTAGQPVLELDLDFLNANARSKISPVVCSNSD
                     DFSALVIKADGHVVAGQTPLYEIKSK"
     gene            723401..725068
                     /gene="glnS"
                     /locus_tag="STY_RS03400"
                     /old_locus_tag="STY0724"
     CDS             723401..725068
                     /gene="glnS"
                     /locus_tag="STY_RS03400"
                     /old_locus_tag="STY0724"
                     /EC_number="6.1.1.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine--tRNA ligase"
                     /protein_id="WP_001287188.1"
                     /translation="MSEAEARPTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGH
                     AKSICLNFGIAQDYQGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHWSGDIRYSSD
                     YFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENLALFEK
                     MRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGTKWCIYPMYDFTHCI
                     SDALEGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNL
                     LVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIRE
                     DLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNKPEMGSREVPFSGEIWIDRA
                     DFREEANKQYKRLVMGKEVRLRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDPAD
                     GRKVKGVIHWVSVAHALPIEIRLYDRLFSVPNPGAAEDFLSVINPESLVIKQGYGEPS
                     LKAAVAGKAFQFEREGYFCLDSRYATADKLVFNRTVGLRDTWAKAGE"
     gene            725520..726926
                     /gene="chiP"
                     /locus_tag="STY_RS03405"
                     /old_locus_tag="STY0725"
     CDS             725520..726926
                     /gene="chiP"
                     /locus_tag="STY_RS03405"
                     /old_locus_tag="STY0725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitoporin"
                     /protein_id="WP_001258803.1"
                     /translation="MRTFSGKRSTLALAIAGITAMSGWIVVPQAQASGFFDDSTLTGG
                     IYYWQRERDRKDVTDGDKYKTNLSHATWNANLDFQSGYAADMFGLDIAAFTAIEMAEN
                     GDSGHPNEIAFSKKNKGYDEDYSGDKSGISLYKAAAKFKYGPVWARAGYIQPTGQTLL
                     APHWSFMPGTYQGAEAGASFDYGDAGALSFSYMWTNEYKAPWHTEMDKFYQADKKTNV
                     DYLHSIGAKYDFKNDLVLEAAFGQSEGYVDQYFAKASYKFDLGGNPFTTSYQFYGARD
                     KVDDRSVNDIYDGTAWLQALTFGYKVAEVVDLRLEGTWVKADGQQGYFLQRMTPTYAS
                     SNGRLDIWWDNRSDFNANGEKAVFFGAMYDLKNWNLPGWAVGASYVYAWDAKPATWQS
                     NPDAYYDKNRTIEESSYSLDAVYTLQEGRAKGTMFKLHFTEYDNHSNIPSWGGGYGNI
                     FQDERDVKFIVIAPFTIF"
     gene            726976..727308
                     /locus_tag="STY_RS03410"
                     /old_locus_tag="STY0726"
     CDS             726976..727308
                     /locus_tag="STY_RS03410"
                     /old_locus_tag="STY0726"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_000722260.1"
                     /translation="MKKILLIASMTAGLTACASSPAPEEDSRLKEAYSACINTAQGSP
                     EKIEACQSVLNVLKKERKHQQFANEESVRVLDYQQCIQATRTGNDQAVKADCDKVWQE
                     IRSHNNVQ"
     gene            complement(727357..728661)
                     /gene="tcuC"
                     /locus_tag="STY_RS03415"
                     /old_locus_tag="STY0727"
     CDS             complement(727357..728661)
                     /gene="tcuC"
                     /locus_tag="STY_RS03415"
                     /old_locus_tag="STY0727"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tricarballylate/proton symporter TcuC"
                     /protein_id="WP_000057014.1"
                     /translation="MAQHTPATSRAGTFGAILRVTSGNFLEQFDFFLFGFYATYIART
                     FFPAESEFASLMLTFAVFGSGFLMRPVGAIVLGAYIDRIGRRKGLMVTLAIMGCGTLL
                     IALVPGYQTIGLAAPALVLLGRLLQGFSAGVELGGVSVYLSEIATPGNKGFYTSWQSA
                     SQQVAIVVAALIGYSLNITLGHDAISEWGWRIPFFIGCMIIPLIFVLRRSLQETEAFL
                     QRKHRPDTREIFATIAKNWRIITAGTLLVAMTTTTFYFITVYTPTYGRTVLNLSARDS
                     LIVTMLVGVSNFIWLPIGGAISDRIGRRAVLMGITLLALITTWPVMQWLTAAPDFTRM
                     TLVLLWFSFFFGMYNGAMVAALTEVMPVYVRTVGFSLAFSLATAIFGGLTPAISTALV
                     KLTGDKSSPGWWLMCAALCGLAATAMLFVRLSRGYIAAENKA"
     gene            complement(728712..729851)
                     /gene="tcuB"
                     /locus_tag="STY_RS03420"
                     /old_locus_tag="STY0728"
     CDS             complement(728712..729851)
                     /gene="tcuB"
                     /locus_tag="STY_RS03420"
                     /old_locus_tag="STY0728"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tricarballylate utilization protein TcuB"
                     /protein_id="WP_000811143.1"
                     /translation="MKQLEKLIIEATVLTEPEAEVERVMQVCNACRYCEGFCAVFPAM
                     TQRLEFGKADIHYLANLCHNCGACLHACQYAPPHEFAINVPKAMAQARLETYQQYAQP
                     AAFGALYRRAGITVALALIVGLTLFLLLAMALKGSLIHPPLAGDFYQIFPHSLLAWMF
                     GSVFVLAIGLLMAGVISFWREISPGVPRSAEIAEASHNALTLKYLDGGHGKGCNEADD
                     AFTLLRRRFHHFTFYGFMLCFAATVVATGYHYVAGWEAPYPFFSLPVMLGTLGGIGLL
                     IGPAGLLWLNLRRSPLHSDARQKPMDRGFILLLFLTSLTGLALLAGRDTSGMGILLAL
                     HLGVVMALFLTLPYGKFAHGFFRCAALLKWAVEKRRGKHAGDTGN"
     gene            complement(729838..731241)
                     /gene="tcuA"
                     /locus_tag="STY_RS03425"
                     /old_locus_tag="STY0729"
     CDS             complement(729838..731241)
                     /gene="tcuA"
                     /locus_tag="STY_RS03425"
                     /old_locus_tag="STY0729"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent tricarballylate dehydrogenase
                     TcuA"
                     /protein_id="WP_000228705.1"
                     /translation="MVDVLVIGGGNAALCAALTAREAGASVLLLEAAPREWRGGNSQH
                     TRNLRCMHDAPQDVLVESYPEEEFWQDLWRVTDGNTNEALARLVIRTSSQCRDWMRKH
                     GVNFQPPLSGALHVARTNAFFMGGGKALVNAYYRSAERLGVQIRYNTPVHALELHDGE
                     FVAALAGSERITAKACVLAAGGFESNREWLREAWGENARGEWPADNFLIRGTRFNQGV
                     LLKFMMDAGADIIGDPSQSHCVAIDARAPLYDGGICTRVDCVSLGIVVNRDAERFYDE
                     GEDFWPKRYAIWGRLVAQQPGQIGYSIIDSKAIGHFMPPVFPGAQANTLAELACQLGL
                     DAEKFTHTVTQYNQACQPGHFDHTLLDDCATKNLTPAKTHWARPLDAPPYYGYALRPG
                     ITFTYLGLKVNERAAVHFAGHPSRNLFVAGEMMAGNVLGKGYTAGVGMSIGTTFGRIA
                     GIEAARAAHKEAQHETA"
     gene            complement(731339..732265)
                     /gene="tcuR"
                     /locus_tag="STY_RS03430"
                     /old_locus_tag="STY0730"
     CDS             complement(731339..732265)
                     /gene="tcuR"
                     /locus_tag="STY_RS03430"
                     /old_locus_tag="STY0730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tricarballylate utilization LysR family
                     transcriptional regulator TcuR"
                     /protein_id="WP_000423368.1"
                     /translation="MELRQLRYFVRIIETGSMGSAAQDLDIGVSALSQQMSRLENELA
                     IRLLQRTSRGVTPTNAGLAFYSQAQLALRHADDAILAAREARLSGHVSVGMAPSTASI
                     LGIPFIHAMQENYADVRLHVVESLSGNLERMINTRQIDLAVVFQKDKILRWSARPILE
                     EQLFLIGSHALLAALPDNPITPEQLAGIPLIMPSQGHGLRGRLDAVCKEHALNVEIVA
                     EIDGLALLMRAVRDGLGATLQPGAAISHLDNDALRVIGVHNPVLSRPNFLVSLSDDEL
                     TPAGLAARVVLTKVMRQLVDAGEWPGATLYAY"
     gene            complement(732380..732832)
                     /gene="fur"
                     /locus_tag="STY_RS03435"
                     /old_locus_tag="STY0731"
     CDS             complement(732380..732832)
                     /gene="fur"
                     /locus_tag="STY_RS03435"
                     /old_locus_tag="STY0731"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferric iron uptake transcriptional regulator"
                     /protein_id="WP_000131699.1"
                     /translation="MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLI
                     DMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEF
                     SDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHDDATK"
     gene            complement(733114..733644)
                     /gene="fldA"
                     /locus_tag="STY_RS03440"
                     /old_locus_tag="STY0732"
     CDS             complement(733114..733644)
                     /gene="fldA"
                     /locus_tag="STY_RS03440"
                     /old_locus_tag="STY0732"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin FldA"
                     /protein_id="WP_001018622.1"
                     /translation="MAITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDL
                     EGYDILLLGIPTWYYGEAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCDAL
                     GTIRDIIEPRGATIVGHWPTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKW
                     VKQVSAELHLGDILNA"
     gene            complement(733795..734088)
                     /gene="ybfE"
                     /locus_tag="STY_RS03445"
                     /old_locus_tag="STY0733"
     CDS             complement(733795..734088)
                     /gene="ybfE"
                     /locus_tag="STY_RS03445"
                     /old_locus_tag="STY0733"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LexA regulated protein"
                     /protein_id="WP_001040939.1"
                     /translation="MAKEQTDRTTLDLFAHERRPGRPKTNPLSRDEQLRINKRNQLKR
                     DKVRGLKRVELKLNAQAVDALNELAEARNISRSELIEEILMKQLMALRGQGLV"
     gene            complement(734222..734992)
                     /gene="ybfF"
                     /locus_tag="STY_RS03450"
                     /old_locus_tag="STY0734"
     CDS             complement(734222..734992)
                     /gene="ybfF"
                     /locus_tag="STY_RS03450"
                     /old_locus_tag="STY0734"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_000773252.1"
                     /translation="MKLNIRAQSAQNLHNNSPIVLVHGLFGSLDNLGVLARDLVTDHD
                     IIQVDMRNHGLSPRDPVMDYPAMAQDLLDTLDAQQIEKATFIGHSMGGKAVMALTALA
                     PDRIDRLVAIDIAPVDYHVRRHDRIFAAINAVSESDATSRQQAAGIMRQHLNKEGVIQ
                     FLLKSWAEGEWRFNVPVLWEQYPHIVGWETIPPWEHPALFIPGGNSPYVTEAYRDALL
                     AQFPLARAHVIAGAGHWVHAEKPEAVLRAIRRYLHDKR"
     gene            735177..735719
                     /gene="seqA"
                     /locus_tag="STY_RS03455"
                     /old_locus_tag="STY0735"
     CDS             735177..735719
                     /gene="seqA"
                     /locus_tag="STY_RS03455"
                     /old_locus_tag="STY0735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation negative regulator SeqA"
                     /protein_id="WP_000848395.1"
                     /translation="MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSATTQPTAS
                     AVKGTPAAQPVAEAKPVNPVKDKVRAMRELLLSDEYAEQKKAVNRFMLILTTLYSLDH
                     HAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIE
                     HIMQSMQFPAELIEKVCGTI"
     gene            735744..737384
                     /gene="pgm"
                     /locus_tag="STY_RS03460"
                     /old_locus_tag="STY0736"
     CDS             735744..737384
                     /gene="pgm"
                     /locus_tag="STY_RS03460"
                     /old_locus_tag="STY0736"
                     /EC_number="5.4.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-D-glucose phosphate-specific
                     phosphoglucomutase"
                     /protein_id="WP_000974369.1"
                     /translation="MAIHNRAGQPAQQSDLINVAQLTAQYYVLKPEAGNAEHAVKFGT
                     SGHRGSAGRHSFNEPHILAIAQAIAEERAKNGITGPCYVGKDPHALSEPAFISVLEVL
                     AANGVDVIVQENNGFTPTPAVSNAILVHNKKGGPLADGIVITPSHNPPEDGGIKYNPP
                     NGGPADTNVTKVVEDRANALLADGLQGVKRISLDAAMASGHVKAVDLVQPFVEGLADI
                     VDMAAIQKAGLTLGVDPLGGSGIEYWKRIAEHYKLNLTLVNDQVDQTFRFMHLDKDGA
                     IRMDCSSECAMAGLLALRDKFDLAFANDPDYDRHGIVTPAGLMNPNHYLAVAINYLFQ
                     HRPLWGKDVAVGKTLVSSAMIDRVVNDLGRKLVEVPVGFKWFVDGLFDGSFGFGGEES
                     AGASFLRFDGTPWSTDKDGIIMCLLAAEITAVTGKNPQEHYNELAARFGAPSYNRLQA
                     AATSAQKAALSKLSPEMVSASTLAGDPITARLTAAPGNGASIGGLKVMTDNGWFAARP
                     SGTEDAYKIYCESFLGEEHRKQIEKEAVEIVSEVLKNA"
     gene            complement(737499..737984)
                     /locus_tag="STY_RS03465"
                     /old_locus_tag="STY0737"
     CDS             complement(737499..737984)
                     /locus_tag="STY_RS03465"
                     /old_locus_tag="STY0737"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase family
                     protein"
                     /protein_id="WP_000070053.1"
                     /translation="MSNPEREVTDIAEILAILSKHEVCRIGFNDNLCPYVVPVNFGYE
                     YQNGRWIFYFHGARTGKKMRLLRKNPAVCIEMDGDHALLRADDPCDYSYAYTSVFATG
                     LASILQTREEMRHGLDVIMRQTDPGKTFSYREDMMKAVCVVRIECDALTCRRHLATQS
                     E"
     gene            complement(738049..739368)
                     /gene="potE"
                     /locus_tag="STY_RS03470"
                     /old_locus_tag="STY0738"
     CDS             complement(738049..739368)
                     /gene="potE"
                     /locus_tag="STY_RS03470"
                     /old_locus_tag="STY0738"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine-ornithine antiporter"
                     /protein_id="WP_000042659.1"
                     /translation="MSKPKSNKMGVVQLTILTMVNMMGSGIIMLPTKLSEVGTISIIS
                     WLVTAVGSMALAWAFAKCGMFSRKSGGMGGYAEYAFGKSGNFMANYTYGVSLLIANVA
                     IAISAVGYGTELFGAALTPLQIGLATIAVLWVCTIANFGGARITGQISSVTVWGVIIP
                     VVGLCIIGWFWFSPSMYVASWNPHHVPFFSAVGSSIAMTLWAFLGLESACANADVVEN
                     PEKNVPIAVLGGTLGAAVIYIVSTNVIAGIVPNMDLANSTAPFGLAFAQMFTPAVGKV
                     IMALMVMSCCGSLLGWQFTIAQVFKSSADEGYFPKVFSRVTKVDAPVQGVLIIVIIQT
                     GLSLMTISPSLNSQFNVLVNLAVVTNIIPYILSMAALVIIQKMANVPSSKAKVANFVA
                     FVGAMYSFYALYSSGEEAMLYGSIVTFLGWTLYGLVSPRFELKNKHG"
     gene            complement(739365..741370)
                     /locus_tag="STY_RS03475"
                     /old_locus_tag="STY0739"
                     /pseudo
     CDS             complement(739365..741370)
                     /locus_tag="STY_RS03475"
                     /old_locus_tag="STY0739"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001331976.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine decarboxylase"
     gene            complement(<741816..741917)
                     /locus_tag="STY_RS03480"
