GenomeNet

Database: RefSeq
Entry: NC_003424
LinkDB: NC_003424
Original site: NC_003424 
LOCUS       NC_003424            5579133 bp    DNA     linear   CON 05-APR-2018
DEFINITION  Schizosaccharomyces pombe chromosome I, complete sequence.
ACCESSION   NC_003424 AL009197 AL009227 AL021046 AL021809 AL021813 AL021817
            AL031180 AL034486 AL034565 AL034583 AL035064 AL035248 AL035254
            AL035439 AL096845 AL109734 AL109770 AL109820 AL109951 AL109988
            AL110469 AL110509 AL117210 AL117390 AL121732 AL121741 AL121745
            AL121770 AL122032 AL132667 AL132675 AL132714 AL132769 AL132779
            AL132798 AL132828 AL132839 AL133154 AL133225 AL133302 AL133357
            AL133442 AL133498 AL135751 AL136078 AL136235 AL136499 AL136521
            AL136538 AL137130 AL138666 AL138854 AL139315 AL157734 AL157811
            AL157872 AL157917 AL158056 AL159180 AL159951 AL162531 AL162631
            AL163031 AL163071 AL163191 AL163481 AL163529 AL353014 AL353860
            AL355252 AL355452 AL355632 AL356333 AL356335 AL357232 AL358272
            AL360054 AL360094 AL390095 AL390274 AL390814 AL391713 AL391744
            AL391746 AL391783 AL441621 AL441624 AL512491 AL512493 AL512496
            AL512549 AL512562 AL583902 AL590562 AL590582 AL590602 AL590605
            AL672256 AL691405 Z49811 Z50142 Z50728 Z54096 Z54142 Z54285 Z54308
            Z54328 Z54354 Z54366 Z56276 Z64354 Z66568 Z67757 Z67961 Z68136
            Z68144 Z68166 Z68887 Z69086 Z69380 Z69944 Z70043 Z70721 Z81312
            Z81317 Z94864 Z95334 Z97185 Z98056 Z98849 Z98944 Z99091 Z99126
            Z99292 Z99568 Z99753
VERSION     NC_003424.3
DBLINK      BioProject: PRJNA127
            BioSample: SAMEA3138176
            Assembly: GCF_000002945.1
KEYWORDS    RefSeq; complete genome.
SOURCE      Schizosaccharomyces pombe (fission yeast)
  ORGANISM  Schizosaccharomyces pombe
            Eukaryota; Fungi; Dikarya; Ascomycota; Taphrinomycotina;
            Schizosaccharomycetes; Schizosaccharomycetales;
            Schizosaccharomycetaceae; Schizosaccharomyces.
REFERENCE   1  (bases 1 to 5579133)
  AUTHORS   Wood,V., Gwilliam,R., Rajandream,M.A., Lyne,M., Lyne,R.,
            Stewart,A., Sgouros,J., Peat,N., Hayles,J., Baker,S., Basham,D.,
            Bowman,S., Brooks,K., Brown,D., Brown,S., Chillingworth,T.,
            Churcher,C., Collins,M., Connor,R., Cronin,A., Davis,P.,
            Feltwell,T., Fraser,A., Gentles,S., Goble,A., Hamlin,N., Harris,D.,
            Hidalgo,J., Hodgson,G., Holroyd,S., Hornsby,T., Howarth,S.,
            Huckle,E.J., Hunt,S., Jagels,K., James,K., Jones,L., Jones,M.,
            Leather,S., McDonald,S., McLean,J., Mooney,P., Moule,S.,
            Mungall,K., Murphy,L., Niblett,D., Odell,C., Oliver,K., O'Neil,S.,
            Pearson,D., Quail,M.A., Rabbinowitsch,E., Rutherford,K., Rutter,S.,
            Saunders,D., Seeger,K., Sharp,S., Skelton,J., Simmonds,M.,
            Squares,R., Squares,S., Stevens,K., Taylor,K., Taylor,R.G.,
            Tivey,A., Walsh,S., Warren,T., Whitehead,S., Woodward,J.,
            Volckaert,G., Aert,R., Robben,J., Grymonprez,B., Weltjens,I.,
            Vanstreels,E., Rieger,M., Schafer,M., Muller-Auer,S., Gabel,C.,
            Fuchs,M., Dusterhoft,A., Fritzc,C., Holzer,E., Moestl,D.,
            Hilbert,H., Borzym,K., Langer,I., Beck,A., Lehrach,H.,
            Reinhardt,R., Pohl,T.M., Eger,P., Zimmermann,W., Wedler,H.,
            Wambutt,R., Purnelle,B., Goffeau,A., Cadieu,E., Dreano,S.,
            Gloux,S., Lelaure,V., Mottier,S., Galibert,F., Aves,S.J., Xiang,Z.,
            Hunt,C., Moore,K., Hurst,S.M., Lucas,M., Rochet,M., Gaillardin,C.,
            Tallada,V.A., Garzon,A., Thode,G., Daga,R.R., Cruzado,L.,
            Jimenez,J., Sanchez,M., del Rey,F., Benito,J., Dominguez,A.,
            Revuelta,J.L., Moreno,S., Armstrong,J., Forsburg,S.L., Cerutti,L.,
            Lowe,T., McCombie,W.R., Paulsen,I., Potashkin,J., Shpakovski,G.V.,
            Ussery,D., Barrell,B.G. and Nurse,P.
  TITLE     The genome sequence of Schizosaccharomyces pombe
  JOURNAL   Nature 415 (6874), 871-880 (2002)
   PUBMED   11859360
  REMARK    Erratum:[Nature 2003 Jan 2;421(6918):94. Cerrutti L [corrected to
            Cerutti L]]
REFERENCE   2  (bases 1 to 5579133)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5579133)
  AUTHORS   Wood,V.
  CONSRTM   The Schizosaccharomyces pombe Genome Sequencing Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUN-2007) European Schizosaccharomyces genome
            sequencing project, Sanger Institute, The Wellcome Trust Genome
            Campus, Hinxton, Cambridge CB10 1SA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU329670.
            On Dec 11, 2007 this sequence version replaced NC_003424.2.
            Notes:
            
            S. pombe (fission yeast) sequence and annotation are available
            from: (URL, http://www.genedb.org/genedb/pombe/index.jsp) (URL,
            http://www.sanger.ac.uk/Projects/S_pombe/)
            
            CDS are numbered using the following system eg SPAC5H10.01c. SP (S.
            pombe), A (chromosome 1), c5H10 (cosmid name), .01 (first CDS), c
            (complementary strand). However, clones may have been reorientated
            since the original submission, therefore the complementary strand
            notation may be invalid for strand inference.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: PomBase
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5579133
                     /organism="Schizosaccharomyces pombe"
                     /mol_type="genomic DNA"
                     /strain="972h-"
                     /db_xref="taxon:4896"
                     /chromosome="I"
     gene            complement(<1..>5662)
                     /gene="tlh1"
                     /locus_tag="SPAC212.11"
                     /db_xref="GeneID:2541932"
     mRNA            complement(<1..>5662)
                     /gene="tlh1"
                     /locus_tag="SPAC212.11"
                     /product="RecQ type DNA helicase"
                     /transcript_id="NM_001018168.1"
                     /db_xref="GeneID:2541932"
     CDS             complement(<1..5662)
                     /gene="tlh1"
                     /locus_tag="SPAC212.11"
                     /codon_start=1
                     /product="RecQ type DNA helicase"
                     /protein_id="NP_595040.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC212.11"
                     /db_xref="EnsemblGenomes-Tr:SPAC212.11.1"
                     /db_xref="GeneID:2541932"
                     /db_xref="GOA:P0CT33"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC212.11"
                     /db_xref="PomBase:SPAC212.11.1"
                     /translation="MVVASEIAKVASKTARDIAGCFTCQCGTQFDNVERIVQHFKECR
                     YRDETCKDDDIVVYEPSSFVQDEKKDKPIIVEAASEATSEEACNSSKERQLPALSALS
                     ALSTLTTSANDDLWTARLIWQSTNDTKLDNSPSSNYTDLNHKLANYGLSILSIHALMC
                     VECECLLNVIHTAQHMQIVHKLELNEDLLWFQELRTLKLKSPTNVLQTHSSQTHVYPY
                     IRGLPVLLNGYECVPCTKNGTGFVHAIMDTFRHHVRRTHGKVIKLENCIRRTALQTVK
                     NKYAQRCQFFKVDYVPLNGGEEEEEEEGEEKEDAQNIKERMVDFCFSKFMEKNQQRRE
                     QQDKGENKKRQDDVDQATDNNTNTILEDDEKDNDEEEEEEIVNAREKNLLNQQFNWTA
                     IVKKLGENWDQLVRFEYTNGIVTLDTIVNQLIRYYYRGFRHLSGMTMGMRRMFTQGGS
                     YSAQERGLCRLEQKDTVVRYAQSAALYLIFLLRRPSADSGIRRHLEAMCGATVERKEG
                     GSNSSSNISNVANFDSAEDDNDNDNDNDRDSNNNNNNNNTNTDDDDKLAYLELHEALK
                     LAFLQQYDFSKNVQDLEIMEFLACMSLHKDGTSKYAYEISACFAPLIYTCRLVAACEL
                     QRLIDEKQIDLLSIPSFQTAGSIAYAHVFCFITLGQRNLYDVLYETQKVVRDIIRTEG
                     YANTLQGLSPSTVLFQPRSNSMYPCIGDAFNNMVRLDLSELTALYEGMFAKVQDLLKE
                     LCFDMNVEKLLPISLLRSIGDDINNSKLGYSFFKESIEIRSSHSVLLRTILKNSELCH
                     RFFPSMSKKDLTKLFGGVSDQQRNECDNYSNHYNDNSNDNDNDVFLKLHWSKSAIKKY
                     ETKASIFNELLFCLVYISAGQPARAQEMVYWTLRNGKYKTRELYLMFGRLMIYSRYDK
                     TRNMKFAEKPIPRFLSEPLSILALRYYVLVRPLEALMKYVTTADRSKVAVYLDFMFVI
                     AGERLQRDLPYRIFPKATYQCIQKPLGFRNYRHIAHYFKEKNIEEEMTRESYFDLQAG
                     HTRNTALYIYGRTMDNLHYLPSDYFANFFRASYKWQELLQIRDNPTHGLLVETKHPFI
                     KRVDQLEEALNEKLARLVGEQMVEGDKEKDKTNEEKNKDEVKAEMTQPVVNQDSHDLQ
                     DQLATTPTAPTAFHYRPGLLQPSQTSVQHCCWALSQYYGLEAKFRSLKQFQSVYFSLL
                     NRMNLITVLPTGGGKSLSFLIPALIEKKRQTPGKVMNMVTLVLVPMMSLRQDMMLRVN
                     EKGLLVCSGNWTAFKDVRLTLETQLPDLFILTYESALTNSGLRFFESLATLGRLARVV
                     IDEAHLLLTSGAWRTALSRASRLSGLYAPLHLLSATFPRQLEMVARQTFCTNFYVLRE
                     TSTARENIFYFLHPYDNTEFLLDLRTLMKRTKVFEGDGRAIIFCRTKKDVEYIHRRLH
                     QSDLFAHTHVTIYTGDVSDEERQMNFDAFRNANGKTRIMIATKAFGLGINYMGVRLVV
                     HYGLPASSMDYVQETGRAGRDGKYAIAALFYEKYDSTWSSYVEDSMKNFLNDNTMCVR
                     SFLASEMDGECVCCASFANCVYCSRCSDSLLGEESTVSTMYGVKPTLPETPKPAIATH
                     SRYNASFSSSPPPQPGNSSGMSAMNTNTTSTTPVSLSELSEITLFPSSVSPTWKKSFG
                     NANTNLKYGLEDMSLSHRRGHKRTYDEHLNNVQQGVNHDMNRVHGSVGGMSGIVGIGI
                     GIGDGDGDGDVDSRTIHFAEYKSRVQAVKKQWVDSTDISAQLERFFRVYKDECLSCTL
                     GNPDTEIRAHTGKACPVRLSTCYKCGKADHNLRECKLRIRFQGLCLFCGLTKFEHADS
                     DMAYTSDCRSWARKANLISLVYYAWNNVQYRRTIADKFLQGDVRD"
     gene            complement(5726..6331)
                     /locus_tag="SPAC212.10"
                     /pseudo
                     /db_xref="GeneID:6391210"
     misc_feature    complement(5726..6331)
                     /locus_tag="SPAC212.10"
                     /pseudo
                     /db_xref="GeneID:6391210"
                     /db_xref="PSEUDO:CAO77628.1"
     repeat_region   complement(6360..6755)
     repeat_region   7548..12710
     gene            7619..9274
                     /locus_tag="SPAC212.09c"
                     /pseudo
                     /db_xref="GeneID:6391211"
     misc_feature    7619..9274
                     /locus_tag="SPAC212.09c"
                     /pseudo
                     /db_xref="GeneID:6391211"
     gene            complement(11027..11556)
                     /locus_tag="SPNCRNA.70"
                     /db_xref="GeneID:3361373"
     misc_RNA        complement(11027..11556)
                     /locus_tag="SPNCRNA.70"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_151068.1"
                     /db_xref="GeneID:3361373"
     gene            11784..>12994
                     /locus_tag="SPAC212.08c"
                     /db_xref="GeneID:2542009"
     mRNA            11784..>12994
                     /locus_tag="SPAC212.08c"
                     /product="putative GPI anchored protein"
                     /transcript_id="NM_001018169.2"
                     /db_xref="GeneID:2542009"
     CDS             12158..12994
                     /locus_tag="SPAC212.08c"
                     /codon_start=1
                     /product="putative GPI anchored protein"
                     /protein_id="NP_595039.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC212.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC212.08c.1"
                     /db_xref="GeneID:2542009"
                     /db_xref="GOA:Q9HGP7"
                     /db_xref="PomBase:SPAC212.08c"
                     /db_xref="PomBase:SPAC212.08c.1"
                     /translation="MSPLIVGTLIIILLSGLATAFYVTWQGRLICAGVGLILEQAYEG
                     GQMFNTLMAHCFETYNGVEKSGTQCVADWLKVGLLAVTFGAGGPRLVNTLGGTFLTSP
                     TAKRSNLYCDDFTGADYFSCELETLRPYTLMRKSLPYGNIHDVWINTTDTHQMIGVHM
                     TLNGTDMIHYYNKTYVINYSGLKLNSSAINKRSYFYPQDSFLVSHAEWQDGNGIWTDT
                     DYFAAMADCDFLGQNLGFWLASSYPNAYKWETQLWRTVGINLNGNIIYPGQLIMQTFN
                     GS"
     gene            13665..14555
                     /locus_tag="SPAC212.07c"
                     /pseudo
                     /db_xref="GeneID:3361374"
     misc_feature    13665..14555
                     /locus_tag="SPAC212.07c"
                     /pseudo
                     /db_xref="GeneID:3361374"
     repeat_region   15829..22113
     gene            <15855..>16226
                     /locus_tag="SPAC212.12"
                     /db_xref="GeneID:9407254"
     mRNA            <15855..>16226
                     /locus_tag="SPAC212.12"
                     /product="GPI-anchored protein"
                     /transcript_id="NM_001355957.1"
                     /db_xref="GeneID:9407254"
     CDS             15855..16226
                     /locus_tag="SPAC212.12"
                     /codon_start=1
                     /product="GPI-anchored protein"
                     /protein_id="NP_001343063.1"
                     /db_xref="GeneID:9407254"
                     /db_xref="GOA:C6Y4B5"
                     /translation="MSPLIVGTLIIILLSGLATAFYVTWQGRLICAGVGLILEQAYEG
                     GQMFNTLMAHCFETYNGVEKSGTQCVADWLKVGLLAVTFGAGGPRLVNTLGGSSPTTK
                     RVIYIVMILLVLITLAVNLKH"
     gene            18042..18974
                     /locus_tag="SPAC212.06c"
                     /db_xref="GeneID:3361375"
     mRNA            join(18042..18306,18349..18974)
                     /locus_tag="SPAC212.06c"
                     /product="DNA helicase-like protein"
                     /transcript_id="NM_001355958.1"
                     /db_xref="GeneID:3361375"
     CDS             join(18072..18306,18349..18557)
                     /locus_tag="SPAC212.06c"
                     /codon_start=1
                     /product="DNA helicase-like protein"
                     /protein_id="NP_001343026.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC212.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC212.06c.1"
                     /db_xref="GeneID:3361375"
                     /db_xref="GOA:G2TRN7"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC212.06c"
                     /db_xref="PomBase:SPAC212.06c.1"
                     /translation="MGVRLVVHYRLPASSMDYVQETGRAGRDGKYAIAALFYEKYDST
                     WSSYVEDSMKNFLNDNTMCVRSFLASEMDGECVCYSLLGEESTVSTMYGVKPTLPETP
                     KPAIATHSRYNASFSSSPPPQPGSSSGMSAMNTNTTSTTPVSGKT"
     gene            20824..21015
                     /locus_tag="SPAC212.05c"
                     /pseudo
                     /db_xref="GeneID:3361380"
     misc_feature    20824..21015
                     /locus_tag="SPAC212.05c"
                     /pseudo
                     /db_xref="GeneID:3361380"
     repeat_region   20859..29663
     repeat_region   21035..21329
                     /rpt_type=long_terminal_repeat
     gene            21381..23050
                     /locus_tag="SPAC212.04c"
                     /db_xref="GeneID:2541911"
     mRNA            join(21381..22076,22132..23050)
                     /locus_tag="SPAC212.04c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018170.2"
                     /db_xref="GeneID:2541911"
     CDS             join(21587..22076,22132..22508)
                     /locus_tag="SPAC212.04c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_595038.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC212.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC212.04c.1"
                     /db_xref="GeneID:2541911"
                     /db_xref="GOA:Q9HGP8"
                     /db_xref="InterPro:IPR009340"
                     /db_xref="PomBase:SPAC212.04c"
                     /db_xref="PomBase:SPAC212.04c.1"
                     /translation="MSNPESLKKQVEPPGYNELFMVEDVCNVDLEQGLDLCKPEKVNK
                     QSQRSRQSRQSLFTNTIKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPNGRISTQ
                     DKSRWVLLIIWSIITILTIDKKFKIKESYLEWIGENQSHSEIWGPIVIYVGLFILLLS
                     AFNYCSKLIIKALPLISMVIAWVGVVIAAFSVIITATIAGVIAAFSVIITATIAGVIA
                     AMVGILYFGHWLVYKILILAFGFKIVTSGDVCVSNTLPTHNGETALHSDATVGSDIEQ
                     IELQNMPTPVKK"
     gene            complement(<23589..24054)
                     /locus_tag="SPAC212.03"
                     /db_xref="GeneID:2542026"
     mRNA            complement(<23589..24054)
                     /locus_tag="SPAC212.03"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018171.2"
                     /db_xref="GeneID:2542026"
     CDS             complement(23589..23978)
                     /locus_tag="SPAC212.03"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_595037.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC212.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC212.03.1"
                     /db_xref="GeneID:2542026"
                     /db_xref="GOA:Q9HGP9"
                     /db_xref="PomBase:SPAC212.03"
                     /db_xref="PomBase:SPAC212.03.1"
                     /translation="MSIEFDDSSRHNMNMTQLMQLGAFDRRSGDDFMVQDFKNGIRDC
                     SGIPVNNRNLAFKAYDAVKQKCDSSIKVFNIQDITIKGATWQHHNCQSTGKWYSQLYD
                     YQNTFIGKQEYNILFDCYSYLKYNLNG"
     repeat_region   complement(24281..24445)
                     /rpt_type=long_terminal_repeat
     repeat_region   complement(24581..24876)
                     /rpt_type=long_terminal_repeat
     repeat_region   complement(25997..26339)
                     /rpt_type=long_terminal_repeat
     gene            complement(<27353..>27763)
                     /locus_tag="SPAC212.02"
                     /db_xref="GeneID:2542050"
     mRNA            complement(<27353..>27763)
                     /locus_tag="SPAC212.02"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018172.1"
                     /db_xref="GeneID:2542050"
     CDS             complement(27353..27763)
                     /locus_tag="SPAC212.02"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_595036.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC212.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC212.02.1"
                     /db_xref="GeneID:2542050"
                     /db_xref="GOA:Q9HGQ0"
                     /db_xref="PomBase:SPAC212.02"
                     /db_xref="PomBase:SPAC212.02.1"
                     /translation="MTALMNHIYIDNPLISNSTNNVTHELLIDLHELYNDGEISRIVL
                     LRTLVTQSADDATWIINLTDDVLNGLPLLKKRDRYTTQCHSTNMASTYDCDTGANAVG
                     ARGGATLAADYRGDWGGGVMLYKPLVVKACLTEI"
     repeat_region   28124..28480
                     /rpt_type=long_terminal_repeat
     gene            <28738..29657
                     /locus_tag="SPAC212.01c"
                     /db_xref="GeneID:2542040"
     mRNA            join(<28738..29227,29286..29657)
                     /locus_tag="SPAC212.01c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018173.2"
                     /db_xref="GeneID:2542040"
     CDS             join(28738..29227,29286..29638)
                     /locus_tag="SPAC212.01c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_595035.1"
                     /db_xref="GeneID:2542040"
                     /db_xref="GOA:Q9HGQ1"
                     /db_xref="InterPro:IPR009340"
                     /translation="MSNPESLKKQVEPPGYNELFMVEDVCNVDLEQGLDLCKPEKVNK
                     QSQRSRQSRQSLFTNTIKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPDGRISTR
                     SNFRWPLLIIWSIIIVFAVDKKFEVQKFLSIWINENRFYSEIWVPIAIYVCLLVLMLL
                     SLIFFAEFAVLALRVTGVIIAVLGAVLGMIIAVLGMIIAALGMIIAALGATITGLLYF
                     GHWALYKLVILSLGFKIVTPGDVCVSNTLPTHNGETALHSETTVGSDIEQIELQNMPT
                     PVKK"
     gap             29664..29763
                     /estimated_length=unknown
     gene            <29764..31069
                     /locus_tag="SPAC977.01"
                     /db_xref="GeneID:2543353"
     mRNA            <29764..31069
                     /locus_tag="SPAC977.01"
                     /product="transmembrane helix domain-containing protein"
                     /transcript_id="NM_001018174.2"
                     /db_xref="GeneID:2543353"
     CDS             <29764..30716
                     /locus_tag="SPAC977.01"
                     /codon_start=3
                     /product="transmembrane helix domain-containing protein"
                     /protein_id="NP_592774.1"
                     /db_xref="GeneID:2543353"
                     /db_xref="GOA:Q9P3V8"
                     /db_xref="InterPro:IPR018291"
                     /translation="SFAYSGNSESVWTGENITSIWKTILINETGSYCVAARPMTMDGA
                     EFNLDLMGYSVSEDQINNDEIGIWNYISVAEMGGVLLFLSYWIWTCLHFSKIIFPAQK
                     VICLYIFLFALNQTLQECIEEYVFSSECIKYRQFYSVYEIIDFLRTNFYRLFVIYCAL
                     GFGITRTVPKYLMIKGISIVIALCSVYWISLYKDVYVVSEIFDMIQYEVSPAIWVYSI
                     CHLLKQCTSVTTYENASKARFFRRMLNAFIFIFCASPMLHYLSNIIFGNFDYRLSVII
                     GDLFTFMEKIAFPCYIMFPTHNEALAYNRNVAEEAQEKMI"
     gene            complement(31140..32345)
                     /locus_tag="SPAC977.18"
                     /db_xref="GeneID:14218019"
     mRNA            complement(join(31140..31557,31768..31913,32163..32345))
                     /locus_tag="SPAC977.18"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001355959.1"
                     /db_xref="GeneID:14218019"
     CDS             complement(join(31327..31557,31768..31913,32163..32187))
                     /locus_tag="SPAC977.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_001343097.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC977.18"
                     /db_xref="EnsemblGenomes-Tr:SPAC977.18.1"
                     /db_xref="GeneID:14218019"
                     /db_xref="GOA:G2TRM1"
                     /db_xref="PomBase:SPAC977.18"
                     /db_xref="PomBase:SPAC977.18.1"
                     /translation="MFYLRVLCVQRRLVREINKLSSFESNWLFLLFLVRVCRQLKTVT
                     VLIVPVLPVYTNKVLRCSQCDWHEPANLDSIYQRSSHDDDLPTIKGSDASTQQYERKT
                     YITDASPESQNLFLSKSKEEGVIFLCIQVSF"
     gene            32034..33012
                     /locus_tag="SPAC977.02"
                     /db_xref="GeneID:2543349"
     mRNA            32034..33012
                     /locus_tag="SPAC977.02"
                     /product="transmembrane helix domain-containing protein"
                     /transcript_id="NM_001018175.2"
                     /db_xref="GeneID:2543349"
     CDS             32230..32670
                     /locus_tag="SPAC977.02"
                     /codon_start=1
                     /product="transmembrane helix domain-containing protein"
                     /protein_id="NP_592775.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC750.04c"
                     /db_xref="EnsemblGenomes-Gn:SPAC977.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC750.04c.1"
                     /db_xref="EnsemblGenomes-Tr:SPAC977.02.1"
                     /db_xref="GeneID:2543349"
                     /db_xref="GOA:Q9P332"
                     /db_xref="InterPro:IPR018291"
                     /db_xref="PomBase:SPAC750.04c"
                     /db_xref="PomBase:SPAC750.04c.1"
                     /db_xref="PomBase:SPAC977.02"
                     /db_xref="PomBase:SPAC977.02.1"
                     /translation="MALLKKINTQVNRIMKNSSLVQNICFDRVPLFIPRLSLTVKYCL
                     AVKLLIYLLYCWYIYSEVPSASSKFRSFTFGCVVVYHNKFFPRFIRTHSINSIRTFSK
                     FQVIILFSIEKVTRSESKNHSYSKTDISDLHQGYNNPPSRFISR"
     repeat_region   complement(32863..33057)
                     /rpt_type=long_terminal_repeat
     gene            <33835..>34272
                     /locus_tag="SPAC977.03"
                     /db_xref="GeneID:2543345"
     mRNA            <33835..>34272
                     /locus_tag="SPAC977.03"
                     /product="putative methyltransferase"
                     /transcript_id="NM_001018176.1"
                     /db_xref="GeneID:2543345"
     CDS             33835..34272
                     /locus_tag="SPAC977.03"
                     /codon_start=1
                     /product="putative methyltransferase"
                     /protein_id="NP_592776.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC977.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC977.03.1"
                     /db_xref="GeneID:2543345"
                     /db_xref="GOA:Q9P7U5"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PomBase:SPAC977.03"
                     /db_xref="PomBase:SPAC977.03.1"
                     /translation="MNLVQLGKLHENVLDAGCEPNRNARYLASLGYKVVGIDISERAI
                     SKAIDKTSSEKSNVNFNQRDFSRLNEFKGHFDTVIDIGCFHSILNSDHEPHTASLSHI
                     CHSDSSVFLRAFSETNKSRYRRWQGHKRYSLALKRNNVKKLSL"
     gene            34298..34978
                     /locus_tag="SPAC977.04"
                     /db_xref="GeneID:3361386"
     mRNA            34298..34978
                     /locus_tag="SPAC977.04"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001355960.1"
                     /db_xref="GeneID:3361386"
     CDS             34349..34816
                     /locus_tag="SPAC977.04"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_001343027.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC977.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC977.04.1"
                     /db_xref="GeneID:3361386"
                     /db_xref="GOA:G2TRN8"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="PomBase:SPAC977.04"
                     /db_xref="PomBase:SPAC977.04.1"
                     /translation="MPINQKFYSYLVKRNGGEGEPEFRLPMGFIGITLFEIGILLFGW
                     TARYKIFWFVPTIGSAIMGGGYIMTSNPLNMYVVDSYGIYSASASAGVKIFQLLLGAI
                     FPLFAESLFRRLNYGWGCTLLAFILLACGCSLPILFKYGKQIRNLRPFDPSKY"
     gene            complement(<35768..>36382)
                     /locus_tag="SPAC977.05c"
                     /db_xref="GeneID:2543096"
     mRNA            complement(<35768..>36382)
                     /locus_tag="SPAC977.05c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018177.1"
                     /db_xref="GeneID:2543096"
     CDS             complement(35768..36382)
                     /locus_tag="SPAC977.05c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592777.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC977.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC977.05c.1"
                     /db_xref="GeneID:2543096"
                     /db_xref="GOA:Q9P7U4"
                     /db_xref="InterPro:IPR019435"
                     /db_xref="PomBase:SPAC977.05c"
                     /db_xref="PomBase:SPAC977.05c.1"
                     /translation="MIFKNLISLFFIGLATAIRFNLTDLECSRLRGPHCGTYLLKVVG
                     TNATYVGEKSFIGLDALTESKGEFFQRMLEQEPRLIPRLFTIAENDTANFTPLTFTTY
                     LKTCNPQSIENAMIPFVNTVTSEISFDAWAYTAQNSSRITGLSNQLMNSTLYNVQVAT
                     CTPGFSALLLDSPTINVFNNEEGMPSWCQPIELIPVCPLDEGFN"
     gene            39416..40072
                     /locus_tag="SPAC977.06"
                     /db_xref="GeneID:2543115"
     mRNA            join(39416..39848,39899..40072)
                     /locus_tag="SPAC977.06"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018178.2"
