GenomeNet

Database: RefSeq
Entry: NC_003277
LinkDB: NC_003277
Original site: NC_003277 
LOCUS       NC_003277              93933 bp    DNA     circular CON 12-DEC-2016
DEFINITION  Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
            plasmid pSLT, complete sequence.
ACCESSION   NC_003277
VERSION     NC_003277.2
DBLINK      BioProject: PRJNA57799
            BioSample: SAMN02604315
            Assembly: GCF_000006945.2
KEYWORDS    RefSeq.
SOURCE      Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
  ORGANISM  Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Salmonella.
REFERENCE   1  (bases 1 to 93933)
  AUTHORS   McClelland,M., Sanderson,K.E., Spieth,J., Clifton,S.W.,
            Latreille,P., Courtney,L., Porwollik,S., Ali,J., Dante,M., Du,F.,
            Hou,S., Layman,D., Leonard,S., Nguyen,C., Scott,K., Holmes,A.,
            Grewal,N., Mulvaney,E., Ryan,E., Sun,H., Florea,L., Miller,W.,
            Stoneking,T., Nhan,M., Waterston,R. and Wilson,R.K.
  TITLE     Complete genome sequence of Salmonella enterica serovar Typhimurium
            LT2
  JOURNAL   Nature 413 (6858), 852-856 (2001)
   PUBMED   11677609
REFERENCE   2  (bases 1 to 93933)
  CONSRTM   Washington University Genome Sequencing Center.
  TITLE     The Salmonella typhimurium Genome Sequencing Project
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 93933)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-DEC-2016) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 93933)
  AUTHORS   McClelland,M., Jain,A., Saraogi,P., Mendelson,R., Westerman,R.,
            SanMiguel,P. and Csonka,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JAN-2016) Department of Microbiology and Molecular
            Genetics, University of California, Irvine, CA 92697, USA
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 93933)
  AUTHORS   McClelland,M., Jain,A., Saraogi,P., Mendelson,R., Westerman,R.,
            SanMiguel,P. and Csonka,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2001) Genome Sequencing Center, Department of
            Genetics, Washington University School of Medicine, 4444 Forest
            Park Boulevard, St. Louis, MO 63108, USA
  REMARK    This sequence was finished as follows unless otherwise noted: all
            regions were double stranded, sequenced with an alternate chemistry
            or covered by high quality data (i.e., phred quality >= 30); an
            attempt was made to resolve all sequencing problems, such as
            compressions and repeats; all regions were covered by sequence from
            more than one m13 subclone.
            NOTES: Coding sequences below are predicted from manually evaluated
            computer analysis, using similarity information and the programs;
            GLIMMER (Salzberg, S., Delcher, A., Kasif, A. and White, O. (1998)
            NAR 26,544-548)  GeneMark (Lukashim, A.V. and Borodovsky, M.
            (1998), NAR 26, 1107-1115.
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to AE006471.
            On Dec 12, 2016 this sequence version replaced NC_003277.1.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..93933
                     /organism="Salmonella enterica subsp. enterica serovar
                     Typhimurium str. LT2"
                     /mol_type="genomic DNA"
                     /strain="LT2"
                     /serovar="Typhimurium"
                     /sub_species="enterica"
                     /culture_collection="SGSC:1412"
                     /db_xref="taxon:99287"
                     /plasmid="pSLT"
     gene            94..378
                     /locus_tag="PSLT001"
                     /db_xref="GeneID:1256238"
     CDS             94..378
                     /locus_tag="PSLT001"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490493.1"
                     /db_xref="GeneID:1256238"
                     /translation="MFKYWPTFVQQWENSLKAAQKGLEIWKSARADAWLAYHNGIFAT
                     SHYEGALTSEDISSAAAAALKGHKIRGGNVNTKSILDGSNRLAHTLALQG"
     misc_feature    <97..375
                     /locus_tag="PSLT001"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:320948"
     gene            712..1155
                     /locus_tag="PSLT002"
                     /db_xref="GeneID:1256237"
     CDS             712..1155
                     /locus_tag="PSLT002"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phospholipase D"
                     /protein_id="NP_490494.1"
                     /db_xref="GeneID:1256237"
                     /translation="MFIPAGLPASYCGTVRSGRFFTGGQRKQLVLKTIEAAQHNIRLM
                     EYSFTSPEVAGALISAKRRGVDVRGGGLDWKANTGKNNNASRVTMNLLTSAGIPVRTV
                     SVYKILHDKVIVSDGRHTEVGSFNYSRAADRSNSENVLSSGMTQS"
     misc_feature    769..1131
                     /locus_tag="PSLT002"
                     /note="Catalytic domain of phospholipase D superfamily
                     proteins; Region: PLDc_SF; cl15239"
                     /db_xref="CDD:326546"
     misc_feature    order(1036..1038,1042..1044,1081..1083,1087..1089,
                     1120..1122)
                     /locus_tag="PSLT002"
                     /note="putative active site [active]"
                     /db_xref="CDD:197200"
     misc_feature    1036..1038
                     /locus_tag="PSLT002"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197200"
     gene            1334..1600
                     /gene="repC"
                     /locus_tag="PSLT003"
                     /db_xref="GeneID:1256235"
     CDS             1334..1600
                     /gene="repC"
                     /locus_tag="PSLT003"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication"
                     /protein_id="NP_490495.1"
                     /db_xref="GeneID:1256235"
                     /translation="MILEEAEMSQIENAVTSSSKRIYRKGNPLSSAEKKRLSISRKKT
                     THKELNVFIQNIHKESLQQLCEETGTTQAQMIELLIEREMAKRA"
     misc_feature    1355..1597
                     /gene="repC"
                     /locus_tag="PSLT003"
                     /note="replication protein; Provisional; Region: PRK13702"
                     /db_xref="CDD:184258"
     gene            1723..1845
                     /gene="repA3"
                     /locus_tag="PSLT004"
                     /db_xref="GeneID:1256236"
     CDS             1723..1845
                     /gene="repA3"
                     /locus_tag="PSLT004"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication"
                     /protein_id="NP_490496.1"
                     /db_xref="GeneID:1256236"
                     /translation="MSTRDQKSKNPDNLLISWRERKINGAYLNCIATNQAMQGV"
     gene            1850..1927
                     /gene="tap"
                     /locus_tag="PSLT005"
                     /db_xref="GeneID:1256234"
     CDS             1850..1927
                     /gene="tap"
                     /locus_tag="PSLT005"
                     /codon_start=1
                     /transl_table=11
                     /product="replication of plasmid"
                     /protein_id="NP_490497.1"
                     /db_xref="GeneID:1256234"
                     /translation="MLRKFQYLFLWHLLLPCIVSAGRSD"
     misc_feature    1850..1924
                     /gene="tap"
                     /locus_tag="PSLT005"
                     /note="RepA leader peptide Tap; Provisional; Region:
                     PRK14745"
                     /db_xref="CDD:173206"
     gene            1908..2789
                     /gene="repA"
                     /locus_tag="PSLT006"
                     /db_xref="GeneID:1256233"
     CDS             1908..2789
                     /gene="repA"
                     /locus_tag="PSLT006"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication"
                     /protein_id="NP_490498.3"
                     /db_xref="GeneID:1256233"
                     /translation="MQAEVTDTRTLFTHYRQVKNPNPEFTPREGKKTLPFCRKLMAKA
                     EGFTSRFDFSVHVAFVRSLGKRHRMPPLLRRRAIDALLQGLCFHYDPLANRVQRSITN
                     LAIECGLATESKSGNLSITRATRALKFMAELGLITYQTEYDPQIGCNIPTDITFTPAL
                     FSALDVSDVAVMAARRSRVEWENQQRKKQNLEPLEMDELIAKAWRFVRERFRSYQSER
                     KLHGLKRARARRDADRSRKDIETLVKQQLTREYASGRFTGGLDAMKRELQRRVKERMM
                     MSRGKNYTRLTMATVPI"
     misc_feature    1926..2780
                     /gene="repA"
                     /locus_tag="PSLT006"
                     /note="replication protein; Provisional; Region: PRK13750"
                     /db_xref="CDD:184300"
     gene            3730..3870
                     /locus_tag="PSLT007"
                     /db_xref="GeneID:1256232"
     CDS             3730..3870
                     /locus_tag="PSLT007"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane protein"
                     /protein_id="NP_490499.1"
                     /db_xref="GeneID:1256232"
                     /translation="MSLHRGLCGLRSDIPQAEGITSDDRDTLWIVSEPNLFYRFTRTA
                     AS"
     misc_feature    <3730..3867
                     /locus_tag="PSLT007"
                     /note="Uncharacterized protein YjiK [Function unknown];
                     Region: YjiK; COG3204"
                     /db_xref="CDD:225745"
     gene            complement(3967..4725)
                     /gene="srgC"
                     /locus_tag="PSLT008"
                     /gene_synonym="rcK"
                     /db_xref="GeneID:1256231"
     CDS             complement(3967..4725)
                     /gene="srgC"
                     /locus_tag="PSLT008"
                     /gene_synonym="rcK"
                     /codon_start=1
                     /transl_table=11
                     /product="sdiA-regulated gene;putative bacterial
                     regulatory helix-turn-helix proteins, araC family"
                     /protein_id="NP_490500.1"
                     /db_xref="GeneID:1256231"
                     /translation="MELDKYLLFFLAGGSTFNQGKAFSFRCAQDSIVLTKVHQTEMHF
                     YRWYHHVVITRETLCRFARQLDVDVLKFYIPKDIPRYLVQPCPEDSVFRPLMVRLCAG
                     TDNSYGETGPENPFLTFALVSAFCEQDIFFPFLKTCLKQSMADQVATVINRNVSENWT
                     IHRVAGELYVSVSLLKKKLKEENTSYTRILLECRMKKASELIVMQEGAVKKVAYQCGY
                     SSVPYFISQFRKYYGYTPSRCKPDGNLFYSFIAK"
     misc_feature    complement(4015..4575)
                     /gene="srgC"
                     /locus_tag="PSLT008"
                     /gene_synonym="rcK"
                     /note="DNA-binding transcriptional regulator GadX;
                     Provisional; Region: PRK09978; cl26289"
                     /db_xref="CDD:331110"
     gene            complement(4992..5549)
                     /gene="rcK"
                     /locus_tag="PSLT009"
                     /gene_synonym="srgB"
                     /db_xref="GeneID:1256230"
     CDS             complement(4992..5549)
                     /gene="rcK"
                     /locus_tag="PSLT009"
                     /gene_synonym="srgB"
                     /codon_start=1
                     /transl_table=11
                     /product="resistance to complement killing"
                     /protein_id="NP_490501.1"
                     /db_xref="GeneID:1256230"
                     /translation="MKKIVLSSLLLSAAGLAAVPVAQADTHSVSVGYAQSRIEHFKDI
                     RGVNLKYRYEAQTPLGLMASFSWQSGKRGESGGIPGGMSWRDDVKATYWSLMAGPAVR
                     VNELVSLYALAGAGTGRAEVKERISMPGYNGRFTGSERRTGFAWGAGVQFNPVENVVI
                     DLGYEGSKVGAAKLNGVNVGVGYRF"
     misc_feature    complement(4995..5549)
                     /gene="rcK"
                     /locus_tag="PSLT009"
                     /gene_synonym="srgB"
                     /note="resistance to complement killing; Provisional;
                     Region: PRK15240"
                     /db_xref="CDD:185153"
     gene            complement(5639..6538)
                     /gene="srgB"
                     /locus_tag="PSLT010"
                     /gene_synonym="srgA"
                     /db_xref="GeneID:1256228"
     CDS             complement(5639..6538)
                     /gene="srgB"
                     /locus_tag="PSLT010"
                     /gene_synonym="srgA"
                     /codon_start=1
                     /transl_table=11
                     /product="sdiA-regulated gene; putative outer membrane
                     protein"
                     /protein_id="NP_490502.1"
                     /db_xref="GeneID:1256228"
                     /translation="MMWSPVSPVTENITFTTTMFRYLCNQKAALLTAILLMAAGVLTL
                     CFPESWYPQETEWHLTAEKEITGIHGGLSGLTWNPDSRTLFAVTDHPSSVVELDTEGN
                     VLRVIPSDGDHDFEAIEYLGGNRYALSRERERTLTTHCIDSSTTVLPPATYSLTLDVN
                     RHSDNAGFEGLARGRGEHALMVAQEKKPLRLYVTDRSPDALSVSDSLTHRASLPWFLK
                     DISGLHYDRNNGLLYVLSHESAVVVVSGLDGGRKVMSLHRGLCGLRSDIPQAEGITSD
                     DRDTLWIVSEPNLFYRFTRTAAS"
     misc_feature    complement(5642..6538)
                     /gene="srgB"
                     /locus_tag="PSLT010"
                     /gene_synonym="srgA"
                     /note="Uncharacterized protein YjiK [Function unknown];
                     Region: YjiK; COG3204"
                     /db_xref="CDD:225745"
     gene            complement(6671..7324)
                     /gene="srgA"
                     /locus_tag="PSLT011"
                     /gene_synonym="orf7"
                     /db_xref="GeneID:1256229"
     CDS             complement(6671..7324)
                     /gene="srgA"
                     /locus_tag="PSLT011"
                     /gene_synonym="orf7"
                     /codon_start=1
                     /transl_table=11
                     /product="sdiA-regulated gene; putative thiol-disulfide
                     isomerase or thioredoxin"
                     /protein_id="NP_490503.1"
                     /db_xref="GeneID:1256229"
                     /translation="MTMNYARDLFSLKGILFSFLLAGCVCPVVAQEWESITPPVVDAP
                     AVVEFFSFYCPPCYAFSQTMGVDQAIRHVLPQGSRMVKYHVSLLGPLGHELTRAWALA
                     MVMKETDVIEKAFFTAGMVEKRLHSPDDVRRVFMSATGISRGEYDRSIKSPAVNDMVA
                     LQERLFKEYGVRGTPSVYVRGRYHINNAAFGAFSVENFRSRYAAVVRKLLAGNPDAD"
     misc_feature    complement(6695..7234)
                     /gene="srgA"
                     /locus_tag="PSLT011"
                     /gene_synonym="orf7"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:320948"
     misc_feature    complement(order(6800..6802,7154..7159,7163..7165))
                     /gene="srgA"
                     /locus_tag="PSLT011"
                     /gene_synonym="orf7"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239317"
     misc_feature    complement(7058..7066)
                     /gene="srgA"
                     /locus_tag="PSLT011"
                     /gene_synonym="orf7"
                     /note="hinge region; other site"
                     /db_xref="CDD:239317"
     misc_feature    complement(order(6866..6895,6914..6940,6950..7009,
                     7019..7045))