                     /pseudo
     CDS             complement(<741816..741917)
                     /locus_tag="STY_RS03480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001312672.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2618 domain-containing protein"
     gene            complement(742195..742872)
                     /gene="kdpE"
                     /locus_tag="STY_RS03485"
                     /old_locus_tag="STY0743"
     CDS             complement(742195..742872)
                     /gene="kdpE"
                     /locus_tag="STY_RS03485"
                     /old_locus_tag="STY0743"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system response regulator KdpE"
                     /protein_id="WP_000186051.1"
                     /translation="MTNVLIVEDEQAIRRFLRAALEGDGLRVYEAETLQRGLLEAATR
                     KPDLIILDLGLPDGDGIDFIRDLRQWSAIPVIVLSARSEESDKIAALDAGADDYLSKP
                     FGIGELQARLRVALRRHAASPCADPIVRFSGVTVDLAARLIHRGDEEIHLTPIEFRLL
                     AVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPTRPRHFIIETG
                     IGYRFMP"
     gene            complement(742869..745577)
                     /gene="kdbD"
                     /locus_tag="STY_RS03490"
                     /old_locus_tag="STY0744"
     CDS             complement(742869..745577)
                     /gene="kdbD"
                     /locus_tag="STY_RS03490"
                     /old_locus_tag="STY0744"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system sensor histidine kinase
                     KdbD"
                     /protein_id="WP_000997481.1"
                     /translation="MNDEPLRPDPDRLLEQTPPPHRGKLKIFFGACAGVGKTWAMLAQ
                     AQRLRAQGLDVVIGVVETHGRKETAALLDGLTILPPKRHSHRGRQIREFDLDAALARR
                     PALILMDELAHSNAPGSRHPKRWQDIEELLEAGIDVFTTVNVQHLESLNDVVSGVTGI
                     QVRETVPDPFFDAADEVVLVDLPPDDLRQRLNEGKVYIAGQAERAIEHFFRKGNLIAL
                     RELALRRTADRVDDQMRAWRAHPGEEKVWHTRDAILLCIGHNTGSEKLVRTAARLASR
                     LGSVWHAVYVETPTLHRLPEKQRRAILSALRLAQELGAETATLSDPAEEKAVVRYARE
                     HNLGKIVMGRPASRRWWRRDAFADRLARRAPDLDQVIVALEEPPARALAQTPDNRPFK
                     EKWRGQIQGCLVAVALCAITTFIAMQWLVTFDAANLVMLYLLGVVVIALLYGRWPSVV
                     ATVINVASFDLFFIAPRGTLAVSDVQYLLTFAVMLTVGLVIGNLTAGVRYQARVARYR
                     EQRTRHLYEMSKALAVGRSEHDIAATSERFIASTCQARSQILLPDTNGKLLPLTHQQG
                     MTPWDDAIARWSFDKGQPAGAGTDTLPGVPYQILPLKSADKTYGLAIVEPGNLRQLMV
                     PEQQRLLETFTLLVANALERLTLTASEEQARLASEEQARLASERESIRNALLAALSHD
                     LRTPLTVLFGQAEILTLDLASAGSPHARQASEIRQHILNTTRLVNNLLDMARIQSGGF
                     NLKKEWLTLEEVVGSALQMLEPGLLHPITLSLPQQLTLIHVDGPLFERVLINLLENAV
                     KYAGPQASIGIDAAVKDNRLQLDVWDNGPGIPAGQEQKIFDKFARGNKESAVPGVGLG
                     LAICHAIVEVHGGTLTAYNRPQGGACFRVTLPQGKPPELDDFHEDM"
     gene            complement(745574..746158)
                     /gene="kdpC"
                     /locus_tag="STY_RS03495"
                     /old_locus_tag="STY0745"
     CDS             complement(745574..746158)
                     /gene="kdpC"
                     /locus_tag="STY_RS03495"
                     /old_locus_tag="STY0745"
                     /EC_number="7.2.2.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium-transporting ATPase subunit KdpC"
                     /protein_id="WP_014341418.1"
                     /translation="MIGLRPAFSTMLFLLLLTGGVYPLLTTALGQWWFPWQANGSLIH
                     KDNLIRGSALIGQSFTAAGYFHGRPSATADTPYNPLASGGSNLAASNPELDAQIQARV
                     AALRAANPQASSAVPVELTTASASGLDNNLTPGAAAWQIPRVAAARQLPVEQVAQLVA
                     EYTHRPLASFLGQPVVNIVELNLALDALQGHRAK"
     gene            complement(746167..747876)
                     /gene="kdpB"
                     /locus_tag="STY_RS03500"
                     /old_locus_tag="STY0746"
     CDS             complement(746167..747876)
                     /gene="kdpB"
                     /locus_tag="STY_RS03500"
                     /old_locus_tag="STY0746"
                     /EC_number="7.2.2.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium-transporting ATPase subunit KdpB"
                     /protein_id="WP_000088016.1"
                     /translation="MSRKQLALFEPVLLVQALTDAVKKLSPRAQWRNPVMFVVWAGSV
                     LATLLTLAMVTGQIAGSALFTGVISLWLWFTVLFANFAEALAEGRSKAQANSLKGVKK
                     TAFARRLRAPRHDAQADNVPAAELRKGDIVLVKAGDIIPCDGEVIEGGASVDESAITG
                     ESAPVIRESGGDFASVTGGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDER
                     TLADAAQLASLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINID
                     NRMIRKGSVDAIRRHVESNGGHFPADVEQNVENVARLGATPLVVVEGARVLGVIALKD
                     IVKGGIKERFAQLRKMGIKTVMITGDNRLTAAAIAAEAGVDDFLAEATPEAKLALIRQ
                     YQAEGRLVAMTGDGTNDAPALAQADVAVAMNSGTQAAKEAGNMVDLDSNPTKLIEVVH
                     IGKQMLMTRGSLTTFSIANDVAKYFAIIPAAFAATYPQLNALNVMGLHSPNSAILSAV
                     IFNALIIIFLIPLALKGVSYKPLSASAMLRRNLWIYGLGGLVVPFIGIKVIDVLLTLL
                     DLA"
     gene            complement(747897..749576)
                     /gene="kdpA"
                     /locus_tag="STY_RS03505"
                     /old_locus_tag="STY0747"
     CDS             complement(747897..749576)
                     /gene="kdpA"
                     /locus_tag="STY_RS03505"
                     /old_locus_tag="STY0747"
                     /EC_number="7.2.2.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium-transporting ATPase subunit KdpA"
                     /protein_id="WP_000730077.1"
                     /translation="MAAQGFLLIASFLLILLVLAKPLGSGLARLIAAVPLPGVAGVER
                     ILWRTLGITDHEMNWRQYLLALLTLNLLGLGILFCLLFWQEWLPLNPQRLPGLSWDLA
                     LNTAVSFVTNTNWQAYSGESTLSYFSQMAGLTVQNFLSAATGIAVVFALIRAFTRQNV
                     HTLGNAWQDLVRITLWILFPVALIIALFFIQQGVPQNLSAYQPITTLEGAKQLLPMGP
                     VASQEAIKMLGTNGGGFFNANSSHPFENPTALTNLAQMLAIFLIPAALCFAFGEAAGD
                     RRQGRALLWAMSFIFVVCVAVVMWAEVQGNPHLLAAGADSSVNMEGKEARFGVLASSL
                     FAVVTTAASCGAVNAMHDSFTALGGMVPMWLMQIGEVVFGGVGSGLYGMLLFVLLAVF
                     IAGLMIGRTPEYLGKKIDVREMKMTALAILVTPMLVLLGSALAMMTDAGRSAMLNPGP
                     HGFSEVLYAVSSAANNNGSAFAGLSANSPFWNCLLAFCMFVGRFGVIIPVMAIAGSLV
                     SKKVQPASQGTLATHGALFIGLLIGTVLLVGALTFIPALALGPVAEHFSLP"
     gene            complement(749576..749665)
                     /gene="kdpF"
                     /locus_tag="STY_RS03510"
     CDS             complement(749576..749665)
                     /gene="kdpF"
                     /locus_tag="STY_RS03510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="K(+)-transporting ATPase subunit F"
                     /protein_id="WP_001670793.1"
                     /translation="MSAGVITGIVLVFLLLGYLVYALINAEAF"
     gene            750002..750208
                     /locus_tag="STY_RS03515"
                     /old_locus_tag="STY0748"
     CDS             750002..750208
                     /locus_tag="STY_RS03515"
                     /old_locus_tag="STY0748"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YbfA family protein"
                     /protein_id="WP_000401435.1"
                     /translation="MEHYKDYPAHVIFARRAFAVTAGVLALPVMLFWKDRARFYSYLH
                     RVWSKTSDKPVWMAQAEKATCDFY"
     gene            750319..751740
                     /gene="phrB"
                     /locus_tag="STY_RS03520"
                     /old_locus_tag="STY0749"
     CDS             750319..751740
                     /gene="phrB"
                     /locus_tag="STY_RS03520"
                     /old_locus_tag="STY0749"
                     /EC_number="4.1.99.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribodipyrimidine photo-lyase"
                     /protein_id="WP_001142014.1"
                     /translation="MPTHLVWFRRDLRLQDNLALAAACRDASARVLALYISTPAQWQA
                     HDMAPRQAAFISAQLNALQTALAEKGIPLLFHEVADFNASIETVKNVCRQHDVSHLFY
                     NYQYEFNERQRDAAVEKTLPSVICEGFDDSVILAPGAVMTGNHEMYKVFTPFKNAWLK
                     RLKEDIPPCVPAPKIRVSGALSIPLTPVSLNYPQQAFDAALFPVEENAVIAQLRHFCS
                     QGADEYASRRDFPAVDGTSRLSASLATGGLSPRQCLHRLLAEQPQALDGGPGSVWLNE
                     LIWREFYRHLMTWYPALCKHQPFIRWTKRVAWQENPHYFQAWQKGETGYPIVDAAMRQ
                     LNATGWMHNRLRMITASFLVKDLLIDWRLGERYFMSQLIDGDLAANNGGWQWAASTGT
                     DAAPYFRIFNPTTQRERFDRDGEFIRQWLPALRDIPGKAIHEPWRWAEKAGVVLDYPR
                     PIVEHKQARIATLSAYEAARKGA"
     gene            complement(751779..753260)
                     /locus_tag="STY_RS03525"
                     /old_locus_tag="STY0750"
     CDS             complement(751779..753260)
                     /locus_tag="STY_RS03525"
                     /old_locus_tag="STY0750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_001041123.1"
                     /translation="MNKQASQPRAIYYVVALQIWEYFSFYGMRALLILYLTNQLKYDD
                     NHAYELFSAYCSLVYVTPILGGYLADKVLGNRMAVMLGAFLMAIGHLVLGASEIAPTF
                     LYLSLAIIVCGYGLFKSNISCLLGELYQPEDPRRDGGFSLLYAAGNIGSIVAPIACGY
                     VQEEYSWAMGFALAAIGMLAGLVIFLCGNRHFTHTTGVNKAVLCARNYLLPNWGWLLI
                     LLVAAPLLITVLFWKEWSVYALIVATAIGLVVLAKIYRQAQTAKQRKELGLIVTLTLF
                     SMLFWAFAQQGGSSISLYIDRFVNRDILGYSVPTAMFQSVNAFAVMLCGVVLAWLVKE
                     SVSGNRTVRIWGKFALGLGLMSAGFCILTLSARWSAAYGHSSMPLMVLGLAVMGFAEL
                     FIDPVAMSQITRIDIPGVTGVLTGIYMLLSGAIANYLAGVIADQTSQSAFDASGAVNY
                     AINAYVDVFEQITWGALACVGVVLLIWLYQSFKFKSRALAVES"
     gene            753589..754332
                     /gene="ybgI"
                     /locus_tag="STY_RS03530"
                     /old_locus_tag="STY0751"
     CDS             753589..754332
                     /gene="ybgI"
                     /locus_tag="STY_RS03530"
                     /old_locus_tag="STY0751"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000798886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radiation resistance protein YbgI"
                     /protein_id="WP_000798844.1"
                     /translation="MKNTELEQLINDKLNSAAISDYAPNGLQVEGKETVQKIVTGVTA
                     SQALLDEAVRLQADAVIVHHGYFWKGESPVIRGMKRRRLKTLLANDINLYGWHLPLDA
                     HPELGNNAQLAALLGITVKGEIEPLVPWGELSMPVPGLELASWIEARLGRKPLWCGDT
                     GPENVQRVAWCTGGGQSFIDSAARFGVDAFITGEVSEQTIHSAREQGLHFYAAGHHAT
                     ERGGIRALSEWLNENTALDVTFIDIPNPA"
     gene            754348..755004
                     /gene="pxpB"
                     /locus_tag="STY_RS03535"
                     /old_locus_tag="STY0752"
     CDS             754348..755004
                     /gene="pxpB"
                     /locus_tag="STY_RS03535"
                     /old_locus_tag="STY0752"
                     /EC_number="3.5.2.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-oxoprolinase subunit PxpB"
                     /protein_id="WP_001188364.1"
                     /translation="MQRARCYLLGETAVVLELEPPITLASQKRIWRLTQRLVDMPNVV
                     EAILGMNNITVILREPQTLALDAIERLQRWWEESEALEPDSRSVEIPVIYGGAGGPDL
                     AAVARHSGLSEKQVVELHASVEYVVWFLGFQPGFPYLGNLPEPLHMPRRAEPRLQVPA
                     GSVGIGGAQTGIYPLSTPGGWQLIGLTPLKLFDPMRETPVLLRPGDSVRFVPQKEGIC
                     "
     gene            754998..755930
                     /locus_tag="STY_RS03540"
                     /old_locus_tag="STY0753"
     CDS             754998..755930
                     /locus_tag="STY_RS03540"
                     /old_locus_tag="STY0753"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin-dependent carboxyltransferase family
                     protein"
                     /protein_id="WP_000932048.1"
                     /translation="MLNIIRAGIYTSVQDSGRHGFRQSGLSHCGALDKPAFQTANLLV
                     GNDANAPALEITLGQLVVEFENETWFALTGAGCEAQLDDQPVWTGWRLPVKAGQRLTL
                     HRPLHGMRSYLAVAGGIAVPEVMGSCSTDLKSGIGGLEGRLLKDGDRLATGKPSRQLS
                     GPQGVKQLLWGNRIRALPGPEYREFDRASQEAFWRSPWQLSPQSNRMGYRLQGQSLTR
                     TTDRELLSHGLLPGVVQVPYNGQPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLEQ
                     PIHFVQCSLEEALNARRERRRYLEQLTWRLQHEH"
     gene            755920..756654
                     /gene="pxpA"
                     /locus_tag="STY_RS03545"
                     /old_locus_tag="STY0754"
     CDS             755920..756654
                     /gene="pxpA"
                     /locus_tag="STY_RS03545"
                     /old_locus_tag="STY0754"
                     /EC_number="3.5.2.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-oxoprolinase subunit PxpA"
                     /protein_id="WP_001017910.1"
                     /translation="MNIDLNADLGEGCASDSELLTLVSSANIACGFHAGDAQTMLTCV
                     REALKNGVAIGAHPSFPDRDNFGRTAMVLPPETVYAQTLYQIGALGAIVQAQGGVMRH
                     VKPHGMLYNQAAKDPHLAQAIAKAVHDYDPSLILVGLAGSELIRAGERHRLVTRQEVF
                     ADRGYQADGSLVPRMQPGALIHDEEQALAQTLDMVQAGRVKSVTGVWTTVTAQTVCIH
                     GDGEYALAFARRLRAAFNARNVHVIA"
     gene            756978..757109
                     /locus_tag="STY_RS03550"
     CDS             756978..757109
                     /locus_tag="STY_RS03550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001521652.1"
                     /translation="MTTYQEIEARLIRCFTITSWIACQIASYMDFKLFTHSNFFSEN"
     gene            757169..757735
                     /locus_tag="STY_RS03555"
                     /old_locus_tag="STY0756"
     CDS             757169..757735
                     /locus_tag="STY_RS03555"
                     /old_locus_tag="STY0756"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_000824704.1"
                     /translation="MKRKYLTQEEIEKLLSATDRMPFPERNRCLILMAFIHGFRASEL
                     LGLRLSDIDLAGRQLYIRRLKNGFSTCHPLLPDEYNVLKSWLRARKYLEKGADGDWLF
                     LSLRRHPLSRQQFFYILREAGRLAELTIAPHPHMLRHACGYALADKGIDTRLIQDYLG
                     HRNIQHTVRYTASNAGRFHGIWRKKRRV"
     gene            757913..758248
                     /locus_tag="STY_RS03560"
     CDS             757913..758248
                     /locus_tag="STY_RS03560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010989127.1"
                     /translation="MQPKSRTGQGVREQCLDGARRHFSYRHGMAPGPRKGADMLFPQH
                     EAAVAGAVPGRQWPEENNLMTQEYAEMSTGRGGTSKCRYSMGAKIFLLLLAVSTVAAL
                     FSLYQVLTY"
     gene            758250..758990
                     /locus_tag="STY_RS03565"
                     /old_locus_tag="STY0758"
     CDS             758250..758990
                     /locus_tag="STY_RS03565"
                     /old_locus_tag="STY0758"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001194239.1"