                     /db_xref="GeneID:2543115"
     CDS             join(39431..39848,39899..40050)
                     /locus_tag="SPAC977.06"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592778.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC977.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC977.06.1"
                     /db_xref="GeneID:2543115"
                     /db_xref="GOA:Q9P7U3"
                     /db_xref="InterPro:IPR009340"
                     /db_xref="PomBase:SPAC977.06"
                     /db_xref="PomBase:SPAC977.06.1"
                     /translation="MVRDTRNVDLERGLELCKPEKVNKQNLFTNIIKPQKDKINIKTD
                     KIKFFLNNLFTEFSKFHDSCYPDGRISTRSKLRWPLLIIWCILIVFAIDKNFEVKDFL
                     SIWINESFINENRFYSEIWGPIAIYICLFVLLLLGLIYCSKIVVKAIPLISIVIAAVV
                     VIIAVAMVKILYICHWLLQNFNFGFRHKS"
     gene            40795..41489
                     /locus_tag="SPNCRNA.136"
                     /db_xref="GeneID:5802727"
     misc_RNA        40795..41489
                     /locus_tag="SPNCRNA.136"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150235.1"
                     /db_xref="GeneID:5802727"
     gene            complement(40916..41770)
                     /locus_tag="SPNCRNA.601"
                     /db_xref="GeneID:14218055"
     misc_RNA        complement(40916..41770)
                     /locus_tag="SPNCRNA.601"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_150962.1"
                     /db_xref="GeneID:14218055"
     gene            complement(<42057..>43307)
                     /locus_tag="SPAC977.07c"
                     /db_xref="GeneID:2543047"
     mRNA            complement(<42057..>43307)
                     /locus_tag="SPAC977.07c"
                     /product="putative glycoprotein"
                     /transcript_id="NM_001018179.1"
                     /db_xref="GeneID:2543047"
     CDS             complement(42057..43307)
                     /locus_tag="SPAC977.07c"
                     /codon_start=1
                     /product="putative glycoprotein"
                     /protein_id="NP_592779.1"
                     /db_xref="GeneID:2543047"
                     /db_xref="GOA:Q9P329"
                     /db_xref="InterPro:IPR018871"
                     /translation="MNFFLYFRTIFLIQLYFFNYSTFGCSASSTSVQSDTTNQVSVSC
                     PKYTTIYTSGTSPDTKTIYPESTSTKSITTSTQSHSSPVIVVSTVGTVTETTISGSTE
                     YTTTIPAEGITSGTVEIVEPTAGTVTETITSGTLPFTTTLAQASGTVSGTVEIVSPKN
                     NPTTVYSGTVATTETFSSSTVVVIPTAICDGVRGLEYAVYDYTISSSMNEFCYPKNGQ
                     TDVFAFNEPAYFGSSDLDQSSPLFTGVFSSTDDIPEWASSWYLPPYPPQASDMASTYC
                     ACKVIVYQFFLRIPETDTYTLVVNNVDDVFFGWFGDKAISGWSNNNFDAYSYWHESPN
                     MGLGTVGMGNFTVGNYPEGYFLPVRFVVANGAYIGGFDFYFTSDSTGPLATTSYSYTK
                     TCTQQFLPFGQGNGGVNGPTEKLS"
     repeat_region   43336..43366
     gene            44644..45468
                     /locus_tag="SPAC977.08"
                     /db_xref="GeneID:2543330"
     mRNA            44644..45468
                     /locus_tag="SPAC977.08"
                     /product="putative dehydrogenase"
                     /transcript_id="NM_001018180.2"
                     /db_xref="GeneID:2543330"
     CDS             44704..45414
                     /locus_tag="SPAC977.08"
                     /codon_start=1
                     /product="putative dehydrogenase"
                     /protein_id="NP_592780.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC977.08"
                     /db_xref="EnsemblGenomes-Tr:SPAC977.08.1"
                     /db_xref="GeneID:2543330"
                     /db_xref="GOA:Q9P324"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="PomBase:SPAC977.08"
                     /db_xref="PomBase:SPAC977.08.1"
                     /translation="MREPKNAKVLSRLENVLVTQLDVNNFSSIKKSVEKAISHFGRID
                     VLLNNAGYSVYSPLESTTEEQIHNIFNTNVFGALEVIKAITPIFRSQHNGMIINVSSI
                     GGKMTFPLGCLYYGTKYAIEGISEALTWEMQSIGVKVKIIEPGFTATEFRVEEGAGKH
                     YAEYDNLKQKLYEDLLPKLKTATPPQKIAEVILQAATDESDELRYPTGDYVVEWMALR
                     SKVDDATFLATHRKQMGL"
     gene            complement(45875..48399)
                     /locus_tag="SPAC977.09c"
                     /db_xref="GeneID:2541836"
     mRNA            complement(join(45875..46143,46208..48399))
                     /locus_tag="SPAC977.09c"
                     /product="putative phospholipase"
                     /transcript_id="NM_001018181.2"
                     /db_xref="GeneID:2541836"
     CDS             complement(join(46075..46143,46208..48160))
                     /locus_tag="SPAC977.09c"
                     /EC_number="3.1.1.5"
                     /codon_start=1
                     /product="putative phospholipase"
                     /protein_id="NP_592781.1"
                     /db_xref="GeneID:2541836"
                     /db_xref="GOA:Q9P327"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /translation="MYVNYIGLFAFVQISLTLAYPPGRVEISEIYDFEESSSYKGQDI
                     DTSVLYTLSKRKPALVKRSTDASYAPFNVTCSNDNLLRPASEGLNEGEQSYINKRISK
                     VNSELRSFISKTGLNVDLDKVVNSSDGPRLGIAFSGGGLRAMVNGGGAFNAFDSRFES
                     DSPLSGLLQSAMYISGLSGGSWLVGSVAINNFTNITYLRDNVWNLEHSVFAPHGDNVI
                     ENLNYYNDLRKEIDQKKHAGFDCSLTDLWGRALSRKLVDAERGGPGITYSSMRNQSWF
                     QNADYPYPIIVADSRLEEETAIPANTSIFEFTAYEFGTWDNGIKAFIPMEYVGTHLLD
                     GVPPDKSCIHNYDNAGFVMGTSATLFNSFLLDWNENVKKNDTYYDILHAILEDLSKHQ
                     DDIAPYPNPYQNYTTSNTSVVNAFEPYDTIDLVDGGEDRENIPLWPLLHPQRFVDVVF
                     AIDSTYNDPYGWPLGSSIVATYERVVTFNANKSVDVRGFPYIPDENTIISLGLNTRPT
                     FFGCDGKNTTAGNHDVDNNTPPLLVYFPNYPWTYYSNISTFTMSMDDKMANGILENAF
                     MSTTQNNNESFAVCLACAIIQRSLERKKLSTPTQCSSCFQEYCWDGTLATSTASVYDP
                     TVMSAATTSRAPSGTTSGTASSTTSSSVASATPTHKHWWDSIFEAKENP"
     gene            complement(50851..51545)
                     /locus_tag="SPNCRNA.602"
                     /db_xref="GeneID:14218020"
     misc_RNA        complement(50851..51545)
                     /locus_tag="SPNCRNA.602"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_150963.1"
                     /db_xref="GeneID:14218020"
     gene            51158..51583
                     /gene="prl19"
                     /locus_tag="SPNCRNA.19"
                     /db_xref="GeneID:5802847"
     misc_RNA        51158..51583
                     /gene="prl19"
                     /locus_tag="SPNCRNA.19"
                     /product="non-coding RNA, poly(A)-bearing RNA (predicted)"
                     /transcript_id="NR_150612.1"
                     /db_xref="GeneID:5802847"
     gene            <52117..53858
                     /gene="sod2"
                     /locus_tag="SPAC977.10"
                     /db_xref="GeneID:2543239"
     mRNA            join(<52117..52240,52318..53858)
                     /gene="sod2"
                     /locus_tag="SPAC977.10"
                     /product="plasma membrane sodium ion/proton antiporter
                     Sod2"
                     /transcript_id="NM_001018182.3"
                     /db_xref="GeneID:2543239"
     CDS             join(52117..52240,52318..53600)
                     /gene="sod2"
                     /locus_tag="SPAC977.10"
                     /codon_start=1
                     /product="plasma membrane sodium ion/proton antiporter
                     Sod2"
                     /protein_id="NP_592782.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC977.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC977.10.1"
                     /db_xref="GeneID:2543239"
                     /db_xref="GOA:P36606"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="PDB:2M7X"
                     /db_xref="PomBase:SPAC977.10"
                     /db_xref="PomBase:SPAC977.10.1"
                     /translation="MGWRQLDIDKVHLALIVAGGFITFFCYFSEVFRKKLLVGEAVLG
                     SITGLIFGPHAAKLVDPFSWGDHGDYLTVEICRIVLDVRVFASAIELPGAYFQHNFRS
                     IIVMLLPVMAYGWLVTAGFAYALFPQINFLGSLLIAGCITSTDPVLSALIVGEGPLAK
                     KTPERIRSLLIAESGCNDGMAVPFFYFAIKLLTVKPSRNAGRDWVLLVVLYECAFGIF
                     FGCVIGYLLSFILKHAQKYRLIDAISYYSLPLAIPLLCSGIGTIIGVDDLLMSFFAGI
                     LFNWNDLFSKNISACSVPAFIDQTFSLLFFTYYGTIIPWNNFNWSVEGLPVWRLIVFS
                     ILTLVCRRLPVVFSVKPLVPDIKTWKEALFVGHFGPIGVCAVYMAFLAKLLLSPDEIE
                     KSIYESTTVFSTLNEIIWPIISFVILSSIIVHGFSIHVLVIWGKLKSLYLNRKVTKSD
                     SDLELQVIGVDKSQEDYV"
     repeat_region   54499..54854
                     /rpt_type=long_terminal_repeat
     gene            55059..56308
                     /locus_tag="SPAC977.11"
                     /db_xref="GeneID:2543234"
     mRNA            55059..56308
                     /locus_tag="SPAC977.11"
                     /product="CRCB domain protein"
                     /transcript_id="NM_001018183.2"
                     /db_xref="GeneID:2543234"
     repeat_region   55264..57914
     CDS             55274..56209
                     /locus_tag="SPAC977.11"
                     /codon_start=1
                     /product="CRCB domain protein"
                     /protein_id="NP_592783.1"
                     /db_xref="GeneID:2543234"
                     /db_xref="GOA:Q9UTS8"
                     /db_xref="InterPro:IPR003691"
                     /translation="MLLTQSYFCIMSMLGTLARLGLTALNTYPGAPFSGLLWVQFVGC
                     VIMGFCQTESVFFPRPKHNATFLLAITTGFCGSLTTFSSWMLQMFTGMANLDPFERRG
                     RGYSFLSVVSDFMVTMCIAMSSLIWGKQIGKTTGQWRIGKVAFAWPIPAHTHIVVRVL
                     LLLLSICFFVGAAFYTAYTTNVTHRGIGFSLIFSPFAALTRLYLARFLNSPQYFIPYG
                     TLCANVFATLLLSIMYMIPQITHCTPVSRSVMYGIQNGFCAVLSTLSTFSNELHTMPI
                     KRAYIYCIISVAISFSICVIVDGATAWGHGYTEKY"
     gene            56373..57736
                     /locus_tag="SPAC977.12"
                     /db_xref="GeneID:2543314"
     mRNA            56373..57736
                     /locus_tag="SPAC977.12"
                     /product="putative L-asparaginase"
                     /transcript_id="NM_001018184.2"
                     /db_xref="GeneID:2543314"
     CDS             56492..57562
                     /locus_tag="SPAC977.12"
                     /EC_number="3.5.1.1"
                     /codon_start=1
                     /product="putative L-asparaginase"
                     /protein_id="NP_592784.1"
                     /db_xref="GeneID:2543314"
                     /db_xref="GOA:Q9UTS7"
                     /db_xref="InterPro:IPR004550"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="InterPro:IPR027473"
                     /db_xref="InterPro:IPR027474"
                     /translation="MWGFIVTCGIFLVLLCQLRLLSKRKSKSTPYNALLPNVTVFAMG
                     GTIAGCANSSLEIVNYIPGSVGIEKLIEAVPAIKAIANINGVQVTNMGSENLTPADVL
                     KLAKLILAEVAKPNVHGIVITHGTDSLEETAMFLDLTISTAKPIVVVGAMRPSTAIGA
                     DGPMNLLNAVAVASSNQSMGRGTLVLLNDRIGSAFYTTKTNGNTLDTFKSYEAGSLGI
                     VLNQKPFYFFSPAVPTGKVFFDIYNIKQLPRVDILYGYQGLNPKLAESAVHLGAKGLV
                     LAAMGATSWTDDGNEVISSLIREHNIPVVYSHRTAEGYSSNSCLGIPSYFLNPQKARY
                     MLMLAISSGYSIRDIEDLFSIK"
     gene            complement(58277..59105)
                     /locus_tag="SPAC977.13c"
                     /pseudo
                     /db_xref="GeneID:3361389"
     misc_feature    complement(58277..59105)
                     /locus_tag="SPAC977.13c"
                     /pseudo
                     /db_xref="GeneID:3361389"
     repeat_region   59436..59486
     repeat_region   complement(59604..60792)
     gene            complement(59614..60907)
                     /locus_tag="SPAC977.14c"
                     /db_xref="GeneID:2543325"
     mRNA            complement(59614..60907)
                     /locus_tag="SPAC977.14c"
                     /product="aldo-keto reductase family protein"
                     /transcript_id="NM_001018185.2"
                     /db_xref="GeneID:2543325"
     CDS             complement(59715..60770)
                     /locus_tag="SPAC977.14c"
                     /codon_start=1
                     /product="aldo-keto reductase family protein"
                     /protein_id="NP_592785.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC977.14c"
                     /db_xref="EnsemblGenomes-Tr:SPAC977.14c.1"
                     /db_xref="GeneID:2543325"
                     /db_xref="GOA:Q9P7U2"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="PomBase:SPAC977.14c"
                     /db_xref="PomBase:SPAC977.14c.1"
                     /translation="MSSLSPELYGCLGNSGLKVSKLILGCMSYGKKEYWEDWVLEDEE
                     EVFKIMKAAYDAGIRTFDTANCYSAGVSEELVGKFIRKYEIPRSSIVILSKCFFPVRK
                     DLIKIFGDLSSRGVHFLDSPELANQCGLSRKHIFDAVEDSVKRLGTYIDVLQIHRYDP
                     HVSAEEVMRALNDVVESGKVRYIGASTMRCYQFIELQNTAEKHGWHKFISMQNYHNLL
                     YREEEREMIPYCQKTGVGLIPWSPLARGLLTRSIDANEETIRSKTDLYTRALEFGAGY
                     KAILSRVEELAKKYNVSMATLATAWSLHKGDYPIVGISKVERLKDALAAVELKLSEED
                     IKYLEEPYCPVPIQGEI"
     gene            62961..63862
                     /locus_tag="SPAC977.15"
                     /db_xref="GeneID:2543311"
     mRNA            62961..63862
                     /locus_tag="SPAC977.15"
                     /product="dienelactone hydrolase family"
                     /transcript_id="NM_001018186.2"
                     /db_xref="GeneID:2543311"
     CDS             62989..63732
                     /locus_tag="SPAC977.15"
                     /codon_start=1
                     /product="dienelactone hydrolase family"
                     /protein_id="NP_592786.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC977.15"
                     /db_xref="EnsemblGenomes-Tr:SPAC977.15.1"
                     /db_xref="GeneID:2543311"
                     /db_xref="GOA:Q9P7U1"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PomBase:SPAC977.15"
                     /db_xref="PomBase:SPAC977.15.1"
                     /translation="MPCCPTKSGAAPTNRNYELQGEMLKDIGGMQTYFTGKRSSKVVL
                     IGFMDVFGLSKQIKEGADQLANHELAIYLPDFLNGETASIEMIDPKTIEQKEARSKFM
                     EKISSPLHWPKLTKVIEDIERIHGQDVKIGAYGFCWGAKVLITYPNKERFLRIGCAHP
                     SLLDPVDAKHVHCPVCFLCSKDEDPEEVDAWKKSFENSPYFSESYFETFGKMHHGWMA
                     ARANLSDPENRKYFDLGYQIFLKFFKELF"
     gene            complement(64559..>66679)
                     /gene="dak2"
                     /locus_tag="SPAC977.16c"
                     /db_xref="GeneID:2541810"
     mRNA            complement(64559..>66679)
                     /gene="dak2"
                     /locus_tag="SPAC977.16c"
                     /product="dihydroxyacetone kinase Dak2"
                     /transcript_id="NM_001018187.2"
                     /db_xref="GeneID:2541810"
     CDS             complement(64904..66679)
                     /gene="dak2"
                     /locus_tag="SPAC977.16c"
                     /EC_number="2.7.1.29"
                     /codon_start=1
                     /product="dihydroxyacetone kinase Dak2"
                     /protein_id="NP_592787.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC977.16c"
                     /db_xref="EnsemblGenomes-Tr:SPAC977.16c.1"
                     /db_xref="GeneID:2541810"
                     /db_xref="GOA:O74215"
                     /db_xref="InterPro:IPR004006"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="InterPro:IPR012734"
                     /db_xref="PomBase:SPAC977.16c"
                     /db_xref="PomBase:SPAC977.16c.1"
                     /translation="MSVKQFVSDGHIVRPYLLGLARSNPGLTVIEHDRVIYRTASAPG
                     SGDLPKVTLVSGGGSGHEPTHAGFVGDGALDAVACGDIFASPSTKQIYSALKAVASPK
                     GTLIIVKNYTGDIIHFGLAAERAKAAGMNVELVAVGDDVSVGKKRGALVGRRGLGATV
                     LVHKIAGSAAALGLDLHQVAQVAQSVIDNAATIAASLDHCAVPGRKFETNLGPDEYEI
                     GMGIHNEPGTFKSSPLPSIPELVTEMLSILFGEKNPDNSFVEFSSKDDVILLVNNMGG
                     MSNLELGYATEVVSEQLAKRGIIPKRTMSGTFVTALNGPGFGITLVNASKATPDIFKY
                     FDLPTTASGWNVSYHNAKDWEVLADGKVPTAPALEHTRNEKHSGVKADPKMFTKILKA
                     AVDAINEFEPKTTWYDTIAGDGDCGTTLVNGGEAITKAINDKSIRLDDGVNGIDDLAY
                     IVEDSMGGTSGGLYSIYLSALAKGVHESGDSELSVHTFAFASKYALDALFKYTRARKG
                     FRTLIDAIQPFVETLNEGKGLDAAAKAATEGSEQTRKMDAVVGRASYVAKEELHKLDS
                     EGGLPDPGAFALAAILNAIVEASEH"
     gene            66219..69821
                     /locus_tag="SPAC977.17"
                     /db_xref="GeneID:2543301"
     mRNA            66219..69821
                     /locus_tag="SPAC977.17"
                     /product="putative MIP superfamily protein"
                     /transcript_id="NM_001018188.2"
                     /db_xref="GeneID:2543301"
     CDS             67143..68939
                     /locus_tag="SPAC977.17"
                     /codon_start=1
                     /product="putative MIP superfamily protein"
                     /protein_id="NP_592788.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC977.17"
                     /db_xref="EnsemblGenomes-Tr:SPAC977.17.1"
                     /db_xref="GeneID:2543301"
                     /db_xref="GOA:Q9P7T9"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="PomBase:SPAC977.17"
                     /db_xref="PomBase:SPAC977.17.1"
                     /translation="MSVPLRFSTPSSSPSASDNESVHDDGPTTELDTFNTTDVPRRVN
                     TTKARQMRPKNTLKVAFSSPNLKGLDNTADSDSQPWLGGYLAGRLEDISGQSRRNYVD
                     PYYEELNAGRRPNKPVWSLNGPLPHVLGNSVVEKISQKNQEARSRANSRVNSRANSRA
                     NSSVSLAGMDGSPNWKRKMKSAVFGSRVKLNDEEAQLPRNKSSVSIAEQAASRPKVSF
                     SLQSSRQPSIAEEQPQTQRKSSAITVEHAENAEPETPRNNVSFSRKPSIAEQDSSQDI
                     TMPPNEIIAEESLDSGSDTETLYLNYWCKIRHFFREGFAEFLGTLVLVVFGVGSNLQA
                     TVTNGAGGSFESLSFAWGFGCMLGVYIAGGISGGHVNPAVTISLAIFRKFPWYKVPIY
                     IFFQIWGAFFGGALAYGYHWSSITEFEGGKDIRTPATGGCLYTNPKPYVTWRNAFFDE
                     FIGTAVLVGCLFAILDDTNSPPTQGMTAFIVGLLIAAIGMALGYQTSFTLNPARDLGP
                     RMFAWWIGYGPHSFHLYHWWWTWGAWGGTIGGGIAGGLIYDLVIFTGPESPLNYPDNG
                     FIDKKVHQITAKFEKEEEVENLEKTDSPIENN"
     gene            71030..71470
                     /locus_tag="SPNCRNA.137"
                     /db_xref="GeneID:9407054"
     misc_RNA        71030..71470
                     /locus_tag="SPNCRNA.137"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150246.1"
                     /db_xref="GeneID:9407054"
     gene            complement(71982..72380)
                     /gene="prl37"
                     /locus_tag="SPNCRNA.37"
                     /db_xref="GeneID:5802849"
     misc_RNA        complement(71982..72380)
                     /gene="prl37"
                     /locus_tag="SPNCRNA.37"
                     /product="non-coding RNA,poly(A)-bearing (predicted)"
                     /transcript_id="NR_150767.1"
                     /db_xref="GeneID:5802849"
     gene            72344..72414
                     /locus_tag="SPNCRNA.83"
                     /db_xref="GeneID:5802850"
     misc_RNA        72344..72414
                     /locus_tag="SPNCRNA.83"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_151210.1"
                     /db_xref="GeneID:5802850"
     repeat_region   complement(73709..73977)
                     /rpt_type=long_terminal_repeat
     repeat_region   73945..74282
                     /rpt_type=long_terminal_repeat
     gene            complement(74452..76721)
                     /locus_tag="SPAPJ695.02"
                     /db_xref="GeneID:14218113"
     mRNA            complement(74452..76721)
                     /locus_tag="SPAPJ695.02"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001355961.1"
                     /db_xref="GeneID:14218113"
     CDS             complement(75698..75910)
                     /locus_tag="SPAPJ695.02"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_001343098.1"
                     /db_xref="EnsemblGenomes-Gn:SPAPJ695.02"
                     /db_xref="EnsemblGenomes-Tr:SPAPJ695.02.1"
                     /db_xref="GeneID:14218113"
                     /db_xref="GOA:G2TRM2"
                     /db_xref="PomBase:SPAPJ695.02"
                     /db_xref="PomBase:SPAPJ695.02.1"
                     /translation="MSDFNLRRYYTSNQLLKFSNEYPKSMTEIKKGELKGYDIFTSST
                     INMVVGNLLRDVQNRIDQADQIEKRS"
     gene            complement(77480..78066)
                     /locus_tag="SPAPJ695.01c"
                     /db_xref="GeneID:2543320"
     mRNA            complement(77480..78066)
                     /locus_tag="SPAPJ695.01c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018189.2"
                     /db_xref="GeneID:2543320"
     CDS             complement(77578..77931)
                     /locus_tag="SPAPJ695.01c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592789.1"
                     /db_xref="EnsemblGenomes-Gn:SPAPJ695.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAPJ695.01c.1"
                     /db_xref="GeneID:2543320"
                     /db_xref="GOA:Q9URW1"
                     /db_xref="InterPro:IPR019445"
                     /db_xref="PomBase:SPAPJ695.01c"
                     /db_xref="PomBase:SPAPJ695.01c.1"
                     /translation="MLLLLYICCLFLKFILANVDLTFVEYAKLPSKYAELLANATNQQ
                     GVMLFSTGDIRIGAYNYLVNNVTEINNDTDAYLCQLLTGQYTTDCYIFDTNSDDKPET
                     FNSSIHLLNSDLDPK"
     gene            79209..79317
                     /locus_tag="SPNCRNA.138"
                     /db_xref="GeneID:9407300"
     misc_RNA        79209..79317
                     /locus_tag="SPNCRNA.138"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150257.1"
                     /db_xref="GeneID:9407300"
     gene            79543..79628
                     /locus_tag="SPNCRNA.76"
                     /db_xref="GeneID:5802851"
     misc_RNA        79543..79628
                     /locus_tag="SPNCRNA.76"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_151133.1"
                     /db_xref="GeneID:5802851"
     repeat_region   complement(79680..79768)
                     /rpt_type=long_terminal_repeat
     gene            complement(81468..82345)
                     /locus_tag="SPNCRNA.603"
                     /db_xref="GeneID:14218099"
     misc_RNA        complement(81468..82345)
                     /locus_tag="SPNCRNA.603"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_150964.1"
                     /db_xref="GeneID:14218099"
     gene            82746..84786
                     /gene="ght3"
                     /locus_tag="SPAC1F8.01"
                     /db_xref="GeneID:2541758"
     mRNA            82746..84786
                     /gene="ght3"
                     /locus_tag="SPAC1F8.01"
                     /product="hexose transporter Ght3"
                     /transcript_id="NM_001018190.2"
                     /db_xref="GeneID:2541758"
     CDS             82936..84603
                     /gene="ght3"
                     /locus_tag="SPAC1F8.01"
                     /codon_start=1
                     /product="hexose transporter Ght3"
                     /protein_id="NP_592790.1"
                     /db_xref="GeneID:2541758"
                     /db_xref="GOA:Q92339"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /translation="MNRFITSILVVFISMSGWLQGADTGSISGILGMRDFQSRFADRY
                     NPISNSYSYSAWRQALLTGTINAGCLFGAMLSSPFTERIGKKYSICFFSGVYIIAELL
                     LVTAVPSWIQVLVGKILAGVGIGALSVLSPGYQSEVAPPQIRGAVVATYQIFSTGAAL
                     VAACINMGTHKLRKTASWRTSFGINMLWGILLMVGVLFLPESPRYLIYKGRDEEALRI
                     MCNMAELSPESEIIQTNFNTIKSDIEIEMAGGKARWIEIFGKDIRYRTCLGFLVMLFR
                     ELIGNNYYFYYATQVFKGTGMTDIFLPAVILGAINFGTTFGALYTIDNLGRRNPLIFG
                     AAFQSICFFIYAAVGDRKLIYKNGTSDHRAGSVMIVFSCLFLFSYCCSWGPMGWVIVG
                     ETFPIRYRSKCASVATSGNWLGNFMISFFTPFINNAIGFKLGYIYACINLFSSFMIFF
                     LAKETKGLTLEEVNDLYMSNIKPWESYKYVREIESHRIHFSKEEEKREREKSKGIRGQ
                     EEEFIENADEDNNDSSSSSGSVVSAVKPRRSAVSNDRFSEDSHPTYI"
     gene            complement(85566..86324)
                     /locus_tag="SPAC1F8.02c"
                     /db_xref="GeneID:2541821"
     mRNA            complement(85566..86324)
                     /locus_tag="SPAC1F8.02c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018191.2"
                     /db_xref="GeneID:2541821"
     CDS             complement(85598..86278)
                     /locus_tag="SPAC1F8.02c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592791.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F8.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F8.02c.1"
                     /db_xref="GeneID:2541821"
                     /db_xref="GOA:Q92340"
                     /db_xref="PomBase:SPAC1F8.02c"
                     /db_xref="PomBase:SPAC1F8.02c.1"
                     /translation="MISLKIYFVLIFLFLKGINSAYVSNEEGETVDFTFSGFYANLTY
                     PNEISELNYVEGNYLSTRIVRFNGSFYCDTTILSETNNVTGSCYVANCANDTVLEICD
                     SGKEVHFTDMSGTTWSADTFTENLYWFCGGDGNKPNMTTAAAMNSDIDSYYVYGNWTI
                     DTADSTVADYTCNYTHFQEAGDIEKGDVYTASADSSDSSSASSTIFKPSYFISCLLSV
                     GLYLVLNF"
     gene            complement(88201..90300)
                     /gene="str3"
                     /locus_tag="SPAC1F8.03c"
                     /db_xref="GeneID:2541891"
     mRNA            complement(88201..90300)
                     /gene="str3"
                     /locus_tag="SPAC1F8.03c"
                     /product="siderophore-Fe(3+) transporter Str3"
                     /transcript_id="NM_001018192.2"
                     /db_xref="GeneID:2541891"
     CDS             complement(88367..90259)
                     /gene="str3"
                     /locus_tag="SPAC1F8.03c"
                     /codon_start=1
                     /product="siderophore-Fe(3+) transporter Str3"
                     /protein_id="NP_592792.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F8.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F8.03c.1"
                     /db_xref="GeneID:2541891"
                     /db_xref="GOA:Q92341"
                     /db_xref="InterPro:IPR010290"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="PomBase:SPAC1F8.03c"
                     /db_xref="PomBase:SPAC1F8.03c.1"
                     /translation="MEAKETHSISDHEVELQDAKPEEKSENGNFVFEKAFSSDEEKGS
                     GYNTNETYSKMDNSLQHRGVSKIEAVRDSIYQNKRGMYLAYAFGIAILACSWASAIQS
                     STTYSYQVYATASFNRTSMISTLEIATAIISSVCKPILGKFSDITSRPMTYTLVLLFY
                     VIGFIVVASSSTISAYVIGSVFISIGSSGLDYLNTLVVGDLTSLKWRGFMTALLSTPY
                     IATVWFTGFIVQGIIDSNWRWGYGMFAIIMPAVMTPAVIILMYLERQANKDENIKKII