                     /gene="srgA"
                     /locus_tag="PSLT011"
                     /gene_synonym="orf7"
                     /note="alpha helical domain; other site"
                     /db_xref="CDD:239317"
     gene            complement(7569..7919)
                     /gene="orf7"
                     /locus_tag="PSLT012"
                     /gene_synonym="pefI"
                     /db_xref="GeneID:1256227"
     CDS             complement(7569..7919)
                     /gene="orf7"
                     /locus_tag="PSLT012"
                     /gene_synonym="pefI"
                     /codon_start=1
                     /transl_table=11
                     /product="putative bacterial regulatory proteins, luxR
                     family"
                     /protein_id="NP_490504.1"
                     /db_xref="GeneID:1256227"
                     /translation="MASALTAFPEDGDFSRIWYDRLCIEFNSDGGLSPAELRVIRLLL
                     RGYNSGQIAALCFRSVKTISAQKGQAFRRLGVRNDATLLPTLMLLGMVTLYTDLNRVH
                     SLEEAGLECGPEAG"
     misc_feature    complement(7674..7829)
                     /gene="orf7"
                     /locus_tag="PSLT012"
                     /gene_synonym="pefI"
                     /note="helix_turn_helix, Lux Regulon; Region: HTH_LUXR;
                     smart00421"
                     /db_xref="CDD:197715"
     misc_feature    complement(order(7683..7685,7716..7730,7734..7739,
                     7743..7748,7770..7778,7815..7823))
                     /gene="orf7"
                     /locus_tag="PSLT012"
                     /gene_synonym="pefI"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     gene            complement(7904..8116)
                     /gene="pefI"
                     /locus_tag="PSLT013"
                     /gene_synonym="orf6"
                     /db_xref="GeneID:1256226"
     CDS             complement(7904..8116)
                     /gene="pefI"
                     /locus_tag="PSLT013"
                     /gene_synonym="orf6"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid-encoded fimbriae; regulatory"
                     /protein_id="NP_490505.1"
                     /db_xref="GeneID:1256226"
                     /translation="MSESIVTKIISIVQERQNMDDGAPVKTRDIADAAGLSIYQVRLY
                     LEQLHDVGVLEKVNAGKGVPGLWRLL"
     misc_feature    complement(7907..8116)
                     /gene="pefI"
                     /locus_tag="PSLT013"
                     /gene_synonym="orf6"
                     /note="FaeA-like protein; Region: FaeA; pfam04703"
                     /db_xref="CDD:309716"
     gene            complement(8548..9423)
                     /gene="orf6"
                     /locus_tag="PSLT014"
                     /gene_synonym="orf5"
                     /db_xref="GeneID:1256224"
     CDS             complement(8548..9423)
                     /gene="orf6"
                     /locus_tag="PSLT014"
                     /gene_synonym="orf5"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane protein"
                     /protein_id="NP_490506.1"
                     /db_xref="GeneID:1256224"
                     /translation="MLKLLIASVIIMGGTVITYPAHAKTTTVSTYSQGIYQYQMQASN
                     FMIKSDQAALSMVTMTSFSQCNVQIISRTCNGTAMVIAPDGTRYPAEVECKVADKGFG
                     VMFRAPGLVQNGIVAGEGYILPAGYTLMFSLSRTGEVRTTRTLYDECEASSLGSWLHQ
                     YHLPSPSVTLTSSSGARYTLGNGVMSTSFPAGGTTKSITVEHPDSINSKAGVNGAFEQ
                     VILKASGTPGASIRVTQSITPSEVARNAQLLKTTGGQCTTMRAGDECKLVLAPGTIRP
                     GHTSSGTVLISVQLQ"
     gene            complement(9676..10233)
                     /gene="orf5"
                     /locus_tag="PSLT015"
                     /gene_synonym="pefD"
                     /db_xref="GeneID:1256225"
     CDS             complement(9676..10233)
                     /gene="orf5"
                     /locus_tag="PSLT015"
                     /gene_synonym="pefD"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane protein"
                     /protein_id="NP_490507.1"
                     /db_xref="GeneID:1256225"
                     /translation="MMRRSEIRWMKRHVCAGALVTGLLFPLATEAASKENITIPFTLT
                     NPQQTCKLTFDNGGNTMNYQLGVMNKGVRMQHRPFTVKVDCGQSTVVKTALTARNTTG
                     TLQGGGDSSVVIMRMNGQPSNNGPLFWLENGSKRVKLTGKDDDAFCISPSPNNCELRP
                     VTDIPANSPEGNIDVTVVFDVVYPQ"
     gene            complement(10248..10940)
                     /gene="pefD"
                     /locus_tag="PSLT016"
                     /gene_synonym="pefC"
                     /db_xref="GeneID:1256223"
     CDS             complement(10248..10940)
                     /gene="pefD"
                     /locus_tag="PSLT016"
                     /gene_synonym="pefC"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid-encoded fimbriae;chaperone"
                     /protein_id="NP_490508.1"
                     /db_xref="GeneID:1256223"
                     /translation="MNKMMKWGLVSLLSLAVSGQAMAAFVLNGTRFIYEEGRKNTSFE
                     VTNQADETFGGQVWIDNTTQGSSTVYMVPAPPFFKVRPKEKQIIRIMKTDSTLPSDRE
                     SLFWLNVQEIPPKPKASEGNVLAVAVNTKVKLIYRPKALVEGRRNAEKNLQIAHRGGE
                     AYLKNPTPYYFAVTGVKLNGQPVRLNDRVMNEIAQLAPKSEVALGKLSLNGTVTVQAV
                     NDWGGTQDYTLK"
     misc_feature    complement(10251..10937)
                     /gene="pefD"
                     /locus_tag="PSLT016"
                     /gene_synonym="pefC"
                     /note="fimbrial chaperone protein PefD; Provisional;
                     Region: PRK15211"
                     /db_xref="CDD:185133"
     gene            complement(10933..13341)
                     /gene="pefC"
                     /locus_tag="PSLT017"
                     /gene_synonym="pefA"
                     /db_xref="GeneID:1256222"
     CDS             complement(10933..13341)
                     /gene="pefC"
                     /locus_tag="PSLT017"
                     /gene_synonym="pefA"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid-encoded fimbriae; usher protein"
                     /protein_id="NP_490509.1"
                     /db_xref="GeneID:1256222"
                     /translation="MSFHHRVFKLSALSLALFSHLSFASTDSELNLDFLQGMSAIPSV
                     LKSGSDFPAGQYYVDVIVNQENVGKARLSITPQEESANALCLSPEWLKAAGVPVRLEG
                     YASTLNAAGQCYVLSRNPYTRVDFSYGSQSLVFSIPQSFLVGKTDPSRWDYGVPAARL
                     KYSANASQTSGQSTSAYANADLMVNLGRWVLASNMSASRYADGSGEFTARDITLSTAI
                     SQVQGDLLLGKSQTRSALFSDFGFYGAALRSNSNMLPWEARGYAPLITGVANSTSRVT
                     ISQNGYAVYSKVVPPGPYQLDDVRSVGNGDLVVTVEDASGHKTTTVYPVTTLPTLLRP
                     GEVEYNVAVGRKSSNYKLKKPFADGENGMFWMGSVGYGFDSTTLNAASILHGKYQAGG
                     VSVTQALGGFGAVSAGMNLSQAKYDNGDNKRGHSVSAKYAKSFSDSSDLQLLAYRYQS
                     KGYVEFADFYSTDRYTRYNTKSRYEMRFSQRLGNSNLNLAGWQEDYWWMKGKAIGGDV
                     SLSTTILDGVSVFLNGSYSKRPYLDKPDYSTSLSFSIPFTLGGVRHYSSTGLSYSSSG
                     RMGMNSGVSASPTDRLSYGLNTNLSDKGDRSLSGNLSYGFDAIQTNMMLSQGRDNTTV
                     SGSVSGTILGTADSGLMMTKETGNTLGVARIPGVKGVRINGSAPTNSKGYTVVNLSDY
                     SLNRVSVDMENVPDDLELQTTSFNVVPTEKAVVYREFGAEHVLRYILRVKERDGRILN
                     GGSAQTEQGLDAGFIAGNGVLLMNMLSAPSRVSVERGDGSVCHFSVKGIVPNTGKVQE
                     VYCE"
     misc_feature    complement(10936..13338)
                     /gene="pefC"
                     /locus_tag="PSLT017"
                     /gene_synonym="pefA"
                     /note="fimbrial outer membrane usher protein PefC;
                     Provisional; Region: PRK15213"
                     /db_xref="CDD:237926"
     gene            complement(13569..14087)
                     /gene="pefA"
                     /locus_tag="PSLT018"
                     /gene_synonym="pefB"
                     /db_xref="GeneID:1256221"
     CDS             complement(13569..14087)
                     /gene="pefA"
                     /locus_tag="PSLT018"
                     /gene_synonym="pefB"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid-encoded fimbriae; major fimbrial
                     subunit"
                     /protein_id="NP_490510.1"
                     /db_xref="GeneID:1256221"
                     /translation="MKKSIIASIIALGVLGGTAHAANEVTFLGSVSATTCDLTTSVNG
                     AAQPNQVVQLGTVQANQPGNFVDFAMKPVDPNAQGCANLAQKTATVSWASAALDGEGF
                     GATSGTATDAKVLVESVNSKNPGAVNANASTVDFEGAKLTTDGLQFKAKLKGGATEGD
                     FKSVASFAVAYK"
     misc_feature    complement(13572..14087)
                     /gene="pefA"
                     /locus_tag="PSLT018"
                     /gene_synonym="pefB"
                     /note="fimbrial protein PefA; Provisional; Region:
                     PRK15214"
                     /db_xref="CDD:185136"
     gene            complement(14362..14664)
                     /gene="pefB"
                     /locus_tag="PSLT019"
                     /db_xref="GeneID:1256219"
     CDS             complement(14362..14664)
                     /gene="pefB"
                     /locus_tag="PSLT019"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid-encoded fimbriae;regulation"
                     /protein_id="NP_490511.1"
                     /db_xref="GeneID:1256219"
                     /translation="MMLNRKDADYYLGKEIMLARIRRGALIPAKVNEEHFWLLIGISS
                     IHSEKIIQALRDYLVFGVSRKDVCERYEVNNGYFSTSLNRLSRISQAAAQMVVYYS"
     misc_feature    complement(14368..14625)
                     /gene="pefB"
                     /locus_tag="PSLT019"
                     /note="Adhesin biosynthesis transcription regulatory
                     protein; Region: PapB; pfam03333"
                     /db_xref="CDD:308768"
     gene            15561..15764
                     /locus_tag="PSLT020"
                     /db_xref="GeneID:1256220"
     CDS             15561..15764
                     /locus_tag="PSLT020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_490512.1"
                     /db_xref="GeneID:1256220"
                     /translation="MEGNIIRQVGHELYEFRDSSGTVYVDIDNKYWMGQTASPADKIH
                     IKGEVDRGWDGIKIDVKNIQVMK"
     misc_feature    <15561..15761
                     /locus_tag="PSLT020"
                     /note="Replication protein A, class 2b aminoacyl-tRNA
                     synthetases, and related proteins with
                     oligonucleotide/oligosaccharide (OB) fold; Region:
                     RPA_2b-aaRSs_OBF_like; cl09930"
                     /db_xref="CDD:299125"
     gene            15921..16377
                     /locus_tag="PSLT021"
                     /db_xref="GeneID:30522292"
     gene            complement(16074..16380)
                     /gene="repA2"
                     /locus_tag="PSLT022"
                     /db_xref="GeneID:30522291"
     gene            complement(16636..17625)
                     /gene="repA2"
                     /locus_tag="PSLT023"
                     /db_xref="GeneID:1256216"
     CDS             complement(16636..17625)
                     /gene="repA2"
                     /locus_tag="PSLT023"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication"
                     /protein_id="NP_490513.1"
                     /db_xref="GeneID:1256216"
                     /translation="MFVEVDKSSGEIVNLTPNASNTVQPVALMRLGVFVPTLKSLKNR
                     KKNTLSRTDASEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGVIHSFARHKVIG
                     DKVELSFVEFAKLCGIPSSQSSRKLRERISPSLKRIAGTVISFSRTTEKHTKEYITHL
                     VQSAYYDTEKDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLP
                     RDPAPISLARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKLFCIHY
                     RRPKLKPPHDESAENPQLPATPGDVSPEMAEKLALLDKLGITLDDLEKLFKSR"
     gene            17369..17677
                     /locus_tag="PSLT024"
                     /db_xref="GeneID:1256217"
     CDS             17369..17677
                     /locus_tag="PSLT024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_490514.1"
                     /db_xref="GeneID:1256217"
                     /translation="MKSLSISRRGPVISTLSNPSALARDRRVSSSDASVRESVFFLRF
                     FSDLSVGTNTPSRIRATGCTVLLALGVRFTISPEDLSTSTNNFFMSRLSLSRAPPIGG
                     "
     gene            complement(18119..18415)
                     /locus_tag="PSLT025"
                     /db_xref="GeneID:1256215"
     CDS             complement(18119..18415)
                     /locus_tag="PSLT025"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490515.1"
                     /db_xref="GeneID:1256215"
                     /translation="MDAEFQKQGLTDLTETDLQAVVTPGETLRLLPTLARLLHVLREK
                     PEAFSLSAASYEEDTSSALKTLLVRTGFTIHQIREMRLHLIRWQLISQEEYDRE"
     gene            complement(18899..19420)
                     /locus_tag="PSLT026"
                     /db_xref="GeneID:1256213"
     CDS             complement(18899..19420)
                     /locus_tag="PSLT026"
                     /codon_start=1
                     /transl_table=11
                     /product="putative periplasmic protein"
                     /protein_id="NP_490516.1"
                     /db_xref="GeneID:1256213"
                     /translation="MAIPPTCKEIFMNTALLAPFISIALSGVGVYTHYYFKKYQASMD
                     QCQKVHKMMVDTLLGTKRLFSRSAPAQALKSELRIMQQQLSQEAQKLDKMTIRLPLKR
                     LQREQRHILRHADWLLHYLDSHLADNEGKFFLFLHDLAMDSDDKVLDFLTSLHDTKRF
                     RNRRLQTGSTTCP"
     gene            20096..20314
                     /gene="ccdA"
                     /locus_tag="PSLT027"
                     /db_xref="GeneID:1256214"
     CDS             20096..20314
                     /gene="ccdA"
                     /locus_tag="PSLT027"
                     /codon_start=1
                     /transl_table=11
                     /product="toxin addiction system: antidote"
                     /protein_id="NP_490517.1"
                     /db_xref="GeneID:1256214"
                     /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERW
                     QEENREGMAEVASFIEANGSFADDNRNW"
     misc_feature    20096..20311
                     /gene="ccdA"
                     /locus_tag="PSLT027"
                     /note="plasmid maintenance protein CcdA; Provisional;
                     Region: PRK13710"
                     /db_xref="CDD:184266"
     gene            20316..20621
                     /gene="ccdB"
                     /locus_tag="PSLT028"
                     /db_xref="GeneID:1256209"
     CDS             20316..20621
                     /gene="ccdB"
                     /locus_tag="PSLT028"
                     /codon_start=1
                     /transl_table=11
                     /product="toxin addiction system: toxin"
                     /protein_id="NP_490518.1"
                     /db_xref="GeneID:1256209"
                     /translation="MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSE
                     KVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEVADLSLRENDIKNAINLMFRGI"