                     /translation="MQTLTRVLPPLRLIMFCQSGENPTQFPDTGGLCVEDCVRLRTPE
                     GLLDRLRRWPGAMVISAGRPSTQLLLWQQVFLRYPRTVVFCSSNAFLPVDVSVEGYFR
                     HLRLIKRAMSVRVLARMAELAIWSSLQTSPYEEEMKSALSVPELVMEINSRTLVRLLS
                     ERLPKQGRRVLGLLLSGCSPEMTARMLGTGVRQVWLAEQTLKQRWDIPTGVPLSDAVR
                     IRIPDVGPDISQQSGLVKTGAGNAPDLC"
     gene            759276..760343
                     /locus_tag="STY_RS03570"
                     /old_locus_tag="STY0759"
     CDS             759276..760343
                     /locus_tag="STY_RS03570"
                     /old_locus_tag="STY0759"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001779972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-binding protein"
                     /protein_id="WP_001779972.1"
                     /translation="MQRKKILIVGAGLSGAVIARQLAEQGHVVNIIDQRSHIGSNAYD
                     ARDEHTGIMVYVYGPHIFHTDNETVWNYVNKYAEMMPYINKVKATVNGQVFSLPINLH
                     TINQFFGVACSPDDARKLLLQKCDSTILEPQNFEQQALRFIGKELYEAFFKGYTIKQW
                     GLHPSALPASVLKRIPVRFNYDDNYFNHKFQGIPKFGYTQMVKSIVEHENIAVELCRS
                     FTQEMRTNYDHVFFSGALDAFYSCQYGRLEYRTLDFKKIICQSDYQGCAVMNYCSIDT
                     PYTRITEHKYFSPWERHEASICYQEYSRECEAGDIPYYPVRRADKMDLLNKYLSRAKK
                     EKILLSLVVLALIVISIWTSR"
     gene            760423..761319
                     /locus_tag="STY_RS03575"
                     /old_locus_tag="STY0760"
     CDS             760423..761319
                     /locus_tag="STY_RS03575"
                     /old_locus_tag="STY0760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_000973923.1"
                     /translation="MMKCTALIVTFNRLEKLKKSVRETVKAGFSSIVIVNNGSSDGTR
                     EWLSSLSEPGITILNLKDNLGGAGGFKVGSQYICSYSNADWVFFYDDDAYPEINILKH
                     FSLLDTSSYRIFASRVQDTYGRSCRMNLPFIRVPSTVFETIYYAMRPERFSPVRTQVT
                     DVQTVSFVGMIIDRKVLNNHLNDIYDELFLYYDDFFFGYKLVLSGQKIRYSPEIKFIH
                     DISIHGRCICPEWKVYYLCRNLLLLRKLLPVPRIFSVLSIVLRLSKYLAILPWQRKKF
                     RYLYFIWQGILHGLKGISGKYH"
     gene            761332..762465
                     /locus_tag="STY_RS03580"
                     /old_locus_tag="STY0761"
     CDS             761332..762465
                     /locus_tag="STY_RS03580"
                     /old_locus_tag="STY0761"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="WP_000824901.1"
                     /translation="MKRLCYFVNSDWYFDLHWTERAIAARDAGYEIHIISHFIGEEII
                     KKFKTLGFICHNVSLVAQSFNMFVFFRAFLNARKIIKEINPDLLHCITLKPCLIGGVS
                     ARRSNSPVVISFVGLGRIFLYNTVPMRILRALTVLVYKYIAGNKRGVFIFEHDKDRRK
                     ISRLVGIDYHKTIVIEGAGINPDIYKFSIEKKHEIPIVLFASRMLWSKGLGDLIEAKK
                     ILRQKNIHFVLNVAGILAEDDKDAIPLELIHHWHNEGLINWLGRSSNVYELIQKSNIV
                     ALPSIYPEGVPRLLLEASSVGRACIAYDTGGCDSLIIHNYNGLIVKSNSAQELAVELE
                     YLLKNPQIRLEMGANGRKRVKELFSSILVINKTLQIYKDTIGC"
     gene            762594..763364
                     /locus_tag="STY_RS03585"
                     /old_locus_tag="STY0762"
                     /pseudo
     CDS             762594..763364
                     /locus_tag="STY_RS03585"
                     /old_locus_tag="STY0762"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459707.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
     gene            763368..764078
                     /locus_tag="STY_RS03590"
                     /old_locus_tag="STY0764"
     CDS             763368..764078
                     /locus_tag="STY_RS03590"
                     /old_locus_tag="STY0764"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000702850.1"
                     /translation="MKISCKNVGVILPIFNSSHRSFKKTFLQAASGGRIGSSNTGIIE
                     VEALKKIDFTLTEGNRLALIGHNGSGKTTLLRVLAGAYKPTSGKYECIGRVTSLIDPM
                     MGMDGELTGLENIKLRGLFLGLSKNEIKNITEDVIEFSELGDFIKIPVRTYSSGMVLR
                     LGFSISTAINPEILLMDEWMSVGDSDFKRKAEMRLNSFISKAGIMVMATHDDELAKSV
                     CNKFIRLEHSEIVSKGGF"
     gene            764172..765945
                     /locus_tag="STY_RS03595"
                     /old_locus_tag="STY0765"
                     /pseudo
     CDS             764172..765945
                     /locus_tag="STY_RS03595"
                     /old_locus_tag="STY0765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459709.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
     gene            766138..766971
                     /locus_tag="STY_RS03600"
                     /old_locus_tag="STY0767"
     CDS             766138..766971
                     /locus_tag="STY_RS03600"
                     /old_locus_tag="STY0767"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_001800477.1"
                     /translation="MEKSLLVIVRHKPGRTRLLMRALQSINDQTFKKINIIIFCMEEE
                     LKCHNVDDFYLKELSNIYSVIYDENCIFNAIKMSESNYLCFMDDDDSWAPEYVSRLLS
                     VLANIQSTYSSVNAIACHTNKVAEIAENNRIIINSTQPWNHYLNAGPVSFDVIYYRNS
                     IPLSSCLFDKNSVIDVIESHKLSSPAFFWPFFIHYLAENDVWILPEALAFYHFRENDD
                     FEFGNYTVINNELFDIECKIAENKMMRSIDDSSLLNVLLSNIANNSLFHKISYIENKI
                     K"
     gene            767029..768451
                     /locus_tag="STY_RS03605"
                     /old_locus_tag="STY0768"
                     /pseudo
     CDS             767029..768451
                     /locus_tag="STY_RS03605"
                     /old_locus_tag="STY0768"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459711.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
     gene            768519..768671
                     /locus_tag="STY_RS03610"
     CDS             768519..768671
                     /locus_tag="STY_RS03610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001528779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010989129.1"
                     /translation="MPWRDHVNPDGEVVSCCDNVIITGYHRLFVHPLWIFIMAFDVHS
                     RQSEAG"
     gene            768705..769496
                     /gene="nei"
                     /locus_tag="STY_RS03615"
                     /old_locus_tag="STY0771"
     CDS             768705..769496
                     /gene="nei"
                     /locus_tag="STY_RS03615"
                     /old_locus_tag="STY0771"
                     /EC_number="4.2.99.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease VIII"
                     /protein_id="WP_001113965.1"
                     /translation="MPEGPEIRRAADNLEAAIKGKPLTDVWFAFAQLKPYESQLTGQL
                     VTRIETRGKALLTHFSNGLTLYSHNQLYGVWRVIDTGEIPQTTRILRVRLQTADKIIL
                     LYSASDIEMLTAEQLMTHPFLQRVGPDVLDARLTPEEVKARLLSPRFRNRQFSGLLLD
                     QSFLAGLGNYLRVEILWQVGLTGQHKAKDLNEAQLNALSHALLDIPRLSYTTRGQADE
                     NKHHGALFRFKVFHRDGEACERCGGIIEKTTLSSRPFYWCAHCQK"
     gene            complement(769551..770597)
                     /locus_tag="STY_RS03620"
                     /old_locus_tag="STY0772"
     CDS             complement(769551..770597)
                     /locus_tag="STY_RS03620"
                     /old_locus_tag="STY0772"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB family transcriptional regulator"
                     /protein_id="WP_001122050.1"
                     /translation="MPILQWFLLFLLSLLISLIFLYLHLPAAMLLGPMIAGIVLSLRG
                     STLQLPRGIFLAAQAILGCMIAQNLTGSILTTLALYWPVVLFVLLVTLLSSAVVGWLL
                     VRYSSLPGNTGAWGSSPGGAAAMVAMAQDYGADIRLVAFMQYLRVLFVAGAAVLVTRL
                     ILGDSAATVSQQVVWFPPLSGNLLTTLLLAIVAGIAGRLMRIPSGTMLLPMLAGALLH
                     SQGIIEIELPEWLLAVAYMAIGWRIGLGFDRQVFFMALRPLPQILLSIFALMAICAAM
                     AWGMAYYMQIDFMTAYLATSPGGLDTVAAIAAGSSADMALIMAMQTLRLFSILLTGPA
                     VARFISTYAPKQPL"
     gene            complement(770734..772017)
                     /locus_tag="STY_RS03625"
                     /old_locus_tag="STY0773"
     CDS             complement(770734..772017)
                     /locus_tag="STY_RS03625"
                     /old_locus_tag="STY0773"
                     /EC_number="2.3.3.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate synthase"
                     /protein_id="WP_000785816.1"
                     /translation="MADTKAKITLTGDTAIELDVLKGTLGQDVIDIRSLGSKGVFTFD
                     PGFTSTASCESKITFIDGDEGILLHRGFPIDQLATDSNYLEVCYILLYGEKPTQEEYD
                     EFRTTVTRHTMIHEQITRLFHAFRRDSHPMAVMCGITGALAAFYHDSLDVNNPRHREI
                     AAFRLLSKMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCETYEVNPVLER
                     AMDRILILHADHEQNASTSTVRTAGSSGANPFACIAAGIASLWGPAHGGANEAALKML
                     EEISSVKHIPEFVRRAKDKNDSFRLMGFGHRVYKNYDPRATVMRETCHEVLKELGTKD
                     DLLEVAMGLEHIALNDPYFIEKKLYPNVDFYSGIILKAMGIPSSMFTVIFAMARTVGW
                     IAHWNEMHTDGMKIARPRQLYTGYDKRDFKSALKR"
     gene            772118..772363
                     /locus_tag="STY_RS03630"
     CDS             772118..772363
                     /locus_tag="STY_RS03630"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010989130.1"
                     /translation="MHQSTVTSLLFGSPLCERGDDLGTEQWAFAGNGLINFELAANQE
                     RSNPSNVTCLSLITVLKEWVNIIVLLHNLLTGERVTP"
     gene            772757..773161
                     /gene="sdhC"
                     /locus_tag="STY_RS03635"
                     /old_locus_tag="STY0775"
                     /gene_synonym="cybA; dhsC"
     CDS             772757..773161
                     /gene="sdhC"
                     /locus_tag="STY_RS03635"
                     /old_locus_tag="STY0775"
                     /gene_synonym="cybA; dhsC"
                     /EC_number="1.3.5.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000263334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase cytochrome b556 subunit"
                     /protein_id="WP_000263340.1"
                     /translation="MWALFMIRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFI
                     AVGILLWLLGTSLSSPEGFQQAADIMDGFIVKFIMWGILTALAYHVIVGIRHMLMDFG
                     YLEETFEAGQRSAKISFVITVVLSLLAGVLVW"
     gene            773155..773502
                     /gene="sdhD"
                     /locus_tag="STY_RS03640"
                     /old_locus_tag="STY0776"
                     /gene_synonym="cybS; dhsD"
     CDS             773155..773502
                     /gene="sdhD"
                     /locus_tag="STY_RS03640"
                     /old_locus_tag="STY0776"
                     /gene_synonym="cybS; dhsD"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017455938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase membrane anchor subunit"
                     /protein_id="WP_000254356.1"
                     /translation="MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELT
                     FEAWTGFFSSAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLAVRLILQLVIVVALV
                     VYVIYGFVVVWGV"
     gene            773502..775268
                     /gene="sdhA"
                     /locus_tag="STY_RS03645"
                     /old_locus_tag="STY0777"
     CDS             773502..775268
                     /gene="sdhA"
                     /locus_tag="STY_RS03645"
                     /old_locus_tag="STY0777"
                     /EC_number="1.3.5.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase flavoprotein subunit"
                     /protein_id="WP_000775523.1"
                     /translation="MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRS
                     HTVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHM
                     GLPFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTI
                     FSEWYALDLVKNQDGAVVGCTALCIETCEVVYFKARATVLATGGAGRIYQSTTNAHIN
                     TGDGVGMALRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMECY
                     APNAKDLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVLESRLPGILELS
                     RTFAHVDPVKEPIPVIPTCHYMMGGIPTKVTGQALTVNEQGEDVVIPGLFAVGEIACV
                     SVHGANRLGGNSLLDLVVFGRAAGLHLQESIAEQGVLRDASESDVEGSLDRLNRWNNN
                     RNGEDPVAIRKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKNARLDDTSSEFNT
                     QRVECLELDNLMETAYATAVSANFRTESRGAHSRFDFPERDDANWLCHTLYQPQTESM
                     TRRSVNMEPKLRPAFPPKIRTY"
     gene            775285..776001
                     /locus_tag="STY_RS03650"
                     /old_locus_tag="STY0778"
     CDS             775285..776001
                     /locus_tag="STY_RS03650"
                     /old_locus_tag="STY0778"
                     /EC_number="1.3.5.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012133276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase iron-sulfur subunit
                     SdhB"
                     /protein_id="WP_001764104.1"
                     /translation="MKLEFSIYRYNPDVDNAPRMQDYTLEGEEGRDMMLLDALIQLKE
                     KDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALTQSGKKIVIRPLPGLPVIRD
                     LVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCP
                     SFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLEGMSDAFSVFRCHSIMNCVSVCPK
                     GLNPTRAIGHIKSMLLQRSA"
     gene            776527..779328
                     /gene="sucA"
                     /locus_tag="STY_RS03655"
                     /old_locus_tag="STY0779"
     CDS             776527..779328
                     /gene="sucA"
                     /locus_tag="STY_RS03655"
                     /old_locus_tag="STY0779"
                     /EC_number="1.2.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate dehydrogenase E1 component"
                     /protein_id="WP_001181500.1"
                     /translation="MQNSALKAWLDSSYLSGSNQSWIEQLYEDFLTDPDSVDANWRLT
                     FQQLPGTGVKPDQLHSKTREYFRRQALAGSRHSSTISDPDTNVKQVKVLQLINAYRFR
                     GHQHANLDPLGLWKQERVADLDPSFHDLTEADFQETFNVGSFASGKETMKLGELLDAL
                     KQTYCGPIGAEYMHITSTEEKRWIQQRIESGRAAFSADEKKRFLNELTAAEGLERYLG
                     AKFPGAKRFSLEGGDALIPMLKEMVRHAGNSGTREVVLGMAHRGRLNVLINVLGKKPQ
                     DLFDEFAGKHKEHLGTGDVKYHMGFSSDIETEGGLVHLALAFNPSHLEIVSPVVMGSV
                     RARLDRLDEPSSNKVLPITIHGDAAVTGQGVVQETLNMSKARGYEVGGTVRIVINNQV
                     GFTTSNPLDARSTPYCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFI
                     DLVCYRRHGHNEADEPSATQPLMYQKIKKHPTPRKIYADKLEADKVATLEDATEMVNL
                     YRDALDAGECVVKEWRPMNMHSFTWSPYLNHEWDEAYPNKVEMKRLQELAKRISTVPE
                     AIEMQSRVAKIYGDRQAMAAGEKLFDWGGAENLAYATLVDEGIPVRLSGEDSGRGTFF
                     HRHAVIHNQTNGSTYTPLQHIHSGQGQFKVWDSVLSEEAVLAFEYGYATAEPRTLTIW
                     EAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQL
                     CAEQNMQVCVPSTPAQVYHMLRRQALRGMRRPLVVMSPKSLLRHPLAVSTLDELANGS
                     FQPAIGEIDELDPKAVKRVVMCSGKVYYDLLEQRRKNDQKDVAIVRIEQLYPFPHKAV
                     QEALQPYAHVHDFVWCQEEPLNQGAWYCSQHHFREVIPFGAALRYAGRPASASPAVGY
                     MSVHQKQQQDLVNDALNVD"
     gene            779343..780551
                     /gene="odhB"
                     /locus_tag="STY_RS03660"
                     /old_locus_tag="STY0780"
     CDS             779343..780551
                     /gene="odhB"
                     /locus_tag="STY_RS03660"
                     /old_locus_tag="STY0780"
                     /EC_number="2.3.1.61"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate dehydrogenase complex
                     dihydrolipoyllysine-residue succinyltransferase"
                     /protein_id="WP_000099858.1"
                     /translation="MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDK
                     VVLEVPASADGILDAVLEEEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQ
                     QASLEEQNNDALSPAIRRLLAEHNLEASAIKGTGVGGRLTREDVEKHLAKGESKAPAV
                     EPAAQPALGARGEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYG
                     EVFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGL
                     VTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPI
                     INPPQSAILGMHAIKDRPMAVDGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELL
                     EDPTRLLLDV"
     gene            780693..781859
                     /gene="sucC"
                     /locus_tag="STY_RS03665"
                     /old_locus_tag="STY0781"
     CDS             780693..781859
                     /gene="sucC"
                     /locus_tag="STY_RS03665"
                     /old_locus_tag="STY0781"
                     /EC_number="6.2.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012133271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-forming succinate--CoA ligase subunit beta"
                     /protein_id="WP_001048590.1"
                     /translation="MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWV
                     VKCQVHAGGRGKAGGVKVVKSKEEIRAFAENWLGKRLVTYQTDANGQPVNQILVEAAT
                     DIGKELYLGAVVDRSSRRVVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQG
                     RELAFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGA
                     DGNALFRQPDLREMRDQSQEDPREAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIV
                     KLHGGEPANFLDVGGGATKERVTEAFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIG
                     AVEEVGVNVPVVVRLEGNNAELGAKKLADSGLNIIAAKSLTDAAQQVVAAVEGK"
     gene            781859..782728
                     /gene="sucD"
                     /locus_tag="STY_RS03670"
                     /old_locus_tag="STY0782"
     CDS             781859..782728
                     /gene="sucD"
                     /locus_tag="STY_RS03670"
                     /old_locus_tag="STY0782"
                     /EC_number="6.2.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate--CoA ligase subunit alpha"
                     /protein_id="WP_000114639.1"
                     /translation="MSVLINKDTNVICQGFTGSQGTFHSEQAIAYGTQMVGGVTPGKG
                     GTTHLGLPVFNTVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPT
                     LDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYE
                     AVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEA
                     AAYIKDHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRS
                     LADIGEALKAIIK"
     gene            784316..785884
                     /gene="cydA"
                     /locus_tag="STY_RS03675"
                     /old_locus_tag="STY0786"
     CDS             784316..785884
                     /gene="cydA"
                     /locus_tag="STY_RS03675"
                     /old_locus_tag="STY0786"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005125442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome ubiquinol oxidase subunit I"
                     /protein_id="WP_000884372.1"
                     /translation="MLDIVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSG
                     KQIYKDMTKFWGKLFGINFALGVATGLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLM
                     AFFLESTFVGLFFFGWDRLSKVQHMCVTWLVALGSNLSALWILVANGWMQNPIAADFN
                     FETMRMEMVSFSELVLNPVAQVKFVHTVASGYVTGAMFILGISAYYMLKGRDFAFAKR
                     SFAIAASFGMAAVLSVIVLGDESGYEMGDVQKTKLAAIEAEWETQPAPASFTLFGIPD
                     QDKQENHLAIQIPYALGIIATRSVDTPVIGLKDLMVQHEERIRNGMKAYELLEQLRAG
                     STDQAVRDQFNSMKKDLGYGLLLKRYTPNVTDATEAQIQQATKDSIPRVAPLYFAFRI
                     MVACGFLLLAIIALSFWSVIRNRIGEKKWLLRAALYGIPLPWIAVEAGWFVAEYGRQP
                     WAIGKVLPTAVANSSLTVGDLLFSMFLICGLYTLFLVAELFLMFKFARLGPSSLKTGR
                     YHFEQSTVTSQPAR"
     gene            785900..787039
                     /gene="cydB"
                     /locus_tag="STY_RS03680"
                     /old_locus_tag="STY0787"
     CDS             785900..787039
                     /gene="cydB"
                     /locus_tag="STY_RS03680"
                     /old_locus_tag="STY0787"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000568269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome d ubiquinol oxidase subunit II"
                     /protein_id="WP_000568258.1"
                     /translation="MIDYEVLRFIWWLLVGILLIGFAVTDGFDMGVGMLTRFLGRNDT
                     ERRIMINSIAPHWDGNQVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLASLFFRPV
                     GFDYRSKIEDPRWRNMWDWGVFIGSFVPPLVIGVAFGNLLQGVPFHVDEYLRLYYTGN
                     FFQLLNPFGLLAGIVSVGMIITQGATYLQMRTVGELHLRARATSQIAALVTLVCFALA
                     GVWVMYGIDGYVVTSAIDHHAASNPLTKEVAREAGAWLVNFNNAPILWLVPALGVVLP
                     LLTILTSRMEKGAWAFLFSSLTLACIILTAGIAMFPFVMPSSTMMNASLTMWDATSSQ
                     MTLNLMTWVAAVFVPIILIYTSWCYWKMFGRITKEHIESNTHSLY"
     gene            787054..787167
                     /gene="cydX"
                     /locus_tag="STY_RS03685"
                     /old_locus_tag="STY0788"
     CDS             787054..787167
                     /gene="cydX"
                     /locus_tag="STY_RS03685"
                     /old_locus_tag="STY0788"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome bd-I oxidase subunit CydX"
                     /protein_id="WP_000270278.1"
                     /translation="MWYFAWILGTLLACAFGIITALALEHVEAGKTGQEES"
     gene            787304..787585
                     /gene="ybgE"
                     /locus_tag="STY_RS03690"
                     /old_locus_tag="STY0789"
     CDS             787304..787585
                     /gene="ybgE"
                     /locus_tag="STY_RS03690"
                     /old_locus_tag="STY0789"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyd operon protein YbgE"
                     /protein_id="WP_000875303.1"
                     /translation="MKYIYAVMDKRLLRALSFVMAIVLAGCMFWDPLRFAARTSTLEI
                     WHGLLLMWAVCAGIIHGVGFRPESVHWQGIFCPLLADIVLIVGLIFFFL"
     gene            787814..788218
                     /gene="ybgC"
                     /locus_tag="STY_RS03695"
                     /old_locus_tag="STY0790"
     CDS             787814..788218
                     /gene="ybgC"
                     /locus_tag="STY_RS03695"
                     /old_locus_tag="STY0790"
                     /EC_number="3.1.2.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tol-pal system-associated acyl-CoA thioesterase"
                     /protein_id="WP_001046241.1"
                     /translation="MNKYMFRWPIRVYYEDTDAGGVVYHASYVAFYERARTEMLRHHH
                     FSQQVLLAERVAFVVRKMTLEYYAPARLDDMLEVQTEITSMRGTALVFTQRIVNAENT
                     LLNEAEVLIVFVDPLKMKPRALPKSIVAEFKQ"
     gene            788215..788907
                     /gene="tolQ"
                     /locus_tag="STY_RS03700"
                     /old_locus_tag="STY0791"
     CDS             788215..788907
                     /gene="tolQ"
                     /locus_tag="STY_RS03700"
                     /old_locus_tag="STY0791"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tol-Pal system protein TolQ"
                     /protein_id="WP_000131318.1"
                     /translation="MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNA
                     AAREAEAFEDKFWSGIELSRLYQESQGRRDSLSGSEQIFYSGFKEFVRLHRANSHAPE
                     AVVEGASRAMRISMNRELETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVK
                     QATLQMVAPGIAEALIATAIGLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILH
                     RQAFTVSESNKG"
     gene            788911..789339
                     /gene="tolR"
                     /locus_tag="STY_RS03705"
                     /old_locus_tag="STY0792"
     CDS             788911..789339
                     /gene="tolR"
                     /locus_tag="STY_RS03705"
                     /old_locus_tag="STY0792"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015965300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin uptake protein TolR"
                     /protein_id="WP_000124676.1"
                     /translation="MARTRGRGRRELKSEINIVPLLDVLLVLLLIFMATAPIITQSVE
                     VDLPEANQSQAVSSNDDPPVIIEVSGVGQYSVVVDKDRMDQLPSEQVIAEVKRHLQAN
                     PKTVFLIGGAKEVPYDEIIKALNLLHSAGVKSVGLMTQPI"
     gene            789404..790534
                     /gene="tolA"
                     /locus_tag="STY_RS03710"
                     /old_locus_tag="STY0793"
     CDS             789404..790534
                     /gene="tolA"
                     /locus_tag="STY_RS03710"
                     /old_locus_tag="STY0793"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope integrity protein TolA"
                     /protein_id="WP_000030559.1"
                     /translation="MSKATEQNDKLKRAIIISAVLHIILFAVLIWSSFDEHIEASAGG
                     GGGSAIDAVMVDPGAVVQQYNRQQDQQASARGAEEERKKLQQQQAEELQQKQAAEQER
                     LKQLEKERLAAQEQQKQAEEAAKLAQQQQQAEEAAKAAADAKKKAEAEAAKAAADAKK
                     KAEAEAAKAAADAKKKAEAEAAKAAAEAKKKAEAEAAKAAADAKKKADAEAAKAAAEA
                     KKKADAAAAKAAADAKKKAAAEKAAAAEGVDDLLGDLSSGKNAPKTGGGAKGNGQPSK
                     DSGTSGANGGTTGADISAYAKQIQVAIQSRLYDASLYQGKQCVLHISLAPDGSLKSIT
                     SEGGDPALCQAALMATKTAKIPKPPSQAVYEKIKDAKLDFKL"
     gene            790658..791950
                     /gene="tolB"
                     /locus_tag="STY_RS03715"
                     /old_locus_tag="STY0794"
     CDS             790658..791950
                     /gene="tolB"
                     /locus_tag="STY_RS03715"
                     /old_locus_tag="STY0794"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001646851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tol-Pal system protein TolB"
                     /protein_id="WP_010989131.1"
                     /translation="MKQALRVAFGFLMLWAAVLHAEVRIEITQGVDSARPIGVVPFKW
                     AGPGAAPEDIGGIVAADLRNSGKFNPLDRSRLPQQPATAQEVQPTAWSALGIDAVIVG
                     LVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIK
                     GAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVT
                     FESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGTKLAFALSKTGSLNLYVMDLA
                     SGQIRQITDGRSNNTEPTWFPDSQTLAFTSDQAGRPQVYKMNINGGAAQRITWEGSQN
                     QDADVSSDGKFMVMVSSNNGQQHIAKQDLVTGGVQVLSSTFLDETPSLAPNGTMVIYS
                     SSQGMGSVLNLVSTDGRFKARLPATDGQVKSPAWSPYL"
     gene            791985..792509
                     /gene="pal"
                     /locus_tag="STY_RS03720"
                     /old_locus_tag="STY0795"
     CDS             791985..792509
                     /gene="pal"
                     /locus_tag="STY_RS03720"
                     /old_locus_tag="STY0795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-associated lipoprotein Pal"
                     /protein_id="WP_001176621.1"
                     /translation="MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGGMLNGAGTG
                     MDANGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAAMLDAHANFLRSNPSY
                     KVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHD
                     EAAYAKNRRAVLVY"
     gene            792519..793307
                     /gene="cpoB"
                     /locus_tag="STY_RS03725"
                     /old_locus_tag="STY0796"
     CDS             792519..793307
                     /gene="cpoB"
                     /locus_tag="STY_RS03725"
                     /old_locus_tag="STY0796"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein CpoB"
                     /protein_id="WP_000097547.1"
                     /translation="MSSNFRHHLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQ
                     LERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVMERQKQIMLQLGSLN
                     NGGAAQPAAGDQSGAATAATPAPDAGTATSGAPVQSGDANTDYNAAIALVQDKSRQDD
                     AIVAFQNFIKKYPDSTYQPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADA
                     MYKVGVIMQDKGDTAKAKAVYQQVINKYPGTDGAKQAQKRLNAM"
     gene            793472..793544
                     /locus_tag="STY_RS03730"
                     /old_locus_tag="STYt012"
     tRNA            793472..793544
                     /locus_tag="STY_RS03730"
                     /old_locus_tag="STYt012"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:793505..793507,aa:Lys,seq:ttt)
     gene            793690..793765
                     /locus_tag="STY_RS03735"
                     /old_locus_tag="STYt013"
     tRNA            793690..793765
                     /locus_tag="STY_RS03735"
                     /old_locus_tag="STYt013"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:793723..793725,aa:Lys,seq:ttt)
     gene            793900..793975
                     /locus_tag="STY_RS03740"
                     /old_locus_tag="STYt014"
     tRNA            793900..793975
                     /locus_tag="STY_RS03740"
                     /old_locus_tag="STYt014"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:793933..793935,aa:Lys,seq:ttt)
     gene            794269..795312
                     /gene="nadA"
                     /locus_tag="STY_RS03745"
                     /old_locus_tag="STY0797"
     CDS             794269..795312
                     /gene="nadA"
                     /locus_tag="STY_RS03745"
                     /old_locus_tag="STY0797"
                     /EC_number="2.5.1.72"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000115355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinolinate synthase NadA"