                     NYQTEEKNKNKQSKWQKLWKAVLEVDLFGLILLGVGWSILLLPFSLTSYAKNGWKNPS
                     MIAMMVVGGVILIAYSGYEMFIAPYPSCPRRVMNRTFITAVIIDFFYYLAGYLQSMYF
                     TTYTWILYDWSYRDWTYFNNTMTIALCVFGVFAGAMHRVFHRYKYLQIIGLVIKIVGY
                     GILIRPNFAATGKVDLAWSLILIGMGGSFSVVGSQVSCQASVPHQDLAIASSLLPLYT
                     NIGGAIGAAIASPIFSNKVPKYLREYLPSSINDTQVYNFYSDSSLIREYPVGTEIRDG
                     AIKAYSRSMFFLLVPAVSLSFIPLAAAFWQSNFYLGNQQNAVEGDQDHKKKGDKETTQ
                     EEKIII"
     gene            complement(90681..91753)
                     /locus_tag="SPNCRNA.604"
                     /db_xref="GeneID:14218351"
     misc_RNA        complement(90681..91753)
                     /locus_tag="SPNCRNA.604"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_150965.1"
                     /db_xref="GeneID:14218351"
     gene            90868..91753
                     /locus_tag="SPNCRNA.139"
                     /db_xref="GeneID:9407122"
     misc_RNA        90868..91753
                     /locus_tag="SPNCRNA.139"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150268.1"
                     /db_xref="GeneID:9407122"
     gene            90949..94038
                     /locus_tag="SPNCRNA.605"
                     /db_xref="GeneID:14218056"
     misc_RNA        90949..94038
                     /locus_tag="SPNCRNA.605"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150966.1"
                     /db_xref="GeneID:14218056"
     gene            complement(92387..93931)
                     /locus_tag="SPAC1F8.04c"
                     /db_xref="GeneID:2541820"
     mRNA            complement(92387..93931)
                     /locus_tag="SPAC1F8.04c"
                     /product="putative hydrolase"
                     /transcript_id="NM_001018193.2"
                     /db_xref="GeneID:2541820"
     CDS             complement(92480..93871)
                     /locus_tag="SPAC1F8.04c"
                     /codon_start=1
                     /product="putative hydrolase"
                     /protein_id="NP_592793.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F8.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F8.04c.1"
                     /db_xref="GeneID:2541820"
                     /db_xref="GOA:Q92342"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="PomBase:SPAC1F8.04c"
                     /db_xref="PomBase:SPAC1F8.04c.1"
                     /translation="MLYTHANIITVNPTRDILIDGAILVKDGSNTIDDIGKTDRLVSI
                     YPNEKHKSLEGHIVMPGLISLHVHLAQSLLRSAADDLPLISWLCDTVWKMQGNFTQED
                     GYVASQLTIAEMLKSGTTTFVEALFAQRYGIEGAVKAVIESGIRGCIGKVVMDQPRYA
                     TQTGVSMHEGLIENSNSLNQAVESHSKFHGKGNGRVEIWFGARTPGGVSEELYRKMVK
                     IARANNIGITMHCAEVKADREFFASKEHTPMTYCKDLGLLGPKTVLAHMVHLDTQDLE
                     ILEKHGNGTSVAHCPVSNSKLGSGIAPLKEMLEKSIIVGIGCDGCPCNNTMDLLQEMK
                     MASLLPKALHGDPSIVPAEKIVEMATINGAKALGRDDLGSLEVGKKADFISLDLSNKL
                     YAQPLRDLVSAVVYIATGADVATVVIDGKLIVEDHVLLTIDEPKLIDKAKKHGKKLQE
                     RAKVDVKGRWKEI"
     gene            complement(95159..96525)
                     /locus_tag="SPNCRNA.606"
                     /db_xref="GeneID:14217905"
     misc_RNA        complement(95159..96525)
                     /locus_tag="SPNCRNA.606"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150967.1"
                     /db_xref="GeneID:14217905"
     gene            95961..96966
                     /gene="isp3"
                     /locus_tag="SPAC1F8.05"
                     /gene_synonym="meu4"
                     /db_xref="GeneID:2541879"
     mRNA            95961..96966
                     /gene="isp3"
                     /locus_tag="SPAC1F8.05"
                     /gene_synonym="meu4"
                     /product="protein isp3"
                     /transcript_id="NM_001018194.2"
                     /db_xref="GeneID:2541879"
     CDS             96000..96548
                     /gene="isp3"
                     /locus_tag="SPAC1F8.05"
                     /gene_synonym="meu4"
                     /codon_start=1
                     /product="protein isp3"
                     /protein_id="NP_592794.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F8.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F8.05.1"
                     /db_xref="GeneID:2541879"
                     /db_xref="GOA:P40899"
                     /db_xref="PomBase:SPAC1F8.05"
                     /db_xref="PomBase:SPAC1F8.05.1"
                     /translation="MGLGNLCSYKQDDSLDILQKKVLIDAFNKVTIDGKPNVQHQQPT
                     YWYPPPPPRHHKEHKKSHHHWEYSSDDDSSDDEESCEKKKPKCCEKKKPKCCESEQNN
                     GCGRRNQLARRLAFLGSFGDGDCDGCNEAFTVTGPITYFRTCPDPLTGITPAVAAAAA
                     TPAAAATPATPAAAATPAAPAA"
     repeat_region   98631..98942
                     /rpt_type=long_terminal_repeat
     repeat_region   complement(98988..99228)
                     /rpt_type=long_terminal_repeat
     gene            complement(99046..101140)
                     /locus_tag="SPNCRNA.607"
                     /db_xref="GeneID:14218218"
     misc_RNA        complement(99046..101140)
                     /locus_tag="SPNCRNA.607"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150968.1"
                     /db_xref="GeneID:14218218"
     gene            99871..101431
                     /gene="fta5"
                     /locus_tag="SPAC1F8.06"
                     /gene_synonym="sma5"
                     /db_xref="GeneID:2541854"
     mRNA            99871..101431
                     /gene="fta5"
                     /locus_tag="SPAC1F8.06"
                     /gene_synonym="sma5"
                     /product="glycoprotein"
                     /transcript_id="NM_001018195.2"
                     /db_xref="GeneID:2541854"
     CDS             100011..101168
                     /gene="fta5"
                     /locus_tag="SPAC1F8.06"
                     /gene_synonym="sma5"
                     /codon_start=1
                     /product="glycoprotein"
                     /protein_id="NP_592795.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F8.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F8.06.1"
                     /db_xref="GeneID:2541854"
                     /db_xref="GOA:Q92344"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="PomBase:SPAC1F8.06"
                     /db_xref="PomBase:SPAC1F8.06.1"
                     /translation="MNSYISLIFTLLFFTSAARSSSVSVETGSCVRYTTIYSSGSSEF
                     TSTITPETPSSSSSTFVPISTHTSSATNTTSGQLSISSSSSTSSEYSSSSIPITTVSS
                     SDSFIPSSSQTISASSSTTDNVIVSSSISSTVSSTPVSTIYSGTSGTTFVSSSTTYQV
                     IPTQICDGVRGLEYAVYNYDLPSESTFCHPSNGYTEVSTFNKPAYFGSKDLKQSAPLF
                     TGIFSSLDDIPTYSASDYLPAYPPNPEGMSSTSSSCKTIVYQFFFRVPATDNWSLFVK
                     NVDDAFFGWFGDKAISGWSNVNYDAYAHWRIGAYGMGTFDLGYLEQDSFVPVRFVLAN
                     GAYIGGFDFAFNSSSTGPVRTTSYSYTSTCDKSFLPFGKGNGGLDEGTANV"
     gene            complement(101715..103594)
                     /locus_tag="SPAC1F8.07c"
                     /db_xref="GeneID:2541874"
     mRNA            complement(join(101715..101869,101872..103594))
                     /locus_tag="SPAC1F8.07c"
                     /product="putative pyruvate decarboxylase"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="NM_001018196.3"
                     /db_xref="GeneID:2541874"
     CDS             complement(join(101836..101869,101872..103544))
                     /locus_tag="SPAC1F8.07c"
                     /EC_number="4.1.1.1"
                     /artificial_location="low-quality sequence region"
                     /codon_start=1
                     /product="putative pyruvate decarboxylase"
                     /protein_id="NP_592796.3"
                     /db_xref="GeneID:2541874"
                     /db_xref="GOA:Q92345"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /translation="MTKDAESTMTVGTYLAQRLVEIGIKNHFVVPGDYNLRLLDFLEY
                     YPGLSEIGCCNELNCAFAAEGYARSNGIACAVVTYSVGALTAFDGIGGAYAENLPVIL
                     VSGSPNTNDLSSGHLLHHTLGTHDFEYQMEIAKKLTCAAVAIKRAEDAPVMIDHAIRQ
                     AILQHKPVYIEIPTNMANQPCPVPGPISAVISPEISDKESLEKATDIAAELISKKEKP
                     ILLAGPKLRAAGAESAFVKLAEALNCAAFIMPAAKGFYSEEHKNYAGVYWGEVSSSET
                     TKAVYESSDLVIGAGVLFNDYSTVGWRAAPNPNILLNSDYTSVSIPGYVFSRVYMAEF
                     LELLAKKVSKKPATLEAYNKARPQTVVPKAAEPKAALNRVEVMRQIQGLVDSNTTLYA
                     ETGDSWFNGLQMKLPAGAKFEVEMQWGHIGWSVPSAMGYAVAAPERRTIVMVGDGSFQ
                     LTGQEISQMIRHKLPVLIFLLNNRGYTIEIQIHDGPYNRIQNWDFAAFCESLNGETGK
                     AKGLHAKTGEELTSAIKVALQNKEGPTLIECAIDTDDCTQELVDWGKAVAANARPPTA
                     DN"
     gene            <103941..104953
                     /locus_tag="SPAC1F8.08"
                     /db_xref="GeneID:2541747"
     mRNA            <103941..104953
                     /locus_tag="SPAC1F8.08"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018197.2"
                     /db_xref="GeneID:2541747"
     CDS             103941..104303
                     /locus_tag="SPAC1F8.08"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592797.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F8.08"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F8.08.1"
                     /db_xref="GeneID:2541747"
                     /db_xref="GOA:Q9C113"
                     /db_xref="PomBase:SPAC1F8.08"
                     /db_xref="PomBase:SPAC1F8.08.1"
                     /translation="MSTSGMLFIFATFCPCFLSCCAFMSHWKLKDFSFRFLRMCGERS
                     LVVCYPLKLLKQIRSLFSIAIGHLSLMLIEGSANLLSLEEISRTLLRILDFVGNKNMR
                     TYLEVPLCRWHISQARPN"
     repeat_region   106349..106684
                     /rpt_type=long_terminal_repeat
     gene            106893..108361
                     /locus_tag="SPAC11D3.19"
                     /db_xref="GeneID:14217906"
     mRNA            106893..108361
                     /locus_tag="SPAC11D3.19"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001355962.1"
                     /db_xref="GeneID:14217906"
     CDS             106965..107198
                     /locus_tag="SPAC11D3.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_001343099.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.19"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.19.1"
                     /db_xref="GeneID:14217906"
                     /db_xref="GOA:G2TRM3"
                     /db_xref="PomBase:SPAC11D3.19"
                     /db_xref="PomBase:SPAC11D3.19.1"
                     /translation="MVPYTETSICLTNVPCGYMNVSGCFKGADALTILHECDEANVYT
                     ATFWSTSSGTRRNSAVICTLIANLMAFFMLLTM"
     gene            complement(108732..109195)
                     /locus_tag="SPAC11D3.01c"
                     /db_xref="GeneID:2542984"
     mRNA            complement(108732..109195)
                     /locus_tag="SPAC11D3.01c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018198.2"
                     /db_xref="GeneID:2542984"
     CDS             complement(108908..109147)
                     /locus_tag="SPAC11D3.01c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592798.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.01c.1"
                     /db_xref="GeneID:2542984"
                     /db_xref="GOA:Q10080"
                     /db_xref="InterPro:IPR018824"
                     /db_xref="PomBase:SPAC11D3.01c"
                     /db_xref="PomBase:SPAC11D3.01c.1"
                     /translation="MPNPGNVIGGHKAALHNPNVSEETKQREKEYLEEHEGEVGEEHQ
                     KNTGNVRGGYKAAMHNPNVSGEAKQRAQEELENLE"
     gene            109628..112377
                     /locus_tag="SPNCRNA.608"
                     /db_xref="GeneID:14217857"
     misc_RNA        109628..112377
                     /locus_tag="SPNCRNA.608"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150969.1"
                     /db_xref="GeneID:14217857"
     gene            complement(<109829..110455)
                     /locus_tag="SPAC11D3.02c"
                     /db_xref="GeneID:2542974"
     mRNA            complement(<109829..110455)
                     /locus_tag="SPAC11D3.02c"
                     /product="putative ELLA family acetyltransferase"
                     /transcript_id="NM_001018199.2"
                     /db_xref="GeneID:2542974"
     CDS             complement(109829..110281)
                     /locus_tag="SPAC11D3.02c"
                     /codon_start=1
                     /product="putative ELLA family acetyltransferase"
                     /protein_id="NP_592799.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.02c.1"
                     /db_xref="GeneID:2542974"
                     /db_xref="GOA:Q10081"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="PomBase:SPAC11D3.02c"
                     /db_xref="PomBase:SPAC11D3.02c.1"
                     /translation="MSNLEFVYKYFNSLDVKELYDIYLLRTNVFVVEQKCAYPEVDEI
                     DLKCGHLMLRNANGKLVAYARLIPEQQQTVRIGRVVVDPDERKNGYGRKLMLQALETS
                     KQEFSSSKTFVLSSQEYAQPLYRSVGFKKCSDAYLEDGIPHVEMRLEL"
     gene            complement(110904..112499)
                     /locus_tag="SPAC11D3.03c"
                     /db_xref="GeneID:2542947"
     mRNA            complement(join(110904..112046,112098..112333,
                     112378..112499))
                     /locus_tag="SPAC11D3.03c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001355963.1"
                     /db_xref="GeneID:2542947"
     CDS             complement(111005..111913)
                     /locus_tag="SPAC11D3.03c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_001342804.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.03c.1"
                     /db_xref="GeneID:2542947"
                     /db_xref="GOA:Q10082"
                     /db_xref="InterPro:IPR018959"
                     /db_xref="PomBase:SPAC11D3.03c"
                     /db_xref="PomBase:SPAC11D3.03c.1"
                     /translation="MTEISELASSSQKPEKTKYNLPKPLPAYYPHPGSPLYADKELYA
                     RIANAPKKLVGRHVCQPRTGLAVKIPQKSIFSIVVPEGPQVCDLNIWNFHNPRERFWA
                     ARTRQIHSAHVSTYDRLWSTLPYLRPLVTIIGDSLQARHDEWGGRVHDTLGTRCDPYI
                     DKLISGKDNDLHCHSNLTRAIMPYGLTEFDVHDVLNVFQVTGLNEYDQYFMETCPATS
                     KDYFQCFAEQDLLVAISACPGGDLSNWGWGEDATDVESSKMVDCCRPLAIEVYELEDE
                     ENSLKGWVPPQVVNYTGNHGLKAPSS"
     gene            complement(112514..114445)
                     /locus_tag="SPAC11D3.04c"
                     /db_xref="GeneID:2543007"
     mRNA            complement(join(112514..113367,113435..114445))
                     /locus_tag="SPAC11D3.04c"
                     /product="SnoaL"
                     /transcript_id="NM_001355964.1"
                     /db_xref="GeneID:2543007"
     CDS             complement(112917..113309)
                     /locus_tag="SPAC11D3.04c"
                     /codon_start=1
                     /product="SnoaL"
                     /protein_id="NP_001342805.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.04c.1"
                     /db_xref="GeneID:2543007"
                     /db_xref="GOA:Q10083"
                     /db_xref="InterPro:IPR009959"
                     /db_xref="PomBase:SPAC11D3.04c"
                     /db_xref="PomBase:SPAC11D3.04c.1"
                     /translation="MSQDSESFIRQLFKAFTDFSTDVESLRGFLTPDYRQLVDGRELT
                     LDDFISHAKALRTHLHRLDINVQQIVCQGNKAATVHIAHAIRSSGESSRIKVIAFYSF
                     KDGRISLIDELTYVLEGGNADRELGSVQ"
     gene            113950..115962
                     /gene="mfs2"
                     /locus_tag="SPAC11D3.05"
                     /db_xref="GeneID:2542991"
     mRNA            113950..115962
                     /gene="mfs2"
                     /locus_tag="SPAC11D3.05"
                     /product="putative MFS family membrane transporter"
                     /transcript_id="NM_001018202.2"
                     /db_xref="GeneID:2542991"
     CDS             114080..115720
                     /gene="mfs2"
                     /locus_tag="SPAC11D3.05"
                     /codon_start=1
                     /product="putative MFS family membrane transporter"
                     /protein_id="NP_592802.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.05.1"
                     /db_xref="GeneID:2542991"
                     /db_xref="GOA:Q10084"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="PomBase:SPAC11D3.05"
                     /db_xref="PomBase:SPAC11D3.05.1"
                     /translation="MDLLSLITGKKFEKHYSKVGSRFSDESLNGLEKQLSNGADAAID
                     TTADDRGSVVSLGASLPLSQGRPAKSKNILNDTLLAEDQYLVTWDGPDDPLNPRNWSH
                     SYKWWIVIQVSVITIVVTFASSVYSSGIIDIASELHSSIPVSTLGSCTFLVGFGVGSL
                     PFAPLSDIYGRFIIYFVTLLIFTIFQVGGGCAHNVWTLAIVRFFQGVFGSTPLANAGG
                     TISDLFTPVQRTYVLPGFCTFPYLGPIIGPIIGDFITQSYLEWRWTFWINMIWAAAVI
                     VFVFIFFPETHEDTILDYKAKYLRKTTGNTAYYTIHERERDPKNAMIQAATQAVSLIF
                     TEPIVVCFTLYLTVVYIINYINFEGYPIVFAKYGFNKGEQGLSFIGVGVGIVCAGLCT
                     PFIYWHYLKVNKKRNGVICPEDRLYPLFIGCFLLPISMFWFAWTCYPHHIHWIVPIIA
                     SAFFGFSLLIVFFVSYNYIIDSYQHMAPSALAAATLVRYSASGGISMVARPMYLNLGD
                     HWATSVLGFISVAMVPIPFIFYRFGKSIRAWSKNAYKL"
     gene            complement(116054..120309)
                     /locus_tag="SPAC11D3.07c"
                     /db_xref="GeneID:2541653"
     mRNA            complement(116054..120309)
                     /locus_tag="SPAC11D3.07c"
                     /product="putative transcription factor"
                     /transcript_id="NM_001018204.3"
                     /db_xref="GeneID:2541653"
     gene            116331..118189
                     /locus_tag="SPAC11D3.06"
                     /db_xref="GeneID:2542994"
     mRNA            116331..118189
                     /locus_tag="SPAC11D3.06"
                     /product="putative MatE family transporter"
                     /transcript_id="NM_001018203.2"
                     /db_xref="GeneID:2542994"
     CDS             116693..118060
                     /locus_tag="SPAC11D3.06"
                     /codon_start=1
                     /product="putative MatE family transporter"
                     /protein_id="NP_592803.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.06.1"
                     /db_xref="GeneID:2542994"
                     /db_xref="GOA:Q10085"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="PomBase:SPAC11D3.06"
                     /db_xref="PomBase:SPAC11D3.06.1"
                     /translation="MGRPLTEVKYLLINSAPVILGYALQNSLQTSSVIVTGRLGPSEL
                     SVAAFAYMFAMSTGWLIALGGTTAFDTLGSNLWGAGKKQELGILLQTGFIVLSILYLP
                     ICLVWWYSKPILIFLHQTPELAEASQKFLRYLIPGGLGYVCFELLKKFLQTQEITRAG
                     SYILLVTSPLNVALNFLLVHYYGLGLKGAPLATGLSYWLSFILLTQYAKYVKGAEAWN
                     GWNKRCLENFGPFVKLSLLGIVMVGTEWWAFEIVALVAGKLGAVPLAAQSVIMTTDQL
                     LNTIPFGLGIITSNRVAYYLGAGLPDNASLTAKVAAIVGVAVGSVIMITMIAVRNIYG
                     RIFTNDPDVIQLVALVMPLVAAFQISDSLNGTMGGALRGTGRQKVGAIVNITAYYLFA
                     LPLGIYLAFHGKGLVGLWIGQVIALSIVGILELKIVMATDWISQSRKAISRFGDSSEL
                     TALLN"
     CDS             complement(118195..120108)
                     /locus_tag="SPAC11D3.07c"
                     /codon_start=1
                     /product="putative transcription factor"
                     /protein_id="NP_592804.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.07c.1"
                     /db_xref="GeneID:2541653"
                     /db_xref="GOA:Q10086"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="PomBase:SPAC11D3.07c"
                     /db_xref="PomBase:SPAC11D3.07c.1"
                     /translation="MSQNKACDLCRLKKIKCSRGQPRCQTCTLFQADCHYSNRARRKR
                     LVQRSKETFGGITLPVFDYAAGINGNEPEPSDHSIPNQENFALTTNGTISKNIEKPED
                     GEESVQRRLKLLEEKIDLLLDIATETSEFKRENKAIELPSLVTQIKDAESIVIKHRQG
                     SPVDNTPTRILNVESLFPPQLPDWEKAFHDIPKKEVAHELVTSYFQHVNWWWPTFVYN
                     DFMYEFERLYAFGFHSNNAWLISFYSILALSSIRKRLGNSKTLAESLFSTAWVFVQKS
                     DFFLTPSIDKVQALIVMTQYAAYLSSSSLCRTLCGQACLMAQQLNLHRKQSTDVEPEK
                     AESWKRIFWMCYILDKNISLIFGTPSVFNDKDIDCNLPDSKYELLFGVQSGGDLIFVP
                     TVSLTIIQSEIRNRLYSVKSPTQMAAREKIIIPIHQKLKAWEENLPSEIKMYHEMLLN
                     NTFSPTISLSDRFEFLTFAGMEVYFSYLNTLIILHRPSSSTENRRICINAAREAVQLL
                     KNRLNIDLRVNVKADPLWIFLYCPFTPFLIIFNNLVHETDTETDSETLLNDLDLLHVI
                     YDFFMEMEPVSDVALELVKIADKLLRVAKEVCSAKNNDVTDSTFKDIVEGFELNDLNS
                     WDFDRVTNVMRNL"
     gene            complement(120321..123785)
                     /locus_tag="SPAC11D3.08c"
                     /db_xref="GeneID:2542911"
     mRNA            complement(120321..123785)
                     /locus_tag="SPAC11D3.08c"
                     /product="amino-acid permease"
                     /transcript_id="NM_001018205.2"
                     /db_xref="GeneID:2542911"
     CDS             complement(120556..122208)
                     /locus_tag="SPAC11D3.08c"
                     /codon_start=1
                     /product="amino-acid permease"
                     /protein_id="NP_592805.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.08c.1"
                     /db_xref="GeneID:2542911"
                     /db_xref="GOA:Q10087"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="PomBase:SPAC11D3.08c"
                     /db_xref="PomBase:SPAC11D3.08c.1"
                     /translation="MSDIDKESLKQNQKQWENEVELGESREANQDDELLMSLGYKPEF
                     TREFSYVSIFGQSFGSMGLCPAMAGSLIFSMNCGGGGMVWSWIIGCICLIPVSISLGE
                     LASSMPTSGGLYFWIFTLASPSSRAFLCWVCGYVSVLGYATIYASTVYSASSMVQALA
                     VIGSPSYSPTKYEQYGIYAALLFVISAMTAIPSRVIAKVNIINITFQFLVSIILIIAL
                     AAGSDSTTRNSGSFIFGDFTNYSGWSNMGWAFILSFTTPVWVVSGFESSAAVAEESTN
                     AAKAAPFAMISSLGVATILGWCIVITVVATMGHDFNAILGSSLGQPVAQVLVNNVGNK
                     GALGIFSLLVIALCLNCISLLIAASREVFAFCRDGGIPGSRYLRLLTKQKVPLNAILL
                     VLLYSLLVGLLILVNVTAISSVFNLAIIALYIAYSGPLMCRFVYNKFQPGVFYVGKWS
                     KPAALWSLVWMWFMILMLLFPQYQKPNQDEMNWAIVVLGFVMVFCVVYYYLPKIGGKT
                     FFTGPIPTVQQENEYISGVPLNELSLSSLPLPKDFDQKQITE"
     gene            122187..124116
                     /locus_tag="SPAC11D3.09"
                     /db_xref="GeneID:2541568"
     mRNA            122187..124116
                     /locus_tag="SPAC11D3.09"
                     /product="putative agmatinase"
                     /transcript_id="NM_001018206.2"
                     /db_xref="GeneID:2541568"
     CDS             122845..124029
                     /locus_tag="SPAC11D3.09"
                     /EC_number="3.5.3.11"
                     /codon_start=1
                     /product="putative agmatinase"
                     /protein_id="NP_592806.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.09.1"
                     /db_xref="GeneID:2541568"
                     /db_xref="GOA:Q10088"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="PomBase:SPAC11D3.09"
                     /db_xref="PomBase:SPAC11D3.09.1"
                     /translation="MALQSLFLILLAGAAQLAQAHPKIFEQSRANAVETFDDAFPGDG
                     ETQADSVFSGIATFGRLPYWKCLNDKSQSFDIAFLGAPFDTGTSYRPGARFGPSGIRE
                     GSRRLNLYGGYNVPMETNPFNNWAKIVDCGDIPLTSYDNAVAIKQIENGHFELLTRKP
                     TSYSEKDGYALDGSVLPRVITLGGDHTIVLPILRSVSRAYGPVSIIHFDSHLDSWKPK
                     VFGGGKSSVGSINHGTYFYHASQEGLVSNDSNIHAGIRTTLSGLSDYDNDADCGFEII
                     EAREIDTIGIDAIIKRIRDRVGDGIAYLSIDIDVLDPAYAPATGTPESAGWTTRELRT
                     ILRGLDGIKLVGADIVEVAPAYDFAEVTTLAAADILFEVMSIMVKTPVYKEQAKQQSR
                     FY"
     gene            124907..129053
                     /locus_tag="SPAC11D3.10"
                     /db_xref="GeneID:2542999"
     mRNA            124907..129053
                     /locus_tag="SPAC11D3.10"
                     /product="putative cysteine desulfurase nifs family
                     protein"
                     /transcript_id="NM_001018207.2"
                     /db_xref="GeneID:2542999"
     CDS             125582..126886
                     /locus_tag="SPAC11D3.10"
                     /codon_start=1
                     /product="putative cysteine desulfurase nifs family
                     protein"
                     /protein_id="NP_592807.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.10.1"
                     /db_xref="GeneID:2542999"
                     /db_xref="GOA:Q10089"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PomBase:SPAC11D3.10"
                     /db_xref="PomBase:SPAC11D3.10.1"
                     /translation="MNALAKIKAFRSYVPLLQGNTKTIYLNQSFQAPMNMLVSTALQG
                     YINEGLYNPHPKPMWKERTEETRSLLAKLLNASTKDSITFTRDTTEGLNLFQRSLKWK
                     PGDNVVILDNEHPNQGFGWIALQNDGLEVRLVPNEGQYHANASTFAPYVDSRTKAIGL
                     SSVMFHSGQKNDVKDIANAFRPKGIHVLADLTQQVGLSKIDVQDLNVSACAFSCHKGL
                     GCPTGLGVLYVSPLAISELRSTPPFVGGGAVEDFKEDLKLKLNAKYHQSALRYEHTNN
                     AYMLITALRAYLKFLLKVGISNVERYLQGLGKDLIKELESLNVSVIGYKDFDKHSSHS
                     YVLKILNPEWFDFLRQQGVCVSRFESGIRVSFGLYNTSKDIIKFISVIRKGLALNIPL
                     NIRPPQRIAVMDNPLVGISDEAIAAMKLPANTLSNRPLAANI"
     gene            complement(126951..129316)
                     /locus_tag="SPAC11D3.11c"
                     /db_xref="GeneID:3361387"
     mRNA            complement(join(126951..129059,129103..129127,
                     129172..129316))
                     /locus_tag="SPAC11D3.11c"
                     /product="truncated GAL4-like Zn2Cys6 binuclear cluster
                     DNA-binding protein"
                     /transcript_id="NM_001355965.1"
                     /db_xref="GeneID:3361387"
     CDS             complement(join(128025..129059,129103..129127,
                     129172..129185))
                     /locus_tag="SPAC11D3.11c"
                     /codon_start=1
                     /product="truncated GAL4-like Zn2Cys6 binuclear cluster
                     DNA-binding protein"
                     /protein_id="NP_001343028.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.11c"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.11c.1"
                     /db_xref="GeneID:3361387"
                     /db_xref="GOA:G2TRN9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="PomBase:SPAC11D3.11c"
                     /db_xref="PomBase:SPAC11D3.11c.1"
                     /translation="MRSLSCIVCRQKKIKCDRKNPCTNCEQAGEKCMFKEYDSRKIRH
                     PHSYVKALETRLAGLEAFWKRVKYAPVNEKLELLKTISFNDHLSPDISVSKTDTTFEF
                     PVSLDIRGPNTIAFYGPTNVYGPPLTPSSPETPSFPPQNPSFSPLITDCLKLFFKWQY
                     PQFLFINREAFLVDYYYRYHEGRYCSEHLLYAMCAIGSRMSVDPNIAALAKNFYQIAW