     misc_feature    20316..20618
                     /gene="ccdB"
                     /locus_tag="PSLT028"
                     /note="plasmid maintenance protein CcdB; Provisional;
                     Region: PRK13708"
                     /db_xref="CDD:184264"
     gene            20623..20913
                     /locus_tag="PSLT029"
                     /db_xref="GeneID:1256212"
     CDS             20623..20913
                     /locus_tag="PSLT029"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490519.1"
                     /db_xref="GeneID:1256212"
                     /translation="MRVSEQVLLSSLRQGGCVRSFWRRSARLAGTPSPIVPDGLVLET
                     PGERGDTPLCHVDFAVVQKWLVCEETWTQTLGGTEFGGTVWRLRTDRENTTS"
     gene            20910..21431
                     /locus_tag="PSLT030"
                     /db_xref="GeneID:1256211"
     CDS             20910..21431
                     /locus_tag="PSLT030"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490520.1"
                     /db_xref="GeneID:1256211"
                     /translation="MTRSRICPDTESTGLSPASDALPVRETTEQFAQVFFGKSVSLLT
                     PEERFTTVYAGSRDIPADLHPASWFPADTWFRNELRACAAYVGRRQGWPLYHASEAER
                     LRALYPLRLATPATDPGKQLLTRTALLKAGYSRATIAAMTPVAERQNRHSGDWYPLYR
                     VQTETRDDSGEKT"
     gene            21466..22248
                     /gene="rsdB"
                     /locus_tag="PSLT031"
                     /db_xref="GeneID:1256210"
     CDS             21466..22248
                     /gene="rsdB"
                     /locus_tag="PSLT031"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /protein_id="NP_490521.1"
                     /db_xref="GeneID:1256210"
                     /translation="MSQPPLPAVCTQAASALLPVAIDYPAALALRQMAMQHDDYPKYL
                     LAPEVSALLHYVPDLHRRMLLATLWNTGARINEALALTRGDFSLAPPYPFVQLATLKQ
                     RAEKAARTAGRMPSGSQPHRLVPLSDNQYVSELQMMVATLKIPLERRNRRTGRTEKAR
                     LWEITDRTVRTWIGEAVEAAAADDVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQALM
                     GHKSVSSTEVYTKVFALDVAARHRVQFQMPGADAVAMLKGGS"
     misc_feature    21592..22167
                     /gene="rsdB"
                     /locus_tag="PSLT031"
                     /note="Phage integrase family; Region: Phage_integrase;
                     pfam00589"
                     /db_xref="CDD:278986"
     misc_feature    order(21643..21645,21685..21690,21967..21969,21973..21975,
                     22045..22047,22150..22152)
                     /gene="rsdB"
                     /locus_tag="PSLT031"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271175"
     misc_feature    order(21685..21687,22045..22047,22054..22056,22123..22125,
                     22150..22152)
                     /gene="rsdB"
                     /locus_tag="PSLT031"
                     /note="active site"
                     /db_xref="CDD:271175"
     gene            22257..22808
                     /locus_tag="PSLT032"
                     /db_xref="GeneID:1256207"
     CDS             22257..22808
                     /locus_tag="PSLT032"
                     /codon_start=1
                     /transl_table=11
                     /product="putative diguanylate cyclase/phosphodiesterase"
                     /protein_id="NP_490522.1"
                     /db_xref="GeneID:1256207"
                     /translation="MHFSAFRLQQAIRNREFTPFYQPIVCATGGEVVGCEMLARWLHP
                     QKGLLSAGNFIPAIEATGLGGALLRGLADEVCGDGQDLARSAGRRLMMTLNLSLSLVM
                     TPLFRPHLLALSIRLEQAGMTPVFEITEREDIRAFPQAAVFRQLAAGGLRFAVDDFGT
                     GHAGPASTVADRMIARTVSLARC"
     misc_feature    22257..>22748
                     /locus_tag="PSLT032"
                     /note="EAL domain, c-di-GMP-specific phosphodiesterase
                     class I (or its enzymatically inactive variant) [Signal
                     transduction mechanisms]; Region: EAL; COG2200"
                     /db_xref="CDD:225110"
     gene            23477..23962
                     /locus_tag="PSLT033"
                     /db_xref="GeneID:1256205"
     CDS             23477..23962
                     /locus_tag="PSLT033"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="NP_490523.1"
                     /db_xref="GeneID:1256205"
                     /translation="MLIIVSDCQFTRLALTRLLAHLDPVNMSVARWLQTAPPAGSHVL
                     LAASPGMLASLVPACHHARTSLSLKLALLGSGGQAVFLNTLGLRPDCLLPRTASATQL
                     KAAVSSWLRRARGWRQATTESLSLRERQALCATLAGLSARTAPGSASAPKPFTAIAAA
                     R"
     misc_feature    23570..>23956
                     /locus_tag="PSLT033"
                     /note="Bacteriophage N adsorption protein A C-term;
                     Region: NfrA_C; cl26232"
                     /db_xref="CDD:331053"
     gene            24682..25242
                     /locus_tag="PSLT034"
                     /db_xref="GeneID:1256206"
     CDS             24682..25242
                     /locus_tag="PSLT034"
                     /codon_start=1
                     /transl_table=11
                     /product="putative adhesin"
                     /protein_id="NP_490524.1"
                     /db_xref="GeneID:1256206"
                     /translation="MLGANIFLDYDLSRDHARAGFGGEYWRDFLKLSANAYVGLTGWK
                     TSPDVEDYEERPASGWDLRAEGYLPSYPQLGAKMVYEQYYGNEVGLFGKDERQKNPHA
                     LTAGVSWTPVPLLKLSAEQRAGKAGEHDTRFGAEASYRIGDSLRSQLDPDAVGALRSL
                     AGSRYDLTDRNNDIILEYRKQEVTCQ"
     misc_feature    <24682..25197
                     /locus_tag="PSLT034"
                     /note="Inverse autotransporter, beta-domain; Region:
                     IAT_beta; pfam11924"
                     /db_xref="CDD:314749"
     gene            complement(25309..25659)
                     /gene="spvD"
                     /locus_tag="PSLT035"
                     /db_xref="GeneID:1256204"
     CDS             complement(25309..25659)
                     /gene="spvD"
                     /locus_tag="PSLT035"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="NP_490525.1"
                     /db_xref="GeneID:1256204"
                     /translation="MLRATKVCIYPTPEQAEHLNAQFGAVRFVYSKSLHIKKHAYQRH
                     GVSLTPRKDIKPLLAVAKKFRKFRKYAWLKEYDSIALQQAVINLDVAFSNCFNPKLKA
                     RFPMFKRKHGKLLG"
     misc_feature    complement(<25327..25659)
                     /gene="spvD"
                     /locus_tag="PSLT035"
                     /note="Transposase [Mobilome: prophages, transposons];
                     Region: InsQ; COG0675"
                     /db_xref="CDD:223747"
     misc_feature    complement(25525..25659)
                     /gene="spvD"
                     /locus_tag="PSLT035"
                     /note="Helix-turn-helix domain; Region: HTH_OrfB_IS605;
                     pfam12323"
                     /db_xref="CDD:315082"
     gene            25877..26140
                     /locus_tag="PSLT036"
                     /db_xref="GeneID:1256203"
     CDS             25877..26140
                     /locus_tag="PSLT036"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase, IS200-like"
                     /protein_id="NP_490526.1"
                     /db_xref="GeneID:1256203"
                     /translation="MECEIIEMDGEQDHVHLLIAYPLKLGVSVMVNNLKSVSSRLLRQ
                     QNTHLRMQSKTGLLWSRSYFACSAGGATIETLKAYVLRQNTPE"
     misc_feature    <25877..26125
                     /locus_tag="PSLT036"
                     /note="Transposase IS200 like; Region: Y1_Tnp; pfam01797"
                     /db_xref="CDD:307766"
     gene            complement(26267..26917)
                     /gene="spvD"
                     /locus_tag="PSLT037"
                     /gene_synonym="spvC"
                     /db_xref="GeneID:1256202"
     CDS             complement(26267..26917)
                     /gene="spvD"
                     /locus_tag="PSLT037"
                     /gene_synonym="spvC"
                     /codon_start=1
                     /transl_table=11
                     /product="Salmonella plasmid virulence: hydrophilic
                     protein"
                     /protein_id="NP_490527.1"
                     /db_xref="GeneID:1256202"
                     /translation="MRVSGSASSQDIISRINSKNINNNDSNEVKRIKDALCIESKERI
                     LYPQNLSRDNLKQMARYVNNTYVHYSGNCVLLSACLHYNIHHRQDILSSKNTASPTVG
                     LDSAIVDKIIFGHELNQSYCLNSIDEVEKEILNRYDIKRESSFIISAENYIAPIIGEC
                     RHDFNAVVICEYDKKPYVQFIDSWKTSNILPSLQEIKKHFSSSGEFYVRAYDEKHD"
     misc_feature    complement(26270..26917)
                     /gene="spvD"
                     /locus_tag="PSLT037"
                     /gene_synonym="spvC"
                     /note="Salmonella plasmid virulence protein SpvD; Region:
                     SpvD; cl27954"
                     /db_xref="CDD:332775"
     gene            complement(27178..27903)
                     /gene="spvC"
                     /locus_tag="PSLT038"
                     /gene_synonym="spvB"
                     /db_xref="GeneID:1256201"
     CDS             complement(27178..27903)
                     /gene="spvC"
                     /locus_tag="PSLT038"
                     /gene_synonym="spvB"
                     /codon_start=1
                     /transl_table=11
                     /product="Salmonella plasmid virulence: hydrophilic
                     protein"
                     /protein_id="NP_490528.1"
                     /db_xref="GeneID:1256201"
                     /translation="MPINRPNLNLNIPPLNIVAAYDGAEIPSTNKHLKNNFNSLHNQM
                     RKMPVSHFKEALDVPDYSGMRQSGFFAMSQGFQLNNHGYDVFIHARRESPQSQGKFAG
                     DKFHISVLRDMVPQAFQALSGLLFSEDSPVDKWKVTDMEKVVQQARVSLGAQFTLYIK
                     PDQENSQYSASFLHKTRQFIECLESRLSENGVISGQCPESDVHPENWKYLSYRNELRS
                     GRDGGEMQRQALREEPFYRLMTE"
     misc_feature    complement(27181..27903)
                     /gene="spvC"
                     /locus_tag="PSLT038"
                     /gene_synonym="spvB"
                     /note="type III effector phosphothreonine lyase;
                     Provisional; Region: PRK15245"
                     /db_xref="CDD:185157"
     gene            complement(28185..29960)
                     /gene="spvB"
                     /locus_tag="PSLT039"
                     /gene_synonym="spvA"
                     /db_xref="GeneID:1256199"
     CDS             complement(28185..29960)
                     /gene="spvB"
                     /locus_tag="PSLT039"
                     /gene_synonym="spvA"
                     /codon_start=1
                     /transl_table=11
                     /product="Salmonella plasmid virulence: hydrophilic
                     protein"
                     /protein_id="NP_490529.1"
                     /db_xref="GeneID:1256199"
                     /translation="MLILNGFSSATLALITPPFLPKGGKALSQSGPDGLASITLPLPI
                     SAERGFAPALALHYSSGGGNGPFGVGWSCATMSIARRTSHGVPQYNDSDEFLGPDGEV
                     LVQTLSTGDAPNPVTCFAYGDVSFPQSYTVTRYQPRTESSFYRLEYWVGNSNGDDFWL
                     LHDSNGILHLLGKTAAARLSDPQAASHTAQWLVEESVTPAGEHIYYSYLAENGDNVDL
                     NGNEAGRDRSAMRYLSKVQYGNATPAADLYLWTSATPAVQWLFTLVFDYGERGVDPQV
                     PPAFTAQNSWLARQDPFSLYNYGFEIRLHRLCRQVLMFHHFPDELGEADTLVSRLLLE
                     YDENPILTQLCAARTLAYEGDGYRRAPVNNMMPPPPPPPMMGGNSSRPKSKWAIVEES
                     KQIQALRYYSAQGYSVINKYLRGDDYPETQAKETLLSRDYLSTNEPSDEEFKNAMSVY
                     INDIAEGLSSLPETDHRVVYRGLKLDKPALSDVLKEYTTIGNIIIDKAFMSTSPDKAW
                     INDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVNCGSQDFASQLSK
                     LRLSDDATADTNRIKRIINMRVLNS"
     misc_feature    complement(28188..29960)
                     /gene="spvB"
                     /locus_tag="PSLT039"
                     /gene_synonym="spvA"
                     /note="virulence protein SpvB; Provisional; Region:
                     PRK15244"
                     /db_xref="CDD:185156"
     gene            complement(30142..30909)
                     /gene="spvA"
                     /locus_tag="PSLT040"
                     /gene_synonym="spvR"
                     /db_xref="GeneID:1256200"
     CDS             complement(30142..30909)
                     /gene="spvA"
                     /locus_tag="PSLT040"
                     /gene_synonym="spvR"
                     /codon_start=1
                     /transl_table=11
                     /product="Salmonella plasmid virulence: outer membrane
                     protein"
                     /protein_id="NP_490530.1"
                     /db_xref="GeneID:1256200"
                     /translation="MNMNQTTSPALSQVETAIRVPAGNFAKYNYYSVFDIVRQTRKQF
                     INANMSWPGSRGGKTWDLAMGQAQYIRCMFRENQLTRRVRGTLQQTPDNGTNLSSSAV
                     GGIQGQAERRPDLATLMVVNDAINQQIPTLLPYHFPHDQVELSLLNTDVSLEDIISES
                     SIDWPWFLSNSLTGDNSNYAMELASRLSPEQQTLPTEPDNSTATDLTSFYQTNLGLKT
                     ADYTPFEALNTFARQLAITVPPGGTVDCGYSACQPAV"
     misc_feature    complement(30145..30909)
                     /gene="spvA"
                     /locus_tag="PSLT040"
                     /gene_synonym="spvR"
                     /note="virulence protein SpvA; Provisional; Region:
                     PRK15212"
                     /db_xref="CDD:185134"
     gene            complement(31421..32314)
                     /gene="spvR"
                     /locus_tag="PSLT041"
                     /db_xref="GeneID:1256197"
     CDS             complement(31421..32314)
                     /gene="spvR"
                     /locus_tag="PSLT041"
                     /codon_start=1
                     /transl_table=11
                     /product="Salmonella plasmid virulence: regulation of spv
                     operon, lysR family"
                     /protein_id="NP_490531.1"
                     /db_xref="GeneID:1256197"
                     /translation="MDFLINKKLKIFITLMETGSFSIATSVLYITRTPLSRVISDLER
                     ELKQRLFIRKNGTLIPTEFAQTIYRKVKSHYIFLHALEQEIGPTGKTKQLEIIFDEIY
                     PGSLKNLIISALTISGQKTNIMGRAVNSQIIEELCQTNNCIVISARNYFHRESLVCRT
                     SVEGGVMLFIPKKFFLCGKPDINRLAGTPVLFHEGAKNFNLDTIYHFFEQTLGITNPA
                     FSFDNVDLFSSLYRLQQGLAMLLIPVRVCRALGLSTDHALHIKGVALCTSLYYPTKKR
                     ETPDYRKAIKLIQQELKQSTF"
     misc_feature    complement(31424..32314)
                     /gene="spvR"
                     /locus_tag="PSLT041"
                     /note="transcriptional regulator SpvR; Provisional;
                     Region: PRK15243"
                     /db_xref="CDD:185155"
     gene            32923..33960
                     /locus_tag="PSLT042"
                     /db_xref="GeneID:1256195"
     CDS             32923..33960
                     /locus_tag="PSLT042"
                     /codon_start=1
                     /transl_table=11
                     /product="putative integrase protein"
                     /protein_id="NP_490532.1"