                     /protein_id="WP_000115355.1"
                     /translation="MSVMFDSQAAIYPFPPKPTPLNDDEKQFYREKIKRLLKERNAVM
                     VAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHAASTLLVAGVRFMGETAKILSPEK
                     NVLMPTLAAECSLDLGCPIDEFSAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAV
                     ELIEHLDSLGEKIIWAPDRHLGNYVQKQTRADVLCWQGACIVHDEFKTQALTRLKKIY
                     PDAAILVHPESPRSIVEMADAVGSTSQLIKAAKTLPHRQLIVATDRGIFYKMQQAVPD
                     KELLEAPTAGEGATCRSCAHCPWMAMNGLKAIAEGLEQGGAAHEIQVDAALRESALLP
                     LNRMLDFAATLRV"
     gene            795337..796056
                     /locus_tag="STY_RS03750"
                     /old_locus_tag="STY0798"
     CDS             795337..796056
                     /locus_tag="STY_RS03750"
                     /old_locus_tag="STY0798"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinamide riboside transporter PnuC"
                     /protein_id="WP_000345378.1"
                     /translation="MDFFSTHNILIHIPIGAGGYDLSWIEAVGTIAGLLCIWLASLEN
                     ISNYFFGLVNVTLFAIIFFQIQLYASLLLQLFFFAANIYGWYAWSRQTKDNEAELKIR
                     WLPLPKAMAWLAICVIAIGLMTRYIDPVFAVLTRVAVAIMQMLGLQVTMPVLQPDAFP
                     FWDSCMMVLSIVAMILMTRKYVENWLLWVIINVISVVIFALQGVYAMSLEYLILTFIA
                     VNGSRLWINSARERGSRALSR"
     gene            complement(796053..796991)
                     /gene="zitB"
                     /locus_tag="STY_RS03755"
                     /old_locus_tag="STY0799"
     CDS             complement(796053..796991)
                     /gene="zitB"
                     /locus_tag="STY_RS03755"
                     /old_locus_tag="STY0799"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDF family zinc transporter ZitB"
                     /protein_id="WP_000951257.1"
                     /translation="MAHSHSHADSHLPKDNNARRLLFAFIVTAGFMLLEVVGGILSGS
                     LALLADAGHMLTDAAALLFALLVVQFSRRPPTVRHTFGWLRLTTLAAFVNAIALVVIT
                     LLIVWEAIERFYTPRPVAGNLMMVIAVAGLLANLFAFWILHRGSDEKNLNVRAAALHV
                     MGDLLGSVGAIVAALIIIWTGWTPADPILSILVSVLVLRSAWRLLKDSVNELLEGAPV
                     SLDINALQRHLSREIPEVRNVHHVHVWMVGEKPVMTLHAQVIPPHDHDALLERIQDFL
                     MHEYHIAHATIQMEYQMCHGPDCHLNQTPSGHVHHH"
     gene            complement(797102..797488)
                     /locus_tag="STY_RS03760"
                     /old_locus_tag="STY0800"
     CDS             complement(797102..797488)
                     /locus_tag="STY_RS03760"
                     /old_locus_tag="STY0800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000784380.1"
                     /translation="MKMTKLTTLLLTATLGLASGAALAAESNAQSSNGQANSAANAGQ
                     VAPDARQNVAPNDVNNNDINTNGNTNSTMQHPDGSTMNHDGMTKDEEHKNTMCKDGRC
                     PDINKKVETGNGVNNDVNTKTDGTTQ"
     gene            797808..798860
                     /gene="aroG"
                     /locus_tag="STY_RS03765"
                     /old_locus_tag="STY0801"
     CDS             797808..798860
                     /gene="aroG"
                     /locus_tag="STY_RS03765"
                     /old_locus_tag="STY0801"
                     /EC_number="2.5.1.54"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001109196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-7-phosphoheptulonate synthase AroG"
                     /protein_id="WP_001109233.1"
                     /translation="MNYQNDDLRIKEINELLPPVALLEKFPATENAANTVAHARKAIH
                     KILKGNDDRLLVVIGPCSIHDPAAAKEYAARLLALRDELQGELEIVMRVYFEKPRTTV
                     GWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWG
                     AIGARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHS
                     AIVNTSGNGDCHIILRGGKAPNYSAQHVAEVKEGLIKAGLTPQVMIDFSHANSCKQFQ
                     KQMEVCADVCQQIAGGEKAIIGVMVESHLVEGNQSLESGQPLTYGKSITDACIGWEDT
                     DALLRQLSAAVKARRG"
     gene            799013..800092
                     /locus_tag="STY_RS03770"
                     /old_locus_tag="STY0802"
     CDS             799013..800092
                     /locus_tag="STY_RS03770"
                     /old_locus_tag="STY0802"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_000128344.1"
                     /translation="MTCQDKSLLAPGLASTPVIPRYRQIIRKRAVLMSAIALAMMVSL
                     MVDVTCGSSGLPLSALWQALFQPEKVNAGIHVIVWDIRLPYALMALLVGMALGLAGAE
                     MQTILNNPLATPFTLGVSSAAAFGAALAIVLGIGIPGIPAAWFIPANAFIFALLSALL
                     LDGITRWTGVAASGVVLFGIALVFTFNALVAIMQFVADEDTLQGLVFWTMGSLVRASW
                     EKLGVLAVVFIAVLFCALRSAWQLTALRLGEERAMSFGVHVRRLRLLSLLRISLLSAL
                     AVAFVGPIGFIGLVAPHIARILLGEDHRFYLPGSVLIGGLVLSLASIAAKNSIPGVMV
                     PVGIVTSLVGVPFFLSIVLRHRGSL"
     gene            800092..800868
                     /locus_tag="STY_RS03775"
                     /old_locus_tag="STY0803"
     CDS             800092..800868
                     /locus_tag="STY_RS03775"
                     /old_locus_tag="STY0803"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_001253471.1"
                     /translation="MRRLMLRSFSAGYSTQPVIADLNVPLLPRGKITILLGPNGCGKS
                     TLLRSLAGLNNVDGEALLDGEDLMSLSFAERAQKVVFLPQSLPQGVHLHVLESIIVVL
                     RASGGRDNAQGRAQILAILEQLGITHLALQYLDQLSGGQRQLVGLAQSLIRRPELLLL
                     DEPLSALDLNYQFHVMDLVRRDTQAQNRVTIVVAHDINIALRHGDHVLMLKDGRLVAS
                     GAPETVITAERLAEVYRVRGRVERCSQGKLQVVLDGVIAV"
     gene            complement(800959..801711)
                     /gene="gpmA"
                     /locus_tag="STY_RS03780"
                     /old_locus_tag="STY0804"
     CDS             complement(800959..801711)
                     /gene="gpmA"
                     /locus_tag="STY_RS03780"
                     /old_locus_tag="STY0804"
                     /EC_number="5.4.2.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000301556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-diphosphoglycerate-dependent
                     phosphoglycerate mutase"
                     /protein_id="WP_000301554.1"
                     /translation="MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKL
                     LKEEGFSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAE
                     TAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDR
                     VIPYWNDTILPRMKSGERVIIAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEF
                     DENFKPIKHYYLGNADEIAAKAAAVANQGKAK"
     gene            complement(801935..802975)
                     /gene="galM"
                     /locus_tag="STY_RS03785"
                     /old_locus_tag="STY0806"
     CDS             complement(801935..802975)
                     /gene="galM"
                     /locus_tag="STY_RS03785"
                     /old_locus_tag="STY0806"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactose-1-epimerase"
                     /protein_id="WP_000931431.1"
                     /translation="MLNETPALAPDGQPYRLLTLRNSAGMVVTLMDWGATLLSARIPL
                     SDGSVREALLGCASPEHYPEQTSFLGASIGRYANRIANSRYTFAGETVQLSPSQGENQ
                     LHGGPEGFDKRRWQIVNQNDRQVLFALTSDDGDQGFPGHLCATAQYRLTDDNRISITY
                     RATVDKPCPVNLTNHVYFNLDGDRTDVRQHKLQILADEYLPVDESGIPRQGLKSVANT
                     SFDFRMPKVIASEFLADDDQRKVKSYDHAFLLQTQGDGKKPAARLWSQDGKLQMMVYT
                     TAPALQFYSGNYLAGTPSRGPEPYADWQGLALESELLPDSPNHPEWPQPDCILRPGEE
                     YASLTEYQFIPF"
     gene            complement(802969..804117)
                     /gene="galK"
                     /locus_tag="STY_RS03790"
                     /old_locus_tag="STY0807"
     CDS             complement(802969..804117)
                     /gene="galK"
                     /locus_tag="STY_RS03790"
                     /old_locus_tag="STY0807"
                     /EC_number="2.7.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001713229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactokinase"
                     /protein_id="WP_001049364.1"
                     /translation="MNLKEKTRALFAEIFGYPATHTIQAPGRVNLIGEHTDYNDGFVL
                     PCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLDAPIVTHDSQQWSNYVRGVVKH
                     LQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVFQQLYHLPLDGAQIALNGQE
                     AENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVSMPKGVAVVIINSNFKRTL
                     VGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPVVAKRVRHVLSENARTV
                     EAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVKATIGDQGGVRMTGG
                     GFGGCVVALIPEDLVPAVQQAVAQQYEAKTGIKETFYVCKPSQGAGQC"
     gene            complement(804120..805166)
                     /gene="galT"
                     /locus_tag="STY_RS03795"
                     /old_locus_tag="STY0808"
     CDS             complement(804120..805166)
                     /gene="galT"
                     /locus_tag="STY_RS03795"
                     /old_locus_tag="STY0808"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactose-1-phosphate uridylyltransferase"
                     /protein_id="WP_000187468.1"
                     /translation="MTPFNPIDHPHRRYNPLTGQWVLVSPHRAKRPWQGAQETPSQQM
                     LPAHDPDCFLCAGNTRVTGDKNPDYKGTYVFTNDFAALMADTPDAPDSHDPLMRCQSA
                     RGTSRVICFSPDHSKTLPELSLPALTEIVRTWQTQTAELGKTYPWVQVFENKGAAMGC
                     SNPHPHGQVWANSFLPNEAEREDRLQKAYFAEQRPPMLVDYVQRELADGSRTVVETEH
                     WLAVVPYWAAWPFETLLLPKTHVLRITDLSDEQRDSLALALKKLTSRYDNLFQCSFPY
                     SMGWHGAPFNGEENAHWQLHAHFYPPLLRSATVRKFMVGYEMLAETQRDLTAEQAAER
                     LRAVSDIHFRESGV"
     gene            complement(805177..806193)
                     /gene="galE"
                     /locus_tag="STY_RS03800"
                     /old_locus_tag="STY0809"
     CDS             complement(805177..806193)
                     /gene="galE"
                     /locus_tag="STY_RS03800"
                     /old_locus_tag="STY0809"
                     /EC_number="5.1.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase GalE"
                     /protein_id="WP_001265456.1"
                     /translation="MRVLVTGGSGYIGSHTCVQLLQNGHDVVILDNLCNSKRSVLPVI
                     ERLGGKHPTFVEGDIRNEALITEILHDHAIDTVIHFAGLKAVGESVAKPLEYYDNNVN
                     GTLRLVSAMRAANVKNLIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQIL
                     TDLQKAQPEWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRESLAVF
                     GNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLADKSGVHIYNLGAGVGSSVLDVVNAF
                     SKACGKPINYHFAPRRDGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQ
                     GYSD"
     gene            complement(806416..807324)
                     /locus_tag="STY_RS03805"
                     /old_locus_tag="STY0810"
     CDS             complement(806416..807324)
                     /locus_tag="STY_RS03805"
                     /old_locus_tag="STY0810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2167 domain-containing protein"
                     /protein_id="WP_000885529.1"
                     /translation="MAFRFPQIILFLLAAMLFCPSSYAEQKPTAAQEARKTAVEVAVE
                     GMSRAAVAGPTKISLGDKATLNLPEGFTWIPAKEAAVFMREIGNYVDDEYFYGLVFKK
                     EMNGFISIEYDDSGYVKDDDAKNWDADELMDNLRKGTKEANKDRIAKGIEPIEIIGWI
                     EKPTYDATNHRLIWSAAIQDIGTNEPLNEQGVNYNTYLLGREGYFSLNLVTDRGSVDH
                     EIPLAKRILSSVKFNAGQRYADFNESTDKIAEYELAALIGGIAAKKVGLLAMLGIALL
                     KFWKVTAIGVVAVGALARKLLSRKKD"
     gene            complement(807495..808970)
                     /gene="modF"
                     /locus_tag="STY_RS03810"
                     /old_locus_tag="STY0811"
     CDS             complement(807495..808970)
                     /gene="modF"
                     /locus_tag="STY_RS03810"
                     /old_locus_tag="STY0811"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter ATP-binding protein
                     ModF"
                     /protein_id="WP_000096923.1"
                     /translation="MSSLQISQGTFRLSDTKTLHLDSLTLNAGDSWAFVGANGSGKSA
                     LARALAGELPLLTGERQCQFTRITRLSFEQLQKLVSDEWQRNNTDMLSPGEDDTGRTT
                     AEIIQDDVHHPARYAMLAQQFGISALLNRRFKYLSTGETRKALLCQALMSEPELLILD
                     EPFDGLDVTARQQLAQRLTALNQAGMTLALVLNRFDEIPDFVQFAGVLADCTLAETGT
                     TAELLQRALVAQLAHSERLTDVQLPEPDEPSARHALPDGEPRIVLNDGVVSYNDRPIL
                     HHLSWRVNPGEHWQIVGPNGAGKSTLLSLITGDHPQGYSNDLTLFGRRRGSGETIWDI
                     KKHIGYVSSSLHLDYRVSTTVRNVILSGYFDSIGIYQAVSDRQRKLAQQWLDILGIDK
                     RTADAPFHSLSWGQQRLALIVRALVKHPTVLILDEPLQGLDPLNRQLVRRFVDVLIRQ
                     GETQLLFVSHHAEDAPACITHRLEFVPEGERYKYVSGRCNN"
     gene            complement(809038..809826)
                     /gene="modE"
                     /locus_tag="STY_RS03815"
                     /old_locus_tag="STY0812"
     CDS             complement(809038..809826)
                     /gene="modE"
                     /locus_tag="STY_RS03815"
                     /old_locus_tag="STY0812"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum-dependent transcriptional regulator"
                     /protein_id="WP_001147416.1"
                     /translation="MQAEILLTLKLQQKLFADPRRISLLKHIALSGSISQGAKDAGIS
                     YKSAWDAINDMNQLSEHMLVERATGGKGGGGAVLTRYGQRLIQLYDLLGQIQQKAFDV
                     LSDDDALPLDSLLAAISRFSLQTSARNQWFGTITARDRDQVQQHVDVLLADGKTRLKV
                     ALTAQSGERLGLEEGKEVLILLKAPWVGITRDAAVARAADNQLSGTISHIERGAEQCE
                     VLMALPDGQTLCATIPTADAATLKEGDDVIAWFNADRVIIATLC"
     gene            809955..810104
                     /locus_tag="STY_RS03820"
     CDS             809955..810104
                     /locus_tag="STY_RS03820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux pump-associated protein, AcrZ
                     family"
                     /protein_id="WP_000891513.1"
                     /translation="MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGIGQKDQ
                     SRQNR"
     gene            810271..811044
                     /gene="modA"
                     /locus_tag="STY_RS03825"
                     /old_locus_tag="STY0814"
     CDS             810271..811044
                     /gene="modA"
                     /locus_tag="STY_RS03825"
                     /old_locus_tag="STY0814"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_000951413.1"
                     /translation="MAHSWLRLVAGATLSFVIAGHALADEGKITVFAAASLTNAMQDI
                     AAEYKKEKNVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAADKKAVDTTTRE
                     TLLGNSLVVVAPKASEQKPFTIDNKTDWIHLLNGGRLAVGDPQHVPAGIYAKEALQKL
                     GAWQTLEPKLAPGEDVRGALALVERNEAPLGIVYGSDAVASKGVNVVATFPEDSHKKV
                     EYPIAIVEGHKNAAVSAFYDYLKGPQASAIFKRYGFTTK"
     gene            811044..811733
                     /gene="modB"
                     /locus_tag="STY_RS03830"
                     /old_locus_tag="STY0815"
     CDS             811044..811733
                     /gene="modB"
                     /locus_tag="STY_RS03830"
                     /old_locus_tag="STY0815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter permease subunit"
                     /protein_id="WP_000604026.1"
                     /translation="MILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCRFPGK
                     ALLDSVLHLPLVLPPVVVGYLLLVSMGRRGFIGQWLYDWFGLTFAFSWRGAVLAAAVM
                     SFPLMVRAIRLALEGVDIKLEQAARTLGAGRWRVFLTITLPLTLPGIIVGTVLAFARS
                     LGEFGATITFVSNIPGETRTIPSAMYTLIQTPGGESAAARLCVISIVLALISLLISEW
                     LARISRERTGR"
     gene            811736..812794
                     /gene="modC"
                     /locus_tag="STY_RS03835"
                     /old_locus_tag="STY0816"
     CDS             811736..812794
                     /gene="modC"
                     /locus_tag="STY_RS03835"
                     /old_locus_tag="STY0816"
                     /EC_number="7.3.2.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter ATP-binding protein
                     ModC"
                     /protein_id="WP_000891721.1"
                     /translation="MLELNFSQTLGTHCLTLNETLPASGITAIFGVSGAGKTSLINAI
                     SGLTRPRKGRIVLNGRVLHDAENGICLTPEKRRIGYVFQDARLFPHYKVRGNLRYGMA
                     KSMTGQFDKLVSLLGIEALLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLASLD
                     IPRKRELLPYLQRLAREINIPMLYVSHSLDEILHLADKVMVLEDGQVKAFGPLEEVWG
                     SSVMHPWLPKEQQSSILKVSVLEHHPHYAMTALALGDQHLWVNKLNQPLQSTLRIRIQ
                     ASDVSLVLQPPQQTSIRNVLRAKVANCYDDNGQVEVQLEIGGRTLWARISPWARDELN
                     IKPGLWLYAQVKSVSITA"
     gene            complement(812795..813613)
                     /locus_tag="STY_RS03840"
                     /old_locus_tag="STY0817"
     CDS             complement(812795..813613)
                     /locus_tag="STY_RS03840"
                     /old_locus_tag="STY0817"
                     /EC_number="3.1.3.74"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal phosphatase"
                     /protein_id="WP_010989132.1"
                     /translation="MTARVIALDLDGTLLTPHKTLLPSSLEALSRAKEAGFQLIIVTG
                     RHHVAIHPFYQALALETPAICCNGTYLYDYQAKTVLDADPMPVDKALQLIDLLDEHQI
                     HGLMYVDDAMLYEHPTGHVVRTSRWAQTLPPEQRPTFTQVSSLAQAARDVNAVWKFAL
                     TDEDIPRLQRFGQHVEQALGLECEWSWHDQVDIARKGNSKGKRLTQWIEAQGGSMKNV
                     IAFGDNYNDISMLEAAGTGVAMGNADEAVKARADFVIGDNTTDSIAKFIYTHLL"
     gene            813777..814772
                     /gene="pgl"
                     /locus_tag="STY_RS03845"
                     /old_locus_tag="STY0818"
     CDS             813777..814772
                     /gene="pgl"
                     /locus_tag="STY_RS03845"
                     /old_locus_tag="STY0818"
                     /EC_number="3.1.1.31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconolactonase"
                     /protein_id="WP_000815470.1"
                     /translation="MKQTVYTASPESQQIHVWSLNHEGTLTLVQVVDVPGQVQPMVVS
                     PDKRYLYVGVRPEFRVLAYRIAPDDGALTFAAESALPGSPTHISTDHHGRFVFVGSYN
                     AGNVSVTRLQDGLPVELVDVVEGLDGCHSANITPDNRTLWVPALKQDRICLFTLSDDG
                     HLVAQEPAEVNTVEGAGPRHMVFHPNRQYAYCVNELNSSVDVWQLKNPHGEIECVQTL
                     DMMPADFSDTRWAADIHITPDGRHLYACDRTASLITVFSVSEDGSVLSVEGFQPTEAQ
                     PRGFNIDNSRKYLIAAGQKSHHIAVYEITGTQGLLTEKGRYAVGQGPMWVVVNAY"
     gene            complement(814916..816199)
                     /locus_tag="STY_RS03850"
                     /old_locus_tag="STY0819"
     CDS             complement(814916..816199)
                     /locus_tag="STY_RS03850"
                     /old_locus_tag="STY0819"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative acyl-CoA thioester hydrolase"
                     /protein_id="WP_001094768.1"
                     /translation="MNTLSVSRLALALAFGVTLSACSSTPPDQIPSDQTAPGTASRPI
                     LSANEAKNFVAARYFASLTPNTAPWSPSPITLPAQPDFVVGPAGTPGVTHTSIQAAID
                     AAMVKRTNKRQYIAIMPGDYQGTVYVPAAPGSLTLYGTGEKPIDVKIGMAIDGEMSVA
                     DWRRAVNPGGKYMPGKPAWYMFDNCQSKHAATIGVMCSAAFWSQNNGLQLQNLTIENT
                     LGDSVDAGNHPAVALRTDGDKVQINKVNILGRQNTFFVTNSGVQNRLQTDRQPRTLVT
                     NSYIEGDVDMVSGRGAVVFDNTNFQVVNSRTQQEAYVFAPATLSNIYYGFLAINSRFN
                     ASGDGVAQLGRSLDVDANTNGQVVIRDSVINEGFNVAKPWADAVISKRPFAGNTGTVD
                     DKDEVQRNLNDTNYNRMWEYNNRGVGSKVVTEPKQ"
     gene            816437..817660
                     /locus_tag="STY_RS03855"
                     /old_locus_tag="STY0820"
     CDS             816437..817660
                     /locus_tag="STY_RS03855"
                     /old_locus_tag="STY0820"
                     /EC_number="3.5.2.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazolonepropionase"
                     /protein_id="WP_001249497.1"
                     /translation="MRQLLPGDTVWRNIRLATMDPQRQAPYGLVDSQALIVREGHICD
                     IVPETQLPVSGDNIHDMQGRLVTPGLIDCHTHLVFAGNRAAEWEQRLNGASYQHISAQ
                     GGGINATVSATRACAEETLYLLARERMMRLASEGVTLLEIKSGYGLELATEEKLLRVA
                     AKLAAENAIDISPTLLAAHATPAEYRDDPDGYITLVCETMIPQLWQKGLFDAVDLFCE
                     SVGFNVAQSERVLQTAKALGIPVKGHVEQLSLLGGAQLVSRYQGLSADHIEYLDEAGV
                     AAMRDGGTVGVLLPGAFYFLRETQRPPVELLRRYQVPVAVASDFNPGTSPFCSLHLAM
                     NMACVQFGLTPEEAWSGVTRHAARALGRQATHGQIRAGYRADFVVWDAEQPVEIVYEP
                     GRNPLYQRVYRGQIS"
     gene            817657..818598
                     /locus_tag="STY_RS03860"
                     /old_locus_tag="STY0821"
     CDS             817657..818598
                     /locus_tag="STY_RS03860"
                     /old_locus_tag="STY0821"
                     /EC_number="3.5.3.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formimidoylglutamase"
                     /protein_id="WP_000195673.1"
                     /translation="MTQWYPASPALWQGRDDSIEAPDARRLFQTVTRSEAFFPENWQQ
                     KIALMGFACDEGVKRNSGRPGAAGGPDALRKALANMASHQGHERLVDLGNWVAPTPDL
                     EGAQQALRDAVSRCLRAGMRTLVMGGGHETAFGHGAGVLDAFAQESVGIINLDAHLDL
                     RQTDRATSGTPFRQLAQLCDAQSRAFHYACFGVSRAANTQALWREAQWRNVTVVEDLD
                     CHDALAQMTQFIDKVDKIYLTIDLDVLPVWEMPAVSAPAALGVPLIQVLRLIEPVCRS
                     GKLQAADLVEFNPRFDEDGAAARVAARLGWQIAHWWR"
     gene            818643..819368
                     /locus_tag="STY_RS03865"
                     /old_locus_tag="STY0822"
     CDS             818643..819368
                     /locus_tag="STY_RS03865"
                     /old_locus_tag="STY0822"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine utilization repressor"
                     /protein_id="WP_000287410.1"
                     /translation="MYSSRSRSAPAPFYETVKQDICKKIAGGVWQPHDRIPSEAELVA
                     QYGFSRMTINRALRELTDEGWLVRLQGVGTFVAEPKGQSALFEVRSIAEEIAARHHQH
                     RCEVLTLERVRANAIQASALNVNESDVIFHSIMVHYENDLPVQIEDRCVNADIAVDYL
                     TQDYRQTTPHAYLSRIAPLTEGEHIVEAVRATAQECAWLTIKEHEPCLLIRRTTWSAS
                     RIVSHARLLFPGSRYRLQGRFIS"
     gene            819564..821249
                     /gene="hutU"
                     /locus_tag="STY_RS03870"
                     /old_locus_tag="STY0823"
     CDS             819564..821249
                     /gene="hutU"
                     /locus_tag="STY_RS03870"
                     /old_locus_tag="STY0823"
                     /EC_number="4.2.1.49"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017441920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urocanate hydratase"
                     /protein_id="WP_001115205.1"
                     /translation="MPESKYRQQTIRAPRGTVLTAKSWLTEAPLRMLMNNLDPDVAEN
                     PHELVVYGGIGRAARNWECYDAIVDALTRLEADETLLIQSGKPVGVFKTHDNAPRVLI
                     ANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIVQGTYETFVEAGRQHY
                     NGTLAGRWALTAGLGGMGGAQPLAATLAGACSLTIECQQSRIDFRLRTRYVDEQAATL
                     DDALARITRYTREGKAVSVALCANAADILPELVNRGVRPDLVTDQTSAHDPLHGYLPS
                     GWCWEEYQKNAQSDPRGTMQAAKRSMAAHVRAMLAFSKMGVPTFDYGNNIRQMAKEMG
                     VENAFDFPGFVPAYIRPLFCRGIGPFRWVALSGDPQDIYKTDAKVKEIVAEDKHLHHW
                     LDMARERIHFQGLPARICWVGLEWRQKLGLAFNEMVRCGEVSAPIVIGRDHLDSGSVA
                     SPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHAGMVIVCD
                     GTDEAAARIRRVLHNDPATGVMRHADAGYDLAVECAVEQGLNLPMVAATQGKG"
     gene            821251..822771
                     /gene="hutH"
                     /locus_tag="STY_RS03875"
                     /old_locus_tag="STY0824"
     CDS             821251..822771
                     /gene="hutH"
                     /locus_tag="STY_RS03875"
                     /old_locus_tag="STY0824"
                     /EC_number="4.3.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ammonia-lyase"
                     /protein_id="WP_001095232.1"
                     /translation="MNTMTLTPGQLSLSQLYDVWRHPVQLRLDASAIDGINASVACVN
                     DIVAEGRTAYGINTGFGLLAQTRIADEDLQNLQRSLVLSHAAGVGDPLDDAMVRLIMV
                     LKINSLARGFSGIRLSVIEALIALVNAGVYPLIPAKGSVGASGDLAPLAHLSLTLLGE
                     GKARWQGEWLPAQAALKKAGLEPVALAAKEGLALLNGTQASTAFALRGLFEAQELFAS
                     AVVCGALTTEAVLGSCRPFDARIHAARGQQGQIDVARLFRHLLTDTSAIAESHHHCHK
                     VQDPYSLRCQPQVMGACLTQLRQTKEVLLAEANAVSDNPLVFAEAGEVISGGNFHAEP
                     VAMAADNLALAIAEIGALSERRITLMMDKHMSQLPPFLVKNGGVNSGFMIAQVTAAAL
                     ASENKALAHPHSVDSLPTSANQEDHVSMAPAAGRRLWEMAANTRGVIAVEWLAACQGI
                     DLREGLTSSPLLEQARQTLRERVAHYTQDRFFAPDIECATTLLAQGALQRLVPDFM"
     gene            complement(822856..823332)
                     /locus_tag="STY_RS03880"
                     /old_locus_tag="STY0825"
     CDS             complement(822856..823332)
                     /locus_tag="STY_RS03880"
                     /old_locus_tag="STY0825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="kinase inhibitor"
                     /protein_id="WP_000767403.1"
                     /translation="MKLISNDLRDGDKLPHRHVFNGMGYDGDNISPHLAWDDVPMGTK
                     SFVVTCYDPDAPTGSGWWHWVVVNLPADTRVLTQGFGSGLVAVPDGVIQTRTDFGKAG
                     YGGAAPPKGETHRYIFTVHALDVERLDVDEDASGAMVGFNVHFHSLASASITAMFS"
     gene            complement(823390..824679)
                     /gene="bioA"
                     /locus_tag="STY_RS03885"
                     /old_locus_tag="STY0826"
     CDS             complement(823390..824679)
                     /gene="bioA"
                     /locus_tag="STY_RS03885"
                     /old_locus_tag="STY0826"
                     /EC_number="2.6.1.62"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine--8-amino-7-oxononanoate
                     transaminase"
                     /protein_id="WP_000205503.1"
                     /translation="MTTDDLAFDKRHIWHPYTSMTSPLPVYPVERAEGCELVLASGER
                     LIEGMSSWWAAIHGYNHPQLNAAMKAQIDAMSHVMFGGITHQPAVNLCRKLVAITPEP
                     LECVFLADSGSVSVEVAMKMALQYWQARGESRQRFLTFRHGYHGDTFGAMSVCDPDNS
                     MHSLWKGYLPENLFAPAPQSRMDGEWDESDIAPFARLMAAHRHEIAAVILEPIVQGAG
                     GMRIYHPQWLRRIRNMCDREGILLIADEIATGFGRTGKLFACEHAGIAPDILCLGKAL
                     TGGTMTLSATLTTRQVAETISNGEAGCFMHGPTFMGNPLACAVACASLTLLESGEWRQ
                     QVASIESQLRAELAPAQSSPWVADVRVLGAIGVVETTHPVNMAALQRFFVGQGVWIRP
                     FGKLIYLMPPYIIRPDQLRRLTQAVNDAVHNETFFSH"
     gene            824766..825806
                     /gene="bioB"
                     /locus_tag="STY_RS03890"
                     /old_locus_tag="STY0827"
     CDS             824766..825806
                     /gene="bioB"
                     /locus_tag="STY_RS03890"
                     /old_locus_tag="STY0827"
                     /EC_number="2.8.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase BioB"
                     /protein_id="WP_000090724.1"
                     /translation="MARHPRWTLSQVTELFEKPLLELLFEAQQIHRQHFDPQQVQVST
                     LLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAW
                     KNPHERDMPYLEKIVQGVKAMGLETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEF
                     YGNIITTRTYQERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPES
                     VPINMLVKVKGTPLADNDDVDAFDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMC
                     FMAGANSIFYGCKLLTTPNPAEDKDLQLFRKLGLNPQQTRVLAGDNEQQQRLEQTLMT
                     PDTDDYYNAAAL"
     gene            825803..826960
                     /gene="bioF"
                     /locus_tag="STY_RS03895"
                     /old_locus_tag="STY0828"
     CDS             825803..826960
                     /gene="bioF"
                     /locus_tag="STY_RS03895"
                     /old_locus_tag="STY0828"
                     /EC_number="2.3.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="WP_000118943.1"
                     /translation="MSWQQRVDDALTARRATDTLRRRYVVSQGAGRWLVANGRQYLNF
                     SSNDYLGLSQHPQIIRAWQQAATRFGVGSGGSGHISGYSVAHQALEEELAQWLGYPRA
                     LLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAANLSPAQLRRFIHNDTQHLSR
                     LLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIGVTGDEGRG
                     TCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMPPAQAQAL
                     SASLAVIRSDEGRERREKLAALVQRFRAGVNASRFTLLNAHSAIQPLIVGDNSRALRL
                     AEALRQQGCWATAIRPPTVPVGTARLRLTLTQAHEACDIDRLLEVLHGAGE"
     gene            826944..827699
                     /gene="bioC"
                     /locus_tag="STY_RS03900"
                     /old_locus_tag="STY0829"
     CDS             826944..827699
                     /gene="bioC"
                     /locus_tag="STY_RS03900"
                     /old_locus_tag="STY0829"
                     /EC_number="2.1.1.197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl-ACP O-methyltransferase BioC"
                     /protein_id="WP_000079913.1"
                     /translation="MAQVNKQAIAAAFGRAASQYEQHASLQQHSADALLTLLTGRQFA
                     SVLDAGCGPGRMSRYWRERGSEVTALDLSLPMLQQARDRQAAHHYLLADIEAIPHDAE
                     VFDLAWSNLAVQWCGDLRDALSELYRVVRPGGVVAFTTLCQGSLPELRQAWQAVDNRA
                     HANSFLPEEAIDHALRGWRASRHTQAMTLWFEDALSAMRSLKGIGATHLHEGRETDVL