                     NKIIEYGLGKSHITSIQCLLCLGYFNIGMGNTSLGWMLSGMAFRMGQDLGFQLNPRNW
                     SVNDHPVVSPADAAVRSRIYWGSYVTDIFISFVLGRPTTLKKSDTSIPDSESLPDFDG
                     VNEYRVNNALLLKEYLCIQSSVY"
     gene            130148..131268
                     /locus_tag="SPAC11D3.13"
                     /db_xref="GeneID:2542927"
     mRNA            130148..131268
                     /locus_tag="SPAC11D3.13"
                     /product="ThiJ domain protein"
                     /transcript_id="NM_001018208.2"
                     /db_xref="GeneID:2542927"
     CDS             130329..130997
                     /locus_tag="SPAC11D3.13"
                     /codon_start=1
                     /product="ThiJ domain protein"
                     /protein_id="NP_592808.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.13"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.13.1"
                     /db_xref="GeneID:2542927"
                     /db_xref="GOA:Q10092"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="PomBase:SPAC11D3.13"
                     /db_xref="PomBase:SPAC11D3.13.1"
                     /translation="MVLFMKTVQRPEHISLKSCIPFKSLQRQGIVFRLSVRMVMLADD
                     HSISDSALSDSDKNAFKDKNNDFWKAIKNAKNASDINFSDYSIFFAAGGHGTLFDFPS
                     ATNLHKGAAKIYSMGGVIAAVCHGPVILPCIKDSTGFSIVKGKTVTAFNEIAEQQMNL
                     MPTFEKYHFKTLNKLFQEAGSNFVDPQEPFDDFVKTDGKLVTGANPASAASTAKAALN
                     SLNS"
     gene            complement(131190..135736)
                     /locus_tag="SPAC11D3.14c"
                     /db_xref="GeneID:2542986"
     mRNA            complement(131190..135736)
                     /locus_tag="SPAC11D3.14c"
                     /product="putative oxoprolinase"
                     /transcript_id="NM_001018209.2"
                     /db_xref="GeneID:2542986"
     gene            131203..135541
                     /locus_tag="SPNCRNA.609"
                     /db_xref="GeneID:14217858"
     misc_RNA        131203..135541
                     /locus_tag="SPNCRNA.609"
                     /product="antisense RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_150970.1"
                     /db_xref="GeneID:14217858"
     CDS             complement(131319..135101)
                     /locus_tag="SPAC11D3.14c"
                     /codon_start=1
                     /product="putative oxoprolinase"
                     /protein_id="NP_592809.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.14c"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.14c.1"
                     /db_xref="GeneID:2542986"
                     /db_xref="GOA:Q10093"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="PomBase:SPAC11D3.14c"
                     /db_xref="PomBase:SPAC11D3.14c.1"
                     /translation="MKQDVRIAIDRGGTFTDVYYKISGWREQEGIFKLLSVNPKLYDD
                     APTEGIRRVLCYASGEEIPRKVPLDLTRVSSIRMGTTVATNALLERKGEKTAFIITEG
                     FRNLVEIGNQARPDLFDLTVSRPSPLYQRVIEAKERVVLENQFSKTAGIVQGITGEFL
                     RVEKKLDEEALYQDLKELYNEGFRSISVSLMHSYTYPLHEEVVEKIAKRIGFTDISLS
                     SKLTPMVKIVPRAVSAIIDAYLSSTLRYYLDSFKKNFYNVKPNTIQFMKSDGGLVDID
                     NFTAISAIMSGPAAGTVGFAKTSSLHADDKTPAIGFDMGGTSTDVSRYDGKFEHIYEA
                     NIFGLYIQSPQLDIQTVAAGGGSRLFWRNQLFSVGPESAGAFPGPACYLNGGPLTVTD
                     ANVLLGRIIPDFFPKIFGPKENESMNKDIVIEKFSELRDIINIDIEKEKTIEEIAMGF
                     IQVANETMCRPIRKLTESRGLDLSAHHLAVFGGAGGQHACAIASLLNIEKIIIHKYSS
                     VLSAYGLALAHVTHEEQMPCLSVLDEDNLPLIQSKFDVLDKKAVSFLENEGYLESQIS
                     TELFANLRYEGNDTTMMIAKPKDSWDFKTLFEESYKNQFGFSLIDRKIMVEDIRIRAI
                     ARASNQSEVDTVFASETENENTVFIRDNKPTMYTPVYFAEVGKVNCHVYQLSSLPVHS
                     LITGPAVIVDTTQTLLIEPSFTAKIFARHVLLEKTKSTLVVKKNVDLDPITMTIFANR
                     FMSISEQMGQVLQKTAVSVNVKERLDYSCALFSPDGGLVANAPHVPAMLGSMQTAVKW
                     QHNYWKGKLVPGDVLLSNHPIAGGVHLPDLTVVTPVFDNNKDIIFYCAARGHMVDVGG
                     ITPGSMPSNSKAIYEEGAAIKTFKVVKAGTFDEKGLTQLLFDEPAKYPDCSGSRTLRD
                     NISDVKAMLSACHRGRSMVEKLVVEYGLDIVQRSMYGIQAAAEKAVRDVLKAFSVQNS
                     QKPLKAIDYMDDGTPLQLEVKIDPETGDAVFDFEGTGPEVYGNWNAPIAITYSSVIYC
                     LRSIINQDIPLNEGCLKPIEIRIPPSCFLNPSETAAVVGGNVLTSQRITDVILKAFSI
                     CAASQGCMNNLTFGYDGENGEEGFAMYETIAGGAGAGPTWNGTSGVHTHMTNTRITDP
                     EVVERRAPVILRRFCLRENSGGKGEYHGGDGVIRHFEFRRSMHCSILSERRSRAPYGM
                     NGGEDGAMGVNTWIDCSNPDFPRYVNLGGKNHVLMGKGDHIVIETPGGGGYGAVSI"
     gene            135569..135926
                     /locus_tag="SPNCRNA.147"
                     /db_xref="GeneID:9407064"
     misc_RNA        135569..135926
                     /locus_tag="SPNCRNA.147"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150355.1"
                     /db_xref="GeneID:9407064"
     gene            136139..140365
                     /locus_tag="SPAC11D3.15"
                     /db_xref="GeneID:2542983"
     mRNA            136139..140365
                     /locus_tag="SPAC11D3.15"
                     /product="putative ATP-hydrolizing 5-oxoprolinase"
                     /transcript_id="NM_001018210.2"
                     /db_xref="GeneID:2542983"
     gene            complement(136274..137355)
                     /locus_tag="SPNCRNA.610"
                     /db_xref="GeneID:14217859"
     misc_RNA        complement(136274..137355)
                     /locus_tag="SPNCRNA.610"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150972.1"
                     /db_xref="GeneID:14217859"
     CDS             136331..140284
                     /locus_tag="SPAC11D3.15"
                     /codon_start=1
                     /product="putative ATP-hydrolizing 5-oxoprolinase"
                     /protein_id="NP_592810.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.15"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.15.1"
                     /db_xref="GeneID:2542983"
                     /db_xref="GOA:Q10094"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="PomBase:SPAC11D3.15"
                     /db_xref="PomBase:SPAC11D3.15.1"
                     /translation="MSVKIHIDRGGTFTDAIATFADESRPPIVIKLLSEDPSNYKDAS
                     IEAVRRILEIVQGKSIPRTEKLDTSCINHLRCGTTVATNALLERKGERCAFITTKGFK
                     DGLLIGNQSRPNIFELGIRRPEVLYSKVIEVDERVTLEDYVEDPMKVKTTIDGSDPSL
                     VVGRSGEVVRIMKKVDCDALRKDLQALYDEGFTSIAVCLAHSFTFPDHELLVGKIAEE
                     VGFSNISLSTKLMPMIKYVPRATSATADAYLSPVVRRYLAGFQSGFLHGLKTKDNSKG
                     VRCEFMQSDGGLVDVNKFSGLHAILSGPAGGVVGFALTSYDEDVKIPVIGFDMGGTST
                     DVSRYGGSYEHVFETTTAGVTIQSPQLDINTVAAGGGSRLFWKNGLFVVGPESAGAHP
                     GPVCYRKGGYLTVTDANLLLGRLLPESFPKIFGPNEDESLDVESTRKEFEKLTAEINS
                     GLEKERQMTADEVAFGFIKIANETMARPIRALTEAKGHDISIHRLTSFGGAGGQHCAA
                     IAKSLGITQVLVHKYSSILSAYGMALADVVSEVQEPSSFTLDDSNTESIKKRFDSLKE
                     EAKANLEEQGFTESQISYELFLNCRYQGTDSTLMISKPLESWDFKQSFFDKHKQEFGF
                     IFENKDIIIDDIRIRASGKSFQSKEPSVDAQLKELKFEPVQKSLATCVKDIYFEGGRV
                     PSEVYSLDNLPVGTIVNGPSLIVDKTQTIVVPPKAVARILHTHVVIDISHGNEYTAND
                     SLAKASTIDPIYLSVFGSRFMAVAEQMGRALQKTSVSTNVKERLDYSCALFDAKGNLV
                     ANAPHMPVHLGSMSTCVRTQAKIHEGKLKPGDVLVTNHPSYGGTHLPDITTITPHFEG
                     DEIMFYVAARAHHADIGGILPGSMPSSSKELSEEGATIKSEKLVVDGVFQEERMIDLL
                     YNEPAKVEGGSGSRCLRDNLNDLKAQVSANQKGINLITSLIKEYGKNSVLRYMKAIQE
                     NAESAVRQLLLGVRERFLGEDLYAEDHMDDGSKICLRITIDEENGDAIFDFTGTTEEI
                     YGNINAPEAVTYSAIIYCLRVLISENIPLNQGCLLPIKVIIPDNCFLKPSETAAVVGG
                     NVLTSQRITDTILKAFQACAASQGDTNNLTFGIGGKDPETGEVKPGFGYYETICGGSG
                     AIDGLDGTSGVHTHMTNTRITDLEVLERRYPVILRKFIIRENSGGAGKYKGGDGVIRD
                     IEFRIPVTLSILSERRAYHPYGMKGGKDAECGKNIWIRKDILPSGEQRVRQINVGGKN
                     TCHMQAGDHIVIMTPGGGGYGPPSERVDTVKKANGVQHFRANGTISQLQEIQHTN"
     gene            complement(140381..141653)
                     /locus_tag="SPAC11D3.16c"
                     /db_xref="GeneID:2542990"
     mRNA            complement(140381..141653)
                     /locus_tag="SPAC11D3.16c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018211.2"
                     /db_xref="GeneID:2542990"
     CDS             complement(140805..141200)
                     /locus_tag="SPAC11D3.16c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592811.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.16c"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.16c.1"
                     /db_xref="GeneID:2542990"
                     /db_xref="GOA:Q10095"
                     /db_xref="PomBase:SPAC11D3.16c"
                     /db_xref="PomBase:SPAC11D3.16c.1"
                     /translation="MTTLKVDEDLECALMEQFIEALHQRCTDIPRTQLCVLAISFNRF
                     ILHKSPDIFTYIQYYQQKLNSYGFPLPPVVLKSLQMPLTSPEPDADERFRDGDTEFDT
                     AGVTASSCFPVDVKSPSVRAFGNVTFQSD"
     gene            141199..144768
                     /locus_tag="SPAC11D3.17"
                     /db_xref="GeneID:2543006"
     mRNA            join(141199..141510,141559..144768)
                     /locus_tag="SPAC11D3.17"
                     /product="zf-C2H2 type zinc finger protein"
                     /transcript_id="NM_001355966.1"
                     /db_xref="GeneID:2543006"
     CDS             142675..144432
                     /locus_tag="SPAC11D3.17"
                     /codon_start=1
                     /product="zf-C2H2 type zinc finger protein"
                     /protein_id="NP_001342806.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.17"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.17.1"
                     /db_xref="GeneID:2543006"
                     /db_xref="GOA:Q10096"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="PomBase:SPAC11D3.17"
                     /db_xref="PomBase:SPAC11D3.17.1"
                     /translation="MVDHVSENSTNVLSAKRKLTEPSLIDSKRVFPCDQCAKRFTRHE
                     NLTRHKACHSKAEPIPCPYCEIKCKRKDLLKRHIQRFHNDKSVIEEGSKDVLDVKAAA
                     SQQEDNMKIVLPSFDAIDVPKAYHPSLRPYFTILPLIPSDFLEHYIEGYFEWFHPVFP
                     FIHQASFNSENVAASFLRSLVVIACLCTGIESDFSMALLFWDSGFHVLQLYLQGDPER
                     VKKAWVFQSRLLFCTASLFEKTACFSGIGHVLLKDLVHESRTFGWTKLNWSVEGDTDI
                     SNLIDLECIRRSVFCLYILEWFLALIFNKPPSLSVLELQMPLPISSALWSSKELLSKD
                     YWRPNPLNPRDALSILVNGPLLLEETNISGFVLLFAIFEFIRDEAKLSMIGLPRQPNR
                     SYEIMLQHLKVSMELSNPCAKTSSIFLCLWHLVLTYYYLPDPLFLRSITLTDLESATS
                     YFKDDSWMDDDYISPCMTTYNLTMGWENVIWGLRYAETELTKFKFDLPVPHLTLFRIF
                     LQGLYALRDFDQISTSSLQTFTMLWKKLSTSLNMKEDAQNTAPSTCVKEFSAFVASAL
                     DVEGGWGIGPLLTKAFRPT"
     gene            144733..146501
                     /locus_tag="SPNCRNA.611"
                     /db_xref="GeneID:14217860"
     misc_RNA        144733..146501
                     /locus_tag="SPNCRNA.611"
                     /product="antisense RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_150973.1"
                     /db_xref="GeneID:14217860"
     gene            complement(144819..146935)
                     /locus_tag="SPAC11D3.18c"
                     /db_xref="GeneID:2543005"
     mRNA            complement(join(144819..146869,146912..146935))
                     /locus_tag="SPAC11D3.18c"
                     /product="putative nicotinic acid plasma membrane
                     transporter"
                     /transcript_id="NM_001355967.1"
                     /db_xref="GeneID:2543005"
     CDS             complement(144862..146358)
                     /locus_tag="SPAC11D3.18c"
                     /codon_start=1
                     /product="putative nicotinic acid plasma membrane
                     transporter"
                     /protein_id="NP_001342807.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC11D3.18c"
                     /db_xref="EnsemblGenomes-Tr:SPAC11D3.18c.1"
                     /db_xref="GeneID:2543005"
                     /db_xref="GOA:Q10097"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="PomBase:SPAC11D3.18c"
                     /db_xref="PomBase:SPAC11D3.18c.1"
                     /translation="MSDQSEYKISKDDEHSIYASEINKEKLQNTASPDVDYGDTASLK
                     IDPKVEKKLLLKMDLVISPIIGFLYLMAFLDRSNIGNAAVAGMTEALSLYGERLNVAV
                     SIFYVLYILVETPSVVLVKRIKASRMLAFISFAWSMTVLFSGFMSSYGGLIATRLILG
                     LLEGCLFPALNLYLTTHYTRKEQCQRLSYLFASAGLAGAFGGLFAYALEQVHAGNKEG
                     WQWIYIVEGLVSFIGVPLCLFALPDKMENAWFLTREEREVAIIRRDINARYHGEQHFE
                     WSEVRKAFKDPKVYVSATSQFCADMVLYGFSSFLPVIIKGLGFVGLQTNYMTIPVYIA
                     GVISFLFVAWLSDRTQLRAVYLISASTVVAVGYIIMLASDSNAAKYTATYIIAIGCYI
                     GPGLNLGWLNNNVAGHYKRATAIGIQQTLANSSGIVAGQIYRSKNAPKYILGNAFTLG
                     CVIVGGLAYVVMFFSLRYVNKKRDERCARGEFDPSAIGDFADDFRYYL"
     gene            complement(146871..148041)
                     /locus_tag="SPNCRNA.612"
                     /db_xref="GeneID:14217861"
     misc_RNA        complement(146871..148041)
                     /locus_tag="SPNCRNA.612"
                     /product="antisense RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_150974.1"
                     /db_xref="GeneID:14217861"
     gene            <146974..148055
                     /locus_tag="SPAC5H10.01"
                     /db_xref="GeneID:2541830"
     mRNA            <146974..148055
                     /locus_tag="SPAC5H10.01"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018214.2"
                     /db_xref="GeneID:2541830"
     CDS             146974..147879
                     /locus_tag="SPAC5H10.01"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592814.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC5H10.01"
                     /db_xref="EnsemblGenomes-Tr:SPAC5H10.01.1"
                     /db_xref="GeneID:2541830"
                     /db_xref="GOA:Q09674"
                     /db_xref="InterPro:IPR009906"
                     /db_xref="InterPro:IPR016938"
                     /db_xref="PomBase:SPAC5H10.01"
                     /db_xref="PomBase:SPAC5H10.01.1"
                     /translation="MTTTSIDPPVYATVDVIREPKAYDGMPKKDECRLPSYSERAITK
                     PVEARKLIRNRLMTKSTTGWCEGYIQANLLVLPAKYRDDFVNLCVRNPVPCPLLGETE
                     IGKPTEFKPEALAKQSNVATDIPFYCEYINGKFSRELENISKEWTEDYVGFLIGCSFS
                     FEAALVAENFIPRHLPTGDAPPMFITNIPLCASGVFTGTFVVSMRPYPEKDLERIRKI
                     TSAYTNCHGEPVAWGWDGAKKIGVKDCGKPDFGVPVEFKEGEIPIFWGCGVTPQNVVM
                     MSKLPEPVYSHKPGYMYLTDLTHNC"
     gene            complement(148038..150331)
                     /locus_tag="SPAC5H10.02c"
                     /db_xref="GeneID:2541799"
     mRNA            complement(148038..150331)
                     /locus_tag="SPAC5H10.02c"
                     /product="ThiJ domain protein"
                     /transcript_id="NM_001018215.2"
                     /db_xref="GeneID:2541799"
     CDS             complement(148213..148935)
                     /locus_tag="SPAC5H10.02c"
                     /codon_start=1
                     /product="ThiJ domain protein"
                     /protein_id="NP_592815.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC5H10.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC5H10.02c.1"
                     /db_xref="GeneID:2541799"
                     /db_xref="GOA:Q09675"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="PomBase:SPAC5H10.02c"
                     /db_xref="PomBase:SPAC5H10.02c.1"
                     /translation="MSIAKGKNALLVASSYYGPFYPDGKNTGVHFSELLIPYNVFKKA
                     GFNVQFVSENGSYKFDDHSIEESKLGDFERKVFNDKNDDFWTNLNNMKKASDIVGKDY
                     QLLFVAGGHAAMFDLPKATNLQAVAREVFTNGGVLSAVCHGPVLLANVKNPQSVEGKT
                     VVYHKHVTAFNKAGEEKMGVMDELKKRGMKSLNEIFAEAGATFIDPPNPNVNFTQIDG
                     KIVTGVNPQSAKSTAEAAVSAL"
     gene            148362..149005
                     /locus_tag="SPNCRNA.613"
                     /db_xref="GeneID:14217987"
     misc_RNA        148362..149005
                     /locus_tag="SPNCRNA.613"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150975.1"
                     /db_xref="GeneID:14217987"
     gene            149446..152909
                     /locus_tag="SPAC5H10.03"
                     /db_xref="GeneID:2541759"
     mRNA            149446..152909
                     /locus_tag="SPAC5H10.03"
                     /product="phosphoglycerate mutase family"
                     /transcript_id="NM_001018216.2"
                     /db_xref="GeneID:2541759"
     gene            149658..149776
                     /locus_tag="SPRRNA.10"
                     /db_xref="GeneID:3361390"
     rRNA            149658..149776
                     /locus_tag="SPRRNA.10"
                     /product="5S ribosomal RNA"
                     /transcript_id="NR_151400.1"
                     /db_xref="GeneID:3361390"
     CDS             151913..152572
                     /locus_tag="SPAC5H10.03"
                     /codon_start=1
                     /product="phosphoglycerate mutase family"
                     /protein_id="NP_592816.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC5H10.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC5H10.03.1"
                     /db_xref="GeneID:2541759"
                     /db_xref="GOA:Q09676"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="PomBase:SPAC5H10.03"
                     /db_xref="PomBase:SPAC5H10.03.1"
                     /translation="MTNNLKKTVYLIRHGQAQHNVGPDEDHNIRDPVLTSEGIEQCEA
                     LAKELESKQIPIDGIVCSPMRRTLQTMEIALKKYLAEGGPDKVPVYISPFFQEVGHLP
                     CDIGLELDKLNKLYPKYNFQSCQDGIYPEKRDIYASDVTISAIRSKEALEYLAALPQQ
                     QIAVITHSAFIRFLLKKMVKAADIDFLPPQLSFKNCEFRIYDLVQTTTGELKLVESSS
                     A"
     gene            152851..155515
                     /locus_tag="SPAC5H10.04"
                     /db_xref="GeneID:2541543"
     mRNA            152851..155515
                     /locus_tag="SPAC5H10.04"
                     /product="putative NADPH dehydrogenase"
                     /transcript_id="NM_001018217.2"
                     /db_xref="GeneID:2541543"
     gene            complement(153070..155583)
                     /locus_tag="SPAC5H10.05c"
                     /db_xref="GeneID:2542621"
     mRNA            complement(153070..155583)
                     /locus_tag="SPAC5H10.05c"
                     /product="putative FAD binding oxidoreductase"
                     /transcript_id="NM_001018218.2"
                     /db_xref="GeneID:2542621"
     CDS             153387..154535
                     /locus_tag="SPAC5H10.04"
                     /EC_number="1.6.99.1"
                     /codon_start=1
                     /product="putative NADPH dehydrogenase"
                     /protein_id="NP_592817.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC5H10.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC5H10.04.1"
                     /db_xref="GeneID:2541543"
                     /db_xref="GOA:Q09670"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="PomBase:SPAC5H10.04"
                     /db_xref="PomBase:SPAC5H10.04.1"
                     /translation="MNDRGELFKPIKVGNMLLQHRIVHAPMTRLRATDYGKITGLMVE
                     YYSQRSMIPGTLLIADATFVGEKSGGFPNNPRCFTKEQAESWIPLVEAVHKNKSFLFI
                     QFWPLPGDLKDEYRNDLEKMQKITYSDCPQDPGGLPAGIHSFDAVQGVEVYKKKYMSK
                     RDIQEHIQDFVNAADLAVNIAKADGVEIHQVNGFLLDRFVLGGFGDQCDPEYRGSIEN
                     RCRFPLEVLEAVTRKIGQERVGYRISPFSGWMQKIDFMEVNIYLMSEIAKRFPKLAYI
                     HAIEPRKYWSGHKLVSSEQNTSFLQKYWKGPFITAGGYDPETAVQAANERGVLVAFGR
                     NFIANPDLVFRIKHHIPLNKWDRSSFYLPKTEKGYTDYPFSKEFLQSK"
     CDS             complement(154807..155397)
                     /locus_tag="SPAC5H10.05c"
                     /codon_start=1
                     /product="putative FAD binding oxidoreductase"
                     /protein_id="NP_592818.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC5H10.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC5H10.05c.1"
                     /db_xref="GeneID:2542621"
                     /db_xref="GOA:Q09677"
                     /db_xref="InterPro:IPR003680"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="PomBase:SPAC5H10.05c"
                     /db_xref="PomBase:SPAC5H10.05c.1"
                     /translation="MKILLINGAQEFAHSQGKFNKTLHNVAKDTLIQLGHTVQETVVD
                     EGYDENTEVEKILWANVIIYQWPGWWMGTPWKLKRYMDEVFTAGYGQLYANDGRSSKN
                     PTQNYGKGGLLHEHRYMISCTWNAPAAAFEEVGNFFDGRGVDGTLLTFHKANQFLGMK
                     PLPTFMVNDVIKNPKVDIAVCAYKDHLNDVFGSANA"
     gene            complement(156430..158279)
                     /gene="adh4"
                     /locus_tag="SPAC5H10.06c"
                     /db_xref="GeneID:2542714"
     mRNA            complement(156430..158279)
                     /gene="adh4"
                     /locus_tag="SPAC5H10.06c"
                     /product="alcohol dehydrogenase Adh4"
                     /transcript_id="NM_001018219.2"
                     /db_xref="GeneID:2542714"
     CDS             complement(156548..157816)
                     /gene="adh4"
                     /locus_tag="SPAC5H10.06c"
                     /EC_number="1.1.1.1"
                     /codon_start=1
                     /product="alcohol dehydrogenase Adh4"
                     /protein_id="NP_592819.1"
                     /db_xref="GeneID:2542714"
                     /db_xref="GOA:Q09669"
                     /db_xref="InterPro:IPR001670"
                     /db_xref="InterPro:IPR018211"
                     /translation="MSILRSPFRLIRSPARFFPSLFHSSCNQSFTNGLKHQSTSSKAM
                     PVSAFYIPSFNLFGKGCLAEAAKQIKMSGFKNTLIVTDPGIIKVGLYDKVKALLEEQS
                     ITVHLYDGVQPNPTVGNVNQGLEIVKKENCDSMVSIGGGSAHDCAKGIALLATNGGKI
                     ADYEGVDKSSKPQLPLIAINTTAGTASEMTRFAIITEETRHIKMAIIDKHTMPILSVN
                     DPETMYGLPPSLTAATGMDALTHAVEAYVSTAANPITDACAVKCIELVNKYLKRAVDN
                     GKDEEARDNMAYAEFLGGMAFNNASLGYVHAMAHQLGGFYGIPHGVCNAVLLAHVQKF
                     NSRDPRANARLGDIAFHLGCEEHTAEAALDRISQLVLEVKIRPHLVDLGVKEKDFDVL
                     VDHAMKDACGATNPIQPTHDEVKAIFKSAM"
     gene            158777..>159472
                     /locus_tag="SPAC5H10.07"
                     /db_xref="GeneID:2542699"
     mRNA            158777..>159472
                     /locus_tag="SPAC5H10.07"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018220.2"
                     /db_xref="GeneID:2542699"
     CDS             159203..159472
                     /locus_tag="SPAC5H10.07"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592820.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC5H10.07"
                     /db_xref="EnsemblGenomes-Tr:SPAC5H10.07.1"
                     /db_xref="GeneID:2542699"
                     /db_xref="GOA:Q09678"
                     /db_xref="PomBase:SPAC5H10.07"
                     /db_xref="PomBase:SPAC5H10.07.1"
                     /translation="MTVLTSYKLYCGPDFPAPLEKKEKREKGKIRNISFLIVLTKGPI
                     WKVSSMESTSYNGCIENLDCKFRKSFIEEIIAYEGFGKYIEVINF"
     gene            complement(159880..>160945)
                     /gene="pan6"
                     /locus_tag="SPAC5H10.08c"
                     /db_xref="GeneID:2541618"
     mRNA            complement(159880..>160945)
                     /gene="pan6"
                     /locus_tag="SPAC5H10.08c"
                     /product="pantoate-beta-alanine ligase"
                     /transcript_id="NM_001018221.2"
                     /db_xref="GeneID:2541618"
     CDS             complement(160094..160945)
                     /gene="pan6"
                     /locus_tag="SPAC5H10.08c"
                     /EC_number="6.3.2.1"
                     /codon_start=1
                     /product="pantoate-beta-alanine ligase"
                     /protein_id="NP_592821.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC5H10.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC5H10.08c.1"
                     /db_xref="GeneID:2541618"
                     /db_xref="GOA:Q09673"
                     /db_xref="InterPro:IPR003721"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="PomBase:SPAC5H10.08c"
                     /db_xref="PomBase:SPAC5H10.08c.1"
                     /translation="MQVLKEKLLIHQQVDNWRKDGNRIAFVPTMGNLHEGHFSLVREA
                     KRHAEKVVVSIFVNPMQFNNPQDLLLYPRTMDQDCSQLQNLGVDLVYAPTVEELYPEG
                     SQDITFVDVPKLSTMLEGASRPGHFRGVTTVVSKLFHIVNPDVACFGEKDFQQVAIIK
                     KMVRDLNFFIEIIQVPIVRADDGLALSSRNGYLTSEERKIAPNLYKILKKLAQELSNG
                     NGDLEKLIAETNTELSRCRFIPDQLEICDSTTLEPFTAGTKNVVILAAAWLGKARLID
                     NIQTTIN"
     gene            complement(<160977..161822)
                     /locus_tag="SPAC5H10.09c"
                     /db_xref="GeneID:2542731"
     mRNA            complement(<160977..161822)
                     /locus_tag="SPAC5H10.09c"
                     /product="putative
                     3-methyl-2-oxobutanoatehydroxymethyltransferase"
                     /transcript_id="NM_001018222.2"
                     /db_xref="GeneID:2542731"
     CDS             complement(160977..161780)
                     /locus_tag="SPAC5H10.09c"
                     /EC_number="2.1.2.11"
                     /codon_start=1
                     /product="putative
                     3-methyl-2-oxobutanoatehydroxymethyltransferase"
                     /protein_id="NP_592822.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC5H10.09c"
                     /db_xref="EnsemblGenomes-Tr:SPAC5H10.09c.1"
                     /db_xref="GeneID:2542731"
                     /db_xref="GOA:Q09672"
                     /db_xref="InterPro:IPR003700"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="PomBase:SPAC5H10.09c"
                     /db_xref="PomBase:SPAC5H10.09c.1"
                     /translation="MSLKQITISTLRQWKLANKKFACITAYDASFSRLFAEQGMPVML
                     VGDSLGMTAQGHSTTLPVSVEDIAYHTKSVRRGAPNRLLMADLPFMSYSTWEDACKNA
                     ATVMRAGANIVKIEGGGNWIFEIVQRLTERSVPVAGHLGLTPQSVNIFGGYKIQGREQ
                     SAAARLIENAQQLEKFGAQLLVLECIPESLAEQITKTISIPTIGIGAGKHTDGQILVM
                     HDALGITGGRPPKFAKNFLSGAGDIRTAIQRYIYEVEQGLYPAEEHSFQ"
     gene            161072..162819
                     /locus_tag="SPNCRNA.614"
                     /db_xref="GeneID:14217988"
     misc_RNA        161072..162819
                     /locus_tag="SPNCRNA.614"
                     /product="antisense RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_150976.1"
                     /db_xref="GeneID:14217988"
     gene            complement(162257..164455)
                     /locus_tag="SPNCRNA.615"
                     /db_xref="GeneID:14218085"