                     /db_xref="GeneID:1256195"
                     /translation="MPIIAAIPDEERQLMRKEAQQTHDKNHARRLIAMLMLHQGMTVT
                     DVARLLCAARSSVGRWINWFTLHGVEGLKSLRPGRAPRWPVADILQLLPLLVQRSPKD
                     FGWLRSRWSTELLALVINRLFDVTLHRSTLHRYLRQADMVWRRAAPTLKIKDPHYEEK
                     RLVIDQALAQEQTAHPVFYQDEVDIDLNPKIGADWMPKGQQKRIATPGQNQKHYLAGA
                     LHSGTGRVHYVSGSSKSSDLFISLLETLRRTYRRAKTITLVADNYIIHKSRKVERWLE
                     ENPKFRLLFLPMYSPWLNPIERLWLSLHETITRNHQCRYMWQLLKQVAQFMNAASLFP
                     GNQQGLAKVER"
     misc_feature    32992..33141
                     /locus_tag="PSLT042"
                     /note="Homeodomain-like domain; Region: HTH_23; pfam13384"
                     /db_xref="CDD:315948"
     misc_feature    33088..33330
                     /locus_tag="PSLT042"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:316122"
     misc_feature    33448..33831
                     /locus_tag="PSLT042"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:315923"
     gene            complement(34149..35174)
                     /locus_tag="PSLT043"
                     /db_xref="GeneID:1256196"
     CDS             complement(34149..35174)
                     /locus_tag="PSLT043"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphoribulokinase / uridine kinase
                     family"
                     /protein_id="NP_490533.1"
                     /db_xref="GeneID:1256196"
                     /translation="MKYSPASETIFVADNQERTMRVEVMEHYGLTQSIEQAGYYETAH
                     HKQLMKDIKGAIREGRLIAVCGVVGSGKTVTLRRLQQQLLDENKIIVARSLSVDKQSV
                     RLATLINALFYDLAQDKQVQIHKQGERRERELQELVKKGKRPVALFVDEAHDLNGNTL
                     TGLKRLMEVVEDGGGRLSVVLAGHPKLRNDLRRPTMEEIGYRTDIFTLDGITGSQREY
                     IQWLLKTSTGKGKPEDILTTEAVDLLAMKLRTPLQVQLHLTLAMEAGYQTGEKPITAT
                     LVESVLSRQLDDLEPTLTRHGYRLKDMVEQFDAKPAEIRALFNNQLDPARTAELRDRM
                     LAVGLPI"
     misc_feature    complement(34332..35147)
                     /locus_tag="PSLT043"
                     /note="Type II secretory pathway, component ExeA
                     (predicted ATPase) [Intracellular trafficking, secretion,
                     and vesicular transport]; Region: ExeA; COG3267"
                     /db_xref="CDD:225806"
     gene            complement(35107..36771)
                     /gene="rlgA"
                     /locus_tag="PSLT044"
                     /db_xref="GeneID:1256194"
     CDS             complement(35107..36771)
                     /gene="rlgA"
                     /locus_tag="PSLT044"
                     /codon_start=1
                     /transl_table=11
                     /product="putative integrase protein"
                     /protein_id="NP_490534.1"
                     /db_xref="GeneID:1256194"
                     /translation="MSSRRSAIPSDSLLQLRQRLDRLPPKSPERANQIAATAQLYGIS
                     VTTVYRALHLVLKPRTAHRSDHGQPRILPPSELEHYCELIAALKLRTTNKSGRHLSTG
                     RAIQLLEEHGVETVQGLIKSPKGLLRKQTVNRWLSRWRLDQPRLLREPPAVRFQAENS
                     NDCWQFDMSPSDLKHIERPDWVDPARGEPTLMLFSVVDDRSGVAYQEYRCVYGEDAES
                     ALRFLFNAMAPKTRSDFPFQGRPKLLYLDNGPVAKNHVFQNVMQSLKVDWLTHTPAGK
                     DGTRTTARSKGKVERPFRTVKEAHETLYHFHKPETELQANEWLWNYLSRYNAQRHRSE
                     KHSRLEDWLANIGQEGVRDMCSWEQYCRFAREPESRKVGVDARITIDGTAWEVEPDMA
                     GETVILLWGLFDEEMYVEFTGETWGPYYPVSGPVPLHRYRTFRRGKAAERADRIHALA
                     RQLNIPISALSGSDLRVVSDDTQQRIDALPHQPFDTRKFEYHFPTVIAAKLAIADDLA
                     IPLARMSDEDRAFIDSILTETLNRSEVLARIRDYFRSRQSGEDHAG"
     misc_feature    complement(35878..36294)
                     /gene="rlgA"
                     /locus_tag="PSLT044"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:307008"
     gene            complement(36755..37315)
                     /locus_tag="PSLT045"
                     /db_xref="GeneID:1256192"
     CDS             complement(36755..37315)
                     /locus_tag="PSLT045"
                     /codon_start=1
                     /transl_table=11
                     /product="putative resolvase"
                     /protein_id="NP_490535.1"
                     /db_xref="GeneID:1256192"
                     /translation="MALYGYARVSTSDQDLTLQTQILRAAGCEIIRAEKASGSGRTGR
                     SELQLLLEFLRPGDTLMVTRVDRLARSIKDLQDIVYALNQQGVTLRATEQPVDTRSAA
                     GKAFLDMLGVFAEFETNLRRERQMEGIAAAKARGVYRGRKPSIDPAVVYRLYTIEKMG
                     ATAIARQLGIGRASVYRALENYEQPA"
     misc_feature    complement(36932..37309)
                     /locus_tag="PSLT045"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(37106..37108,37115..37120,37286..37288,
                     37292..37294))
                     /locus_tag="PSLT045"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(37286..37288)
                     /locus_tag="PSLT045"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(36965..36967,36977..36982,36986..36991,
                     37121..37123))
                     /locus_tag="PSLT045"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(36959..36961,36968..36970,36977..36982,
                     36989..36994,37001..37003,37085..37090,37103..37105))
                     /locus_tag="PSLT045"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(36944..36946,36956..36958,36965..36967,
                     36977..36979,36986..36991,36998..37003,37028..37036))
                     /locus_tag="PSLT045"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(36944..36946,36956..36958,36965..36967,
                     36977..36979,36986..36988,37034..37036))
                     /locus_tag="PSLT045"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(36941..36946,36962..36964))
                     /locus_tag="PSLT045"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     misc_feature    complement(36776..36898)
                     /locus_tag="PSLT045"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:328727"
     misc_feature    complement(order(36782..36790,36794..36799,36887..36895))
                     /locus_tag="PSLT045"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     gene            complement(37522..38262)
                     /locus_tag="PSLT046"
                     /db_xref="GeneID:1256193"
     CDS             complement(37522..38262)
                     /locus_tag="PSLT046"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carbonic anhydrase"
                     /protein_id="NP_490536.1"
                     /db_xref="GeneID:1256193"
                     /translation="MEQNQPAQPSRRAILKQTLAVSALSVTGLAALSVPTISFAASLS
                     KEERDGMTPDAVIEHFKQGNLRFRENRPAKHDYLAQKRNSIAGQYPAAVILSCIDSRA
                     PAEIVLDAGIGETFNSRVAGNISNRDMLGSMEFACAVAGAKVVLVIGHTRCGAVRCAI
                     DNAELGNLTGLLDEIKPAIAKTEYSGERKGSNYDFVDAVARKNVELTIENIRKNSPVL
                     KQLEDEKKIKIVGSMYHLTGGKVEFFEV"
     misc_feature    complement(37528..38262)
                     /locus_tag="PSLT046"
                     /note="carbonic anhydrase; Provisional; Region: PRK15219"
                     /db_xref="CDD:237927"
     misc_feature    complement(order(37561..37563,37804..37806,37813..37815,
                     37843..37845,37858..37860,37915..37917,37924..37926,
                     37960..37968,37972..37974,37993..37995,37999..38001))
                     /locus_tag="PSLT046"
                     /note="active site clefts [active]"
                     /db_xref="CDD:239473"
     misc_feature    complement(order(37804..37806,37813..37815,37966..37968,
                     37972..37974))
                     /locus_tag="PSLT046"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:239473"
     misc_feature    complement(order(37540..37542,37546..37548,37552..37557,
                     37561..37563,37858..37863,37870..37875,37906..37908,
                     37912..37914,37918..37926,37939..37950,37954..37956,
                     37960..37971))
                     /locus_tag="PSLT046"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239473"
     gene            complement(38917..39405)
                     /locus_tag="PSLT047"
                     /db_xref="GeneID:1256191"
     CDS             complement(38917..39405)
                     /locus_tag="PSLT047"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490537.1"
                     /db_xref="GeneID:1256191"
                     /translation="MPQDESVVKRAREYFFRHHRYTEEDLESDYQAELCNYRDDTWEA
                     PQRAARLSAAVKRYKTYEMLYFFFQIADEAGLDYTPLVVKRLCAHLFDRQGSQNIIVD
                     IFGQKGRMHRSHDSDPDIIAAVAERYRQQAEDHWQTVLKNIGRVKQDYQKNQNRQKGA
                     GD"
     gene            39664..40779
                     /gene="tlpA"
                     /locus_tag="PSLT048"
                     /db_xref="GeneID:1256190"
     CDS             39664..40779
                     /gene="tlpA"
                     /locus_tag="PSLT048"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-helical coiled coil protein"
                     /protein_id="NP_490538.1"
                     /db_xref="GeneID:1256190"
                     /translation="MRPATYEPEQIIEAGLALQAEGRNITGFALRNQVGGGNPTRLRQ
                     IWDEYQASQSTVVTEPVAELPVEVAEEVKAVSAALSERITQLATELNDKAVRAAERRV
                     AEVTRAAGEQTAQAERELADAAQTVDDLEEKLDELQDRYDSLTLALESERSLRQQHDV
                     EMAQLKERLAAAEENTRQREERYQEQKTVLQDALNAEQAQHKNTREDLQKRLEQISAE
                     ANARTEELKSERDKVNTLLTRLESQENALASERQQHLATRETLQQRLEQAIADTQARA
                     GEIALERDRVSSLTARLESQEKASSEQLVRMGSEIASLTERCTQLENQRDDARLETMG
                     EKETVAALRGEAEALKRQNQSLMAALSGNKQTGGQNA"
     misc_feature    39685..40044
                     /gene="tlpA"
                     /locus_tag="PSLT048"
                     /note="Plasmid replication region DNA-binding N-term;
                     Region: KfrA_N; pfam11740"
                     /db_xref="CDD:314581"
     misc_feature    <39994..>40731
                     /gene="tlpA"
                     /locus_tag="PSLT048"
                     /note="RecF/RecN/SMC N terminal domain; Region: SMC_N;
                     cl25732"
                     /db_xref="CDD:330553"
     gene            40865..41281
                     /locus_tag="PSLT049"
                     /db_xref="GeneID:1256189"
     CDS             40865..41281
                     /locus_tag="PSLT049"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA polymerase III epsilon subunit
                     (3'-5' exonuclease)"
                     /protein_id="NP_490539.1"
                     /db_xref="GeneID:1256189"
                     /translation="MKPAPGAEPVRMYKSPYGGKYGVWRLADCVPMRAKRPQTEKQRL
                     ASTRLGLQARMKSERGRFAMLAHTWLALGPVFLDTETTGLDAGAQALEIGLVNARGER
                     IFETRLKPTVGIDPAAAAVQIVTEPYRFPVLSVRLA"
     misc_feature    41087..>41242
                     /locus_tag="PSLT049"
                     /note="DnaQ-like (or DEDD) 3'-5' exonuclease domain
                     superfamily; Region: DnaQ_like_exo; cl10012"
                     /db_xref="CDD:324557"
     gene            complement(40975..41301)
                     /locus_tag="PSLT050"
                     /db_xref="GeneID:30522293"
     CDS             complement(40975..41301)
                     /locus_tag="PSLT050"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490540.1"
                     /db_xref="GeneID:30522293"
                     /translation="MSHPDPAQASLTDSTGKRYGSVTICTAAAAGSMPTVGFRRVSNI
                     LSPRAFTRPISSACAPASSPVVSVSRKTGPSANQVCASMANLPRSLFIRACRPRRVLA
                     SRCFSV"
     gene            complement(42455..43396)
                     /gene="samB"
                     /locus_tag="PSLT051"
                     /db_xref="GeneID:1256185"
     CDS             complement(42455..43396)
                     /gene="samB"
                     /locus_tag="PSLT051"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490541.1"
                     /db_xref="GeneID:1256185"
                     /translation="MKKKNTTPTPHDATFRQFLTQPDIARDFMELHLPAELRAICDLS
                     TLKLESGSFVEDDLRQYFSDVLYSLKTTAGDGYIHVLVEHQSTPDKHMAFRLIRYAVA
                     AMQRHLEAGHKKLPLVIPVLFYTGKRSPYPYSTRWLDEFDDTALADKLYSSAFPLVDV
                     TVIPDDEIAGHRSMAALTLLQKHIHQRDLAELVDRLAPILLAGYLSSSQVISLVHYIV
                     QAGETSDAEAFVRELAQRVPQHGDALMTIAQQLEQKGIEKGIQLGEQRGIEKGRSEGE
                     REATLKIARTMLQNCIDRNTVMKMTGLTEDDLAQIRH"
     misc_feature    complement(42461..43372)
                     /gene="samB"
                     /locus_tag="PSLT051"
                     /note="Predicted transposase YdaD [Replication,
                     recombination and repair]; Region: YadD; COG5464"
                     /db_xref="CDD:227751"
     gene            43811..45016
                     /gene="parA"
                     /locus_tag="PSLT052"
                     /db_xref="GeneID:1256186"
     CDS             43811..45016
                     /gene="parA"
                     /locus_tag="PSLT052"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partition protein A"
                     /protein_id="NP_490542.1"
                     /db_xref="GeneID:1256186"
                     /translation="MENIEQLRKVATRAGKLLTSLSESIRQQKEELKLTEFYQEYSKA
                     ALYKLPKLSKGSVEYAVAEMEASGYIFKKKPSGNTMKYAMTIQNVIDLYFHRKVPKYR
                     DRFDKAFTIFVCNLKGGGSKTVSTASLSHAFRAHPQLLFEDLRILAIDFDPQASLTMF
                     LSHENSVGLVENTAAQAMLQNVSREELLSDFIVSSIIPGVDVIPASIDDAFLAEGWKG
                     LCEEHLPGQNIHAVLKENIIDKLRYDYDFIFLDSGPHLDAFLKNCIGAADLMLTPLPP
                     ATVDFHSSLKFVASLPALIDSIEQDGHTCNLIGNVGFMSKILNKSDHKICHSQAKEVF
                     GADMLDMVLPRLDGFERCGETFDTVISANPATYDGSTEALKSAKSAAEDFAKAVFDRI
                     EFIRTNGGM"
     misc_feature    44129..44971
                     /gene="parA"
                     /locus_tag="PSLT052"
                     /note="Cellulose biosynthesis protein BcsQ [Cell
                     motility]; Region: BcsQ; COG1192"
                     /db_xref="CDD:224113"
     gene            45013..45990
                     /gene="parB"
                     /locus_tag="PSLT053"
                     /db_xref="GeneID:1256184"
     CDS             45013..45990
                     /gene="parB"
                     /locus_tag="PSLT053"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partition protein B"
                     /protein_id="NP_490543.1"
                     /db_xref="GeneID:1256184"
                     /translation="MMSNERRKTIGRQLNTQASMVEMTDTQRSQVFTLKTGRKITFRF
                     VRVPASDVESKTFVNQETNGRDQLALTRESLKSIIQTIKFQQFFPCIGIQQGERIEIL
                     DGSRRRASAIYIRTGLDVMVTNELLSADEARHLAKDIQTAKEHNLREIGLRLMALKES
                     GFNQKEIAELEGLSQAKVTRALQAAAVPQELISLFPVQSELSFSDYKILLEVNEKLSE
                     KGLTSEGLIQSVSDQHDAILSDYERPDDEQKSSILKLISQASQALIAPPPKEKSVISA
                     LWTFEEKDKFARKRVKGRTLTYEFSRMSKVVQDELDKAINEVLERNLSQ"
     misc_feature    45151..45666
                     /gene="parB"