                     TRARLRQIQLAWPQRQGKYLLTYHLFMGVIERD"
     gene            827692..828378
                     /gene="bioD"
                     /locus_tag="STY_RS03905"
                     /old_locus_tag="STY0830"
     CDS             827692..828378
                     /gene="bioD"
                     /locus_tag="STY_RS03905"
                     /old_locus_tag="STY0830"
                     /EC_number="6.3.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent dethiobiotin synthetase BioD"
                     /protein_id="WP_000167219.1"
                     /translation="MTKRYFVTGTDTEVGKTVASCALLQAATQLGYQTVGYKPVASGS
                     EMTTDGLRNSDALALQRNSSLPQPYSAINPYTFAEPTSPHIASADEGRAIDAAVLSRG
                     LRTLEAQADWVLTEGAGGWFTPLSATLTFADWVQTEQLPVILVVGVKLGCINHAMLTA
                     LAVEQAGLPLVGWIANDMQPPGARHGEYLATLRRVIPAPLLGEIPWLGVSPSQAATGQ
                     YLDLSPLERA"
     gene            829029..831050
                     /gene="uvrB"
                     /locus_tag="STY_RS03910"
                     /old_locus_tag="STY0831"
     CDS             829029..831050
                     /gene="uvrB"
                     /locus_tag="STY_RS03910"
                     /old_locus_tag="STY0831"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005123745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit B"
                     /protein_id="WP_000042501.1"
                     /translation="MSKPFKLNSAFKPSGDQPDAIRRLEEGLEDGLAHQTLLGVTGSG
                     KTFTIANVIADLQRPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYYDYYQPEAYV
                     PSSDTFIEKDASVNEHIEQMRLSATKALLERRDVVVVASVSAIYGLGDPDLYLKMMLH
                     LTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRVRGEVIDIFPAESDDIALRVELFD
                     EEVERLSLFDPLTGQVESTVPRYTIYPKTHYVTPRERILQAMEEIKDELADRRKVLLA
                     NNKLLEEQRLSQRTQFDLEMMNELGYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGL
                     LVVDESHVTIPQIGGMYRGDRARKETLVEYGFRLPSALDNRPLKFEEFEALAPQTIYV
                     SATPGNYELEKSGDEVVDQVVRPTGLLDPIIEVRPVATQVDDLLSEIRQRAAINERVL
                     VTTLTKRMAEDLTEYLEEHGERVRYLHSDIDTVERMEIIRDLRLGEFDVLVGINLLRE
                     GLDMPEVSLVAILDADKEGFLRSERSLIQTIGRAARNVNGKAILYGDKITPSMAKAIG
                     ETERRREKQQKYNEEHGITPQGLNKKVVDILALGQNIAKTKAKGKGKGRSTAKAGIVE
                     LDMTPKALQQKIHELEEQMMQHAQNLEFEEAAQIRDQLHQLRELFIAAS"
     gene            831359..831532
                     /locus_tag="STY_RS03915"
     CDS             831359..831532
                     /locus_tag="STY_RS03915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_447236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001539544.1"
                     /translation="MATDYIILLKKEVMEARAFISQALQILNDLSEIMTTMASCLKLR
                     ISLSVTLGYVQIR"
     gene            831540..833804
                     /gene="slrP"
                     /locus_tag="STY_RS03920"
                     /old_locus_tag="STY0833"
                     /pseudo
     CDS             831540..833804
                     /gene="slrP"
                     /locus_tag="STY_RS03920"
                     /old_locus_tag="STY0833"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459778.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="SPI-1 type III secretion system effector E3
                     ubiquitin transferase SlrP"
     gene            complement(833899..834807)
                     /gene="yvcK"
                     /locus_tag="STY_RS03925"
                     /old_locus_tag="STY0835"
     CDS             complement(833899..834807)
                     /gene="yvcK"
                     /locus_tag="STY_RS03925"
                     /old_locus_tag="STY0835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uridine diphosphate-N-acetylglucosamine-binding
                     protein YvcK"
                     /protein_id="WP_001246034.1"
                     /translation="MRNRTLADLDRVVALGGGHGLGRVLSSLSSLGSRLTGIVTTTDN
                     GGSTGRIRRSEGGIAWGDMRNCLNQLITEPSVASAMFEYRFGGNGELSGHNLGNLMLK
                     ALDHLSVRPLEAINLIRNLLKVDAQLIPMSELPVDLMAIDDQGHEIYGEVNIDQLATP
                     PQEIMLTPNVPATREAVQAINDADLILIGPGSFYTSLMPCLLLDELAQALRRTPAPMV
                     YIGNLGRELSLPAASLTLVDKLAMMEQYIGKKVIDTVVVGPRVDVSAVNDRLVIQEVL
                     EASDIPYRHDRQLLHNALEKALQALG"
     regulatory      835072..835216
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01055"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="molybdenum cofactor riboswitch; Derived by
                     automated computational analysis using gene prediction
                     method: cmsearch."
                     /bound_moiety="molybdenum cofactor"
                     /db_xref="RFAM:RF01055"
     gene            835204..836193
                     /gene="moaA"
                     /locus_tag="STY_RS03930"
                     /old_locus_tag="STY0836"
     CDS             835204..836193
                     /gene="moaA"
                     /locus_tag="STY_RS03930"
                     /old_locus_tag="STY0836"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP 3',8-cyclase MoaA"
                     /protein_id="WP_000168180.1"
                     /translation="MASQLTDAFARKFYYLRLSITDVCNFRCTYCLPDGYKPGGVTNN
                     GFLTVDEIRRVTRAFASLGTEKVRLTGGEPSLRRDFTDIIAAVGENDAIRQIAVTTNG
                     YRLARDAANWREAGLTGVNVSVDSLDARQFHAITGQDKFRQVMAGIDAAFDAGFEKVK
                     VNTVLMRDVNHHQLDTFLAWIQPRPIQLRFIELMETGEGSDLFRKHHISGQVLRDELI
                     KRGWIHQLRQRSDGPAQVFCHPDYAGEIGLIMPYEKDFCATCNRLRVSSVGKLHLCLF
                     GDGGVSLRDLLQDDAQQYALEERISDALREKKQTHFLHQSNTGITQNLSYIGG"
     gene            836215..836727
                     /gene="moaB"
                     /locus_tag="STY_RS03935"
                     /old_locus_tag="STY0837"
     CDS             836215..836727
                     /gene="moaB"
                     /locus_tag="STY_RS03935"
                     /old_locus_tag="STY0837"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005123739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein B"
                     /protein_id="WP_000084604.1"
                     /translation="MSQVSAEFIPTRIAILTVSSRRGEEDDTSGHYLRDSAQEAGHEV
                     VAKAIVKENRYAIRAQVSAWIASDEVQVVLITGGTGLTEGDQAPEALLPLFDREVEGF
                     GEVFRMLSFEEIGTATLQSRAVAGVANNTLIFAMPGSTKACRTAWENIIAPQLDARTR
                     PCNFHPHLKK"
     gene            836730..837215
                     /gene="moaC"
                     /locus_tag="STY_RS03940"
                     /old_locus_tag="STY0838"
     CDS             836730..837215
                     /gene="moaC"
                     /locus_tag="STY_RS03940"
                     /old_locus_tag="STY0838"
                     /EC_number="4.6.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic pyranopterin monophosphate synthase MoaC"
                     /protein_id="WP_000080893.1"
                     /translation="MSQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMI
                     VDGKHHKGDVFATARIAGIQAAKRTWELIPLCHPLLLSKVEIQLQAEPEHNRVRIESL
                     CRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDIVIGPVRLLAKSGGKSGDFKVDAH
                     D"
     gene            837208..837453
                     /gene="moaD"
                     /locus_tag="STY_RS03945"
                     /old_locus_tag="STY0839"
     CDS             837208..837453
                     /gene="moaD"
                     /locus_tag="STY_RS03945"
                     /old_locus_tag="STY0839"
                     /EC_number="2.8.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_308889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin synthase sulfur carrier subunit"
                     /protein_id="WP_000598583.1"
                     /translation="MIKVLFFAHVRELTGTDALDLPADFSTVESLRQHLATKSDRWAL
                     ALEDGKLLAAVNQTLVSFDHPLTAGDEVAFFPPVTGG"
     gene            837455..837907
                     /gene="moaE"
                     /locus_tag="STY_RS03950"
                     /old_locus_tag="STY0840"
     CDS             837455..837907
                     /gene="moaE"
                     /locus_tag="STY_RS03950"
                     /old_locus_tag="STY0840"
                     /EC_number="2.8.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin synthase catalytic subunit MoaE"
                     /protein_id="WP_000545202.1"
                     /translation="MHETRIVVGPAPFSVGEEYSWLAARDEDGAVVTFTGKVRNHNLG
                     DSVKALTLEHYPGMTEKALAEIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSA
                     HRSSAFDAGQFIMDYLKTRAPFWKREATPEGDRWVEARDSDQQLAKRW"
     gene            837955..838660
                     /locus_tag="STY_RS03955"
                     /old_locus_tag="STY0841"
                     /pseudo
     CDS             837955..838660
                     /locus_tag="STY_RS03955"
                     /old_locus_tag="STY0841"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000373608.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="Bax inhibitor-1/YccA family protein"
     gene            838807..839514
                     /locus_tag="STY_RS03960"
                     /old_locus_tag="STY0843"
     CDS             838807..839514
                     /locus_tag="STY_RS03960"
                     /old_locus_tag="STY0843"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Bax inhibitor-1 family protein"
                     /protein_id="WP_000529046.1"
                     /translation="MGPLAAIRIRQIAFIPATMLSLTYWYTALGLWCTAGIIWLTLYS
                     HFLITHVQPVVVLWISALLLGLGYGAVTCLSRFGTVVATLIYIAIITLTGVSLAYLFS
                     GGATIFVIVGIMFSLNALFIFYLNISSGLFRPLIFMAVSGIIAAIVVNSLVASSTLVW
                     IVSVLTVLVWTLITALEKSTLHGYARMLYHSEFSSLPRCALFGALTLYLGIINAVVTL
                     CRYIILMILEILLSFRP"
     gene            839704..839946
                     /locus_tag="STY_RS03965"
                     /old_locus_tag="STY0845"
     CDS             839704..839946
                     /locus_tag="STY_RS03965"
                     /old_locus_tag="STY0845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000017217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000017220.1"
                     /translation="MSGVIIYRYVLLLAIISVTLATFCTLSSVFMGEFNEVLLLLFSW
                     SLLLFSRLQMNTSFFSAYVYFYRIKRVVLESENASA"
     gene            complement(839949..840911)
                     /locus_tag="STY_RS03970"
                     /old_locus_tag="STY0846"
     CDS             complement(839949..840911)
                     /locus_tag="STY_RS03970"
                     /old_locus_tag="STY0846"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UPF0104 family protein"
                     /protein_id="WP_001129824.1"
                     /translation="MAKSHPRWRLAKKVLTWLFFIAVVVLLVVYAKKVDWGDVWTVIR
                     DYNRTALLSAVGLVIVSYLLYGCYDLLGRLYCGHKLAKRQVMLVSFVCYAFNLTLSTW
                     VGGIGMRYRLYSRLGLPGSTITRIFSLSITTNWLGYILLGGIIFTFGVVQLPDHWYID
                     EGTLRILGIVLLLIIAVYLWFCAFAKRRHMTIKGQKLVLPSWKFALAQMAISSANWMA
                     MGAIIWLLMGQDVNYFFVLGVLLVSSIAGVIVHIPAGIGVLEAVFLALLAGEHTSQGT
                     IIAALLAYRVLYYFIPLLLALVCYLILESRAKKLRAKNERAMAK"
     gene            complement(840911..842152)
                     /gene="clsB"
                     /locus_tag="STY_RS03975"
                     /old_locus_tag="STY0847"
     CDS             complement(840911..842152)
                     /gene="clsB"
                     /locus_tag="STY_RS03975"
                     /old_locus_tag="STY0847"
                     /EC_number="2.7.8.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cardiolipin synthase ClsB"
                     /protein_id="WP_000649638.1"
                     /translation="MKCGWREGNQIQLLENGDQFYPAVFEAIAQAQQKIILETFILFE
                     DEVGKKLHAALLKAAQRGVKAEVLLDGYGSPDLSDAFVGELTSAGVIFRYYDPRPRLL
                     GLRTNIFRRMHRKIVVIDDRIAFVGGINYSAEHMSDYGPQAKQDYAVRVEGPVVADIL
                     QFEVENLPGQSPARRWWKRHHQAEENRHPGEAQALFVWRDNEEHRDDIERHYLKMLTQ
                     AKREVIIANAYFFPGYRLLHAMRKAARRGVSVKLIVQGEPDMPIVKVGARLLYNYLVK
                     GGVQVYEYRRRPLHGKVALMDDHWATVGSSNLDPLSLSLNLEANLIIHDRTFNQTLRD
                     NLQGIIVNDCKQVDESMLPKRTWWNLTKSVLAFHFLRHFPALVGWLPAHTPHLAQVPP
                     PAQPEMETQDRVDPENSGVKP"
     gene            complement(842149..842907)
                     /locus_tag="STY_RS03980"
                     /old_locus_tag="STY0848"
     CDS             complement(842149..842907)
                     /locus_tag="STY_RS03980"
                     /old_locus_tag="STY0848"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase family
                     protein"
                     /protein_id="WP_000192041.1"
                     /translation="MTQHTRNFSFKVLTINTHKGFTAFNKRFILPELRDAVRTVGADI
                     VCLQEVMGAHEVHPLHIENWPDTTHYEFLADTMWSDFAYGRNAVYPEGHHGNAVLSRY
                     PIEHYENRGVSVGGSEKRGVLYCRITPPMLNRPIHVMCVHLGLRESHRQAQLTMLAGW
                     VNALPESEPVLVAGDFNDWRQKAGPPLNAAGLEEIFTRAHGRPARTFPVSMPLLRLDR
                     IYVKNANASSPGALPLRNWRHLSDHAPLSAEIHL"
     gene            843040..843450
                     /locus_tag="STY_RS03985"
                     /old_locus_tag="STY0849"
     CDS             843040..843450
                     /locus_tag="STY_RS03985"
                     /old_locus_tag="STY0849"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000871970.1"
                     /translation="MKWQQRVRVATGLGCWQIMLHLLVVAMLVIGWMSGTLVRVGLGL
                     CVLYGVTVLLMLALQRHHEQRWRDVADVLEELTTTWYFGTALIVLWLLSRVLQNNVLL
                     ALAGLAILAGPAVVSLLAKDKKLHHFASKHRIRR"
     gene            complement(843412..844518)
                     /locus_tag="STY_RS03990"
                     /old_locus_tag="STY0850"
     CDS             complement(843412..844518)
                     /locus_tag="STY_RS03990"
                     /old_locus_tag="STY0850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_000469048.1"
                     /translation="MFHRLWTLIRKELQSLLREPQTRAILILPVLIQVILFPFAATLE
                     VTNATIAIYNEDNGKHSVELTQRFARAKAFTHVLLLNSPQEIQPTIDTQKALLLVRFP
                     ADFSRNLDTFQPAPMQLILDGRNSNSAQIAANYLQQIVKEYQQTLMDGKPKPNNSELV
                     VRNWYNPNLDYKWFVVPSLIAMITTIGVMIVTSLSVAREREQGTLDQLLVSPLTTWQI
                     FVGKAVPALIVATFQATIVLAIGIWAYQIPFAGSLALFYFTMVIYGLSLVGFGLLISA
                     LCATQQQAFIGVFVFMMPAILLSGYVSPVENMPVWLQNLTWINPIRHFTDITKQIYLK
                     DASLGIVWGSLWPLLVIAATTGSAAYAMFRRKVM"
     gene            complement(844634..845764)
                     /locus_tag="STY_RS03995"