     misc_RNA        complement(162257..164455)
                     /locus_tag="SPNCRNA.615"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150977.1"
                     /db_xref="GeneID:14218085"
     gene            162756..164635
                     /locus_tag="SPAC5H10.10"
                     /db_xref="GeneID:2541553"
     mRNA            162756..164635
                     /locus_tag="SPAC5H10.10"
                     /product="putative NADPH dehydrogenase"
                     /transcript_id="NM_001018223.2"
                     /db_xref="GeneID:2541553"
     CDS             162960..164138
                     /locus_tag="SPAC5H10.10"
                     /EC_number="1.6.99.1"
                     /codon_start=1
                     /product="putative NADPH dehydrogenase"
                     /protein_id="NP_592823.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC5H10.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC5H10.10.1"
                     /db_xref="GeneID:2541553"
                     /db_xref="GOA:Q09671"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="PomBase:SPAC5H10.10"
                     /db_xref="PomBase:SPAC5H10.10.1"
                     /translation="MAVQKLYESQSKLFQPIKVGNMQLQHRMVHAPATRLRCLDNGLV
                     MTDLVKEYYKQRSSIPGTLLITESLFSGAKSGGFSNIPCLYNDEHVEAWKPIVQAIHD
                     NDCFVFIQFWNLPGELKVDYLEDQERLEKVTQGECPMDPTGLPAALGSAYSICGEELY
                     VDKFMTKQDIQEHITTYTEAAKRAVFGCGADGVEVHQVNGFLLDKFVLNGYGDKCDPE
                     YCGSLENRARFCLELLESVVNAIGQERVGYRISPFSDIWKDKDSFEAHVFMIKKIKER
                     FPNLAYLHAIEPRQYWNGHVHITQEKNTLIYKNLWGDPFITAGGHDRDSAIQMAEQEN
                     TLVAFGRYFLSNPDLPFRLKYNLPLNKWDRATFYTKMSPKGYIDYPFSKEFLDTKKVE
                     "
     gene            164570..166335
                     /gene="gmh1"
                     /locus_tag="SPAC5H10.11"
                     /db_xref="GeneID:2542018"
     mRNA            164570..166335
                     /gene="gmh1"
                     /locus_tag="SPAC5H10.11"
                     /product="putative alpha-1,2-galactosyltransferase Gmh1"
                     /transcript_id="NM_001018224.2"
                     /db_xref="GeneID:2542018"
     CDS             164728..165717
                     /gene="gmh1"
                     /locus_tag="SPAC5H10.11"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /product="putative alpha-1,2-galactosyltransferase Gmh1"
                     /protein_id="NP_592824.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC5H10.11"
                     /db_xref="EnsemblGenomes-Tr:SPAC5H10.11.1"
                     /db_xref="GeneID:2542018"
                     /db_xref="GOA:Q09679"
                     /db_xref="InterPro:IPR008630"
                     /db_xref="PomBase:SPAC5H10.11"
                     /db_xref="PomBase:SPAC5H10.11.1"
                     /translation="MLSFFTKNTLTKRKLIMLALAIVFTFFAFGLYFIPHDEISVFDF
                     KLPALQYETTVTSLDNFLIGGSTTLYTATVNHEDLNEPKSHEIVMLLASDGNVGSFES
                     NLLDDCFKNRIEYAKLQNYNFEFVNVSSLVVPPVWGKMPAILQTMRKYPSAKWIWWLD
                     QDALIMNKNLSLQELFLSPAMLQKSLLREQPIINSFGEDNFRITPAAYSKEMIEQIQF
                     LISQDHNGLNAGSFLVRNSRSIALLMDLLTDPSLADAGVVRHEQDLIGYFIQKHSQVA
                     SMVGILPQRFINAFHEGPPTMQWQEGDLALHFAGCWVENKCAELWTKYKDKII"
     gene            complement(165814..167826)
                     /locus_tag="SPAC5H10.12c"
                     /db_xref="GeneID:2541724"
     mRNA            complement(165814..167826)
                     /locus_tag="SPAC5H10.12c"
                     /product="putative acetylglucosaminyltransferase"
                     /transcript_id="NM_001018225.2"
                     /db_xref="GeneID:2541724"
     CDS             complement(166420..167535)
                     /locus_tag="SPAC5H10.12c"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /product="putative acetylglucosaminyltransferase"
                     /protein_id="NP_592825.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC5H10.12c"
                     /db_xref="EnsemblGenomes-Tr:SPAC5H10.12c.1"
                     /db_xref="GeneID:2541724"
                     /db_xref="GOA:Q09680"
                     /db_xref="InterPro:IPR002495"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PomBase:SPAC5H10.12c"
                     /db_xref="PomBase:SPAC5H10.12c.1"
                     /translation="MSRISLSNFLSLPRYKFLLFSVVLIIVMTTLVFNGHDYKQTLND
                     RLTSLKNNFVEENDNAVLKEEPGKYTYMSLFTMPSTEEDYYFNATRVLIHRLKYHPTT
                     KSKYPIHILALRGVDEWKIERFRKDGASVIVIDPIASSDIVYDTSSFSQEISARYEQM
                     FSKLRIFEQIQFDKICVIDSDILIMKNIDDIFDTPYMYQQINTLNYTRLPSYTKPDDD
                     TVYHFNEDFKEYGASRSEFYPYLLAAVSDRGEHHSIPPEDTPYFNAGLMLIRPSELHF
                     NRILKIGRFPYMYENAKMMEQSLLNLAFSLDGWFPWTRLDPYYNGVWPSIDERPLLKT
                     AHGKFWNIGSSEFAPVYLADWYAAYGEMLSFHKYETH"
     gene            166583..167280
                     /locus_tag="SPNCRNA.616"
                     /db_xref="GeneID:14217989"
     misc_RNA        166583..167280
                     /locus_tag="SPNCRNA.616"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150978.1"
                     /db_xref="GeneID:14217989"
     gene            complement(167766..170137)
                     /gene="gmh2"
                     /locus_tag="SPAC5H10.13c"
                     /db_xref="GeneID:2542227"
     mRNA            complement(167766..170137)
                     /gene="gmh2"
                     /locus_tag="SPAC5H10.13c"
                     /product="putative alpha-1,2-galactosyltransferase Gmh2"
                     /transcript_id="NM_001018226.2"
                     /db_xref="GeneID:2542227"
     CDS             complement(168810..169850)
                     /gene="gmh2"
                     /locus_tag="SPAC5H10.13c"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /product="putative alpha-1,2-galactosyltransferase Gmh2"
                     /protein_id="NP_592826.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC5H10.13c"
                     /db_xref="EnsemblGenomes-Tr:SPAC5H10.13c.1"
                     /db_xref="GeneID:2542227"
                     /db_xref="GOA:Q09681"
                     /db_xref="InterPro:IPR008630"
                     /db_xref="PomBase:SPAC5H10.13c"
                     /db_xref="PomBase:SPAC5H10.13c.1"
                     /translation="MALMLSRIPRRFFFLFLTVGLIAGAFLYSLIYFVDVDLVSKVNQ
                     LYDQQIAPMLSDAIGTPSVNHSFELAPLDSHLVATSTTFHEASYESEPQQNPASQNIV
                     LLLVSDGHTSYNNGANTFEEAIQNRVDYSTKQNYNFEYVNVTGLPIPAVWSKMPAVLQ
                     TMKKYPKAEWIWLLDQDAIITNTHLSLQDSFLKPENLQKTLITNTILTKRPINANGDL
                     RYTPSNYSLKDIENLMVIISQDHNGLNAGSILFRNSPATALFLDIWTDPVVAECAKAN
                     NEQDMLGYLISKHSQLASLVGLIPQRKINAFHEGPENMEWQKGDLVIHFAGCWVENRC
                     DELWQKFYALID"
     gene            170237..174473
                     /locus_tag="SPNCRNA.617"
                     /db_xref="GeneID:14218201"
     misc_RNA        170237..174473
                     /locus_tag="SPNCRNA.617"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150979.1"
                     /db_xref="GeneID:14218201"
     gene            complement(170489..174701)
                     /gene="rad8"
                     /locus_tag="SPAC13G6.01c"
                     /gene_synonym="SPAC5H10.14c"
                     /db_xref="GeneID:3361391"
     mRNA            complement(170489..174701)
                     /gene="rad8"
                     /locus_tag="SPAC13G6.01c"
                     /gene_synonym="SPAC5H10.14c"
                     /product="ubiquitin-protein ligase E3 Rad8"
                     /transcript_id="NM_001355968.1"
                     /db_xref="GeneID:3361391"
     CDS             complement(170972..174373)
                     /gene="rad8"
                     /locus_tag="SPAC13G6.01c"
                     /gene_synonym="SPAC5H10.14c"
                     /codon_start=1
                     /product="ubiquitin-protein ligase E3 Rad8"
                     /protein_id="NP_001342793.1"
                     /db_xref="GeneID:3361391"
                     /db_xref="GOA:P36607"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014905"
                     /db_xref="InterPro:IPR027417"
                     /translation="MKRKVQKIIDEAPLEENSPPRFFDSDVEADSKPNDLTAANSIVD
                     LKTNSQHENANAAGKEYGDSGVSESWVLDFLSVTGEKTISEFLAQKIWKTSNGDLNVA
                     VDMYFDESFNIKNSNPDSESQKDTDASLTQMDQLSNTVSVKDLSINRNTNKKALNAVS
                     PSLNLSSNSSVQDVSIDKEEMMKKQSRNALTPLDFIMKKNELMKYIGCFGVEAYSTAS
                     GTRTLQAGERIYLERQKLSIKSQSRNSRKKSKLLSINSSCYSNIVRFCNSDHHEIGKL
                     PTEVASVISTLMEQGFWSFEAICIYSDNIIRFGSNVTLQVYCFINVNHPSLNRSPFTL
                     ATNSMQEEEEHLKASFAQNKRDHLLRLFTWIALEPDLEDCNTKESIHIDDILKTSSLP
                     EARDESNSDLTPSSTEDEEDVVSDQLAILYDKVKTSGAELPSAPKPSTFALDLREYQK
                     QALYWMCCKEEGVQSDGSAPKLHPLWSRFRFPKDSEFPEFFKCSSDDDNTHFYVNLYT
                     GETTMLFPNSMPYHRGGILADEMGLGKTIEVLSLIHSRPCFSTDEIPEAFRHSKPSLP
                     VASRTTLVVAPMSLLDQWHSEACKVSQGTKFRSMIYYGSEKPLDLKSCVIDTSTAPLI
                     IITSYGVLLSEFSQQSHSSGLFSVHWFRVVLDEGHNIRNRESKTAKACHSISSQNRWV
                     ITGTPIVNKLDDLYSLIKFMRYEPWCNYTYWQTFVSLPYQSKDVLKALNVVQSILEFL
                     VLRRTKETKDRNGNSIVTLPPKTVKIEYLDFSDSERKIYDSLYTKAKSTVNANIVAGT
                     LFRNYTTILGLLLRLRQACCDPVLLSNMTINSETFDDFEFSVEQFNSLINQFVVTGKP
                     IPSDILKIDTLKSFEALITECPICCNEPIQNPLLLNCKHACCGDCLSEHIQYQKRRNI
                     IPPLCHTCRQPFNEQDVYKPFFVKNNGTQSTLLVGEEVKWKYWNRLQSVKLNGLLGQL
                     RQLTHSSEPEKVVIFSQFTTFLDIIADVLESEKMGYARFDGTMSQQMRSTALETFRND
                     PDVNVLIISLKAGGVGLNLTCANHVFIMDPWWSWSVEAQAIDRIHRLGQEKPVFVTRY
                     IVRDTVEERMLKIQERKNFITGTLGMSEGKQQVQSIEDIKMLFEY"
     gene            complement(174865..176655)
                     /gene="rps101"
                     /locus_tag="SPAC13G6.02c"
                     /gene_synonym="rps1-1; rps3a-1"
                     /db_xref="GeneID:2542817"
     mRNA            complement(174865..176655)
                     /gene="rps101"
                     /locus_tag="SPAC13G6.02c"
                     /gene_synonym="rps1-1; rps3a-1"
                     /product="40S ribosomal protein S1"
                     /transcript_id="NM_001018229.2"
                     /db_xref="GeneID:2542817"
     CDS             complement(175013..175771)
                     /gene="rps101"
                     /locus_tag="SPAC13G6.02c"
                     /gene_synonym="rps1-1; rps3a-1"
                     /codon_start=1
                     /product="40S ribosomal protein S1"
                     /protein_id="NP_592828.1"
                     /db_xref="GeneID:2542817"
                     /db_xref="GOA:Q09781"
                     /db_xref="InterPro:IPR001593"
                     /db_xref="InterPro:IPR018281"
                     /db_xref="InterPro:IPR027500"
                     /translation="MAVGKNKRLSKGKKGIKKRVVDPFSRKDWYDIKAPAFFEVKNVG
                     KTLVNRTAGLKNANDSLKGRILEVSLADLQKDEEHSFRKVKLRVEDIQGKSCLTSFNG
                     FDMTSDKLRSLVRKWQSTIEANQTIKTTDGYLCRIFVIGFTSRRVNQVKKTTYAQSSQ
                     IRAIHQKMFQVIQNQANGCSMKELVQKLIPEVIGRAIEKATNNIYPLQNVFVRKVKIL
                     KAPKHDAQKLLELHGESQDVGSKVISDVAPLESV"
     regulatory      complement(175826..175833)
                     /regulatory_class="promoter"
                     /gene="rps101"
                     /locus_tag="SPAC13G6.02c"
                     /gene_synonym="rps1-1; rps3a-1"
     gene            175890..180028
                     /gene="gpi7"
                     /locus_tag="SPAC13G6.03"
                     /db_xref="GeneID:2542835"
     mRNA            175890..180028
                     /gene="gpi7"
                     /locus_tag="SPAC13G6.03"
                     /product="putative GPI anchor biosynthesis protein Gpi7"
                     /transcript_id="NM_001018230.2"
                     /db_xref="GeneID:2542835"
     gene            175923..176736
                     /locus_tag="SPNCRNA.141"
                     /db_xref="GeneID:9407038"
     misc_RNA        175923..176736
                     /locus_tag="SPNCRNA.141"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150290.1"
                     /db_xref="GeneID:9407038"
     gene            complement(176878..177943)
                     /locus_tag="SPNCRNA.618"
                     /db_xref="GeneID:14218057"
     misc_RNA        complement(176878..177943)
                     /locus_tag="SPNCRNA.618"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150980.1"
                     /db_xref="GeneID:14218057"
     CDS             177292..179568
                     /gene="gpi7"
                     /locus_tag="SPAC13G6.03"
                     /codon_start=1
                     /product="putative GPI anchor biosynthesis protein Gpi7"
                     /protein_id="NP_592829.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13G6.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC13G6.03.1"
                     /db_xref="GeneID:2542835"
                     /db_xref="GOA:Q09782"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="PomBase:SPAC13G6.03"
                     /db_xref="PomBase:SPAC13G6.03.1"
                     /translation="MRFAFFGIFWLQIFGSILFLLGFFPHKNDSTGKAMSNQFSPPAV
                     IDQVVFVMVDALRADFVFSKSHNMPFTQSLLYNSTHGIGFSAFARSPTVTMPRLKALT
                     TGTIPGFLDVLLNIAESDTGSSIEAQDSWVYQLNSFNKKIEFYGDDTWLKLFPSAFSK
                     FEGTTSFFVSDYTEVDNNVTRNFDHALPSSLSHSWDALILHYLGVDHIGHLYGPSSPL
                     LNIKLLEIDTIISRIYKYLQEYDEKTNTHSLIVLCGDHGMNEVGNHGGSSSGETTAAL
                     SLLFPSNELSHINKPILNMDDNPYSILERVEQVDVVPTICLLLGIPIPKGNMGKVLSP
                     VTELWKDTKTAKMAALSNLFQLSLLKNPSLTTSELSTQFQDSDLNDIRLALENLQSQM
                     VAQSSSYSLDRMLVAISILGACSILSLILFRNLYNYKELLAFAPFVVQNIIIVFSSSF
                     IEEEHVIWYFAAVSLSLLQLLNPKTRLAGSLQLFCLSIIKRWNQTGQKYSDLRDIVDD
                     FIAPSTFMKTILCVTSAFMPAIRSPSPINFLSSMFIAFYKLMPIISKHLNELPIIASF
                     DYTFFVRIIWSLLLISFLSKPTFKQLRCQLSLFILLLTRLENMGLYLLYDIWQRTMPE
                     EGTLASVMYYVAEQVAFFSLGNSNSLATVDLSQAYTGLDSYNIFAVGILLFTSVFAGA
                     LWWCLHQPKRMMDRSVKTFWIMSSISLTFLCISCFIMRHHLFVWSVFSPKLLYNASWA
                     SMYFLAKCLISTIMVRLR"
     gene            180272..181069
                     /gene="tim8"
                     /locus_tag="SPAC13G6.04"
                     /db_xref="GeneID:2542819"
     mRNA            join(180272..180528,180586..180721,180890..181069)
                     /gene="tim8"
                     /locus_tag="SPAC13G6.04"
                     /product="putative TIM22 inner membrane protein import
                     complex subunit Tim8"
                     /transcript_id="NM_001018231.3"
                     /db_xref="GeneID:2542819"
     CDS             join(180423..180528,180586..180721,180890..180911)
                     /gene="tim8"
                     /locus_tag="SPAC13G6.04"
                     /codon_start=1
                     /product="putative TIM22 inner membrane protein import
                     complex subunit Tim8"
                     /protein_id="NP_592830.2"
                     /db_xref="GeneID:2542819"
                     /db_xref="GOA:Q09783"
                     /db_xref="InterPro:IPR004217"
                     /translation="MADATKNPIADLSESEQLELSKFIESEQQKVKLQQAIHQFTSTC
                     WPKCIGNIGNKLDKSEEQCLQNCVERFLDCNFHIIKSLESTRK"
     gene            complement(180903..182254)
                     /gene="trs33"
                     /locus_tag="SPAC13G6.05c"
                     /db_xref="GeneID:2542905"
     mRNA            complement(join(180903..181436,181485..181574,
                     181632..181749,182001..182254))
                     /gene="trs33"
                     /locus_tag="SPAC13G6.05c"
                     /product="putative TRAPP complex subunit Trs33"
                     /transcript_id="NM_001018232.2"
                     /db_xref="GeneID:2542905"
     CDS             complement(join(181077..181436,181485..181574,
                     181632..181749,182001..182194))
                     /gene="trs33"
                     /locus_tag="SPAC13G6.05c"
                     /codon_start=1
                     /product="putative TRAPP complex subunit Trs33"
                     /protein_id="NP_592831.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC13G6.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC13G6.05c.1"
                     /db_xref="GeneID:2542905"
                     /db_xref="GOA:Q09784"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="PomBase:SPAC13G6.05c"
                     /db_xref="PomBase:SPAC13G6.05c.1"
                     /translation="MIVHQQLPMSVNVASLDFLLIELVHTAKRLAEDRKKKSSSEKSI
                     ESDFQMLESIGFQVGRKITERLLLNRNRITETTDVMRFLCRELWPIVFRKPLDNLKTN
                     RRGIFVLTDTYFYWFTKMTAMTGTEMAQITTPYFYFPSGFIRGVVYTFGYSAQVIAQC
                     PNLPTCIFHVKFSPNPTQTSPGKPSTSESSQTDTSTRPANSQTPTTTRASSYTTLVST
                     SNQVSNEAEASAVETSANQAQNTEDATENEDRLPS"
     gene            complement(182337..186358)
                     /gene="gcv2"
                     /locus_tag="SPAC13G6.06c"
                     /db_xref="GeneID:2542828"
     mRNA            complement(182337..186358)
                     /gene="gcv2"
                     /locus_tag="SPAC13G6.06c"
                     /product="putative glycine cleavage complex subunit P"
                     /transcript_id="NM_001018233.2"
                     /db_xref="GeneID:2542828"
     CDS             complement(182976..186071)
                     /gene="gcv2"
                     /locus_tag="SPAC13G6.06c"
                     /EC_number="1.4.4.2"
                     /codon_start=1
                     /product="putative glycine cleavage complex subunit P"
                     /protein_id="NP_592832.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC13G6.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC13G6.06c.1"
                     /db_xref="GeneID:2542828"
                     /db_xref="GOA:Q09785"
                     /db_xref="InterPro:IPR003437"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020580"
                     /db_xref="InterPro:IPR020581"
                     /db_xref="PomBase:SPAC13G6.06c"
                     /db_xref="PomBase:SPAC13G6.06c.1"
                     /translation="MFDSFMKRNQLALIMFRACSKLQYHGVNTSLSRHLFLAKRNLSI
                     SSACLEAKNSQKFPALDTFEPRHIGPSKTDQQYQLESLGYKDFDSFLKDVIPDSVRTP
                     ESQLMAFGSVNPNEKNPPVNYSESEFTTLANNVANQNKLIKSFIGMGYYNVKLPAAIQ
                     RNVLENPEWYTQYTPYQAEISQGRLESMMNYQTMIADLTGLSISNASLLDEGTAAGEA
                     MVMLMANDKKKRKTFLVDKNIYPNTLSVLRTRASGFGIKIELDNITPELITKSAKHVF
                     GIFVQYPAADGSIFDYGHLAATARSFNMHVVAATDLLALTILKSPGEWGADVAVGSTQ
                     RFGLPMGYGGPHAGFFACSEEFKRKIPGRLIGLSKDRLENPAYRLALQTREQHIRREK
                     ATSNICTAQALLANMSAFYAIYHGPNGLQEIANRIYASTSFLKSALESSGYKIVNKSH
                     FFDTLTIEVESADKVLAKALDHGYNLRKVDDSHVGLSLDETVCDKDIQALFSIFNINK
                     SVDQYYMEIATSEPNGNSASTVDNLSICSLPENFRRTTLYLQHPVFNRYHSETELMRY
                     IHHLQSKDLSLAHAMTPLGSCTMKLNAVTEMMPITNPLFANIHPYVPEEQAKGYRHVI
                     EDLQLMLTTITGFDAACFQPNSGAAGEYTGLSVIRAYQRSIGQGHRNICLIPVSAHGT
                     NPASAAMAGFTVIPVKCLNNGYLDMQDLKEKASKHADKLAAFMVTYPSTFGIFEPDVK
                     EALEVIHEHGGQVYFDGANMNAMVGLCKAGDIGADVCHLNLHKTFCIPHGGGGPGVGP
                     ICVKKHLADFLPSHPVVSCGGKNGITSVSSSPFGSAGILPISWAYMRMMGLAGLRDAS
                     KAALLNANYMAKRLSSHYKLVYTNKNNLCAHEFILDAREFKATAGVDATDIAKRLQDY
                     SFHAPTLSWPIANTLMIEPTESESMYEMDRFCDALISIRQEIREIEEGLQPKDNNLLV
                     NAPHPQKDIASEKWDRPYTRERAVYPVPLLKERKFWPSVARLDDAYGDKNLFCTCSPV
                     V"
     gene            complement(186314..187683)
                     /gene="rps601"
                     /locus_tag="SPAC13G6.07c"
                     /gene_synonym="rps6-1"
                     /db_xref="GeneID:2542870"
     mRNA            complement(186314..187683)
                     /gene="rps601"
                     /locus_tag="SPAC13G6.07c"
                     /gene_synonym="rps6-1"
                     /product="40S ribosomal protein S6"
                     /transcript_id="NM_001018234.2"
                     /db_xref="GeneID:2542870"
     CDS             complement(186844..187563)
                     /gene="rps601"
                     /locus_tag="SPAC13G6.07c"
                     /gene_synonym="rps6-1"
                     /codon_start=1
                     /product="40S ribosomal protein S6"
                     /protein_id="NP_592833.1"
                     /db_xref="GeneID:2542870"
                     /db_xref="GOA:P05752"
                     /db_xref="InterPro:IPR001377"
                     /db_xref="InterPro:IPR014401"
                     /db_xref="InterPro:IPR018282"
                     /translation="MKLNISYPANGTQKLIEIDDDRRLRVFMEKRMGQEVPGDSVGPE
                     FAGYVFKITGGNDKQGFPMFQGVLLPHRVRLLLRAGHPCYRPRRDGERKRKSVRGCIV
                     GQDLAVLALAIIKQGEQDIPGLTDVTVPKRLGPKRASKIRRFFNLSKEDDVRQFVIRR
                     EVVPKKEGKKPYTKAPKIQRLVTPRTLQHKRHRFALKRRQAEKNREEAAEFAQLMAKR
                     VAEAKQKREVVKARRASSLKK"
     regulatory      complement(187628..187635)
                     /regulatory_class="promoter"
                     /gene="rps601"
                     /locus_tag="SPAC13G6.07c"
                     /gene_synonym="rps6-1"
     gene            187701..190031
                     /locus_tag="SPAC13G6.08"
                     /db_xref="GeneID:2542840"
     mRNA            187701..190031
                     /locus_tag="SPAC13G6.08"
                     /product="Cdc20/Fizzy subfamily WD repeat protein"
                     /transcript_id="NM_001018235.2"
                     /db_xref="GeneID:2542840"
     CDS             188377..189984
                     /locus_tag="SPAC13G6.08"
                     /codon_start=1
                     /product="Cdc20/Fizzy subfamily WD repeat protein"
                     /protein_id="NP_592834.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13G6.08"
                     /db_xref="EnsemblGenomes-Tr:SPAC13G6.08.1"
                     /db_xref="GeneID:2542840"
                     /db_xref="GOA:Q09786"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="PomBase:SPAC13G6.08"
                     /db_xref="PomBase:SPAC13G6.08.1"
                     /translation="MSTLYQVNKIKEILIRFLETIIINGMNSFSSTVYGQNAERSNTP
                     TLIDPSNKETANVCPISKNLFQSYPKGSYRNSQRLTSRNGLDRFIPMTSNKDTISLGR
                     HSSLSRNLVNKTKNASETYQQLLEYALEVERDDNVFTYAKLQKSDMTQKCPTMVASEK
                     DNKGKLNEKKNRSPENLLPFRILDAPELRDDFYTSLLSWSPKGDLAIGLAENIYLWSK
                     ELGPTRVLEESIYDVSSVAYSYNGDILAVGRVDGTLQFWQDNERVPRISIHHPGDIGV
                     LAWKPVLETNRLLVGKGNGNIFVYDIIWSESTSKAVLVATITNAHDEQVCGLTWNHDG
                     SQFASGGNDNRVCLFKGSDLRQPLYVWQQNAAVKALSFCPWQRSLLATGAGSHDKHIR
                     FYNCFNGKKIDELYCGAQITSIHWSPKYREFSVTFGYSLETVQHRFAVYSWPQLECLV
                     SVLPSVPDIRCVHSVLTSQLNETTGRCEMTDSIIIASSNETIKFFDLSEESSWHNSRV
                     LTWHGIFDSQILEMLEGIDGKIDSHLR"
     gene            complement(188450..190474)
                     /locus_tag="SPNCRNA.619"
                     /db_xref="GeneID:14217871"
     misc_RNA        complement(188450..190474)
                     /locus_tag="SPNCRNA.619"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150981.1"
                     /db_xref="GeneID:14217871"
     gene            190192..191947
                     /locus_tag="SPAC13G6.09"
                     /db_xref="GeneID:2542826"
     mRNA            join(190192..190584,190730..191947)
                     /locus_tag="SPAC13G6.09"
                     /product="putative SSU-rRNA maturation Tsr4 family
                     protein"
                     /transcript_id="NM_001018236.2"
                     /db_xref="GeneID:2542826"
     CDS             join(190322..190584,190730..191291)
                     /locus_tag="SPAC13G6.09"
                     /codon_start=1
                     /product="putative SSU-rRNA maturation Tsr4 family
                     protein"
                     /protein_id="NP_592835.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13G6.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC13G6.09.1"
                     /db_xref="GeneID:2542826"
                     /db_xref="GOA:Q09787"
                     /db_xref="InterPro:IPR007320"
                     /db_xref="PomBase:SPAC13G6.09"
                     /db_xref="PomBase:SPAC13G6.09.1"
                     /translation="MEDVDLGFLSQEKLDEKDYLDIECSRVGGAPLFIRKNDAAFLNE
                     SLENSFEFLMQLYAPKNSEISYHRILYIFINRDGDSQTAGWTRGVKVFREQARETDEI
                     DFQLITSKVTKLIDSSEIEVDAEPKEENKKEIPEKLKNVKVDTENPSAEPYTKAKGDV
                     SFLKFQKRLSRAPDQIMRYYHATSNEFPGLWCNNECIPSSIPNCACGAKRQLEFQILP
                     TLISSMNIDHSAKNALDWGILSIYVCSASCDLANCGLAEELCWLQTFSEQGIIAPE"
     gene            complement(191928..194053)
                     /gene="asl1"
                     /locus_tag="SPAC13G6.10c"
                     /db_xref="GeneID:2542895"
     mRNA            complement(191928..194053)
                     /gene="asl1"
                     /locus_tag="SPAC13G6.10c"
                     /product="putative O-glucosyl hydrolase Asl1"
                     /transcript_id="NM_001018237.2"
                     /db_xref="GeneID:2542895"
     CDS             complement(192296..193888)
                     /gene="asl1"
                     /locus_tag="SPAC13G6.10c"
                     /codon_start=1
                     /product="putative O-glucosyl hydrolase Asl1"
                     /protein_id="NP_592836.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13G6.10c"
                     /db_xref="EnsemblGenomes-Tr:SPAC13G6.10c.1"
                     /db_xref="GeneID:2542895"
                     /db_xref="GOA:Q09788"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR024655"
                     /db_xref="PomBase:SPAC13G6.10c"
                     /db_xref="PomBase:SPAC13G6.10c.1"
                     /translation="MRTTFATVALAFLSTVGALPYAPNHRHHRRDDDGVLTVYETILE
                     TVYVTAVPGANSSSSYTSYSTGLASVTESSDDGASTALPTTSTESVVVTTSAPAASSS
                     ATSYPATFVSTPLYTMDNVTAPVWSNTSVPVSTPETSATSSSEFFTSYPATSSESSSS
                     YPASSTEVASSYSASSTEVTSSYPASSEVATSTSSYVAPVSSSVASSSEISAGSATSY
                     VPTSSSSIALSSVVASASVSAANKGVSTPAVSSAAASSSAVVSSVVSSATSVAASSTI
                     SSATSSSASASPTSSSVSGKRGLAWIPGTDLGYSDNFVNKGINWYYNWGSYSSGLSSS
                     FEYVLNQHDANSLSSASSVFTGGATVIGFNEPDLSAAGNPIDAATAASYYLQYLTPLR
                     ESGAIGYLGSPAISNVGEDWLSEFMSACSDCKIDFIACHWYGIDFSNLQDYINSLANY