                     /locus_tag="PSLT053"
                     /note="Chromosome segregation protein Spo0J, contains
                     ParB-like nuclease domain [Cell cycle control, cell
                     division, chromosome partitioning]; Region: Spo0J;
                     cl26722"
                     /db_xref="CDD:331543"
     misc_feature    45595..45972
                     /gene="parB"
                     /locus_tag="PSLT053"
                     /note="ParB family; Region: ParB; pfam08775"
                     /db_xref="CDD:312346"
     gene            complement(46072..47346)
                     /gene="samB"
                     /locus_tag="PSLT054"
                     /gene_synonym="samA"
                     /db_xref="GeneID:1256183"
     CDS             complement(46072..47346)
                     /gene="samB"
                     /locus_tag="PSLT054"
                     /gene_synonym="samA"
                     /codon_start=1
                     /transl_table=11
                     /product="mutagenesis by UV and mutagens; related to umuDC
                     operon"
                     /protein_id="NP_490544.1"
                     /db_xref="GeneID:1256183"
                     /translation="MFALADVNSFYASCEKVFRPDLRDRSVVVLSNNDGCVIARSAEA
                     KKLGIKMGVPWFQLRSAKFPEPVIAFSSNYALYASMSNRVMVHLEELAPRVEQYSIDE
                     MFLDIRGIDSCIDFEDFGRQLREHVRSGTGLTIGVGMGPTKTLAKSAQWASKEWSQFG
                     GVLALTLHNQKRTEKLLSLQPVEEIWGVGRRISKKLNTMGITTALQLARANPTFIRKN
                     FNVVLERTVRELNGESCISLEEAPPPKQQIVCSRSFGERVTTYEAMRQAVCQHAERAA
                     EKLRGERQFCRHIAVFVKTSPFAVTEPYYGNLASEKLLIPTQDTRDIIAAAVRALDRI
                     WVDGHRYAKAGCMLNDFTPTGVSQLNLFDEVQPRERSEQLMQVLDGINHPGKGKIWFA
                     GRGIAPEWQMKRELLSPAYTTRWADIPAAKLT"
     misc_feature    complement(46081..47346)
                     /gene="samB"
                     /locus_tag="PSLT054"
                     /gene_synonym="samA"
                     /note="DNA polymerase V subunit UmuC; Reviewed; Region:
                     umuC; PRK03609"
                     /db_xref="CDD:179607"
     misc_feature    complement(order(46885..46887,47041..47046,47212..47214,
                     47221..47223,47314..47319,47326..47331))
                     /gene="samB"
                     /locus_tag="PSLT054"
                     /gene_synonym="samA"
                     /note="active site"
                     /db_xref="CDD:176454"
     misc_feature    complement(order(46438..46440,46444..46458,46513..46515,
                     46594..46611,46684..46686,46771..46791,47041..47043,
                     47050..47052))
                     /gene="samB"
                     /locus_tag="PSLT054"
                     /gene_synonym="samA"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176454"
     gene            complement(47346..47768)
                     /gene="samA"
                     /locus_tag="PSLT055"
                     /db_xref="GeneID:1256182"
     CDS             complement(47346..47768)
                     /gene="samA"
                     /locus_tag="PSLT055"
                     /codon_start=1
                     /transl_table=11
                     /product="mutagenesis by UV and mutagens; related to umuDC
                     operon"
                     /protein_id="NP_490545.1"
                     /db_xref="GeneID:1256182"
                     /translation="MLLLVAPEQEPVQSTAPLFTERCPAGFPSPAADYTEEELDLNAY
                     CIRRPAATFFVRAIGDSMKEMGLHSGDLMVVDKAEKPMQGDIVIAETDGEFTVKRLQL
                     KPRIALLPINPAYPTLYPEELQIFGVVTAFIHKTRSTD"
     misc_feature    complement(47358..47765)
                     /gene="samA"
                     /locus_tag="PSLT055"
                     /note="The S24, S26 LexA/signal peptidase superfamily
                     contains LexA-related and type I signal peptidase
                     families. The S24 LexA protein domains include: the lambda
                     repressor CI/C2 family and related bacterial prophage
                     repressor proteins; LexA (EC 3.4.21.88), the...; Region:
                     Peptidase_S24_S26; cl10465"
                     /db_xref="CDD:324586"
     misc_feature    complement(order(47475..47477,47586..47588))
                     /gene="samA"
                     /locus_tag="PSLT055"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     gene            48279..48749
                     /locus_tag="PSLT056"
                     /db_xref="GeneID:1256180"
     CDS             48279..48749
                     /locus_tag="PSLT056"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490546.1"
                     /db_xref="GeneID:1256180"
                     /translation="MFRVTCIDLENGEFALYINGHYLSSEDGSGEKLYLGDILERLSR
                     LPGVTTETVERPVPDSDEWSWNDVADSVFPACITLSRNMTVAAFKQRLSRFPDDALCC
                     GTFWLASDFLALDSSLTEDDIDAAMELAQHCHDANDGFNWSHLQWAIDEVKRGG"
     gene            48742..49098
                     /locus_tag="PSLT057"
                     /db_xref="GeneID:1256181"
     CDS             48742..49098
                     /locus_tag="PSLT057"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490547.1"
                     /db_xref="GeneID:1256181"
                     /translation="MDNNSNINDTWLVGLSVDVNGTEMMVHYLVSATDLEHAEAGVLQ
                     MGRTWWPSLKREDDRHRWEYETGVVWFNSIILLDDVENSILRGLKFLDAWTVTGSTDA
                     PVLRDEWGNDWRDITR"
     gene            complement(49448..49860)
                     /locus_tag="PSLT058"
                     /db_xref="GeneID:1256179"
     gene            49480..50160
                     /locus_tag="PSLT059"
                     /db_xref="GeneID:1256178"
     CDS             49480..50160
                     /locus_tag="PSLT059"
                     /codon_start=1
                     /transl_table=11
                     /product="putative adenine-specific DNA methylase"
                     /protein_id="NP_490548.1"
                     /db_xref="GeneID:1256178"
                     /translation="MSRLILGNCVDIMSGFPERAVDFILTDPPYLVGFRDRSGRSIAG
                     DRTDEWLQPACNQMYRVLKKDALLVSFYGWNRVDRFMAAWKSAGFSVVGHLVFTKNYS
                     SKSAYVGYRHECAYVLAKGRPALPQNPLPDVLGWKYSGNRHHPTEKPVTSLQPLIESF
                     THTNAIVLDPFAGSASTCVAALQAGRRYIGIELMEQYHKAGIERLTAVQRAMQRPAAN
                     DVFYPEAA"
     misc_feature    49480..50157
                     /locus_tag="PSLT059"
                     /note="putative methylase; Provisional; Region: PRK13699"
                     /db_xref="CDD:184255"
     gene            50160..50381
                     /locus_tag="PSLT060"
                     /db_xref="GeneID:1256177"
     CDS             50160..50381
                     /locus_tag="PSLT060"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490549.1"
                     /db_xref="GeneID:1256177"
                     /translation="MNYSGHEKLRAEVAALANSMCDLRATLKVLEERYHWQRHGLTER
                     LAGQSLRRINTLLDEAYNESLMLNECFKD"
     gene            50922..51686
                     /locus_tag="PSLT061"
                     /db_xref="GeneID:1256176"
     CDS             50922..51686
                     /locus_tag="PSLT061"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="NP_490550.1"
                     /db_xref="GeneID:1256176"
                     /translation="MRNTLSTLIVRHGDNLLRRSGWPETVGVTQVAPGVVPGWLAVCG
                     VLSAAEILALTTHLCQPLNYGRAQLLTASAQRLAGTPVRLHLYPVQAYPHPATVRECT
                     EIRLPYAQEWLTTDEYADLLAFLKASADRVCEIVRQDTKRIAAALAPSGESRLMEKRI
                     GNWRLLADEYDHDNWLDEEDEDGLDKVLDAVLVRNARFCPVLLTLVNEPEEEIEAAGV
                     ITDCLRFPGEPNRRWLDRRVLRDVVNEARSFTGNIR"
     gene            52182..52616
                     /locus_tag="PSLT062"
                     /db_xref="GeneID:1256173"
     CDS             52182..52616
                     /locus_tag="PSLT062"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490551.1"
                     /db_xref="GeneID:1256173"
                     /translation="MQYSNQQRARVINVEESDRLSFLPYMFGNDFMLAELQLYALAKK
                     WMPEYNGGFWHFIRLPEGGGYMMPDCDRVHMINGENWFDRTVSADAAGIILTSLAINR
                     RCWTHHDCGNAALTRLYMLRDTQLWNHITFHPECNAIYAALD"
     misc_feature    52320..52613
                     /locus_tag="PSLT062"
                     /note="Antirestriction protein; Region: Antirestrict;
                     pfam03230"
                     /db_xref="CDD:308711"
     gene            52683..53117
                     /locus_tag="PSLT063"
                     /db_xref="GeneID:1256174"
     CDS             52683..53117
                     /locus_tag="PSLT063"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490552.1"
                     /db_xref="GeneID:1256174"
                     /translation="MYGTVSTICCDLLKVYENHEKIAVIIWCEGDVREMGAEFNPTAD
                     DIQAVLRAIGESDSDALWRDGIGQNFVEGVLRELVALRPPRQIAVPEDVLRTLLPLME
                     AGMNLPRYQTQDRAAEEETALDTLRYLLSTNIPAHNLTEGNY"
     misc_feature    52683..53033
                     /locus_tag="PSLT063"
                     /note="Protein of unknown function (DUF1380); Region:
                     DUF1380; pfam07128"
                     /db_xref="CDD:311216"
     gene            53353..53676
                     /locus_tag="PSLT064"
                     /db_xref="GeneID:1256172"
     CDS             53353..53676
                     /locus_tag="PSLT064"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="NP_490553.1"
                     /db_xref="GeneID:1256172"
                     /translation="MSGLNLAATTKEEQDKVAIDLVASGVVYKERLAMPVVAELVVRE
                     QPEHLREYFRARLEYLRNSRTRMPRNMPEKRMRLKNSAIPDAFCLSLAGFYACRVMFF
                     SGRGV"
     misc_feature    53359..53562
                     /locus_tag="PSLT064"
                     /note="DNA polymerase III, theta subunit; Region:
                     DNA_pol3_theta; pfam06440"
                     /db_xref="CDD:310798"
     gene            53906..54186
                     /locus_tag="PSLT065"
                     /db_xref="GeneID:1256171"
     gene            54395..54913
                     /gene="ssbB"
                     /locus_tag="PSLT066"
                     /db_xref="GeneID:1256170"
     CDS             54395..54913
                     /gene="ssbB"
                     /locus_tag="PSLT066"
                     /codon_start=1
                     /transl_table=11
                     /product="single-strand binding protein"
                     /protein_id="NP_490554.1"
                     /db_xref="GeneID:1256170"
                     /translation="MAARGVNKVILVGHIGQDPEVRYMPNGGAVANLTLATSETWRVR
                     QDGEMREHTEWHRVVVFGKLAEIASEYLRKGAQVYIEGQLRTRKWTDQSGQDKYTTEV
                     IVNVGGTMQMLGRHNSQPQQEPQTPPTAAKGEGKAVKGAGNAAKGKNAAAPQQPPAQP
                     DPAYDFDDDIPF"
     misc_feature    54395..54910
                     /gene="ssbB"
                     /locus_tag="PSLT066"
                     /note="Replication protein A, class 2b aminoacyl-tRNA
                     synthetases, and related proteins with
                     oligonucleotide/oligosaccharide (OB) fold; Region:
                     RPA_2b-aaRSs_OBF_like; cl09930"
                     /db_xref="CDD:324543"
     misc_feature    order(54419..54430,54503..54511,54554..54556,54560..54562,
                     54623..54625,54650..54652,54683..54685,54692..54694)
                     /gene="ssbB"
                     /locus_tag="PSLT066"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(54434..54442,54458..54460,54488..54490,54509..54514,
                     54548..54553,54557..54559,54563..54565,54569..54571,
                     54575..54577,54614..54619,54641..54643,54647..54649,
                     54653..54658,54695..54697,54701..54703)
                     /gene="ssbB"
                     /locus_tag="PSLT066"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     gene            54968..55210
                     /locus_tag="PSLT067"
                     /db_xref="GeneID:1256168"
     CDS             54968..55210
                     /locus_tag="PSLT067"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490555.1"
                     /db_xref="GeneID:1256168"
                     /translation="MTDNIMSPLKSLPDGTFTHEQAEAVAAQYQNVAIEDDQGTHLRL
                     VVRKDGEMVWRGWNFEPGGEYWLNRCIESHGIRKTQ"
     misc_feature    54998..55201
                     /locus_tag="PSLT067"
                     /note="Bacterial protein of unknown function (DUF905);
                     Region: DUF905; pfam06006"
                     /db_xref="CDD:310532"
     gene            55279..57276
                     /locus_tag="PSLT068"
                     /db_xref="GeneID:1256169"
     CDS             55279..57276
                     /locus_tag="PSLT068"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ParB-like nuclease domain"
                     /protein_id="NP_490556.1"
                     /db_xref="GeneID:1256169"
                     /translation="MSVTNSNAKSAVKTSRKAKNAASASNTVLSAVLAQTEEQHVPLS
                     ALVKSPQNVRIVPYSTESVRELADSIKGIGLLQNLVVHALPDGLYGVAAGGRRLAAMN
                     LLATENTIHPDWPVRVKVVPDNLATAASLTENGQHLEMHPAEQIAGFRAMAAEGKTPA
                     QTGDLLGYSPRHVQRMLKLAGLAPVILEALAADKITTEHCQALALEDNPDRQVQVYEA
                     ACREGWNNKPEVRVIRNLITDSQVSTLNNSKYTFVGEKAFSGDEIRADLFSDEQGGFV
                     DKLALDTALLEKLQWVAECLKEAEGWAWCAGRMEPVSRYGEDTEVYRIQDEPDAVYTE
                     QEQQRLDELQELYDENQTASDETDTMESEIEAIECAAQLRAWTLEMRAQSGVVVSWRH
                     GEICVQRGVSLREQSETEDEPDQVPVYERQPEPVDEISVPLLTRMCAERTLSVQAALM
                     QQPEKSLALLAWTLCLNVFSSGAYNRPAQISLNCKHYSLTKDAPPGESGVAFVTLSQE
                     GKRLETLLPEGWTQDFTTFFTLSAKDLTALLSFCTACSLDGMQMRGAGGTTRSPLDKL
                     EIALAFHLRDWWQPTKADFFTGLKKPQIIAALNEAGLTGAARDAEKMKKGDAAELAED
                     KMRDNRWVPVWMRAPDAENDVSDTENGSADADSHHTLPDAA"
     misc_feature    55393..55995
                     /locus_tag="PSLT068"
                     /note="Chromosome segregation protein Spo0J, contains
                     ParB-like nuclease domain [Cell cycle control, cell
                     division, chromosome partitioning]; Region: Spo0J;
                     COG1475"
                     /db_xref="CDD:224392"
     gene            57316..57750
                     /gene="psiB"
                     /locus_tag="PSLT069"
                     /db_xref="GeneID:1256167"
     CDS             57316..57750
                     /gene="psiB"
                     /locus_tag="PSLT069"
                     /codon_start=1
                     /transl_table=11
                     /product="Plasmid SOS inhibition"
                     /protein_id="NP_490557.1"
                     /db_xref="GeneID:1256167"
                     /translation="MMRNIITPAVLSTMIPQEFEDWRDGGEDLRRELTHAAMRDLTCP
                     AGWDMNGEYRSEFGGFFPVQIRFTPSRGNFSLAVCSPGDISPSWMVVFIPVSGRPFSV
                     IRTLPAWSPEVITHTLSLVAHLDADGYSQASIISVLAMEGAA"
     misc_feature    57319..57747