                     /old_locus_tag="STY0851"
     CDS             complement(844634..845764)
                     /locus_tag="STY_RS03995"
                     /old_locus_tag="STY0851"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_000045765.1"
                     /translation="MSKSLSWRRVRALCVKETRQIVRDPSSWLIAVVIPLLLLFIFGY
                     GINLDSSKLRVGILLEQQSQEALDFTHAMTGSPYIDATISDNRHELIEKMQAGRIRGL
                     VVIPVDFAQQMARDGDSAPIQVITDGSEPNTANFVQGYVEGIWQIWQQQRAEDRGDTF
                     EPLIDVQTRYWFNPAAISQHFIIPGAVTIIMTVIGAILTSLVVAREWERGTMEALLST
                     EVTRVELLLCKLIPYYFLGMLAMLLCMLVSVFILGVPYRGSLVILFIITSLFLLSTLG
                     MGLLISTITRNQFNAAQVALNAAFLPSIMLSGFIFQIDSMPAVIRAVTYIIPARYFVS
                     TLQSLFLAGNIPVVLGVNVLFLIASAVMFIGLTWLKTKRRLD"
     gene            complement(845757..847493)
                     /locus_tag="STY_RS04000"
                     /old_locus_tag="STY0852"
     CDS             complement(845757..847493)
                     /locus_tag="STY_RS04000"
                     /old_locus_tag="STY0852"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_001287626.1"
                     /translation="MSEAVITLNGLTKRFAGMDKPAVAPLDCTIHSGYVTGLVGPDGA
                     GKTTLMRMLAGQLKADGGSASVLGFDPIQNDSELHAVLGYMPQKFGLYEDLTVMENLN
                     LYADLRSVTGEIREKTFARLLEFTALGPFTGRLAGKLSGGMKQKLGLACTLVGEPKVL
                     LLDEPGVGVDPISRRELWQMVHELAGDGMLILWSTSYLDEAEQCRDVLLMNEGELLYQ
                     GEPKALTQTMAGRSFLMSSPQENNRKLLQRALRLPQVSDGMIQGRSVRLILKKEATAA
                     DIRQAEGMPEITLNETAPRFEDAFIDLLGGAGTSESPLGSILHTVEGTAGETVIEAQE
                     LTKKFGDFAATDHVNFVVQRGEIFGLLGPNGAGKSTTFKMMCGLLVPTSGKALVLDMD
                     LKVSSGKARQHLGYMAQKFSLYGNLTVEQNLRFFSGVYGLRGRAQNEKIQRMSEAFGL
                     KSIASHPTDALPLGFKQRLALACSLMHEPDILFLDEPTSGVDPLTRREFWLHINSMVE
                     KGVTVMVTTHFMDEAEYCDRIGLVYRGKLIASGTPDDLKAQAADEQQADPTMEQAFIT
                     LINDWDKEHTHE"
     gene            complement(847486..848481)
                     /gene="hlyD"
                     /locus_tag="STY_RS04005"
                     /old_locus_tag="STY0853"
     CDS             complement(847486..848481)
                     /gene="hlyD"
                     /locus_tag="STY_RS04005"
                     /old_locus_tag="STY0853"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD"
                     /protein_id="WP_000743445.1"
                     /translation="MKKPVVIGLVIAAIVAVIAGGTWWYQSRQDDGLTLYGNVDIRTV
                     NISFRVGGRLASLNVDEGDTIKAGQVLGELDHAPYENALMQAKAGVSVAQAQYDLMLA
                     GYRDEEIAQAAAAVRQAQAAYDYAQNFYNRQQGLWKSRTISANDLENARSSRDQAQAT
                     LKSAQDKLSQYRTGNREQDIAQAKASLEQAKAQLAQAQLDLQDTTLIAPANGTLLTRA
                     VEPGSMLNAGSTVLTLSLTRPVWVRAYVDERNLSQTQPGRDILLYTDGRPDKPYHGKI
                     GFVSPTAEFTPKTVETPDLRTDLVYRLRIIVTDADDALRQGMPVTVKFNDEARHE"
     gene            complement(848481..849155)
                     /gene="cecR"
                     /locus_tag="STY_RS04010"
                     /old_locus_tag="STY0854"
     CDS             complement(848481..849155)
                     /gene="cecR"
                     /locus_tag="STY_RS04010"
                     /old_locus_tag="STY0854"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator CecR"
                     /protein_id="WP_001025256.1"
                     /translation="MNIPTTTTKGEQAKSQLIAAALAQFGEYGLHATTRDIAALAGQN
                     IAAITYYFGSKEDLYLACAQWIADFLGEKFRPHAEKAERLFSQPAPDRDAIRELILLA
                     CKNMIMLLTQEDTVNLSKFISREQLSPTSAYQLVHEQVIDPLHTYLTRLVAAYTGCDA
                     NDTRMILHTHALLGEVLAFRLGKETILLRTGWPQFDEEKAELIYQTVTCHIDLILHGL
                     TQRSLD"
     gene            849385..850752
                     /gene="rhlE"
                     /locus_tag="STY_RS04015"
                     /old_locus_tag="STY0855"
     CDS             849385..850752
                     /gene="rhlE"
                     /locus_tag="STY_RS04015"
                     /old_locus_tag="STY0855"
                     /EC_number="3.6.4.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase RhlE"
                     /protein_id="WP_000007058.1"
                     /translation="MSFDSLGLNPDILRAIAEQGYREPTPIQQQAIPAVLEGRDLMAS
                     AQTGTGKTAGFTLPLLQHLITHQPHAKGRRPVRALILTPTRELAAQIGENVRDYSKYL
                     NIRSLVVFGGVSINPQMMKLRGGVDVLVATPGRLLDLEHQNAVKLDQIEILVLDEADR
                     MLDMGFIHDIRRVLAKLPAKRQNLLFSATFSDDIKALAEKLLRNPLEIEVARRNTASE
                     QVTQHVHFVDKKRKRELLSQMIGQGNWQQVLVFTRTKHGANHLAEQLNKDGIRSAAIH
                     GNKSQGARTRALADFKSGDIRVLVATDIAARGLDIEELPHVVNYELPNVPEDYVHRIG
                     RTGRAAATGEALSLVCVDEHKLLRDIEKLLKKEIPRITTPGYEPDPSIKAEPIQNGRQ
                     QRGGGGGGRGRGQNQGGAGRSQQPRRQDSGAAKAKPKPRTGEGKPAGDKARPPRRPRR
                     ITPAQ"
     gene            850960..853104
                     /gene="dinG"
                     /locus_tag="STY_RS04020"
                     /old_locus_tag="STY0856"
                     /pseudo
     CDS             850960..853104
                     /gene="dinG"
                     /locus_tag="STY_RS04020"
                     /old_locus_tag="STY0856"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459799.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase DinG"
     gene            853134..854108
                     /gene="ybiB"
                     /locus_tag="STY_RS04025"
                     /old_locus_tag="STY0858"
                     /pseudo
     CDS             853134..854108
                     /gene="ybiB"
                     /locus_tag="STY_RS04025"
                     /old_locus_tag="STY0858"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459800.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein YbiB"
     gene            complement(854264..854524)
                     /locus_tag="STY_RS04030"
                     /old_locus_tag="STY0860"
     CDS             complement(854264..854524)
                     /locus_tag="STY_RS04030"
                     /old_locus_tag="STY0860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1471 domain-containing protein"
                     /protein_id="WP_000849089.1"
                     /translation="MKTIKYAVAAIALSTLSFGAFAAEPVSASQTQNLHKIGVVSADG
                     ATTLDGLEAKLAEKAAAAGASAYNITSAVGNDKMSGTAVIYK"
     gene            complement(854809..855075)
                     /locus_tag="STY_RS04035"
                     /old_locus_tag="STY0862"
     CDS             complement(854809..855075)
                     /locus_tag="STY_RS04035"
                     /old_locus_tag="STY0862"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DksA/TraR family C4-type zinc finger protein"
                     /protein_id="WP_000146332.1"
                     /translation="MASGWANDDAVNEQINNTIEDAVARARGELPHGESRDECESCGD
                     PIPEARRKAVPGVRLCISCQQEKDLHNATFSGYNRRGSKDSQLR"
     gene            855280..856201
                     /gene="rlmF"
                     /locus_tag="STY_RS04040"
                     /old_locus_tag="STY0863"
                     /pseudo
     CDS             855280..856201
                     /gene="rlmF"
                     /locus_tag="STY_RS04040"
                     /old_locus_tag="STY0863"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459803.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA (adenine(1618)-N(6))-methyltransferase
                     RlmF"
     gene            complement(856198..858420)
                     /gene="ybiO"
                     /locus_tag="STY_RS04045"
                     /old_locus_tag="STY0865"
     CDS             complement(856198..858420)
                     /gene="ybiO"
                     /locus_tag="STY_RS04045"
                     /old_locus_tag="STY0865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive channel protein"
                     /protein_id="WP_001267712.1"
                     /translation="MRWTLFILFCLLGAPAHAVAIPGVTTGTSTSQQAAPEPSPEQKK
                     AAYAALADVLENEASRNELIAQLREASTTPPTEPAPALAPPAAKDEKTVLENVTTVTR
                     QYGDAFATRFAQLYRNITDAPYKPFNSQTFTNALTHFLFLAVAVFGFYSVIRLCALPL
                     YRKMGLWARKKNRERSNWLQLPAMIAGAFIIDLLLLALTLFIGQMLSDNFHAGSRTIA
                     FQQSLFLNAFALIEFFKAILRLIFCPNVPELRPFAIQDATARYWNRRMSSLSSLIGYG
                     LIVAVPIISNQVNVQVGAMANVAIMLCITIWALYLIFKNKAEITQHLLSLAERSLAFF
                     SLFIRAFALVWHWLASAYFIVLFFFSLFDPGNSLKFMMGATVRSLAIIGIAAFISGMF
                     TRWIAKTITLSPHTQRNYPELQKRLNGWLSSALKVARFLTVCVAVMLLLNAWGLFDFW
                     HWLHYGAGEKMVDILIRIALILFFSAVGWTILASLIENRLASDIHSRPLPSARTRTLL
                     TLFRNALAVIISTITIMIVLSEIGVNIAPLLAGAGALGLAISFGSQTLVKDIITGVFI
                     QFENGMNTGDLVTIGPLMGTVERMSIRSVGVRQDTGAYHIIPWSSITTFANFVRGIGS
                     VVANYDVDRHEDADKANQALKDAVTALMETEDIRGLIIGEPTFAGIVGLTNTAFTLRV
                     SFTTLPLKQWTVRFALDSQVKKHFDLANVRAPVQTYQVLPAPAGGPPPDSLPPREPTI
                     "
     gene            complement(858539..859261)
                     /gene="glnQ"
                     /locus_tag="STY_RS04050"
                     /old_locus_tag="STY0866"
     CDS             complement(858539..859261)
                     /gene="glnQ"
                     /locus_tag="STY_RS04050"
                     /old_locus_tag="STY0866"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000569103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine ABC transporter ATP-binding protein
                     GlnQ"
                     /protein_id="WP_000569093.1"
                     /translation="MIEFKNVSKHFGPTQVLHNIDLNIRQGEVVVIIGPSGSGKSTLL
                     RCINKLEEITSGDLIVDGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGP
                     LRVRGVKKEEAEKQAKALLAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLF
                     DEPTSALDPELRHEVLKVMQDLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDG
                     SPQALIENPPSPRLQEFLQHVS"
     gene            complement(859258..859917)
                     /gene="glnP"
                     /locus_tag="STY_RS04055"
                     /old_locus_tag="STY0867"
     CDS             complement(859258..859917)
                     /gene="glnP"
                     /locus_tag="STY_RS04055"
                     /old_locus_tag="STY0867"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015367581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine ABC transporter permease GlnP"
                     /protein_id="WP_001159076.1"
                     /translation="MQFDWSAIWPAIPLLLEGAKMTLWISVLGLAGGLVIGLAAGFAR
                     TFGGWFANHIALVFIEIIRGTPIVVQVMFIYFALPMAFNDLRIDPFSAAVVTIMINSG
                     AYIAEITRGAVLSIHKGFREAGLALGLSRRETIRHVILPLALRRMLPPLGNQWIISIK
                     DTSLFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVFYLIITLVLSFILRRLERRMKI
                     L"
     gene            complement(860063..860809)
                     /gene="glnH"
                     /locus_tag="STY_RS04060"
                     /old_locus_tag="STY0868"
     CDS             complement(860063..860809)
                     /gene="glnH"
                     /locus_tag="STY_RS04060"
                     /old_locus_tag="STY0868"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005123681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine ABC transporter substrate-binding
                     protein GlnH"
                     /protein_id="WP_000838671.1"
                     /translation="MKSLLKVSLAALTLAFAVSSHAADKKLVVATDTAFVPFEFKQGD
                     KYVGFDVDLWDAIAKELKLDYTLKPMDFSGIIPALQTKNIDLALAGITITDERKKAID
                     FSDGYYKSGLLVMVKANNNDIKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPN
                     IDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGESLEAQQYGVAFPKGSDEL
                     REKVNGALKTLRENGTYNEIYKKWFGTEPK"
     gene            complement(861286..861789)
                     /gene="dps"
                     /locus_tag="STY_RS04065"
                     /old_locus_tag="STY0870"
                     /gene_synonym="pexB"
     CDS             complement(861286..861789)
                     /gene="dps"
                     /locus_tag="STY_RS04065"
                     /old_locus_tag="STY0870"
                     /gene_synonym="pexB"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA starvation/stationary phase protection
                     protein Dps"
                     /protein_id="WP_000100805.1"
                     /translation="MSTAKLVKTKASNLLYTRNDVSESDKKATVELLNRQVIQFIDLS
                     LITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAERAVQLGGVALGTTQVINSKT
                     PLKSYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDEDTADIFTAASRDLDKFLW
                     FIESNIE"
     gene            complement(862092..862979)
                     /gene="rhtA"
                     /locus_tag="STY_RS04070"
                     /old_locus_tag="STY0871"
     CDS             complement(862092..862979)
                     /gene="rhtA"
                     /locus_tag="STY_RS04070"
                     /old_locus_tag="STY0871"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine/homoserine exporter RhtA"
                     /protein_id="WP_001119558.1"
                     /translation="MPGSTRKLPVWLPILVLLIAMSSIQSGASLAKSLFPLVGAPGVT
                     ALRLALGTLILIAFFKPWRLRFAKEQRLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVA
                     LEFTGPLAVALFSSRRPVDFIWVVLAVLGLWFLLPLGQDMSHVDLTGAALALGAGACW
                     AVYILTGQRAGAEHGPATVAVGSLITAIIFVPIGAVQAGDALWHWSILPLGLAVAVLS
                     TALPYSLEMIALTRLPTRTFGTLMSMEPVLAAISGMIFLGETLTGIQILALCAIIAAS
                     MGSTLTIRREPQIKQVDVK"
     gene            863334..863849
                     /gene="ompX"
                     /locus_tag="STY_RS04075"
                     /old_locus_tag="STY0872"
     CDS             863334..863849
                     /gene="ompX"
                     /locus_tag="STY_RS04075"
                     /old_locus_tag="STY0872"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_459810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein OmpX"
                     /protein_id="WP_000716763.1"
                     /translation="MKKIACLSALAAVLAFSAGTAVAATSTVTGGYAQSDAQGVANKM
                     SGFNLKYRYEQDDNPLGVIGSFTYTEKDRTNGAGDYNKGQYYGITAGPAYRLNDWASI
                     YGVVGVGYGKFQTTDYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDV
                     GTWIAGVGYRF"
     repeat_region   863890..864608
                     /note="IS200"
     gene            863902..864084
                     /locus_tag="STY_RS04080"
     CDS             863902..864084
                     /locus_tag="STY_RS04080"
                     /inf