                     GLPIWLTEFACTNWDDSNLPSLDEVKTLMTSALGFLDGHGSVERYSWFAPATELGAGV
                     GNNNALISSSGGLSEVGEIYIS"
     gene            complement(194099..195626)
                     /gene="erg12"
                     /locus_tag="SPAC13G6.11c"
                     /db_xref="GeneID:2542818"
     mRNA            complement(join(194099..195258,195508..195626))
                     /gene="erg12"
                     /locus_tag="SPAC13G6.11c"
                     /product="putative mevalonate kinase Erg12"
                     /transcript_id="NM_001018238.2"
                     /db_xref="GeneID:2542818"
     CDS             complement(join(194119..195258,195508..195582))
                     /gene="erg12"
                     /locus_tag="SPAC13G6.11c"
                     /EC_number="2.7.1.36"
                     /codon_start=1
                     /product="putative mevalonate kinase Erg12"
                     /protein_id="NP_592837.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13G6.11c"
                     /db_xref="EnsemblGenomes-Tr:SPAC13G6.11c.1"
                     /db_xref="GeneID:2542818"
                     /db_xref="GOA:Q09780"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006205"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="PomBase:SPAC13G6.11c"
                     /db_xref="PomBase:SPAC13G6.11c.1"
                     /translation="MSKSLIVSSPGKTILFGEHAVVYGATALAAAVSLRSYCKLQTTN
                     NNEIVIVMSDIGTERRWNLQSLPWQHVTVENVQHPASSPNLDLLQGLGELLKNEENGL
                     IHSAMLCTLYLFTSLSSPSQGCTLTISSQVPLGAGLGSSATISVVVATSLLLAFGNIE
                     PPSSNSLQNNKALALIEAWSFLGECCIHGTPSGIDNAVATNGGLIAFRKATAHQSAMK
                     EFLKPKDTLSVMITDTKQPKSTKKLVQGVFELKERLPTVIDSIIDAIDGISKSAVLAL
                     TSESDKNSSAKKLGEFIVLNQKLLECLGVSHYSIDRVLQATKSIGWTKLTGAGGGGCT
                     ITLLTPECKEEEFKLCKESLLAHKNSIYDVQLGGPGVSVVTDSDSFFPQYESDFDFKK
                     LNLLSKFNKYYI"
     gene            complement(195940..199051)
                     /gene="chs1"
                     /locus_tag="SPAC13G6.12c"
                     /gene_synonym="SPAC24B11.01c"
                     /db_xref="GeneID:2542858"
     mRNA            complement(join(195940..196174,196221..199051))
                     /gene="chs1"
                     /locus_tag="SPAC13G6.12c"
                     /gene_synonym="SPAC24B11.01c"
                     /product="chitin synthase I"
                     /transcript_id="NM_001018239.2"
                     /db_xref="GeneID:2542858"
     CDS             complement(join(196090..196174,196221..198715))
                     /gene="chs1"
                     /locus_tag="SPAC13G6.12c"
                     /gene_synonym="SPAC24B11.01c"
                     /EC_number="2.4.1.16"
                     /codon_start=1
                     /product="chitin synthase I"
                     /protein_id="NP_592838.1"
                     /db_xref="GeneID:2542858"
                     /db_xref="GOA:P30597"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /translation="MRRWFKKTLPRPPDEEESAGLTNKDIVETNHLYPTITNLSLNSD
                     TSSILFDKNKKPLKPKIIIPDKEFDLDYYLKDETESIQSPFEGFTAQPNFSNFNKQGN
                     TMNREANFQRTNEKIQRNKSIKRVKLFHGNLILDCPIPKKLLVTLPQQTEREFAYMRY
                     SAATCDPQDFSKSLFTLRQPLFFQPRKTEICIAITMYNEDEVLFARTMHSVMKNISHL
                     CTRKNSQVWGKDAWKKVVVCIISDGRTKIHPRTLAYLAAIGVYQDGIAKNQVNDKEVK
                     AHIYEYTTQLSIDPNLKFKGSDRGIVPVQMIFCLKEKNQKKLNSHLWFFQAFCPILKP
                     EVCILLDAGTRPGDQSIYHLWKSFDLNPQVAGACGEIVVMKGKLGSGLINPLVATQNF
                     EYKMSNILDKPVESVFGFISVLPGAFSAYRFEALQNDSQGNGPLASYFKGELQNTGKS
                     GIFEANMYLAEDRILCFELVSKKNEAWILHYVKSAYADTDVPDRIPEFVLQRRRWLNG
                     SFFAAAYAICHYYRFFRTSHTISRKFMLSIEFIYQLATIVFGWFNIGNFFIIFYILTS
                     SLASTSANFLPGEILFRIAIWIYASLLVTCFVLALGNRPHGSPNFYLSMVIMYSILMG
                     YLLFCSGWIAYRAISDAIHNASSTSSSYTSALLNSNVFINIVISLSSTYGMYLVVSII
                     SFDPWHMFTSFVQYIFLSIMYTNVLNVYAFCNTHDVSWGTKGDHFTNNDLGVARLLQK
                     GADVEIAIPTNQSDIDAKYEDAVKLLASPSLEFNSPIINHGEQEDFYKNFRTYVVLTW
                     ILSNLFLVGIVLSIPKINGISISNNETSAYLSFLLWSVVAFSVFRFIGCIFYLFIRLC
                     TGE"
     gene            <198884..>199231
                     /locus_tag="SPAC13G6.13"
                     /db_xref="GeneID:2542859"
     mRNA            <198884..>199231
                     /locus_tag="SPAC13G6.13"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018240.1"
                     /db_xref="GeneID:2542859"
     CDS             198884..199231
                     /locus_tag="SPAC13G6.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592839.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13G6.13"
                     /db_xref="EnsemblGenomes-Tr:SPAC13G6.13.1"
                     /db_xref="GeneID:2542859"
                     /db_xref="GOA:Q09789"
                     /db_xref="PomBase:SPAC13G6.13"
                     /db_xref="PomBase:SPAC13G6.13.1"
                     /translation="MFQLPMIVEANDMKIKYYKRRNCYTLLIFKYKESKKINVYKRKK
                     SDEVVEDCNKLKCTFFMIEEWHLLAILYDKSKYIKIIICSVLLKLNTTVIIRRNTHTK
                     VYVMNKFYQKLKK"
     gene            complement(199874..200587)
                     /locus_tag="SPNCRNA.620"
                     /db_xref="GeneID:14217872"
     misc_RNA        complement(199874..200587)
                     /locus_tag="SPNCRNA.620"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150983.1"
                     /db_xref="GeneID:14217872"
     gene            200121..201517
                     /gene="aps1"
                     /locus_tag="SPAC13G6.14"
                     /gene_synonym="SPAC24B11.03"
                     /db_xref="GeneID:2542890"
     mRNA            200121..201517
                     /gene="aps1"
                     /locus_tag="SPAC13G6.14"
                     /gene_synonym="SPAC24B11.03"
                     /product="diadenosine 5',5'''-p1,p6-hexaphosphate
                     hydrolase Aps1"
                     /transcript_id="NM_001018241.2"
                     /db_xref="GeneID:2542890"
     CDS             200235..200867
                     /gene="aps1"
                     /locus_tag="SPAC13G6.14"
                     /gene_synonym="SPAC24B11.03"
                     /EC_number="3.6.1.52"
                     /codon_start=1
                     /product="diadenosine 5',5'''-p1,p6-hexaphosphate
                     hydrolase Aps1"
                     /protein_id="NP_592840.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13G6.14"
                     /db_xref="EnsemblGenomes-Tr:SPAC13G6.14.1"
                     /db_xref="GeneID:2542890"
                     /db_xref="GOA:Q09790"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="PomBase:SPAC13G6.14"
                     /db_xref="PomBase:SPAC13G6.14.1"
                     /translation="MLENNGSVILMEPDHLRTAVNRSMTSREGRTKNRFNPITGARLA
                     AGVVALSADKRKVLLVSSAKKHPSWVVPKGGWEADESVQQAALREGWEEGGLVGHITR
                     SLGSFKDKRPTDTIDRRKKYLKQLMSKSSGNDVSTNTELGAEAEKLLLPPRAECEFFE
                     VIVERLEDNYPEMRKRRRKWMSYQEAKEALTSRKDILAALEKSSIIKEEN"
     gene            complement(201729..203346)
                     /locus_tag="SPAC13G6.15c"
                     /db_xref="GeneID:2542877"
     mRNA            complement(201729..203346)
                     /locus_tag="SPAC13G6.15c"
                     /product="putative calcipressin"
                     /transcript_id="NM_001018242.2"
                     /db_xref="GeneID:2542877"
     CDS             complement(202487..202978)
                     /locus_tag="SPAC13G6.15c"
                     /codon_start=1
                     /product="putative calcipressin"
                     /protein_id="NP_592841.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13G6.15c"
                     /db_xref="EnsemblGenomes-Tr:SPAC13G6.15c.1"
                     /db_xref="GeneID:2542877"
                     /db_xref="GOA:Q09791"
                     /db_xref="InterPro:IPR006931"
                     /db_xref="PomBase:SPAC13G6.15c"
                     /db_xref="PomBase:SPAC13G6.15c.1"
                     /translation="MLVFTTSPDHVDELNEFVQQLNPVAFTRVLRGLGKVLASYNDKA
                     VEEDTLKKSSTGSLPSGQQVHCQYVLDDPNHVEGISVDQSLQVPKFEKNWLISPPGSP
                     PVGWEPIVEESPNSQHLAHDIQLKLDELGNALLNDHSAGPQIVISEHNNTKETSPSRQ
                     FEH"
     gene            complement(203597..204322)
                     /locus_tag="SPNCRNA.621"
                     /db_xref="GeneID:14217873"
     misc_RNA        complement(203597..204322)
                     /locus_tag="SPNCRNA.621"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_150984.1"
                     /db_xref="GeneID:14217873"
     gene            204386..206081
                     /locus_tag="SPAC24B11.05"
                     /db_xref="GeneID:2541562"
     mRNA            204386..206081
                     /locus_tag="SPAC24B11.05"
                     /product="putative pyrimidine 5'-nucleotidase"
                     /transcript_id="NM_001018243.2"
                     /db_xref="GeneID:2541562"
     CDS             205213..205893
                     /locus_tag="SPAC24B11.05"
                     /codon_start=1
                     /product="putative pyrimidine 5'-nucleotidase"
                     /protein_id="NP_592842.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24B11.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC24B11.05.1"
                     /db_xref="GeneID:2541562"
                     /db_xref="GOA:Q09893"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR010237"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="PomBase:SPAC24B11.05"
                     /db_xref="PomBase:SPAC24B11.05.1"
                     /translation="MTVEQKIIFFDLDNCLYPKSYKIHNMMAARITAFFSDKLGIPTE
                     EAERLREVYYRHYGIAIRGLVLHHEIDAVDYDQRVDQSLPLEKVIKKDEVLREMLLEL
                     RKKYKCWIFTNAYIVHANRVLKYLGIEDCFDGITYCDYNAKDLIAKPMPEMYERVMRE
                     AGVTDKDKCIFVDDSYGNILGAREFGWKYTVQLVEHGDPLPQPQAGSHVIRDIHKFKH
                     LLDEIDGE"
     gene            complement(206476..208044)
                     /gene="sty1"
                     /locus_tag="SPAC24B11.06c"
                     /gene_synonym="phh1; spc1"
                     /db_xref="GeneID:2541652"
     mRNA            complement(206476..208044)
                     /gene="sty1"
                     /locus_tag="SPAC24B11.06c"
                     /gene_synonym="phh1; spc1"
                     /product="MAP kinase Sty1"
                     /transcript_id="NM_001018244.2"
                     /db_xref="GeneID:2541652"
     gene            206775..209401
                     /locus_tag="SPNCRNA.622"
                     /db_xref="GeneID:14218352"
     misc_RNA        206775..209401
                     /locus_tag="SPNCRNA.622"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150985.1"
                     /db_xref="GeneID:14218352"
     CDS             complement(206864..207913)
                     /gene="sty1"
                     /locus_tag="SPAC24B11.06c"
                     /gene_synonym="phh1; spc1"
                     /codon_start=1
                     /product="MAP kinase Sty1"
                     /protein_id="NP_592843.1"
                     /db_xref="GeneID:2541652"
                     /db_xref="GOA:Q09892"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008352"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /translation="MAEFIRTQIFGTCFEITTRYSDLQPIGMGAFGLVCSAKDQLTGM
                     NVAVKKIMKPFSTPVLAKRTYRELKLLKHLRHENIISLSDIFISPFEDIYFVTELLGT
                     DLHRLLTSRPLETQFIQYFLYQILRGLKFVHSAGVIHRDLKPSNILINENCDLKICDF
                     GLARIQDPQMTGYVSTRYYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGRD
                     HVNQFSIITELLGTPPMEVIETICSKNTLRFVQSLPQKEKVPFAEKFKNADPDAIDLL
                     EKMLVFDPRKRISAADALAHNYLAPYHDPTDEPVADEVFDWSFQDNDLPVETWKVMMY
                     SEVLSFHNMDNELQS"
     gene            complement(208839..211275)
                     /locus_tag="SPAC24B11.07c"
                     /db_xref="GeneID:2541561"
     mRNA            complement(208839..211275)
                     /locus_tag="SPAC24B11.07c"
                     /product="putative oxidoreductase"
                     /transcript_id="NM_001018245.2"
                     /db_xref="GeneID:2541561"
     CDS             complement(209346..211031)
                     /locus_tag="SPAC24B11.07c"
                     /codon_start=1
                     /product="putative oxidoreductase"
                     /protein_id="NP_592844.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24B11.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC24B11.07c.1"
                     /db_xref="GeneID:2541561"
                     /db_xref="GOA:Q09894"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="PomBase:SPAC24B11.07c"
                     /db_xref="PomBase:SPAC24B11.07c.1"
                     /translation="MTDAGKKERVSILCVGSPSITTLLGWRLQQSSVVTCQETIMFFN
                     APEPSTNVFTIQSKKFGTRKYRPTYRLSKLEEVTSDSEPFDYVFVSIKPNSRNFQLSN
                     ILEPVITAKHTCIVYNSTGAIGVEEALQRQYPENPIFSLITHTPVSQRSVDEFFFGDC
                     APFYLAPAGSNLEIDQLSRLVEILEGGEISSEILDTLLPLEIEDLALPLSLYPLTVLT
                     QNPNLPKLLERPDINDLHQGILQELDSLCNCLGSSLDVKKLSKQRETLLSHMQVNPAF
                     REYRSNRPVEIVQYLHYCIDLATKQSLQVPRLRTISALISSIQHLPLVQPHHMNDMHG
                     PTDNSPKKNKVLVNMRPINPSSFVSDRHSPLHPYSVPENGKPNMGRIPSAPSLSKGRA
                     MTADNMDMLSLTTRRSRRSLYSPSLMQMQQSLKSDYEGLGRTFDPRFAPRGSPPVRGG
                     KNVLSPEAKEHTHKNISPESSRFGTPSDPNSSSQSLGNEVLSRPNSNSNSAESRNGET
                     DDSGESETYFTLMNNNKGVEPRASVASETSSMTVIPNAMRRFPLARGTSRMKS"
     gene            complement(211714..213591)
                     /locus_tag="SPAC24B11.08c"
                     /db_xref="GeneID:2541538"
     mRNA            complement(211714..213591)
                     /locus_tag="SPAC24B11.08c"
                     /product="putative COPII-coated vesicle-associated protein
                     Erv46"
                     /transcript_id="NM_001018246.2"
                     /db_xref="GeneID:2541538"
     CDS             complement(212034..213206)
                     /locus_tag="SPAC24B11.08c"
                     /codon_start=1
                     /product="putative COPII-coated vesicle-associated protein
                     Erv46"
                     /protein_id="NP_592845.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24B11.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC24B11.08c.1"
                     /db_xref="GeneID:2541538"
                     /db_xref="GOA:Q09895"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="PomBase:SPAC24B11.08c"
                     /db_xref="PomBase:SPAC24B11.08c.1"
                     /translation="MQFRSPLRRFDAFQKTVEDARIKTASGGLITLVSGLIVIFIVLM
                     EWINYRRVIAVHEIIVNPSHGDRMEINFNITFPRIPCQILTVDVLDVSGEFQRDIHHT
                     VSKTRLSPSGEIISVDDLDIGNQQSISDDGAAECGDCYGAADFAPEDTPGCCNTCDAV
                     RDAYGKAHWRIGDVDAFKQCKDENFKELYEAQKVEGCNLAGQLSVNRMAGNFHIAPGR
                     STQNGNQHVHDTRDYINELDLHDMSHSIHHLSFGPPLDASVHYSNPLDGTVKKVSTAD
                     YRYEYFIKCVSYQFMPLSKSTLPIDTNKYAVTQHERSIRGGREEKVPTHVNFHGGIPG
                     VWFQFDISPMRVIERQVRGNTFGGFLSNVLALLGGCVTLASFVDRGYYEVQKLKKN"
     gene            complement(213527..215928)
                     /locus_tag="SPNCRNA.623"
                     /db_xref="GeneID:14217923"
     misc_RNA        complement(213527..215928)
                     /locus_tag="SPNCRNA.623"
                     /product="intergenic RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_150986.1"
                     /db_xref="GeneID:14217923"
     gene            213841..214818
                     /locus_tag="SPNCRNA.142"
                     /db_xref="GeneID:9407230"
     misc_RNA        213841..214818
                     /locus_tag="SPNCRNA.142"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150301.1"
                     /db_xref="GeneID:9407230"
     gene            214093..216962
                     /locus_tag="SPAC24B11.09"
                     /db_xref="GeneID:2541475"
     mRNA            214093..216962
                     /locus_tag="SPAC24B11.09"
                     /product="putative BRP44L family protein"
                     /transcript_id="NM_001018247.2"
                     /db_xref="GeneID:2541475"
     CDS             216483..216839
                     /locus_tag="SPAC24B11.09"
                     /codon_start=1
                     /product="putative BRP44L family protein"
                     /protein_id="NP_592846.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24B11.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC24B11.09.1"
                     /db_xref="GeneID:2541475"
                     /db_xref="GOA:Q09896"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="PomBase:SPAC24B11.09"
                     /db_xref="PomBase:SPAC24B11.09.1"
                     /translation="MFRAGFKRFWNHPAGPKTVHFWAPAMKWTLVLSGIGDYARSPEY
                     LSIRQYAALCATGAIWTRWSLIVRPKNYFNATVNFFLAIVGAVQVSRILVYQRQQKRI
                     TAQSEQRTELARSLAA"
     gene            complement(218260..221562)
                     /gene="chr3"
                     /locus_tag="SPAC24B11.10c"
                     /gene_synonym="cfh1"
                     /db_xref="GeneID:2541607"
     mRNA            complement(218260..221562)
                     /gene="chr3"
                     /locus_tag="SPAC24B11.10c"
                     /gene_synonym="cfh1"
                     /product="putative chitin synthase regulatory factor-like
                     Chr3"
                     /transcript_id="NM_001018248.2"
                     /db_xref="GeneID:2541607"
     CDS             complement(218657..221455)
                     /gene="chr3"
                     /locus_tag="SPAC24B11.10c"
                     /gene_synonym="cfh1"
                     /codon_start=1
                     /product="putative chitin synthase regulatory factor-like
                     Chr3"
                     /protein_id="NP_592847.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24B11.10c"
                     /db_xref="EnsemblGenomes-Tr:SPAC24B11.10c.1"
                     /db_xref="GeneID:2541607"
                     /db_xref="GOA:Q09897"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="PomBase:SPAC24B11.10c"
                     /db_xref="PomBase:SPAC24B11.10c.1"
                     /translation="MKDSHSSRRKYEKEKLVFATNNGKRTEGTPAFLKSGNTASSSSP
                     TLQFRPTSRYPTLSHEPVYTNVLDLSSRIDANRASIMSATMGTPPSALKFSKKKISRP
                     VVSEDTFKDKLPRATIPVKPEPQPQYKIPAAPAPTSKRVVNRGLKLNTNLRQASPILP
                     SPSLKLDRQDAPIQINHEQKEDFLVSIPRPTPMTNLDDGKDEIGQPDPHRKYMAPPRV
                     NSISRVQRRMSYIPYGGFDDFLDNYYKDDDTVLEDNQLKSNSRIETLEEEDGAESDSI
                     TNTVSNASSDAEPAHRHLGPVYENSGHLPSKSHFSSTDSNTDSFGLESDERSLPSVSN
                     DLKSSETLKNPRNDDLLTLQQPPRYPHSQMVMLPARSPVEVPAPTFDRRNVSRNSNNN
                     SPEGYDNNRTNPTVNNLPSYPTNLARPKAIKPMPTSIHGQTSPLSPIPPVHTTHGLVS
                     DIRPLPSVSSPIMRADSTPISHNLAVTPSFSPIPQQSNKSIGNHKNTSVANVSSKVAN
                     SKFERNISMMSNSNASSPAIFEVGAEAKEKTKDAIPCHPDDKLMIPSPKIVTHGDAMQ
                     EEQRLRQKSQITPDDEVELAKVYLNALETLENKPSLAPDQASYNTRINVYRTRAVELL
                     KKNAYPSKTQNTVPEALFLIGQFHSQGVLGFRRDLGKAFELYSLAAKKGHPLSNYRVA
                     VCLQTGTGVKPDTSKCVAIYKKAAEMDVVEAMFRIALIYLNGLLGQKRNISLGVQWLE
                     RACKSKGPESVRAMYELAKIYEQPDRYGVSATPERKFELYKQSAVYGYAAAQCKLGEC
                     YEHGLLGCLAEPRRSIFWYTRAAEQDYGEAELGLSGWYLTGSEGILPKNGEEALLWAH
                     KAACKGLAKAQYAVGFMMEQGIGVAADPSSAHNWYIRAAKQGFPKAKKRLEEQALSSK
                     QTHSKAPKKKQQEQCVVM"
     gene            complement(221694..223991)
                     /gene="sid2"
                     /locus_tag="SPAC24B11.11c"
                     /db_xref="GeneID:2541599"
     mRNA            complement(221694..223991)
                     /gene="sid2"
                     /locus_tag="SPAC24B11.11c"
                     /product="NDR kinase Sid2"
                     /transcript_id="NM_001018249.2"
                     /db_xref="GeneID:2541599"
     CDS             complement(222029..223852)
                     /gene="sid2"
                     /locus_tag="SPAC24B11.11c"
                     /codon_start=1
                     /product="NDR kinase Sid2"
                     /protein_id="NP_592848.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24B11.11c"
                     /db_xref="EnsemblGenomes-Tr:SPAC24B11.11c.1"
                     /db_xref="GeneID:2541599"
                     /db_xref="GOA:Q09898"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="PomBase:SPAC24B11.11c"
                     /db_xref="PomBase:SPAC24B11.11c.1"
                     /translation="MNRVNDMSPVEGDLGLQLSSEADKKFDAYMKRHGLFEPGNLSNN
                     DKERNLEDQFNSMKLSPVASSKENYPDNHMHSKHISKLPIASPIPRGLDRSGELSYKD
                     NNHWSDRSSTGSPRWENGSMNLSVEEMEKVVQPKVKRMATICQMFFLDHYFEQLHYLY
                     TRKQRARLFEEQLLKEPDSRRDELVKRYNGRERVYLRKRRTRISHGDFQTITQVGQGG
                     YGSVWLARKRDTKEIVALKIMNKSVLHKMDEIRHVLTERDILTTANSEWLVRLLYAFQ
                     DTSNIYLAMEFVPGGDFRTLLSNSGVLRDHHAKFYATEMFLAIDALHQLGYIHRDLKP
                     ENFLVGASGHIKLTDFGLSSGIISKKKIESMKIRLQEVNNVVVPERSMRERRQVFRTL
                     LSQDPVYAHSVVGSPDYMAPEVLRGENYNHSVDYWSLGCIMYECLSGFPPFSGSNVNE
                     TWSNLKNWRKCFQRPHYDDPRDLEFNWRDDAWDFVCHCITDPKDRFCSLKQVMQHPYF
                     SKIDWKNVRTAYRPPFVPDLNSEIDAGYFDDFTNENDMSKYKEVHEKQAAIANMVNTF
                     NKPKRNAFIGFTFRHQKNSHPTSSSSALSSPLSAPSFGTLL"
     gene            complement(224080..229307)
                     /locus_tag="SPAC24B11.12c"
                     /db_xref="GeneID:2541560"
     mRNA            complement(join(224080..228232,228312..229307))
                     /locus_tag="SPAC24B11.12c"
                     /product="putative P-type ATPase"
                     /transcript_id="NM_001018250.2"
                     /db_xref="GeneID:2541560"
     CDS             complement(join(224396..228232,228312..228683))
                     /locus_tag="SPAC24B11.12c"
                     /EC_number="3.6.3.1"
                     /codon_start=1
                     /product="putative P-type ATPase"
                     /protein_id="NP_592849.1"
                     /db_xref="GeneID:2541560"
                     /db_xref="GOA:Q09891"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR026871"
                     /translation="MESVEEKSKQRRWLPNFKALRLKVYRLADRLNIPLADAARVELE
                     EYDGSDPQSLRGLQKLPRTLYFGLPLPDSELDDTGEAKRWFPRNKIRTAKYTPIDFIP
                     KNIFLQFQNVANLFFLFLVILQSISIFGEQVNPGLAAVPLIVVVGITAVKDAIEDFRR
                     TMLDIHLNNTPTLRLSHYQNPNIRTEYISYFRRFKKRISALFRVFLAKQEEKKRAKRL
                     NDAVPLEDMAGSESRPSYDSIFRESFEAKRSFEDSKGKVPLSALDGTATILQSRPMDI
                     IDYEAEATGECHFKKTYWKDVRVGDFVKVMDNDEIPADIVIINSSDPEGICYIETKNL
                     DGETNLKMRHALTCGKNVVDEASCERCRFWIESEPPHANLYEYNGACKSFVHSEAGGS
                     DTSQTVSEPISLDSMLLRGCVLRNTKWVIGVVVFTGDDTKIMLNSGAPPLKRSRITRN
                     LNWNVYLNFIILFSMCFVCAVVEGIAWRGHSRSSYYFEFGSIGGSPAKDGVVTFFTGV
                     ILFQNLVPISLYISIEIVKTIQAIFIYFDKDMYYKKLKYACTPKSWNISDDLGQVEYI
                     FSDKTGTLTQNVMEFKKCTINGVAYGEAFTEAMAGMAKREGKDTEELTLQKQSFIERD
                     RMQMISQMRNMHDNKYLVDDNLTFISSQFVHDLAGKAGEEQSLACYEFFLALALCHSV
                     VADRVGDRIVYKAQSPDEAALVGTARDVGFVFLDQRRDIMVTRALGETQRFKLMDTIE
                     FSSARKRMSVIVKGPDNRYVLICKGADSIIFERLEPNEQVELRKTTSEHLRIFALEGL
                     RTLCIAKRELTEEEYYEWKEKYDIAASAIENREEQIEEVADLIESHLTLLGGTAIEDR
                     LQEGVPDSIALLAQAGIKLWVLTGDKMETAINIGFSCNLLDAGMDMIKFDVDQEVSTP
                     ELEVILADYLYRYFGLSGSVEELEAAKKDHDTPSGSHALVIDGSVLKRVLDGPMRTKF
                     LLLCKRCKAVLCCRVSPAQKADVVQLVRESLEVMTLAIGDGANDVAMIQKADIGVGIV
                     GEEGRAAAMSADYAIGQFRFLSKLVLVHGRWDYNRVAEMVNNFFYKSVVWTFTLFWYQ
                     IYNNFDANYLFDYTYVMLFNLIFSSLPVIVMGVYDQDVNADLSLRIPQLYKRGILQLN
                     SARKIFIGYMLDGFYQSVICFFFSFLVINNVTTAAQNGRDTMAVQDLGVYVAAPTIMV
                     VDTYVILNQSNWDVFSIGLWALSCLTFWFWTGVYSQSLYTYEFYKSASRIFRTPNFWA
                     VLCGTIVSCLFPKFLFMTTQKLFWPYDVDIIRESYRTKRLHELDEEEEIENAEQSPDW
                     ASSTLQVPFNASSSSLATPKKEPLRLDTNSLTLTSSMPRSFTPSYTPSFLEGSPVFSD
                     EILNRGEYMPHRGSISSSEQPLRP"
     gene            complement(229270..230855)
                     /locus_tag="SPNCRNA.624"
                     /db_xref="GeneID:14217924"
     misc_RNA        complement(229270..230855)
                     /locus_tag="SPNCRNA.624"
                     /product="antisense RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_150987.1"
                     /db_xref="GeneID:14217924"
     gene            <230545..>231136
                     /locus_tag="SPAC24B11.14"
                     /db_xref="GeneID:2541528"
     mRNA            join(<230545..230681,230743..230799,230830..>231136)
                     /locus_tag="SPAC24B11.14"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001355969.1"
                     /db_xref="GeneID:2541528"
     CDS             join(230545..230681,230743..230799,230830..231136)
                     /locus_tag="SPAC24B11.14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_001342929.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24B11.14"
                     /db_xref="EnsemblGenomes-Tr:SPAC24B11.14.1"
                     /db_xref="GeneID:2541528"
                     /db_xref="PomBase:SPAC24B11.14"
                     /db_xref="PomBase:SPAC24B11.14.1"
                     /translation="MFAYNHKTLHVCLRLISLRNCSNTWTFVPYANSNRGLNINQQLK
                     LFNRRSKIALSSFIIPTSVDILVKVAGFQRYIVNVEFSNVQSYFRYYNYISLYFVTHS
                     KVPLNRLPNSMIPYTVFAHFDIVPYTTYSILTKYRCAQDKEREIVGLINASQSKLRYK
                     FCGLRN"
     gene            231311..233488
                     /gene="hem3"
                     /locus_tag="SPAC24B11.13"
                     /gene_synonym="SPAC806.01"
                     /db_xref="GeneID:3361383"
     mRNA            231311..233488
                     /gene="hem3"
                     /locus_tag="SPAC24B11.13"
                     /gene_synonym="SPAC806.01"
                     /product="putative hydroxymethylbilane synthase"
                     /transcript_id="NM_001018252.2"
                     /db_xref="GeneID:3361383"
     CDS             231655..232665
                     /gene="hem3"
                     /locus_tag="SPAC24B11.13"
                     /gene_synonym="SPAC806.01"
                     /EC_number="2.5.1.61"
                     /codon_start=1