                     /gene="psiB"
                     /locus_tag="PSLT069"
                     /note="plasmid SOS inhibition protein B; Provisional;
                     Region: psiB; PRK13701"
                     /db_xref="CDD:237477"
     gene            57747..58484
                     /gene="psiA"
                     /locus_tag="PSLT070"
                     /db_xref="GeneID:1256166"
     CDS             57747..58484
                     /gene="psiA"
                     /locus_tag="PSLT070"
                     /codon_start=1
                     /transl_table=11
                     /product="Plasmid SOS inhibition"
                     /protein_id="NP_490558.1"
                     /db_xref="GeneID:1256166"
                     /translation="MIHSSHALVTLKPARQAALQAILTVEESRRRGARLPALPHARTF
                     LRVLSGSSRINTTVAQRIPGLNWEPKNRLTSLKQVEEALDRLISSHGEYCPLPLSVDV
                     QAELFPEVIHARTDRRMQREKIAFNRKMRREEKALEHAWLLRQNLLGQAMTELNFQSP
                     ETVNAWYTRWADEFDARELAQGFWQWRTRFTSLTSLDWLRDSDEPLYNVMYEIWFIVR
                     ENPVYVREAERWQVPNKLTNRRPGRLP"
     misc_feature    57750..58454
                     /gene="psiA"
                     /locus_tag="PSLT070"
                     /note="PsiA protein; Region: PsiA; pfam06952"
                     /db_xref="CDD:311103"
     gene            58994..59812
                     /locus_tag="PSLT071"
                     /db_xref="GeneID:1256165"
     gene            complement(60123..60593)
                     /gene="finP"
                     /locus_tag="PSLT072"
                     /db_xref="GeneID:1256164"
     CDS             complement(60123..60593)
                     /gene="finP"
                     /locus_tag="PSLT072"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transglycosylase"
                     /protein_id="NP_490559.1"
                     /db_xref="GeneID:1256164"
                     /translation="MYKWLLSVLLVLMSTVVHAADCFDLAGRDYKIDPDLLRAISWKE
                     SRNRANAVGINPVTGYGSGLMQVDSQHFNELARYGIKPEQLVSDPCLNIYTGAYYLAI
                     AFRKWGVSWTAVGAYNAGFKKTPLQDARRLDYATDVHRIWIAIKQSKTRQTPAR"
     misc_feature    complement(60129..60593)
                     /gene="finP"
                     /locus_tag="PSLT072"
                     /note="lysozyme_like domain. This contains several members
                     including Soluble Lytic Transglycosylases (SLT), Goose
                     Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes
                     (HEWL), chitinases, bacteriophage lambda lysozymes,
                     endolysins, autolysins, and chitosanases; Region:
                     lysozyme_like; cl00222"
                     /db_xref="CDD:320832"
     misc_feature    complement(order(60243..60245,60297..60299,60390..60392,
                     60462..60464))
                     /gene="finP"
                     /locus_tag="PSLT072"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    complement(60462..60464)
                     /gene="finP"
                     /locus_tag="PSLT072"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            61008..61388
                     /gene="traM"
                     /locus_tag="PSLT073"
                     /db_xref="GeneID:1256163"
     CDS             61008..61388
                     /gene="traM"
                     /locus_tag="PSLT073"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: mating signal"
                     /protein_id="NP_490560.1"
                     /db_xref="GeneID:1256163"
                     /translation="MAKVNVYISNEVHNKITAIVEKRRQEGARDKDISFSGTSSMLLE
                     LGLRVYEAQMERKESPFNQTEFNKVLLENVLKTQSSVAKILGIGSLSPHVAGNPKFEY
                     ANMVEDIKEKVSSEMERFFHENEE"
     misc_feature    61008..61385
                     /gene="traM"
                     /locus_tag="PSLT073"
                     /note="TraM protein, DNA-binding; Region: Tra_M;
                     pfam05261"
                     /db_xref="CDD:310111"
     misc_feature    order(61011..61031,61035..61037,61044..61046,61050..61055,
                     61113..61115,61122..61127,61131..61148,61152..61157,
                     61203..61274,61320..61322,61332..61337,61341..61346,
                     61353..61358,61365..61370)
                     /gene="traM"
                     /locus_tag="PSLT073"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:271351"
     misc_feature    order(61014..61016,61020..61031,61035..61037,61044..61046,
                     61107..61115)
                     /gene="traM"
                     /locus_tag="PSLT073"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271351"
     gene            complement(61455..61622)
                     /gene="finP"
                     /locus_tag="PSLT074"
                     /db_xref="GeneID:1256162"
     misc_RNA        complement(61455..61622)
                     /gene="finP"
                     /locus_tag="PSLT074"
                     /product="antisense RNA determining region"
                     /db_xref="GeneID:1256162"
     gene            61581..62267
                     /gene="traJ"
                     /locus_tag="PSLT075"
                     /db_xref="GeneID:1256127"
     CDS             61581..62267
                     /gene="traJ"
                     /locus_tag="PSLT075"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: regulation"
                     /protein_id="NP_490561.1"
                     /db_xref="GeneID:1256127"
                     /translation="MCPTDRRERTLASQSVNKYILSIQDIYKNSPVPVCVRNQSRKII
                     YANGAFIELFSKEDQPLSGDSYNRYGVEVFLSSLELECQSLGHGAAFCRRFNFHGEIY
                     QIRMENISFDNNEIIVLWQINLFPDHPFFSPDTKTKNLSLSGTESFWNELSPGTLLVF
                     SFYTLGVSHANIAKELGITIRASEDRIKPVKRKIKRNYESFDSFRISCISKGKIISLI
                     DIIREFYCVK"
     misc_feature    61581..62249
                     /gene="traJ"
                     /locus_tag="PSLT075"
                     /note="conjugal transfer transcriptional regulator TraJ;
                     Provisional; Region: PRK13719"
                     /db_xref="CDD:237479"
     gene            62268..62588
                     /gene="traY"
                     /locus_tag="PSLT076"
                     /db_xref="GeneID:1256161"
     CDS             62268..62588
                     /gene="traY"
                     /locus_tag="PSLT076"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: oriT nicking"
                     /protein_id="NP_490562.1"
                     /db_xref="GeneID:1256161"
                     /translation="MLIKARHFWRVFFCRFPCNHKFISRVSRGEFVRRRNAREGISRT
                     VSVYLDEDTNNRLIRAKDRSGRSKTIEVQIRLRDHLKRYPDFYNEEIFREVIEETEST
                     FKEI"
     misc_feature    62364..62570
                     /gene="traY"
                     /locus_tag="PSLT076"
                     /note="conjugal transfer protein TraY; Provisional;
                     Region: PRK13740"
                     /db_xref="CDD:184292"
     gene            62630..62992
                     /gene="traA"
                     /locus_tag="PSLT077"
                     /db_xref="GeneID:1256159"
     CDS             62630..62992
                     /gene="traA"
                     /locus_tag="PSLT077"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: fimbrial subunit"
                     /protein_id="NP_490563.1"
                     /db_xref="GeneID:1256159"
                     /translation="MSAILSVQGASAPVKKKSFLSTFTRLNLLKLARAVIPAAVLIFF
                     FPQLAMAAGGSQDLMASGNGTVKATFGKDSSAVKWVILAEVLVGAVMYMMTKNVKFLA
                     GFAIISVFIAVGMAVVGL"
     misc_feature    62630..62989
                     /gene="traA"
                     /locus_tag="PSLT077"
                     /note="conjugal transfer pilin subunit TraA; Provisional;
                     Region: PRK13734"
                     /db_xref="CDD:237485"
     gene            63007..63318
                     /gene="traL"
                     /locus_tag="PSLT078"
                     /db_xref="GeneID:1256160"
     CDS             63007..63318
                     /gene="traL"
                     /locus_tag="PSLT078"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: assembly"
                     /protein_id="NP_490564.1"
                     /db_xref="GeneID:1256160"
                     /translation="MSGDENKLRKYRFPETLTNQSRWFGLPVDELIPAAVCIGWGLMT
                     SKQLFGISAAVLVYFGIRKLKKGRGSSWLRDLIYWYMPTALLRGIFHNVPDSCFRQWI
                     K"
     misc_feature    63007..63315
                     /gene="traL"
                     /locus_tag="PSLT078"
                     /note="conjugal transfer pilus assembly protein TraL;
                     Provisional; Region: PRK13707"
                     /db_xref="CDD:184263"
     gene            63340..63906
                     /gene="traE"
                     /locus_tag="PSLT079"
                     /db_xref="GeneID:1256158"
     CDS             63340..63906
                     /gene="traE"
                     /locus_tag="PSLT079"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: assembly"
                     /protein_id="NP_490565.1"
                     /db_xref="GeneID:1256158"
                     /translation="MEHGARLSTSRVLAISFIFMALLIVLSLAVNVIQGINNYRLQNE
                     QRTAVTPMGFNASFAVSQNSADASYLQQMALSFIALRLNVSSETVDASHQALLQYIRS
                     GAQNQMKVILAEEARRIKADNVNSAFFQTSVRVWPQYGRVEIRGVLKTWIGDSKPFTD
                     IKHYILILKRENGVTWLDNFGETDDEKK"
     misc_feature    63340..63903
                     /gene="traE"
                     /locus_tag="PSLT079"
                     /note="conjugal transfer pilus assembly protein TraE;
                     Provisional; Region: PRK13726"
                     /db_xref="CDD:184278"
     gene            63893..64633
                     /gene="traK"
                     /locus_tag="PSLT080"
                     /db_xref="GeneID:1256157"
     CDS             63893..64633
                     /gene="traK"
                     /locus_tag="PSLT080"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: assembly"
                     /protein_id="NP_490566.1"
                     /db_xref="GeneID:1256157"
                     /translation="MRKNKPYKPFLLAAGWLFSGLVMASGSGTLAPVVVSLANGGQAN
                     IAVSNTDPNLFTVPGDRITAVSGLDGMLTNSEQTGTGGVVVATVSKKPFTFILETERG
                     LNFSVRAVPRAGAGRTVQLVSDLRGTGEEAGAWETATPYESLLVAVSQAVRGGTLPAG
                     WYQIPVTKEALQAPAGLSARADAVWTGNHLKLVRFAVENKMPSALNIRESDFWQPGTR
                     AVMFSQPVSQILAGARMDVYVIRDGEGN"
     misc_feature    63893..64630
                     /gene="traK"
                     /locus_tag="PSLT080"
                     /note="conjugal transfer protein TraK; Provisional;
                     Region: PRK13736"
                     /db_xref="CDD:237486"
     gene            64633..66054
                     /gene="traB"
                     /locus_tag="PSLT081"
                     /db_xref="GeneID:1256155"
     CDS             64633..66054
                     /gene="traB"
                     /locus_tag="PSLT081"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: assembly"
                     /protein_id="NP_490567.1"
                     /db_xref="GeneID:1256155"
                     /translation="MASINTVVKRKQYIWLGIVAVGAAAAIGGGLYLSDVDMSGNGTA
                     AEQEPVPDMTGVVDTTFDDKVRQHATTEMQVTAAQMQKQYDEIRHELDVLNKQRGDDQ
                     RRIEKLGQDNAALAEQVKALGANPVTTTGEPVPHTPVSPPGPEGEPQPGNTPMTFPPQ
                     GAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKTFSYDAAAKKGPSLPYIPSGSFA
                     KTMLIEGADANASVTGNESTVPMQLRITGPVEMPNSKTYDLTGCFVGLEAWGDVSSER
                     AIVRTRNISCLKDGKTIDMSVKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIG
                     QGMERASQQAVGLGATATYGAGDVFRMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIG
                     AGNEVTVVFQDGFQLKTVEEMAQEQARHRKEDENAESPVPIPPSVDSHMNGFNTDQML
                     KQLGDLNPQQFMSGSQGGHVNGK"
     misc_feature    64633..66051
                     /gene="traB"
                     /locus_tag="PSLT081"
                     /note="conjugal transfer pilus assembly protein TraB;
                     Provisional; Region: PRK13729"
                     /db_xref="CDD:184281"
     gene            66044..66640
                     /gene="traP"
                     /locus_tag="PSLT082"
                     /db_xref="GeneID:1256156"
     CDS             66044..66640
                     /gene="traP"
                     /locus_tag="PSLT082"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer"
                     /protein_id="NP_490568.1"
                     /db_xref="GeneID:1256156"
                     /translation="MGNNRLNNLKGRAVLYRIAGLLRWLIWGVKYAVIWPLATTAIVV
                     ILLFRTGDTTPGQQMAQEIGRVRAMAPSGMFPVRDCPDPAFTVSSPVPLNLTENCPLK
                     ITGAEEYAADIDQSLSQTGWLLWGMLALLYTAVAVMIGDRPYRHNPLTYAYDTATNNL
                     KYIDKENEIRTLKVNTNGQVSYSGNKEAKKEGDKNEHT"
     misc_feature    66044..66637
                     /gene="traP"
                     /locus_tag="PSLT082"
                     /note="TraP protein; Region: TraP; pfam07296"
                     /db_xref="CDD:254144"
     gene            66618..66863
                     /gene="trbD"
                     /locus_tag="PSLT083"
                     /db_xref="GeneID:1256154"
     CDS             66618..66863
                     /gene="trbD"
                     /locus_tag="PSLT083"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer protein"
                     /protein_id="NP_490569.1"
                     /db_xref="GeneID:1256154"
                     /translation="MIKMNIRNVISVPDESVQDDFVKYVISNCTTKIILSGRREYNFS
                     RQEYNFSVTGMPGAGKTCVLSELIKKLLRENKKGAKS"
     misc_feature    66618..66788
                     /gene="trbD"
                     /locus_tag="PSLT083"
                     /note="Protein of unknown function (DUF2689); Region:
                     DUF2689; cl23902"
                     /db_xref="CDD:329161"
     misc_feature    66771..>66854
                     /gene="trbD"
                     /locus_tag="PSLT083"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:328724"
     gene            66860..67375
                     /gene="traV"
                     /locus_tag="PSLT084"
                     /db_xref="GeneID:1256153"
     CDS             66860..67375
                     /gene="traV"
                     /locus_tag="PSLT084"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: assembly"
                     /protein_id="NP_490570.1"
                     /db_xref="GeneID:1256153"
                     /translation="MNRISCLIPFCGALLLSGCAGTNSDFECTATTSDTCMTMEQANE
                     KAKRQEQPETVKPGAVSLPRLAEGNFRTTPVQVVSTVTLPVAKTVAAPRSGQKPPAPH
                     PLFTAAREVKPVAAVSTVSPVVPPRPLRTREQTAALWIAPYIDSQDIYHQPSGVFFVI
                     KPSVWGKPRIN"
     misc_feature    66860..67372
                     /gene="traV"
                     /locus_tag="PSLT084"
                     /note="conjugal transfer protein TraV; Provisional;