                     /product="putative hydroxymethylbilane synthase"
                     /protein_id="NP_001018179.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24B11.13"
                     /db_xref="EnsemblGenomes-Tr:SPAC24B11.13.1"
                     /db_xref="GeneID:3361383"
                     /db_xref="GOA:Q09899"
                     /db_xref="InterPro:IPR000860"
                     /db_xref="InterPro:IPR022417"
                     /db_xref="InterPro:IPR022418"
                     /db_xref="InterPro:IPR022419"
                     /db_xref="PomBase:SPAC24B11.13"
                     /db_xref="PomBase:SPAC24B11.13.1"
                     /translation="MPSCTSFPIGTRKSKLAVIQSEIIREELEKHYPHLEFPIISRDT
                     IGDEILSKALFEFKRQLAKSLWTRELEALLVTNQCRILVHSLKDLPSEMPDGMVIACI
                     PKRSCPLDAIVFKAGSHYKTVADLPPGSVVGTSSIRRRALLARNFPHLRFVDIRGNVG
                     TRLAKLDAPDSQFDCLVLAAAGLFRLGLKDRIAQMLTAPFVYYAVGQGALAVEVRADD
                     KEMIEMLKPLQHQETLYACLAERALMKRLQGGCAIPIGVQTDVLAISNSSYRISLLGT
                     VLSADGLRAAFGNAEAVVSSEEEAEELGITVALALLKNGAGPILEEHQRSSDSEESLK
                     NY"
     gene            complement(233032..235164)
                     /locus_tag="SPAC806.02c"
                     /db_xref="GeneID:2542122"
     mRNA            complement(join(233032..235053,235103..235164))
                     /locus_tag="SPAC806.02c"
                     /product="putative Par A family ATPase/WD
                     repeat-containing iron cluster assembly protein"
                     /transcript_id="NM_001018253.2"
                     /db_xref="GeneID:2542122"
     CDS             complement(join(233231..235053,235103..235106))
                     /locus_tag="SPAC806.02c"
                     /codon_start=1
                     /product="putative Par A family ATPase/WD
                     repeat-containing iron cluster assembly protein"
                     /protein_id="NP_592852.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC806.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC806.02c.1"
                     /db_xref="GeneID:2542122"
                     /db_xref="GOA:Q9UT57"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028600"
                     /db_xref="InterPro:IPR028608"
                     /db_xref="PomBase:SPAC806.02c"
                     /db_xref="PomBase:SPAC806.02c.1"
                     /translation="MDKVQHVILVLSGKGGVGKSSVTTQLALSLHDSKVYSRPLKTGI
                     LDIDLTGPSIPRMFGKDAERNRIHQSSAGWVPVYTDETKEIGLMSLGFLLTSKNDSVV
                     WRGPKKAAMIRQFISDVSWGELDFLIIDTPPGTGDEHLTIVESLLSETSTVRDVPIDG
                     AVIVTTPQGIATLDVQKEIDFCKKASIKILGIVENMSGYICPHCADCTNIFSSGGGLT
                     LSEKYKLPFLGSVPIDPKFGEMIENLTPDSNIVHLYSKTEMSKKFSFITNEFLNQLYG
                     PRKLDTITTISGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDGFHTR
                     SIRRVAWRPIERPVLAVASFDSVVSINEKIDDDWECTAALEGHENEVKCIAWSCNGNY
                     LATCSRDKSVWIWEATEDDEFDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFW
                     RDDGDDWALTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSNEDVATIDS
                     TNILRPALQEEWKQQTSLPHIHKGAVYTISWMNDATLCSAGGDGKIVVYQREKHDEAL
                     WHVAYEQDHAHGVYEINSLEYLRDDRLLSGGDDGECRVWSFK"
     gene            235280..237141
                     /locus_tag="SPNCRNA.625"
                     /db_xref="GeneID:14218004"
     misc_RNA        235280..237141
                     /locus_tag="SPNCRNA.625"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150988.1"
                     /db_xref="GeneID:14218004"
     gene            complement(235533..236104)
                     /gene="rps2601"
                     /locus_tag="SPAC806.03c"
                     /gene_synonym="rps26; rps26-1"
                     /db_xref="GeneID:2543085"
     mRNA            complement(235533..236104)
                     /gene="rps2601"
                     /locus_tag="SPAC806.03c"
                     /gene_synonym="rps26; rps26-1"
                     /product="40S ribosomal protein S26"
                     /transcript_id="NM_001018254.2"
                     /db_xref="GeneID:2543085"
     CDS             complement(235653..236015)
                     /gene="rps2601"
                     /locus_tag="SPAC806.03c"
                     /gene_synonym="rps26; rps26-1"
                     /codon_start=1
                     /product="40S ribosomal protein S26"
                     /protein_id="NP_592853.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC806.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC806.03c.1"
                     /db_xref="GeneID:2543085"
                     /db_xref="GOA:Q9UT56"
                     /db_xref="InterPro:IPR000892"
                     /db_xref="PomBase:SPAC806.03c"
                     /db_xref="PomBase:SPAC806.03c.1"
                     /translation="MTQKRRNCGRNKHGRGHTKFVRCINCSRAVPKDKAIKRWNIRNM
                     VETAAIRDLSEASVYSEYAIPKIYVKLQYCVSCAIHARVVRVRSREGRRIRTPPPRVR
                     YNRDGKRVNPAAIAKTAL"
     gene            236819..236928
                     /locus_tag="SPNCRNA.143"
                     /db_xref="GeneID:9407225"
     misc_RNA        236819..236928
                     /locus_tag="SPNCRNA.143"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150312.1"
                     /db_xref="GeneID:9407225"
     gene            complement(237023..237885)
                     /locus_tag="SPAC806.11"
                     /db_xref="GeneID:5802854"
     mRNA            complement(237023..237885)
                     /locus_tag="SPAC806.11"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001355970.1"
                     /db_xref="GeneID:5802854"
     gene            complement(237074..237848)
                     /gene="prl3"
                     /locus_tag="SPNCRNA.03"
                     /gene_synonym="prl03"
                     /db_xref="GeneID:5802853"
     misc_RNA        complement(237074..237848)
                     /gene="prl3"
                     /locus_tag="SPNCRNA.03"
                     /gene_synonym="prl03"
                     /product="non-coding RNA, poly(A)-bearing RNA (predicted)"
                     /transcript_id="NR_149830.1"
                     /db_xref="GeneID:5802853"
     CDS             complement(237212..237430)
                     /locus_tag="SPAC806.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_001343029.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC806.11"
                     /db_xref="EnsemblGenomes-Tr:SPAC806.11.1"
                     /db_xref="GeneID:5802854"
                     /db_xref="GOA:A6X969"
                     /db_xref="PomBase:SPAC806.11"
                     /db_xref="PomBase:SPAC806.11.1"
                     /translation="MLCPTHGPTTWNPHSCTVVEKCITNLLITTILLCFFNATTYWKL
                     FFGAMFDFIHYQLLFRNSLSEILLLGLG"
     gene            complement(237820..239427)
                     /locus_tag="SPNCRNA.626"
                     /db_xref="GeneID:14218292"
     misc_RNA        complement(237820..239427)
                     /locus_tag="SPNCRNA.626"
                     /product="intergenic RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_150989.1"
                     /db_xref="GeneID:14218292"
     gene            237903..238881
                     /locus_tag="SPNCRNA.627"
                     /db_xref="GeneID:14218086"
     misc_RNA        237903..238881
                     /locus_tag="SPNCRNA.627"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_150990.1"
                     /db_xref="GeneID:14218086"
     gene            238509..238898
                     /locus_tag="SPNCRNA.144"
                     /db_xref="GeneID:9406930"
     misc_RNA        238509..238898
                     /locus_tag="SPNCRNA.144"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150323.1"
                     /db_xref="GeneID:9406930"
     gene            238998..240617
                     /locus_tag="SPNCRNA.628"
                     /db_xref="GeneID:14218058"
     misc_RNA        238998..240617
                     /locus_tag="SPNCRNA.628"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_150991.1"
                     /db_xref="GeneID:14218058"
     gene            239730..240571
                     /locus_tag="SPNCRNA.145"
                     /db_xref="GeneID:9406933"
     misc_RNA        239730..240571
                     /locus_tag="SPNCRNA.145"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150334.1"
                     /db_xref="GeneID:9406933"
     gene            complement(241008..243122)
                     /locus_tag="SPAC806.04c"
                     /db_xref="GeneID:2543077"
     mRNA            complement(join(241008..241537,241589..241709,
                     241757..242815,242917..243122))
                     /locus_tag="SPAC806.04c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018255.2"
                     /db_xref="GeneID:2543077"
     CDS             complement(join(241426..241537,241589..241709,
                     241757..242815,242917..242941))
                     /locus_tag="SPAC806.04c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592854.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC806.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC806.04c.1"
                     /db_xref="GeneID:2543077"
                     /db_xref="GOA:Q9UT55"
                     /db_xref="InterPro:IPR002791"
                     /db_xref="PomBase:SPAC806.04c"
                     /db_xref="PomBase:SPAC806.04c.1"
                     /translation="MKFLNPPFPYSMTSDPESFGHECFTRRWGIILTGIEKDVSERLS
                     KLASTSKDSEVVAQGKPLLNDLEAFKSDIKNDRPLVPLEGEGQDIVEYNEELKQLDNA
                     SWGNAPWLYSECYYYRRISLIFARYSEWKAYDPFFQQKDSTLKSSRAAVEELAGRYCL
                     LEEELNSIAKKGDSHIAYMVFVEMAQISLWGNATDLSLLTNLSYEELQNLQGQKVVEE
                     SQKNILVNDFPTVWSKLKDVHNGRIDFVLDNAGFELYVDLIFAAYLLKAGIAKEIVLH
                     PKDFPWFVSDVLPYDIEYLLTNLDTIFPTESVTKFATDLRSFSAKGQLRLRTDPFWTT
                     AHYFGRMPDFAAGLLTELEKSDMIFFKGDLNYRKLTGDCLWPRTTPFGKTLGPIANAI
                     NACALRTCKADVVVGLPDGLYEKIAKDLPHWERTGKYAVVEFCPKA"
     gene            complement(244206..247074)
                     /locus_tag="SPAC806.06c"
                     /db_xref="GeneID:2543055"
     mRNA            complement(244206..247074)
                     /locus_tag="SPAC806.06c"
                     /product="putative nicotinamide mononucleotide
                     adenylyltransferase"
                     /transcript_id="NM_001018257.2"
                     /db_xref="GeneID:2543055"
     gene            244214..247574
                     /locus_tag="SPAC806.05"
                     /db_xref="GeneID:2543073"
     mRNA            join(244214..247438,247491..247574)
                     /locus_tag="SPAC806.05"
                     /product="ANC9 family protein"
                     /transcript_id="NM_001355971.1"
                     /db_xref="GeneID:2543073"
     CDS             244731..245108
                     /locus_tag="SPAC806.05"
                     /codon_start=1
                     /product="ANC9 family protein"
                     /protein_id="NP_001342908.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC806.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC806.05.1"
                     /db_xref="GeneID:2543073"
                     /db_xref="GOA:Q9UT54"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="PomBase:SPAC806.05"
                     /db_xref="PomBase:SPAC806.05.1"
                     /translation="MKKEHASAFRQLWRAGMAAAISTRFPGHRFVIRDLLRNGFRQNN
                     CSFYSKEKVENTVIFLEMAASRKSVEHLILKNRLHIQMFRRKAGQRLAHYSTAKERPY
                     FLSAYDTYEWCLQRVGTIYNLYL"
     CDS             complement(245304..246410)
                     /locus_tag="SPAC806.06c"
                     /EC_number="2.7.7.1"
                     /codon_start=1
                     /product="putative nicotinamide mononucleotide
                     adenylyltransferase"
                     /protein_id="NP_592856.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC806.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC806.06c.1"
                     /db_xref="GeneID:2543055"
                     /db_xref="GOA:Q9UT53"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR005248"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="PomBase:SPAC806.06c"
                     /db_xref="PomBase:SPAC806.06c.1"
                     /translation="MHTMNGDNFANSFPKNPLLSRNSSSSNVIQYSDEFSPDEDWLNE
                     HAAKEHEERIRRPSVNRAWQKNSTSGGPSVSLEKREADVASLGEVMDLEEVPRGITRQ
                     ARQLNEYIFPKHRFRNHLVDEGKIPLVLVACGSFSPITYLHLRMFEMATDTIQEQTNM
                     ELVAGYFSPVNDHYKKEGLAPAYHRVRMCELACERTSSWLMVDAWESLQPSYTCTARV
                     LDHFDEEINQKRGGITLSDGTKRPCKIMLLAGGDLIASMGEPGVWSDKDLHHILGKFG
                     CCIVERTGSDVWAFLLAHDIMFAYRGNILVIKQLIYNDISSTKVRLFIRRGMSIRYLL
                     PNSVIQYIERYALYRDAEPVKTIFYQSPFVRMEP"
     gene            complement(247720..248448)
                     /locus_tag="SPNCRNA.629"
                     /db_xref="GeneID:14218005"
     misc_RNA        complement(247720..248448)
                     /locus_tag="SPNCRNA.629"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150992.1"
                     /db_xref="GeneID:14218005"
     gene            247821..248560
                     /gene="ndk1"
                     /locus_tag="SPAC806.07"
                     /db_xref="GeneID:2543111"
     mRNA            247821..248560
                     /gene="ndk1"
                     /locus_tag="SPAC806.07"
                     /product="nucleoside diphosphate kinase Ndk1"
                     /transcript_id="NM_001018258.2"
                     /db_xref="GeneID:2543111"
     CDS             247928..248383
                     /gene="ndk1"
                     /locus_tag="SPAC806.07"
                     /EC_number="2.7.4.6"
                     /codon_start=1
                     /product="nucleoside diphosphate kinase Ndk1"
                     /protein_id="NP_592857.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC806.07"
                     /db_xref="EnsemblGenomes-Tr:SPAC806.07.1"
                     /db_xref="GeneID:2543111"
                     /db_xref="GOA:P49740"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR023005"
                     /db_xref="PomBase:SPAC806.07"
                     /db_xref="PomBase:SPAC806.07.1"
                     /translation="MSTEQTFIAVKPDAVQRGLIGYIISKFELKGYKLRALKFLVPSR
                     DLVEEHYAEHKGKPFYEKLVGFMASGPVCAMIWEGKQAVKTGRLMLGASNPLDSAPGT
                     IRGDYGIDLGRNVCHGSDSIESANREIKLWFQPSEIQVYDRTIEPWIYE"
     gene            complement(248579..250983)
                     /gene="mod21"
                     /locus_tag="SPAC806.08c"
                     /db_xref="GeneID:2543117"
     mRNA            complement(join(248579..250549,250607..250983))
                     /gene="mod21"
                     /locus_tag="SPAC806.08c"
                     /product="gamma tubulin complex subunit Mod21"
                     /transcript_id="NM_001018259.2"
                     /db_xref="GeneID:2543117"
     CDS             complement(join(248680..250549,250607..250770))
                     /gene="mod21"
                     /locus_tag="SPAC806.08c"
                     /codon_start=1
                     /product="gamma tubulin complex subunit Mod21"
                     /protein_id="NP_592858.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC806.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC806.08c.1"
                     /db_xref="GeneID:2543117"
                     /db_xref="GOA:Q9UT52"
                     /db_xref="PomBase:SPAC806.08c"
                     /db_xref="PomBase:SPAC806.08c.1"
                     /translation="MTMSRADQILQHLLRELIHNDSLVASEWLKHSKKIIQNVPSSTL
                     VFHEMIEHIKGICDKMGIQGREDLEMPLRNACEVLNRQTVSVKQSILHAQILKLFLEL
                     SKPPSDIHVPQIPVYKDCNKNEQEAIIQLLTSCEGDHWLMPDWSSMPDDETITEDSEE
                     ETFNGNANEITIPANIHIPIIEESDNASNNKLCTLFKKSKQPNLDFLQIKPFMFWDSS
                     LNETVRISERSIIRDSIYMLIGYPSFFFLKNGSKIETRLSLLPKLHHMSEEILRSIMT
                     ELADYGSNLEFFRQKLTSPSDSFFKSDDQSTKNEPFLSVVFIYPQIKPHLLSCLKNTH
                     QELIKLETEVYNATKNCTLFQFFQHVKKFVDPLLCFRFAYEKSATNMWDFVKTLEFIY
                     STRNYSSQMFKLYKASAIAMLLWMVNQASQITSSMTIARPLYNILILCKDFPNNFLEK
                     DNIALQLGSIVFDQSPTLNNLLVEMEILIRSKILKLGKSLDLSFDFQSLMGEFENLIK
                     QQEEAKKSLWSKRFSRFYYGHYVFVNTCHNFFLTLYQSFTEVDENSIFNGVFETLNND
                     VDDESVIGEKEKLILKQKQKCLSEFFVDDIKKLLNEELLNCQKQELPDVMENTYQIST
                     VSGIKNDPLFTLDQTCNIIAKLADNLIHPSVPIGSSAYRCRRNLADLLFLIMP"
     gene            complement(251173..254600)
                     /locus_tag="SPAC1639.01c"
                     /db_xref="GeneID:2543177"
     mRNA            complement(join(251173..252337,252392..252752,
                     253590..254600))
                     /locus_tag="SPAC1639.01c"
                     /product="putative GNS1/SUR4 family protein"
                     /transcript_id="NM_001018260.3"
                     /db_xref="GeneID:2543177"
     CDS             complement(join(251726..252337,252392..252752,
                     253590..253714))
                     /locus_tag="SPAC1639.01c"
                     /codon_start=1
                     /product="putative GNS1/SUR4 family protein"
                     /protein_id="NP_592859.3"
                     /db_xref="EnsemblGenomes-Gn:SPAC1639.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1639.01c.1"
                     /db_xref="GeneID:2543177"
                     /db_xref="GOA:Q7LKX0"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="PomBase:SPAC1639.01c"
                     /db_xref="PomBase:SPAC1639.01c.1"
                     /translation="MPDSPTLHHNHIIGLENGSLTSNNNHQGMASVSVGQFQYPIWSW
                     LNSLADATFGKRPSSFEFIVNKTRFSSAPVVATIIISYYLLILVGGRIMRNRQPIRLQ
                     KIFQYYNLTFSIASAILALLIFEQVAPAIYKHGFFFSICNEKAWTQPLVFLYYCAYIS
                     KFLELTDTFFLVLRKKPLQFLHCYHHGATAVLVYTQIVGRTSISWLIIEINLLVHVTM
                     YYYYYLVAKGIRVPWKKWVTRFQIVQFFADLGFIYFAVYTEVAYRLKFYKACMGHCSG
                     HPLAAFCGLATISSYLVLFIVFYHNTYKKNAALKMKAKAAAATKGNSSESSKNADLKR
                     LSKSNASIAEVKCNNIVTNLYPISSGLNNEK"
     gene            253719..255964
                     /locus_tag="SPNCRNA.630"
                     /db_xref="GeneID:14217881"
     misc_RNA        253719..255964
                     /locus_tag="SPNCRNA.630"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_150993.1"
                     /db_xref="GeneID:14217881"
     gene            complement(255881..259505)
                     /gene="trk2"
                     /locus_tag="SPAC1639.02c"
                     /gene_synonym="SPAC1F5.12"
                     /db_xref="GeneID:3361385"
     mRNA            complement(join(255881..256134,256345..256370,
                     256427..256445,256542..256612,256684..256750,
                     256797..257009,257055..257070,257116..257135,
                     257179..257181,257229..258184,258220..259120,
                     259161..259315,259356..259505))
                     /gene="trk2"
                     /locus_tag="SPAC1639.02c"
                     /gene_synonym="SPAC1F5.12"
                     /product="potassium ion transporter Trk2"
                     /transcript_id="NM_001355972.1"
                     /db_xref="GeneID:3361385"
     CDS             complement(join(256030..256134,256345..256370,
                     256427..256445,256542..256612,256684..256750,
                     256797..257009,257055..257070,257116..257135,
                     257179..257181,257229..258184,258220..259120,
                     259161..259315,259356..259461))
                     /gene="trk2"
                     /locus_tag="SPAC1639.02c"
                     /gene_synonym="SPAC1F5.12"
                     /codon_start=1
                     /product="potassium ion transporter Trk2"
                     /protein_id="NP_001342909.1"
                     /db_xref="GeneID:3361385"
                     /db_xref="GOA:Q10065"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="InterPro:IPR004773"
                     /db_xref="InterPro:IPR015958"
                     /translation="MFVRYRRFLRRKILYRFYHAVIGFFYKRFRFLEYHYSFIIGMTI
                     LCSVILYGSGNLRYIDALLLASGSCTQTGLQPVDLTQISIYQQLTILLFGVLSTPITV
                     NLGLTLFKLYFYNKRYDMVITNNKLRMTYTYHTVRRRDTPEPSKVGNRKIRVLLDQGN
                     QMHRPVAPETKAEEAEHQENEKHHRHHFRLRKFANAIDRPSFFRGNTMPALPSYAGVR
                     NSQENEDRTEALSPALGKRRMASIDNGSLSVVQNNARNNPVDFYIPSSFEESSFQTIP
                     EDFEPQVHDHENQTQLNHHLDNNSSISSHNPSLETANDGNQETVSSSNSNYSTTRVDN
                     DPHVASYSPQNSNFDHQAAATTNDAHQNVVRGSAITIAPTPVPRHNRRPIYFADDTNG
                     AEQEKGAHRLDGRGRKRGKSFAVTPTLHRNERSMSVLPFQLAKSFTSALPRRLTFNRT
                     HTKASTMSLPYLSYNATVGRNSAFYALTPVEREELAGIEYESLRILTVILVVYFLFWH
                     ILGLVAFLIFIYTAKTSGRVVTDGGINRGWWAAFTSSSLFDNLGYSLNSDSLNSFQKA
                     IFPQVLGTILIFLGNTFFPIMLRFIIWIMIRTTRFSPNFQQALYFLFEHPRRSFTLLF
                     PSKTTWVLFLNLTLLNFASFFFFMVLDLGNSYVDKIPVGYRIMNAIFQNAATRSAGFT
                     VVDLSQIAPAVMVTYMFMMYISAYPIAMSIRQTNVYEERSLGIYAADTENDDDNNINN
                     NNNDNNTPKRKNFLMDHIQRQLSHDLWYLFLGYFIITIVEGRRLESEAEPQFTLFAIL
                     FEVISGYGTVGLSLGYKNDPSLTAQFRKISKLVMVALQIRGRHRGLPSALDRAVLMPS
                     DKNFDREEEDYMRRHGKKNTNRADPVPSS"
     gene            256086..257001
                     /locus_tag="SPNCRNA.631"
                     /db_xref="GeneID:14218366"
     misc_RNA        256086..257001
                     /locus_tag="SPNCRNA.631"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150994.1"
                     /db_xref="GeneID:14218366"
     gene            259603..271053
                     /gene="tra2"
                     /locus_tag="SPAC1F5.11c"
                     /db_xref="GeneID:2541659"
     mRNA            join(259603..259782,259844..271053)
                     /gene="tra2"
                     /locus_tag="SPAC1F5.11c"
                     /product="phosphatidylinositol kinase-like protein Tra2"
                     /transcript_id="NM_001018262.2"
                     /db_xref="GeneID:2541659"
     CDS             join(259719..259782,259844..270747)
                     /gene="tra2"
                     /locus_tag="SPAC1F5.11c"
                     /codon_start=1
                     /product="phosphatidylinositol kinase-like protein Tra2"
                     /protein_id="NP_592862.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F5.11c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F5.11c.1"
                     /db_xref="GeneID:2541659"
                     /db_xref="GOA:Q10064"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PomBase:SPAC1F5.11c"
                     /db_xref="PomBase:SPAC1F5.11c.1"
                     /translation="MEDGFEKSLSSSIELLKAESTEIEEKIKLTKILITKVSSISSDA
                     SQLYAELIPLLLDFLRNTEVNLYRNSSVNELKIEALTLIQSCAHRDEFKQYAQSCVLS
                     FISLIKADNEEVAVFCLKVIMDIFKTFKFCIESTAQPFFDLVLELSTNLPYLIPSIFV
                     ENPKSNEEENTTLAFGSYLSTETSIIQQRVNSLAISTQPLELASQSFRVYVECPVIIV
                     LILQAYRQAAFPGVQAIIPCFLKMVQIDVPIDIASYAMIEKDSSIDFIEFIRNKYQYR
                     NFFMAQVKTLSFLAYILRTHPNTLSEKDIIPDIVIKLLRRCPFDMCFARKELLVATRH
                     ILSTNLKSLFVKKLDFLLDLNILLGNGVGTQKLLRPLAFSTLADLLHHVRDELNETQI
                     RKSIMIYSTNMHDLTLSIGLQTMGARLILNMVDRMISLPSIPDAIFLLLSIFDSFVNK
                     FSELNDSLDQFFKKKYEEEIKETKSPTRSSPRDLSSFSTSVNDGSFLFKNLMFGLRAL
                     MYGLRTCKSRCIEIGGEQFSGFLTNIKPFEAVTFQKLFFEVGKGFSYFRPEQVYLETF
                     FCCEEESLDRPAISTLPRNKDEKDCLEVFATIFIHLEPSIFLKVFETNLPTFFDQLKK
                     NLTLFHIPQFLLSNESTSSKFLNILLRFLLSRIEELGSSDIRHGSVLLRLFRLSFVTV
                     SMFATENEPVLRPYVSEIIVKCMKLAPNSANSLNYYYLLRALFRGIGGGRFESLYKEV
                     MPLLHALLEAFNSLLISARTPKEKDLFTELCLTIPVRLSLLLPYMSYLMRPLVMSLKS
                     SQELVSQGLRTFELCLDNLTPDFLDPIMAPYIEDLMNALWSHLQPLPYNYNHSHTALK
                     ILGKLGGRNRKLLDRVQSLKNSPEPNNDFTLLLSIKGVKQPQLLHYTQYVDEAVNLLS
                     SPSSDLEVKQQAFTYVCNISKLYVYKSDATNSLASSIRCTADKISKSNFDFRRPYSVI
                     PSRMTGRSSFTQLSDDSDETIILASATYGLFFATTVDELREEAYFWLEKLAVNVIVHD
                     IFYAFDVIQGNHSKFTTNLQKEVIISPHYFAHCLSEVVCNDNSKMGDAVKHVLKFMFS
                     FLESIFENPERAFILPIFEVLLSDFRHKCYDPHWYKKYGGCFGLECLIEQDHSSKWLF
                     DRQVDILTALFFTLKDTTSEVPTVCKDHVMDVLKQLFRKIYASKDTEIAPGILGHLVL
                     ELSNHNSVVRSSTQKLLSLLSELSNTPIVKLVSPFKERLLSPIFAKPLRALPFHIQIG
                     HIDAVNYCISLGSELITFSDELIRLIHETTALAEADDDALIGIGKTSHFKNAALLIRL
                     RVVCVELLSTCILKIDFNNPQHAHLREGIIVVFFKSLYAKSKELIEAASLGLKNALQE
                     DQKLSKELLQTTLRPILYNISDYRRLSVAGLEGLGRLLRLLTNYFKVEIGRKLLDHLK
                     ALLENVDFQKVSSLPLFCQTEMKIVRALIDLFHLLPNNANRFMDELLICVVEFSLRLQ
                     RTFPNYFSEPLLKYVNRYPEDAWKFFMVRYDEAAFTSVFVELLRLKDSDPLLSVVKDN
                     WLFFQTILTNEINTVTANRYSFALDSAIVILQRDPSFFKDKNDFFRGSMDAVLAISHL
                     VENESILESMVFWNDLLVRTSTFLLEVYDLCIYNYDDGLKLLSCFHMYKNSLAKNLVS
                     DLTAHLVKKIEEPDLENNVKLILNLILSKDYGFLLKENLAGILLTYLNQNVSSLEKCN
                     QIFSIFYEVFFQHPSTNVYANDEGIKIGALQIISFFLKNVPEITVQHQTEMLKMCSLF
                     GNSEDVMIKQLSIYVMSLFILRSQFPYELVNVVYMALLKSSPIEVRHLVKSSFDNIFS
                     YIFSEEPESKKSPIWFELPLQVISSQSQNISQLLNVYDFISSHSDIFIEHRGRYVPIL
                     IDSLYKFGAIPNPNPEIRALSLGLIKVLLEWNDLQLKVDQKEIFSNNQKRAILSYLFR
                     FVCLFSEPFTEGLCSEAISLLERLLSSGTWASLGMKLSFFTKSITHFDATDANSVMFA
                     NSLRTLSIVVGHSDSAWIEENLSDLKFLLEKSLENESVGVQSAIGNFVSTILTLSNTH
                     PSIAGNPIFNDIWTSIASWTERRLQSCSQIEVTLPCVECFFKYKKDALHTLLPGFMRC
                     FHKVAKEFLSLGSQPSGNSLNLQIVNAVDERVSILKSMIELGCSYISYLGDQRRWFLS
                     ALVQIIEKSSSYEICNYLLEIVRGWIMNSPVPVPTVKEKAALLLKMVTFEGRFSQNEQ
                     NDLFNKYLSFIADIYEMEPYKNSELTFRLEAVYLLGTRVANKKLKERFIKGLNSSFPS
                     DLFSRFQFLLGSQHWESLSNTYWIVQLNIFLSRCFDLNQRCQFYKKPKLFSCFSIYCR
                     EFDEDLTSQAQDTEMLHNNLLKYGIIDFNQNSMLVSDFVLPVLSLQFSNSKIAEYLWR
                     DFFNASVCSFTKDEIPLCIGSIISFLSREYHIRLLGKTPNVLETILTSIVSSDMPIPL
                     PPHLLVYLSKTYGLHHYCILLLENSLQNNPGLSEDELTVYHKSCLDALSDIYYSLDEH
                     DLYHGLWRRRANFLETEVATSHEQCHEWEKAQLVYEHAQLKVCTGSLPYSPTEHGFWL
                     DHWILCAQKLNQWDVLFDFSKQEGCAELYLECAWRLSDWSTEQDTLEKATKSLSPFTS
                     LRRHTADALLYLNKTQRKMGSVTEFSRIIDECMQFSLRRWQQLPKRVYQSHVSLLHHF
                     QEIVELQEAFGIYSQLNDTNIHNIDNKLRDIKVVLQGWRERLPNVWDDIDIWSDLIAW
                     RQSVFKSINKVFLPLVSIAQQSTNKSNTNSVSYLYRGYHELAWIINRFAHVARVHHLP