                     Region: PRK13733"
                     /db_xref="CDD:184285"
     gene            67510..67731
                     /gene="traR"
                     /locus_tag="PSLT085"
                     /db_xref="GeneID:1256151"
     CDS             67510..67731
                     /gene="traR"
                     /locus_tag="PSLT085"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer"
                     /protein_id="NP_490571.1"
                     /db_xref="GeneID:1256151"
                     /translation="MSDEADEAYSVTEQLTVTGINRIRQKVNRKGIPVYRCEACGNPI
                     PEARRKIFPGVTLCVECQSFLEKQGRHYA"
     misc_feature    67510..67728
                     /gene="traR"
                     /locus_tag="PSLT085"
                     /note="conjugal transfer protein TraR; Provisional;
                     Region: PRK13715"
                     /db_xref="CDD:184270"
     gene            67724..68191
                     /locus_tag="PSLT087"
                     /db_xref="GeneID:1256152"
     CDS             67724..68191
                     /locus_tag="PSLT087"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer protein"
                     /protein_id="NP_490572.1"
                     /db_xref="GeneID:1256152"
                     /translation="MHKSDAEKMESIIDKHDRIYRRQVRVFKNLGFLSIITAVLSVIT
                     ALFSTSLLLKYTLCVVICVCLIYLVFMFFCLDRYIALSRQTLLWLLRRVEDTADVRRE
                     LLRRLLSGKTLTGRDEDDILRLWWESSNEVEELATRQREQDAIRKFVGGDKSE"
     gene            68587..71235
                     /gene="traC"
                     /locus_tag="PSLT088"
                     /db_xref="GeneID:1256150"
     CDS             68587..71235
                     /gene="traC"
                     /locus_tag="PSLT088"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: assembly"
                     /protein_id="NP_490573.1"
                     /db_xref="GeneID:1256150"
                     /translation="MKNLLDTVTQAANSLLTALKLPDESAQANQILGEMSFPQFSRLL
                     PYRDYNQESGLFMNDATMGFMLEATPVNGANETIALSLDHLLRTKLPRGIPLCVHLMS
                     SQLVGERIEYGLRKFSWSGEQAERFNAITRAYYMKAAETHFPLPEGMNLPLTLRHYRV
                     FISYCAPSRKKSRADILEMENLVKIIRASLQGAYISTQTVDAKAFINIVGEMINHNPE
                     SIHPTRRRLDPYSDLNYQCVDDSFDLKVRQDYLTLGLRDNGKNSTARIMSFHLARNPE
                     IAFLWNSADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSY
                     AKWFPSVEKEAKEWGDLRQRLASNQSSVVSYFFNITAFCRDNKETALETEQDILNSFR
                     KNGFELISPRFNHMRNFLACLPFMAGKGLFKQLKEAGVVQRAESFNVTNLMPLVADNP
                     LTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGAGKTGLIQPLIRSVLDSGG
                     FAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITNIDQSAERIRDQLSVMASPNG
                     NLDEVHEGLLLQAVRAAWLTKKNRARIDDVVDFLENARTSEQYAESPGIRSRLDEMIV
                     LLNQYTAAGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENRM
                     YRTPRNLKKLNVIDEGWRLLDFKNRKVGDFIEKGYRTARRHTGAYITITQNIVDFDSD
                     KASSAARAAWGNSSYKIILKQSAKEFAKYNQLYPDQFPQLHREMIEKFGAAKDQWFSS
                     FLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGLSIHEAVWQLAWKKSGP
                     EMASLEAWLQEHETFRGTYEYKAETD"
     misc_feature    68677..71208
                     /gene="traC"
                     /locus_tag="PSLT088"
                     /note="conjugal transfer ATP-binding protein TraC;
                     Provisional; Region: PRK13721"
                     /db_xref="CDD:237480"
     gene            71210..71596
                     /gene="trbI"
                     /locus_tag="PSLT089"
                     /db_xref="GeneID:1256149"
     CDS             71210..71596
                     /gene="trbI"
                     /locus_tag="PSLT089"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer"
                     /protein_id="NP_490574.1"
                     /db_xref="GeneID:1256149"
                     /translation="MSTKQKQTDGTGARKRDGLWMIPGCLGMVVLNAAISYGIVRLNT
                     PVTVAFNMKQTVDAFFDSAGQKKLTEAQSKALSGRFNAALEASLQAWQREHHAVILVS
                     PAVVQGAPDITREIQQDIARRMRAEP"
     misc_feature    71210..71593
                     /gene="trbI"
                     /locus_tag="PSLT089"
                     /note="conjugal transfer protein TrbI; Provisional;
                     Region: PRK13717"
                     /db_xref="CDD:184271"
     gene            71593..72225
                     /gene="traW"
                     /locus_tag="PSLT091"
                     /db_xref="GeneID:1256147"
     CDS             71593..72225
                     /gene="traW"
                     /locus_tag="PSLT091"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: assembly"
                     /protein_id="NP_490575.1"
                     /db_xref="GeneID:1256147"
                     /translation="MKWRGLTALLIWGQSVAAADLGTWGDLWPVQEPDMLAVIMHRLE
                     ALQQSGEMGRRMEAFKERVIHNSLRPPAVPGIGRAEKYRSRLFDPSVRLAADIRDNEG
                     RVFARQGEVMNPLQYVPFNQTLYFINGDDPEQVSWMKRQTPPTLESKIILVQGSIPEM
                     EKALDSRIYFDQNGVLCQRLGIDQVPARVTAAKDGRFLKVEFIPAEDGRK"
     misc_feature    71596..72222
                     /gene="traW"
                     /locus_tag="PSLT091"
                     /note="conjugal transfer pilus assembly protein TraW;
                     Provisional; Region: PRK13738"
                     /db_xref="CDD:184290"
     gene            72222..73214
                     /gene="traU"
                     /locus_tag="PSLT092"
                     /db_xref="GeneID:1256148"
     CDS             72222..73214
                     /gene="traU"
                     /locus_tag="PSLT092"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: assembly"
                     /protein_id="NP_490576.1"
                     /db_xref="GeneID:1256148"
                     /translation="MKRYLWLCVLILLAGHVPTVSADAACESRFVNPITDICWSCIFP
                     LSLGSTKVSQGKLPDTANPSMPLQFCPAPPPIFKRPGLAIGYWEPMALTDVTRSPGCM
                     VNLGFSLPAFGKTAQGTAKKEDKQVNGAFYHVHWYKYPLTYWLNIITSMGCLEGGDLD
                     IAYLSEIDPTWTDSSLTSILNPEAVIFANPIAQGACAADAIASTFNKPLDVLFWCAGS
                     QGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGQIMETIGQNTAVCFEYPSPILP
                     KERWRYQMVNMYPDSGQCHPFGRSVMRWETGKNPPNTKKNFGYLMWRKRNCVFL"
     misc_feature    72222..73211
                     /gene="traU"
                     /locus_tag="PSLT092"
                     /note="conjugal transfer pilus assembly protein TraU;
                     Provisional; Region: PRK13737"
                     /db_xref="CDD:237487"
     gene            73233..73541
                     /locus_tag="PSLT093"
                     /db_xref="GeneID:1256146"
     CDS             73233..73541
                     /locus_tag="PSLT093"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer protein"
                     /protein_id="NP_490577.1"
                     /db_xref="GeneID:1256146"
                     /translation="MFMRIIYKRQHYLSVIRWGAVAVVQVLNESVKLFPFALVMFALM
                     AFYFLPERIISDVVNSWMETDTTGKISLIRLYLEVTFMLSLESSSLLFMYRGKRCTGK
                     "
     gene            73526..74164
                     /gene="trbC"
                     /locus_tag="PSLT094"
                     /db_xref="GeneID:1256145"
     CDS             73526..74164
                     /gene="trbC"
                     /locus_tag="PSLT094"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: assembly"
                     /protein_id="NP_490578.1"
                     /db_xref="GeneID:1256145"
                     /translation="MHRKIKYLAGLIMVISGTVSAGGVANTPENRQFLKQQEELSRQL
                     RDRPDAELKAWADRQIQANPLVQSDRHFLDDLARKQQTSQADKPEQGAVYFISFSIPE
                     EGLKRMLGETRRYGIPATLRGMRDNDLKATADAVLSLVKDGATDGVQIDPTLFTKYDI
                     RSVPTLVVYCRQGYDVIRGNLRVKQALEKVVTAGDCRQVAAGLLDGAGDKPQ"
     misc_feature    73526..74161
                     /gene="trbC"
                     /locus_tag="PSLT094"
                     /note="conjugal transfer pilus assembly protein TrbC;
                     Provisional; Region: PRK13730"
                     /db_xref="CDD:184282"
     gene            74617..76443
                     /gene="traN"
                     /locus_tag="PSLT095"
                     /db_xref="GeneID:1256144"
     CDS             74617..76443
                     /gene="traN"
                     /locus_tag="PSLT095"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: aggregate stability"
                     /protein_id="NP_490579.1"
                     /db_xref="GeneID:1256144"
                     /translation="MKRMLPLFLLLAAGQAQADSNSDYRAGSDFAHQIKGQGTGSIRN
                     FNPQESIPGYNANPDETKYYGGVTAGGDSGLKNDGTTQWATGETGKTITESFMNKPKD
                     ILSPDAPFIEKGRDVVNRADSIVGNTGQQCSAQEINRSEFTNYTCERDTTVEEYCTRT
                     ATITGDWRETTEVRTYTLTAFSFSRSGKQIVFSVTVPEAGTISSASLNVITQNYLWNS
                     RAGFMNTIFNMTWGSTITLGGATGMMLSKGQILSGTSCSGNGSCTGTLDDRIFNELTS
                     GRTTFTLTLVMQVKDREWIPRVEWVESCPFNKADGVLKGTECSEPGGTKTGVMEGKPW
                     SLTEACWAYRDKYVTQSADNGTCQAYVDNPACTLATRQCAFYSGEGTCLHEYATYSCE
                     SKTSGKVMICGGDVFCLDGECDKAQSGKSNDFGEAVSQLAALAAAGKDVAALNGIDVR
                     AFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKTNKLTVSVGEFCS
                     KKVLGVCLEKKRSYCQFDSKLAQIVQQQGRNGQLHISFGSSKHPDCRGITVDELQQIK
                     FDQLDLTNFYEDLMNNQKIPDSGALTEKVKEQIADQLRQAGK"
     misc_feature    74626..76413
                     /gene="traN"
                     /locus_tag="PSLT095"
                     /note="type-F conjugative transfer system mating-pair
                     stabilization protein TraN; Region: TraN_Ftype; TIGR02750"
                     /db_xref="CDD:274281"
     gene            76454..76669
                     /gene="trbE"
                     /locus_tag="PSLT096"
                     /db_xref="GeneID:1256142"
     CDS             76454..76669
                     /gene="trbE"
                     /locus_tag="PSLT096"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer"
                     /protein_id="NP_490580.1"
                     /db_xref="GeneID:1256142"
                     /translation="MKIMSFLVRVVVTLIVISPAVYWSWDAVSTTTADDIMLAVLIIA
                     AYGLMFTLLFCFVNVLTKLLQHDNESS"
     misc_feature    76454..76666
                     /gene="trbE"
                     /locus_tag="PSLT096"
                     /note="Conjugal transfer protein TrbE; Region: TrbE;
                     cl23903"
                     /db_xref="CDD:329162"
     gene            76681..77430
                     /gene="traF"
                     /locus_tag="PSLT097"
                     /db_xref="GeneID:1256140"
     CDS             76681..77430
                     /gene="traF"
                     /locus_tag="PSLT097"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: assembly"
                     /protein_id="NP_490581.1"
                     /db_xref="GeneID:1256140"
                     /translation="MRKIQTVWVAALLCGSLTAYGKDAGWQWYNDPVKLPDPKTTDKS
                     AQVRQEPDIMQKLSALQTATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFSMSAK
                     KAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAISKLAEHYGIMFFYRGQDPIDG
                     QLAQVINGFRATYGLSVIPVTVDGVINPMLPDTRPDQGQAQRLGVKYFPAMMLVDPKQ
                     GSVRPLSYGFITQDDLAKQFLNVSEDFKPNF"
     misc_feature    76684..77427
                     /gene="traF"
                     /locus_tag="PSLT097"
                     /note="conjugal pilus assembly protein TraF; Provisional;
                     Region: PRK13703"
                     /db_xref="CDD:184259"
     gene            77644..77937
                     /gene="traQ"
                     /locus_tag="PSLT098"
                     /db_xref="GeneID:1256141"
     CDS             77644..77937
                     /gene="traQ"
                     /locus_tag="PSLT098"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: fimbrial synthesis"
                     /protein_id="NP_490582.1"
                     /db_xref="GeneID:1256141"
                     /translation="MRKYKLSLPLPDITGVWVFSLGVWFHIVGRLVYRKPWMAFFLAE
                     LIAIILVLSGAYRVLDAWIARVSREERALLEARQAAILAAEKEEKGDKSHVSQ"
     misc_feature    77644..77934
                     /gene="traQ"
                     /locus_tag="PSLT098"
                     /note="Type-F conjugative transfer system pilin chaperone
                     (TraQ); Region: TraQ; cl11516"
                     /db_xref="CDD:299758"
     gene            77924..78472
                     /gene="trbB"
                     /locus_tag="PSLT099"
                     /db_xref="GeneID:1256139"
     CDS             77924..78472
                     /gene="trbB"
                     /locus_tag="PSLT099"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer"
                     /protein_id="NP_490583.1"
                     /db_xref="GeneID:1256139"
                     /translation="MSLNKALLFLLLLMGTGVNASTREEIERLYNPHGMAAPSGQKQP
                     ADTQGVQKVTPAPRWFRLSNGKTVNLADWKVVLFMQRSCPWCHQFDPVLKQVAQQYGF
                     SVFPYTLDGQGDAAFPEALPAPPEVMQTFFPNIPVATPTTFLVNVNTLEALPLLQGAT
                     DAAGFMARMDTVLQMYGEKHAG"
     misc_feature    77924..78469
                     /gene="trbB"
                     /locus_tag="PSLT099"
                     /note="conjugal transfer protein TrbB; Provisional;
                     Region: PRK13728"
                     /db_xref="CDD:237484"
     gene            78462..79844
                     /gene="traH"
                     /locus_tag="PSLT100"
                     /db_xref="GeneID:1256138"
     CDS             78462..79844
                     /gene="traH"
                     /locus_tag="PSLT100"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: assembly"
                     /protein_id="NP_490584.1"
                     /db_xref="GeneID:1256138"
                     /translation="MQGKTRIKPLFILCTALMTVAPAVSADVNSDMNQFFNKLGFASN
                     TTQPSVWQGQAAGYASGGSLYARTQVKNVQLVSMTLPDINAGCGGIDAYLGSFSFING
                     EQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQKMASDINSMNLSSCQAAQGI
                     VGGLFPKTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGQSDSVRDKASDKDKERVT
                     KNINIMWNALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEIMPLPARTTDRAIIRALM
                     EGGTAKIYHCNDSDKCLKVVADTPVTISRDNALKSQITKLLTSIQNKAVSDTPLDNKE
                     KGFISSTTIPVFKYLVDPQMLGVSTSMIYQLTDYIGYDILLQYIQELIQQARAMVATG
                     NYDEAVIEHITDNMNDATRQIASFQAQVQVQQDALLVVDRQMSYMRQQLSARMLSRYQ
                     NNYHFGGGAQ"
     misc_feature    78480..79832
                     /gene="traH"
                     /locus_tag="PSLT100"
                     /note="conjugal transfer pilus assembly protein TraH;
                     Provisional; Region: PRK13723"
                     /db_xref="CDD:237481"
     gene            79841..82663
                     /gene="traG"
                     /locus_tag="PSLT101"
                     /db_xref="GeneID:1256136"
     CDS             79841..82663
                     /gene="traG"
                     /locus_tag="PSLT101"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: assembly abd aggregate
                     stability"
                     /protein_id="NP_490585.1"
                     /db_xref="GeneID:1256136"
                     /translation="MNEVYVIAGGEWLSNNLNAIAAFMSTRTWDSIEKIALTLSVLAV
                     SVMWVQRHNVMDLLGWVAVFVLISLLVTIRTSVQIIDNSDLVRVYRVDNVPVGLALPL
                     SLTTRIGHAMVASYEMIFAQPDSVTYSKTGMLFGANLIVKSTDFLSRNPEIINLFQDY
                     VQNCVLGDIYLNHKYSLEELMESDDPYTLIFSRPSPLRGVYDKNNHFVTCKDASVTLK
                     DKLNLDTKTGGKTWHYYVQQIFGGRPDPDLLFRELVSDSYSYFYGSSQSASQIMRKNV
                     TMNALKEGITSNAARNGDTASLVNLATTSSMEKQRLSHVSIGYVTMRNLPMVQTILLG
                     IAIGIFPLLVLAAVFNKLTLSVLKGYVFALMWLQTWPLLYAILNSAMVFYAKQNGAPV
                     VLSELSQIQLKYSDLASTAGYLSAMIPPLSWMMVKGLGAGFSSVYSHFASSSISPTAS
                     AAAGVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMTYQTGSGATATQTRDGNMVMDA
                     SGAQSRLPVNINATRQIAAAQQEMAREASTQAESALHGFSSSIASAWNTLSQFGTNRG
                     SSDSVTSGADSTMSAQDSIMASRMRSAVESYAKAHNISNEQATQELAARSTRTSGGIY
                     GDASAEWGIRPKILGVGGGAGVKAGGRAGIDWSDDDTHQASSSSRSSQDVRHGVDAKA
                     TQDFKEASDYFTSRKVSESGSHTDNNADSRVDHLSAALNSAKQSYDQYTTNLTRSHEY
                     AEMASRTESMSGQMSEDLSQQFVNFVQKHAPQDAENILTNTSSPEVAERRRAMAWAFV
                     QEQVQPGVDNAWGEARGDIGSGMSTVSGGGDKQDVVADHQAHQATVEQRTRDSNISND
                     VKNQVDNMVTDYHSDINDTYGNIQGEEKTIDQQYSGLQKQYKTEALSQNNKYNEEKAA
                     QERMPGADSPEELMKRAKEYQDKHKQ"
     misc_feature    79841..82660
                     /gene="traG"
                     /locus_tag="PSLT101"
                     /note="conjugal transfer mating pair stabilization protein
                     TraG; Provisional; Region: PRK13735"
                     /db_xref="CDD:184287"
     gene            82679..83173
                     /gene="traS"
                     /locus_tag="PSLT102"
                     /db_xref="GeneID:1256137"
     CDS             82679..83173
                     /gene="traS"
                     /locus_tag="PSLT102"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: surface exclusion"
                     /protein_id="NP_490586.1"
                     /db_xref="GeneID:1256137"
                     /translation="MGMKNLAQIVLVTVVQFIACYLAEWGVAETGIILLFVLLWQGLF
                     IWLFIQIRKKNNISDEFKFSKGIWYVIMPVCSLLSPLLSLMIFIGGTLYELRRVSGCI
                     SIKEWVKCQLDDQYDEDRGLDFESVEYRQTTYYNPSTGYPMHGGVDSAGNTFGSRWQD
                     NNDR"
     misc_feature    82685..83170
                     /gene="traS"
                     /locus_tag="PSLT102"
                     /note="Plasmid conjugative transfer entry exclusion
                     protein TraS; Region: TraS; pfam10624"
                     /db_xref="CDD:287579"
     gene            83209..83940
                     /gene="traT"
                     /locus_tag="PSLT103"
                     /db_xref="GeneID:1256135"
     CDS             83209..83940
                     /gene="traT"
                     /locus_tag="PSLT103"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: surface exclusion"
                     /protein_id="NP_490587.1"
                     /db_xref="GeneID:1256135"
                     /translation="MKMKKIMMVTLVSSTLALSGCGAMSTAIKKRNLEVKTQMSQTIW
                     LDPSSERTVYLQVKNTSDKDMSDLQSLIAKDIQAKGYTVVTSPDKAYYWIQANVLKAD
                     KMDLRESQGWLNRGYEGALSGAALGAGITAYNSNSAGATLGVGLAAGLVGMAADAMVE
                     DINYTMITDVQISERTKATVTTDNVAALRQGTSGAKIQTSTETGNQHKYQTRVVSNAN
                     KVNLKFEEAKPVLEEQLAKSIANIL"
     misc_feature    83209..83937
                     /gene="traT"
                     /locus_tag="PSLT103"
                     /note="conjugal transfer surface exclusion protein TraT;
                     Provisional; Region: PRK13731"
                     /db_xref="CDD:184283"
     gene            84317..86560
                     /gene="traD"
                     /locus_tag="PSLT104"
                     /db_xref="GeneID:1256134"
     CDS             84317..86560
                     /gene="traD"
                     /locus_tag="PSLT104"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: DNA transport"
                     /protein_id="NP_490588.1"
                     /db_xref="GeneID:1256134"
                     /translation="MSFNAKDMTQGGQIASMRIRMFSQIANIIFYCLFIFFWILVGLV
                     LWVKLSWQTFVNGGIYWWCTTLEGMRDLIKSQPVYEIRYYGQTFRMNAAQVLQDKYTV
                     WCGEQLWSAFVLAACVALVICLITFFMTTWILGRQGKQQSEDDVTGGRQLTDNPKDVA
                     RMLKKDGKASDILIGDLPIIKDSEIQNFLLHGTVSTGKSEIIRRLANYARQRGDMVVM
                     YDRSCEFVKSYYDPSIDKILNPCDARCAAWDLWRECLTLPDFDNAANTLIPMGTKEDP
                     FWQGSGRTIFAEAAYLMRNDSDRSYSKLVDTLLSIKIEKLRTYLRDSPAANLVEEKIE
                     KTAISIRAVLTNYVKAVRYLQGIERNGEPFTIRDWMRGVREDQKNGWLFISSNADTHS
                     SLKPVISMWLSIAIRGLLAMGENRNRRVWFFCDELPTLHKLPDLVEIVPEARKFGGCY
                     VFGIQSSTQMEDIYGEKAAATLLDVMNTRAFFRSPSYKIADYVAHEIGEKEILKASEQ
                     YSYGADPVRDGVSTGKEMERVTLVSYSDIQSLPDLTCYVTLPGPYPAVKLALKYQERP
                     KVAPEFIPREMNPEAEARLSAVLAAREAEVRQMSSLFEPDTEAVAPTAAEAQAEQPQQ
                     PQQPQQPQQPQQPQQPQQPQQPQQPQQPQPTVVSDKKSAAAGTAVNTPAGGVGQELKM
                     KPEDEEQPLPPGINASGEVVDMAAYERWRQEQEVNTQQQMQRREEVNINVHRGHGKDE
                     PEPGDDF"
     misc_feature    84317..86557
                     /gene="traD"
                     /locus_tag="PSLT104"
                     /note="conjugal transfer protein TraD; Provisional;
                     Region: PRK13700"
                     /db_xref="CDD:184256"
     gene            86560..87279
                     /gene="trbH"
                     /locus_tag="PSLT105"
                     /db_xref="GeneID:1256132"
     CDS             86560..87279
                     /gene="trbH"
                     /locus_tag="PSLT105"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer"
                     /protein_id="NP_490589.1"
                     /db_xref="GeneID:1256132"
                     /translation="MAVSAPVLSSQSTHTFKLPGVVRDNNQSPAACVTGNHLIEWPDR
                     ASLTGKLCPDLPRMGGGRRVIIQNIKSGNKPLYHSEISFGHLAFFGAVNQLHQGDRAD
                     THSPLVQVKTLPDAGRFVFYRENADVSIQHKLQHQNDSRSCTEGCSRLSIKSALTLFP
                     SNHSSHDSPAGVIIRVRPTAITSTRFTFSGKATAFGSLTAWLRLLRNTLVSIMCLLTG
                     ICLTYIHYGFCDGICQRDIHL"
     gene            complement(86569..86967)
                     /locus_tag="PSLT106"
                     /db_xref="GeneID:1256133"
     CDS             complement(86569..86967)
                     /locus_tag="PSLT106"
                     /codon_start=1
                     /transl_table=11
                     /product="homologue of mvpA, Shigella flexneri"
                     /protein_id="NP_490590.1"
                     /db_xref="GeneID:1256133"
                     /translation="MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELI
                     YGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHTGQIRAELARQGRPVGPFDQMIA
                     GHARSRGLIVVTNNTREFERVGGLRTEDWS"
     misc_feature    complement(86572..86967)
                     /locus_tag="PSLT106"
                     /note="plasmid maintenance protein; Provisional; Region:
                     PRK13725"
                     /db_xref="CDD:184277"
     misc_feature    complement(order(86608..86610,86665..86670,86674..86679,
                     86683..86685,86704..86706,86713..86718,86725..86730,
                     86734..86736,86749..86757,86761..86763,86785..86787,
                     86794..86796,86830..86838,86842..86850,86854..86859,
                     86869..86871,86887..86889,86896..86898,86920..86928,
                     86932..86937,86944..86952))
                     /locus_tag="PSLT106"
                     /note="oligomeric interface; other site"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(86620..86622,86674..86676,86842..86844,
                     86947..86949))
                     /locus_tag="PSLT106"
                     /note="putative active site [active]"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(86671..86673,86677..86682,86713..86718,
                     86722..86730,86734..86739,86752..86754,86779..86781,
                     86788..86793,86833..86838,86842..86847,86854..86859))
                     /locus_tag="PSLT106"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:189051"
     gene            complement(86967..87197)
                     /locus_tag="PSLT107"
                     /db_xref="GeneID:1256131"
     CDS             complement(86967..87197)
                     /locus_tag="PSLT107"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="NP_490591.1"
                     /db_xref="GeneID:1256131"
                     /translation="MMETSVFLSNRSQAVRLPKAVALPENVKRVEVIAVGRTRIITPA
                     GESWDEWFDGNNVSADFMDNREQPSVQERESF"
     misc_feature    complement(86970..87194)
                     /locus_tag="PSLT107"
                     /note="Virulence-associated protein VagC (function
                     unknown) [Function unknown]; Region: VagC; COG4456"
                     /db_xref="CDD:226863"
     gene            87276..92534
                     /gene="traI"
                     /locus_tag="PSLT108"
                     /db_xref="GeneID:1256130"
     CDS             87276..92534
                     /gene="traI"
                     /locus_tag="PSLT108"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: oriT nicking-unwinding"
                     /protein_id="NP_490592.1"
                     /db_xref="GeneID:1256130"
                     /translation="MMSIAQVRSAGSAAGYYSDRDNYYVLGSMEERWAGKGAEQLGLQ
                     GTVDKEVFTRVLEGRLPDGADLSRQQDGGNKHRPGYDLTFSAPKSVSLMAMLAGDKRL
                     TEAHNQAVDIAVRQVEALASTRVMTDGQSETVLTGNLVMALFNHDTSRDQEPQLHTHA
                     VVVNVTQHDGEWKTLSSDKVGKTGFIENVYANQIAFGKIYRAVLKEKVEALGYETEVV
                     GKHGMWEMPGVPVEAFSSRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVKMAE
                     WMQTLKDTGFDISAYRESADRRAEIQAAQPVPSQEQPDIQQAVTQAIAGLSDRKVQFT
                     YTDVLARTVGMLPPEAGVIEKARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVR
                     ALSSDIMKQNRVTVHPEKSVPRTGSYSDAVSVLAQDRPSLAIISGQGGAAGQRERVAE
                     LTMMAREQGREVQIIVADRRSQTNLKQDERLSGELITGRRQLQEGMLFSPGSTVIVDQ
                     GEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKEAGVNSYRWQGRQQTP
                     ATVISEPDRNVRYARLAGDFVAAVKAGEESVAQVSGMREQAILAGMIRSELKTQGILG
                     QQDTMMTALSPVWLDSRNRYLRDMYREGMVMEQWNPEKRSHDRYVIDRVTAQSHSLTL
                     RDAQGETQMVRISALDSSWSLFRPEKMPVADGERLMVTGKIPGLRVSVGDRLQVSAVN
                     DGVMTVTVPGRAEPASLPVGDSPFTALKLENGWVETPGHSVSDSAKVFASVTQMAMDN
                     ATLNSLARSGRDVRLYSSLDETRTAEKLSRHPSFTVVSEQIKARAGEVSLETAISRQK
                     AGLHTPAQQAIHLALPVVESKNLAFSQVDLLTEAKSFAAEGTGFADLGREIDAQIKRG
                     DLLYVDVAKGYGTDLLISRASYDAEKSILHHILEGKEAVTPLMERVPGELMETLTSGQ
                     RAATRMILETKDRFTVVQGYAGVGKTTQFRAVMSAVNLLPESERPRVVGLGPTHRAVG
                     EMRSAGVEAQTLASFLHDTQLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAA
                     GGGRAVASGDTDQLQAIAPGQPFRLQQTRSAADVAIMKEIVRQTPELRDAVYSLINRD
                     VNKALSGLENVKPVQVPRLKGAWAPENSVTEFSRLQERELAKAAQEAEKKGEAFPDVP
                     VTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIQDALAKPGEQQVTVPVLTT
                     ANIRDGELRRLSTWEAHPGALALVDNVYHRIAGISKEDGLITLEDKAGNTRLISPREA
                     AAEGVTLYNPETIRVGAGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGKQTRV
                     VRPGQDRAEQHIDLAYAITAHSAQGASETFAIALEGTEGGRKQMAGFESAYVALSRMK
                     QHVQVYTDDRQGWVKAINSAEQKGTAHDVLEPKSEREMMNAERLFSTARELRDVAAGR
                     AVLRNAGLAQGDSRARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPLTTDDGAGLRG
                     FTGEGRVKGSEEAQFVALQGSRNGESLLAGSMQDGVRIARENPDSGVVVRIVGDGRPW
                     NPVAITGGRVWGDIPDSNVQPGAGNGEPVTAEILAQRQAEEAVRRETERRADEIVRKM
                     AEDKSDLPEEKTAQAVREIAGQEQDRMTPPEREPPLPESVLREPQRERETIREVAREN
                     RGRERLQQMEQEMVRDLQKEKTPGGD"
     misc_feature    87279..92516
                     /gene="traI"
                     /locus_tag="PSLT108"
                     /note="conjugal transfer nickase/helicase TraI;
                     Provisional; Region: PRK13709"
                     /db_xref="CDD:237478"
     gene            complement(89306..89875)
                     /locus_tag="PSLT109"
                     /db_xref="GeneID:30522294"
     gene            92554..93294
                     /gene="traX"
                     /locus_tag="PSLT110"
                     /db_xref="GeneID:1256128"
     CDS             92554..93294
                     /gene="traX"
                     /locus_tag="PSLT110"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: fimbrial acetylation"
                     /protein_id="NP_490593.1"
                     /db_xref="GeneID:1256128"
                     /translation="MTMDNATRNDSRAVRVDTRLQRLLAWSPGQRDLIKTVALLLMVA
                     DHINRILHLNQEWLFLAGRGAFPLFALVWGLNLSQHTHIRQSAINRLWGWAVIAQSGY
                     FLAGFPWYEGNILFAFAVTAQALKWCEQRCLFHSAAALLLLTAWIPLSGTSYGVAGVL
                     VLVICYRLYRTTDTEEHLALAACLVVAVPALNLVTSDAAAVAGLLVTGLTVWLVSLTG
                     KSRPRFWPADFFPVFYTCHLAALGVLAM"
     misc_feature    92554..93291
                     /gene="traX"
                     /locus_tag="PSLT110"
                     /note="TraX protein; Region: TraX; cl05434"
                     /db_xref="CDD:323055"
     gene            93349..93912
                     /gene="finO"
                     /locus_tag="PSLT111"
                     /gene_synonym="srgC"
                     /db_xref="GeneID:1256129"
     CDS             93349..93912
                     /gene="finO"
                     /locus_tag="PSLT111"
                     /gene_synonym="srgC"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer: regulation"
                     /protein_id="NP_490594.1"
                     /db_xref="GeneID:1256129"
                     /translation="MTEQKRPVLTLKRKTDGEAPARSRKTIINVTTPPKWKVKKQQLA
                     DRAVREASLAEKKARARKDLSIYLRFQSVEEAVSTLKPWWPGLFDGDTPRLFACGVRE
                     ALFEDASRRGIPLSHKKIIRALKAIARSEAYLSAMKAGACRYDTEGYVTEHITVEEEQ
                     YALARLAKVRAQNARKAELRAVLAQTV"
     misc_feature    93349..93906
                     /gene="finO"
                     /locus_tag="PSLT111"
                     /gene_synonym="srgC"
                     /note="conjugal transfer fertility inhibition protein
                     FinO; Provisional; Region: PRK13754"
                     /db_xref="CDD:184304"
CONTIG      join(AE006471.2:1..93933)
//
DBGET integrated database retrieval system