                     EVCINQLTKIYTLPNIEIQEAFLKLREQAECHYESPSEMQLGLEVINNTNLMYFRNRQ
                     KAEFFTLKGMFQNRLGEKDEANQAFATAVQIDIGSGKAWSEWGLYHDELFQANPQEIH
                     HACNAVSCFLQASSLLSSSNSKPLLTRVLWLLSVDDSHGSVSEVVSSFKSEIPTWNWI
                     PFIPQLLSALSHRESIHARAILIQIAKTYPQSLHFQLRTAYEDFLMLKKQQAANVLRG
                     NSRLRENDSSSDNKSKDLSPSGSFSSVSQFNSKNGSPSSIDSSEKHQISTVKPAWELI
                     ADVTSILKTAYPLLALTMETMVDQIHTRLKSFPEEDAYRLIVALLNDGLQYISRLGVV
                     SKNTFQLPMSQANIQRFAENVLPVSVREAFLRDFVETKLDLLTYVDKLRMWRKKFENI
                     LDQRPKFLHLEQCSLYLSEFQHQKFDEVEIPGQYLLDKNNNNDFVRLERFVPNVDLVR
                     GHTMCYKRLTLRGYDGKLYPFALQYPATRHSRREERMLQLLGTFNTVLRSKIEIQNRN
                     FSFQIPSSIPLSSHMRIIADKPSYVTMQTISDEYCKNRGMPLDYGIRFYFDRLQTGLI
                     QLKRASASMLSNSTVEEKKQIFRQRALQLRMQLLETLNSSVFPESIYYDYFYKTFERY
                     CDFWFFRRTFTTQYAYMIIMTYVFNIGGRSPQKLFIVKDSGQVMSQDLLPSMTSNQPV
                     FHNTEAVPFRLTPPIQYLISDLGVEGLLSGLVMSIAQSLSSPTTDIKQYLSLYVRDEV
                     FWWSKQQRKPIPQGIQLFETVKVNVELLFRRISVISHNVPEDLPLNQTLVDLVSQATN
                     PQQLAQMDQLWQAWL"
     gene            complement(266551..267792)
                     /locus_tag="SPNCRNA.632"
                     /db_xref="GeneID:14218365"
     misc_RNA        complement(266551..267792)
                     /locus_tag="SPNCRNA.632"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150995.1"
                     /db_xref="GeneID:14218365"
     gene            complement(270893..272610)
                     /locus_tag="SPAC1F5.10"
                     /db_xref="GeneID:2541602"
     mRNA            complement(join(270893..272116,272170..272190,
                     272257..272610))
                     /locus_tag="SPAC1F5.10"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="NM_001018263.2"
                     /db_xref="GeneID:2541602"
     CDS             complement(join(271020..272116,272170..272190,
                     272257..272323))
                     /locus_tag="SPAC1F5.10"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="NP_592863.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F5.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F5.10.1"
                     /db_xref="GeneID:2541602"
                     /db_xref="GOA:Q10055"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC1F5.10"
                     /db_xref="PomBase:SPAC1F5.10.1"
                     /translation="MADEIMENVELTTSEDVNAVSSFEEMNLKEDLLRGIYAYGYETP
                     SAVQSRAIIQICKGRDVIAQAQSGTGKTATFSIGILQSIDLSVRDTQALILSPTRELA
                     VQIQNVVLALGDHMNVQCHACIGGTSVGNDIKKLDYGQHVVSGTPGRVTDMIRRRNLR
                     TRNVKMLILDEADELLNQGFKEQIYDIYRYLPPGTQVVVVSATLPQDVLEMTNKFTTN
                     PVRILVKRDELTLEGLKQYFIAVEKEEWKFDTLCDLYDTLTITQAVIFCNSRRKVDWL
                     TEKMREANFTVTSMHGEMPQKERDAIMQDFRQGNSRVLICTDIWARGIDVQQVSLVIN
                     YDLPANRENYIHRIGRSGRFGRKGVAINFVTNEDVRILRDIEQYYSTVIDEMPMNIGD
                     MV"
     gene            271077..272457
                     /locus_tag="SPNCRNA.633"
                     /db_xref="GeneID:14217904"
     misc_RNA        271077..272457
                     /locus_tag="SPNCRNA.633"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150996.1"
                     /db_xref="GeneID:14217904"
     gene            complement(272539..274901)
                     /locus_tag="SPNCRNA.634"
                     /db_xref="GeneID:14218087"
     misc_RNA        complement(272539..274901)
                     /locus_tag="SPNCRNA.634"
                     /product="antisense RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_150997.1"
                     /db_xref="GeneID:14218087"
     gene            <273152..>274921
                     /gene="shk2"
                     /locus_tag="SPAC1F5.09c"
                     /gene_synonym="pak2"
                     /db_xref="GeneID:2541468"
     mRNA            <273152..>274921
                     /gene="shk2"
                     /locus_tag="SPAC1F5.09c"
                     /gene_synonym="pak2"
                     /product="PAK-like kinase Shk2"
                     /transcript_id="NM_001018264.1"
                     /db_xref="GeneID:2541468"
     CDS             273152..274921
                     /gene="shk2"
                     /locus_tag="SPAC1F5.09c"
                     /gene_synonym="pak2"
                     /codon_start=1
                     /product="PAK-like kinase Shk2"
                     /protein_id="NP_592864.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F5.09c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F5.09c.1"
                     /db_xref="GeneID:2541468"
                     /db_xref="GOA:Q10056"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PomBase:SPAC1F5.09c"
                     /db_xref="PomBase:SPAC1F5.09c.1"
                     /translation="MLLSVRGVPVEIPSLKDTKKSKGIIRSGWVMLKEDKMKYLPWTK
                     KWLVLSSNSLSIYKGSKSESAQVTLLLKDIQKVERSKSRTFCFKLRFKSSTKNFEIQA
                     CELSVADNMECYEWMDLISSRALASKVSSPMNPKHQVHVGIDNEGNYVGLPKEWILLL
                     QSSSITKQECMEEPKAVIQALDFYSKQLDTTSETKDSFSFCKETLPRSSTTSYSIRDA
                     DKHHKLTTSGVTKMNITERCKPKTTIQTDKKHIIRPFIEDKSHVESIMTGKVTKVPVK
                     ADSKNTLSRRMTDRQALAMLKDSVTSHDPVEYFNVKHKLGQGASGSVYLAKVVGGKQL
                     GIFDSVAIKSIDLQCQTRKELILNEITVMRESIHPNIVTYLDSFLVRERHLWVVMEYM
                     NAGSLTDIIEKSKLTEAQIARICLETCKGIQHLHARNIIHRDIKSDNVLLDNSGNIKI
                     TDFGFCARLSNRTNKRVTMVGTPYWMAPEVVKQNEYGTKVDIWSLGIMIIEMIENEPP
                     YLREDPIRALYLIAKNGTPTLKKPNLVSKNLKSFLNSCLTIDTIFRATAAELLTHSFL
                     NQACPTEDLKSIIFSRKANTHIN"
     gene            <275089..276661
                     /gene="yam8"
                     /locus_tag="SPAC1F5.08c"
                     /gene_synonym="ehs1"
                     /db_xref="GeneID:2541627"
     mRNA            <275089..276661
                     /gene="yam8"
                     /locus_tag="SPAC1F5.08c"
                     /gene_synonym="ehs1"
                     /product="calcium channel regulatory subunit Yam8"
                     /transcript_id="NM_001018265.2"
                     /db_xref="GeneID:2541627"
     CDS             275089..276549
                     /gene="yam8"
                     /locus_tag="SPAC1F5.08c"
                     /gene_synonym="ehs1"
                     /codon_start=1
                     /product="calcium channel regulatory subunit Yam8"
                     /protein_id="NP_592865.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F5.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F5.08c.1"
                     /db_xref="GeneID:2541627"
                     /db_xref="GOA:Q10063"
                     /db_xref="InterPro:IPR024338"
                     /db_xref="PomBase:SPAC1F5.08c"
                     /db_xref="PomBase:SPAC1F5.08c.1"
                     /translation="MFFFSTHLILKILFFWSITRNIFGATYTSLLLNNTINGNINDQS
                     TAYYNLTWEGNTAYNVSLTLSTCTAFDGANDLMLYISNNTFDEALPLDNFTITASENG
                     LATIFVTGYSPLYIAVSSAFSQFAPNFFVESGESTLEGNNVINYELAAGIDTPFSQYN
                     ATKFLFAQDTDFQAALLITGNLTTNETSIIPSYEIYVNPSNSTYDNTFNKFSSSFCAF
                     QNNPSTVNTNNADRSMTLRGLGPFAKEQFYLKGLDPNVTYTAYLVEPNIGQPGGTVYP
                     GVTFTTKTSPACQLIYDLQFCSEVAYAVPGNSSLFSASALAEWYDQQAYGYYQNFTYT
                     LDLIPCNATSWSAYSLLKNCSDCANSYKNWLCASVIPRCADINDNSSYLIYKNYDSRY
                     PLIDEVIQPGPYKEVLPCSYLCYSLASSCPLDLGFACPKAGYGLEFSYGEVSNVTGLI
                     TCNAPGVEFYESGSALLNISWRTFFISLIFWILFVE"
     gene            complement(276657..281347)
                     /gene="lsh1"
                     /locus_tag="SPAC1F5.06"
                     /db_xref="GeneID:2541537"
     mRNA            complement(276657..281347)
                     /gene="lsh1"
                     /locus_tag="SPAC1F5.06"
                     /product="putative protein Lhs1"
                     /transcript_id="NM_001018267.2"
                     /db_xref="GeneID:2541537"
     gene            276723..278573
                     /gene="hem14"
                     /locus_tag="SPAC1F5.07c"
                     /db_xref="GeneID:2541631"
     mRNA            276723..278573
                     /gene="hem14"
                     /locus_tag="SPAC1F5.07c"
                     /product="putative protoporphyrinogen oxidase"
                     /transcript_id="NM_001018266.2"
                     /db_xref="GeneID:2541631"
     CDS             276893..278365
                     /gene="hem14"
                     /locus_tag="SPAC1F5.07c"
                     /EC_number="1.3.3.4"
                     /codon_start=1
                     /product="putative protoporphyrinogen oxidase"
                     /protein_id="NP_592866.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F5.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F5.07c.1"
                     /db_xref="GeneID:2541631"
                     /db_xref="GOA:Q10062"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR004572"
                     /db_xref="InterPro:IPR027418"
                     /db_xref="PomBase:SPAC1F5.07c"
                     /db_xref="PomBase:SPAC1F5.07c.1"
                     /translation="MSIAICGGGIAGLSTAFYLARLIPKCTIDLYEKGPRLGGWLQSV
                     KIPCADSPTGTVLFEQGPRTLRPAGVAGLANLDLISKLGIEDKLLRISSNSPSAKNRY
                     IYYPDRLNEIPSSILGSIKSIMQPALRPMPLAMMLEPFRKSKRDSTDESVGSFMRRRF
                     GKNVTDRVMSAMINGIYAGDLNDLSMHSSMFGFLAKIEKKYGNITLGLIRALLAREIL
                     SPAEKALKAALLAEPKTAELSNSMKSTSMFAFKEGIETITLSIADELKKMPNVKIHLN
                     KPAKTLVPHKTQSLVDVNGQAYEYVVFANSSRNLENLISCPKMETPTSSVYVVNVYYK
                     DPNVLPIRGFGLLIPSCTPNNPNHVLGIVFDSEQNNPENGSKVTVMMGGSAYTKNTSL
                     IPTNPEEAVNNALKALQHTLKISSKPTLTNATLQQNCIPQYRVGHQDNLNSLKSWIEK
                     NMGGRILLTGSWYNGVSIGDCIMNGHSTARKLASLMNSSS"
     CDS             complement(278599..281145)
                     /gene="lsh1"
                     /locus_tag="SPAC1F5.06"
                     /codon_start=1
                     /product="putative protein Lhs1"
                     /protein_id="NP_592867.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F5.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F5.06.1"
                     /db_xref="GeneID:2541537"
                     /db_xref="GOA:Q10061"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="PomBase:SPAC1F5.06"
                     /db_xref="PomBase:SPAC1F5.06.1"
                     /translation="MKRSVLTIILFFSCQFWHAFASSVLAIDYGTEWTKAALIKPGIP
                     LEIVLTKDTRRKEQSAVAFKGNERIFGVDASNLATRFPAHSIRNVKELLDTAGLESVL
                     VQKYQSSYPAIQLVENEETTSGISFVISDEENYSLEEIIAMTMEHYISLAEEMAHEKI
                     TDLVLTVPPHFNELQRSILLEAARILNKHVLALIDDNVAVAIEYSLSRSFSTDPTYNI
                     IYDSGSGSTSATVISFDTVEGSSLGKKQNITRIRALASGFTLKLSGNEINRKLIGFMK
                     NSFYQKHGIDLSHNHRALARLEKEALRVKHILSANSEAIASIEELADGIDFRLKITRS
                     VLESLCKDMEDAAVEPINKALKKANLTFSEINSIILFGGASRIPFIQSTLADYVSSDK
                     ISKNVNADEASVKGAAFYGASLTKSFRVKPLIVQDIINYPYLLSLGTSEYIVALPDST
                     PYGMQHNVTIHNVSTIGKHPSFPLSNNGELIGEFTLSNITDVEKVCACSNKNIQISFS
                     SDRTKGILVPLSAIMTCEHGELSSKHKLGDRVKSLFGSHDESGLRNNESYPIGFTYKK
                     YGEMSDNALRLASAKLERRLQIDKSKAAHDNALNELETLLYRAQAMVDDDEFLEFANP
                     EETKILKNDSVESYDWLIEYGSQSPTSEVTDRYKKLDDTLKSISFRFDQAKQFNTSLE
                     NFKNALERAESLLTNFDVPDYPLNVYDEKDVKRVNSLRGTSYKKLGNQYYNDTQWLKD
                     NLDSHLSHTLSEDPLIKVEELEEKAKRLQELTYEYLRRSLQQPKLKAKKGASSSSTAE
                     SKVEDETFTNDIEPTTALNSTSTQETEKSRASVTQRPSSLQQEIDDSDEL"
     gene            281774..282745
                     /locus_tag="SPAC1F5.05c"
                     /db_xref="GeneID:2541432"
     mRNA            281774..282745
                     /locus_tag="SPAC1F5.05c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018268.2"
                     /db_xref="GeneID:2541432"
     CDS             281949..282404
                     /locus_tag="SPAC1F5.05c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592868.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F5.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F5.05c.1"
                     /db_xref="GeneID:2541432"
                     /db_xref="GOA:Q10060"
                     /db_xref="InterPro:IPR028095"
                     /db_xref="PomBase:SPAC1F5.05c"
                     /db_xref="PomBase:SPAC1F5.05c.1"
                     /translation="MWSKLSISSKINRIRDPESDNTIEDTHVARVMRKYYMDKIGTLP
                     EWLRPPGWQPPVNTGPTSPVSINASNAAPSNLKASYIPANPRRLSSSTSSASSPPLRR
                     LPSVQHSTFDDLFEGVGSLQKSPSTTKPLSSTPSGSLLRSKFDHTRKKF"
     gene            283287..289200
                     /gene="cdc12"
                     /locus_tag="SPAC1F5.04c"
                     /db_xref="GeneID:2541603"
     mRNA            283287..289200
                     /gene="cdc12"
                     /locus_tag="SPAC1F5.04c"
                     /product="formin Cdc12"
                     /transcript_id="NM_001018269.2"
                     /db_xref="GeneID:2541603"
     CDS             283476..289001
                     /gene="cdc12"
                     /locus_tag="SPAC1F5.04c"
                     /codon_start=1
                     /product="formin Cdc12"
                     /protein_id="NP_592869.1"
                     /db_xref="GeneID:2541603"
                     /db_xref="GOA:Q10059"
                     /db_xref="InterPro:IPR010472"
                     /db_xref="InterPro:IPR010473"
                     /db_xref="InterPro:IPR014768"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="InterPro:IPR016024"
                     /translation="MRNSSKGQDPNFSYDSILSTPTPSARRTIGPRAPKSKTTYHKPP
                     SSIESVSTLIQPNKSQSVTSPYVKQFTFSSKEYNSHNKHALQNSQLPLPKTPEKSTVH
                     RPKANKVEVTDLPSSSSVEHLHTSKHLKGPRLPKNIIKSSEDVQIAPVTPPVHSRSFD
                     PLPKPPVPSVPVSKTKRRTKHKLAPVVEVPEITNEVSPKFTSTNDEQVYRLRSIRAGS
                     PNSVCSFQFEIPSTRPPSLDQLIHLFNDFLRHPVFDFDENAIEMLQSCTPDEKWCFIR
                     SNFAGFDDPSFQIPELAAVHRPVSWFVIQLWNKTISNLQLITLSSLLSTQSDRWISLF
                     LELQGLRALHNLLTYFNSSAVVQPQQAEVPRCMLTLLKKKPTLVTSNSYIFQAITVTL
                     ISPNLLPRKVAADLLTWVLSLKEPLVVSILETGFKEINAEYEKEVPLFFGWIKSFKDI
                     ILEKELARTPPSSPARNSASSSPSNIAFLEYCTSTMEFINQLIVACEELEQGFDLDIL
                     DSLRESGIHEVIQLLRNFPDQQLEKQLNIYESEEERRTISQTTHEDVDSFMSNESSIL
                     SSFNEFASNEVGRLLESTIQNILLAKGTEKQKVKLIKVFNSLLQRILLNSKVSNESFE
                     DSLQASLNMLTERFYSDDTARNALKEAKASRAMAEKMVIERDAMAAQVNLGAEDLIAK
                     LNKEVEDQKDVILSQKRTNETLKTEIDALQKSHVTQIQRSEVELRELYLLINSDSFQG
                     STNSKERIIEYLLDKLDLRKKEIAAESTLWSNDGIDDKLRDLREQMSRQSSQPSTVST
                     ILQIPDKKFHRPFPRHLHRYVGRSASESLTSEKDESIKSMKGIDDFANLEIPGKGIES
                     NVVIKDISNQTHEINSVENKAETVSNNSKITNFDIPNDATSLPTIITHPTPPPPPPLP
                     VKTSLNTFSHPDSVNIVANDTSVAGVMPAFPPPPPPPPPLVSAAGGKFVSPAVSNNIS
                     KDDLHKTTGLTRRPTRRLKQMHWEKLNSGLEFTFWTGPSDEANKILETLHTSGVLDEL
                     DESFAMKEAKTLVKKTCARTDYMSSELQKLFGIHFHKLSHKNPNEIIRMILHCDDSMN
                     ECVEFLSSDKVLNQPKLKADLEPYRIDWANGGDLVNSEKDASELSRWDYLYVRLIVDL
                     GGYWNQRMNALKVKNIIETNYENLVRQTKLIGRAALELRDSKVFKGLLYLILYLGNYM
                     NDYVRQAKGFAIGSLQRLPLIKNANNTKSLLHILDITIRKHFPQFDNFSPELSTVTEA
                     AKLNIEAIEQECSELIRGCQNLQIDCDSGALSDPTVFHPDDKILSVILPWLMEGTKKM
                     DFLKEHLRTMNTTLNNAMRYFGEQPNDPNSKNLFFKRVDSFIIDYSKARSDNLKSEEE
                     EASQHRRLNLVNNHKEHVLERAMSENNKMDNEAMDGFLDKLRNVKLESHHKPRNRSAI
                     TMGKEHLIEAPNTSTKSSPAKNELFVPKRSSVKSDLAKVRPRYPKGSESTDGLSDALN
                     ITPTKKGEVSSKAKKGYNYEKRRSGRQVSDSYVLNKNSKNKSNKGRSASYTFSDPSSL
                     EDSNRQKPFNGEKFRRFSSKSRRGSQNRDSKKTGKARKDKGINNNQTSPQNKPSKESL
                     KSDTISNEKKVFPQKASKVNLLTPTISNGTRASKHANEKENTFPRGVENNLVAPMIPN
                     NTELNEDTSAVSRNLENATNDLKETFPTTTTISTARAKPGNNDINTILRRNNSRGRRR
                     MLQQMSPLKSNKFSGTNDLNFQQATKPDGSNKSSYMERLEKLKQNSERHLQSVGGKKV
                     YSSEETPVNKILVSPSVSILDHNRILSQSTPIKSPQRAQEMLAGLLSGKLAPKENEK"
     gene            289790..291927
                     /locus_tag="SPAC1F5.03c"
                     /db_xref="GeneID:2541471"
     mRNA            join(289790..289985,290187..291927)
                     /locus_tag="SPAC1F5.03c"
                     /product="putative FAD-dependent oxidoreductase"
                     /transcript_id="NM_001018270.2"
                     /db_xref="GeneID:2541471"
     CDS             join(289952..289985,290187..291301)
                     /locus_tag="SPAC1F5.03c"
                     /codon_start=1
                     /product="putative FAD-dependent oxidoreductase"
                     /protein_id="NP_592870.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F5.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F5.03c.1"
                     /db_xref="GeneID:2541471"
                     /db_xref="GOA:Q10058"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="PomBase:SPAC1F5.03c"
                     /db_xref="PomBase:SPAC1F5.03c.1"
                     /translation="MSNSRNIVIVGGGITGVSCLYFLAHHPSFNRDRDTITLFESAGI
                     ASAASGKASGFLSLEWHGPSTSSLAALSYNLHKELSDQYDGVNKWGYRALDTWSIKAD
                     ENCQQPDKLPEGIEWIAPSIVENVTRLGNKKNSGQVHPYKFCHAIYEEASKVANVTLV
                     KGHVLSVDENEVEYRLIGDDYAPDEEEEITSAEELHTIHSMEATHIIVAAGPWTPQLI
                     PNLRISGARIHSITIDLPIKLNGNAVFSEITYKDGTIAAPEFYAREDELYVCGEFDDE
                     PLPELSSDTKVDQDKCALIKQCANHFHQIIRDSPVKVRQACYLPISNATGAPVIGKIG
                     SSIYVAAAHGCWGITLGPGTGKVLSELILDGAVTSANIDLLDPEGSLE"
     gene            complement(291979..293771)
                     /locus_tag="SPAC1F5.02"
                     /db_xref="GeneID:2541460"
     mRNA            complement(291979..293771)
                     /locus_tag="SPAC1F5.02"
                     /product="putative protein disulfide isomerase"
                     /transcript_id="NM_001018271.2"
                     /db_xref="GeneID:2541460"
     CDS             complement(292260..293738)
                     /locus_tag="SPAC1F5.02"
                     /EC_number="5.3.4.1"
                     /codon_start=1
                     /product="putative protein disulfide isomerase"
                     /protein_id="NP_592871.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F5.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F5.02.1"
                     /db_xref="GeneID:2541460"
                     /db_xref="GOA:Q10057"
                     /db_xref="InterPro:IPR005788"
                     /db_xref="InterPro:IPR005792"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="PomBase:SPAC1F5.02"
                     /db_xref="PomBase:SPAC1F5.02.1"
                     /translation="MKISNLLAAFLAFSGGFFCASAEVPKVNKEGLNELITADKVLMV
                     KFYAPWCGHCKALAPEYESAADELEKDGISLVEVDCTEEGDLCSEYSIRGYPTLNVFK
                     NGKQISQYSGPRKHDALVKYMRKQLLPTVKPISKDTLENFVEKADDLAVVAFFKDQKL
                     NDTYTEVAEVMKDDFVFAASDDKELAKSLGSNFPGIVAFTKDAAQDSDKLVYTGDWDP
                     ASIADFIGVSSIPLLDELNQMTFGKYQQSGLPLGIIFYNSTESRDELYDVFQPLAKKY
                     QDTLRFAFLDAVRYGAVAKQMNVESDWPAFVIANLKSMLKYPFPTTELTAKAMTKFVG
                     DFVDGKLQPKIKSQPIPESQEDLVVLVADNFDDIVMDETKDVLVEFYAPWCGHCKNLA
                     PTYEKLAEEYSDDSNVVVAKIDATENDISVSISGFPTIMFFKANDKVNPVRYEGDRTL
                     EDLSAFIDKHASFEPIKKEKESVPAPDLEDQVAVEDEMADEL"
     gene            294010..294228
                     /locus_tag="SPNCRNA.148"
                     /db_xref="GeneID:9407316"
     misc_RNA        294010..294228
                     /locus_tag="SPNCRNA.148"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150366.1"
                     /db_xref="GeneID:9407316"
     gene            complement(294591..299154)
                     /locus_tag="SPAC18B11.11"
                     /db_xref="GeneID:3361388"
     mRNA            complement(294591..299154)
                     /locus_tag="SPAC18B11.11"
                     /product="putative GTPase-activating protein"
                     /transcript_id="NM_001355973.1"
                     /db_xref="GeneID:3361388"
     CDS             complement(294902..298786)
                     /locus_tag="SPAC18B11.11"
                     /codon_start=1
                     /product="putative GTPase-activating protein"
                     /protein_id="NP_001342803.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC18B11.11"
                     /db_xref="EnsemblGenomes-Tr:SPAC18B11.11.1"
                     /db_xref="GeneID:3361388"
                     /db_xref="GOA:Q09716"
                     /db_xref="InterPro:IPR018515"
                     /db_xref="InterPro:IPR024584"
                     /db_xref="PomBase:SPAC18B11.11"
                     /db_xref="PomBase:SPAC18B11.11.1"
                     /translation="MKALDIDTILTQISNQQSLDKRYKRIKRLINNEQFCKNVILQKL
                     VDSTKDIIENKVHGNILAATISLWTHAAEKHKEMSSDDRALLFNELSKVPNSEYYPAT
                     VDALIVITSQGERTESFSNDILKVLSEWLTDLFTIIDDMRAQSRKSFKGSAELRNYTR
                     CFRQIILLLTNMFRVGFNLFDEMEVSSMLANCVWVSKSTTDEEDIALVFSLLNCIISY
                     GRISSAVLYSIVEVVCRAKFGLVASSQSAQQIVEKLLKTATKYEALNSLKRIMEETDE
                     GSYIAIMGGIQIVSALFTDIPRSVYCTRGMLLGFLQRSLKNKSSRIALETTRSLYNAL
                     ERRSFVEVLYADEWISLLDLLVEISSSLPKSLNYRPGTWQHIEPNIIESIASYQLQHL
                     LLFNEILKPDSNHFVLEKFHEFLKINFSYLTPTLSQKLFTVLDLRSQLPYSEGWLEDQ
                     TILLKSYFDTSFSLDFHVYLIGLFRKVLFACPVELRPEVYARMLCPLVKSLDKSSSEV
                     IIDEVISLVCDLSWIYPSNVFHEVKDSLCFYAHNSSNGDLQLRSIQAIVSLTFYYVLL
                     PEFKSVLYDGLVEISCDFKIRRTFRIPVLKLLLQLRINTNDYCFVNLSPAQLELISVY
                     STQWHNPFISEEAQRCRDNKVKDRDLSFSPVFQKFPLKVNTSATLSKDLMSLPINEWV
                     KNVMYIVTHETDWKVVQYILINFTNQLRNTKMFTKTVEALQLLLNSLRDIINGKQSLN
                     INFSDFFRIEDLLVSLSKILSVLMVYKDVLPPTAHEQFFQLLNRFAEKGDKTMESCID
                     TLITNCCAMQSFSIMHLPKFFSITMSSNLSERSLVNFLRLLHVVSDNWELNEGLEKET
                     IQSICLFCLKVIRTKKEELDGHKKLVNPNTKVFCLYLVSFSYSIISNLFLGCETTERA
                     QLASFLLKEFLNLKNGSHFEGYERVFYELLLRYTYSDERIESYPSDSRFHFNSSSKSW
                     LYRGCVITINAEYETGDYQMILRRMSGTTIYRFWRNMRDRGAFEKSLMMEQSMVSSEL
                     KQKYLQEIAASHVFMETVLSPLDSPDEEPILIKPDARTEELIQSLDATHTKPVINIAV
                     ALQAGDVSDINTTVGWQLFYRLLESFGHEKKLDNGETIYVWQSKTIEMIFRYVSDPAE
                     ALESSLYSSLIIIGSDDLVGPDSLNWDSVDVPVIIKISLDSHLDALKMFDTLFHVKLE
                     IITTGTDISHQSFWKLDQIISTNSIAPLLHSYLADIGLYQMIFENFAYVHPWLLRQQY
                     IDTLYTIHQVPTTQRESSALPSDKTFDFTLFL"
     gene            complement(299278..301837)
                     /gene="tup11"
                     /locus_tag="SPAC18B11.10"
                     /db_xref="GeneID:2542299"
     mRNA            complement(join(299278..301263,301436..301520,
                     301588..301837))
                     /gene="tup11"
                     /locus_tag="SPAC18B11.10"
                     /product="transcriptional corepressor Tup11"
                     /transcript_id="NM_001018273.2"
                     /db_xref="GeneID:2542299"
     gene            299464..299610
                     /gene="prl27"
                     /locus_tag="SPNCRNA.27"
                     /db_xref="GeneID:5802855"
     misc_RNA        299464..299610
                     /gene="prl27"
                     /locus_tag="SPNCRNA.27"
                     /product="non-coding RNA, poly(A)-bearing (predicted)"
                     /transcript_id="NR_150682.1"
                     /db_xref="GeneID:5802855"
     CDS             complement(join(299628..301263,301436..301520,
                     301588..301711))
                     /gene="tup11"
                     /locus_tag="SPAC18B11.10"
                     /codon_start=1
                     /product="transcriptional corepressor Tup11"
                     /protein_id="NP_592873.1"
                     /db_xref="GeneID:2542299"
                     /db_xref="GOA:Q09715"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013890"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /translation="MASVEDATKVQEMLDALKAEYNALAHHSFASKARGNDYESSMIQ
                     SQIQEIEAFRKTVDDMYEKQKSIRETYEKDINKLKRELEELGVEANTASYRNRGERSE
                     LAASNNQVTHIDQEHPSQTKSTSQPPSNHLPAFQQIPPIHQSAYPQNNVAEVLMPPIP
                     PSVEASSGQNFNQGIASQNPAISTSNLPSTTPLYIPPVNYGANQVSQQPNPQLPGVSN
                     YYNPSATSKPAVNVQPPRIPTKATPSAEPSMTASANAGSISQAGPDGEYQGREQIAPV
                     SDTEAARKTTSQSWYVTYNPACKRVFNINLVHTLEHPSVVCCVKFSNNGKYLATGCNQ
                     AANVFDVQTGKKLFTLHEESPDPSRDLYVRTIAFSPDGKYLVTGTEDRQIKLWDLSTQ
                     KVRYVFSGHEQDIYSLDFSHNGRFIVSGSGDRTARLWDVETGQCILKLEIENGVTAIA
                     ISPNDQFIAVGSLDQIIRVWSVSGTLVERLEGHKESVYSIAFSPDSSILLSGSLDKTI
                     KVWELQATRSVGLSAIKPEGICKATYTGHTDFVLSVAVSPDSRWGLSGSKDRSMQFWD
                     LQTGQSYLTCQGHKNSVISVCFSPDGRQFASGSGDLRARIWSIDPASP"
     gene            300705..301411
                     /locus_tag="SPNCRNA.635"
                     /db_xref="GeneID:14218291"
     misc_RNA        300705..301411
                     /locus_tag="SPNCRNA.635"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150998.1"
                     /db_xref="GeneID:14218291"
     gene            303004..304161
                     /locus_tag="SPAC18B11.09c"
                     /db_xref="GeneID:2542578"
     mRNA            join(303004..303231,303334..303640,303716..303793,
                     303852..304161)
                     /locus_tag="SPAC18B11.09c"
                     /product="putative serine O-acetyltransferase activity"
                     /transcript_id="NM_001018274.2"
                     /db_xref="GeneID:2542578"
     CDS             join(303161..303231,303334..303640,303716..303793,
                     303852..304019)
                     /locus_tag="SPAC18B11.09c"
                     /EC_number="2.3.1.30"
                     /codon_start=1
                     /product="putative serine O-acetyltransferase activity"
                     /protein_id="NP_592874.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC18B11.09c"
                     /db_xref="EnsemblGenomes-Tr:SPAC18B11.09c.1"
                     /db_xref="GeneID:2542578"
                     /db_xref="GOA:Q09707"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="InterPro:IPR024688"
                     /db_xref="PomBase:SPAC18B11.09c"
                     /db_xref="PomBase:SPAC18B11.09c.1"
                     /translation="MTRTRVQKMIPKTIEYQKMISGQPYKAYDEELTQARCNAKKLMR
                     RFNDTMGDLENVGPAELIKRRAELLAEVFVFDESSAPEIEPPMAFDYGFNVHFGKKFF
                     ANYNCTFLDVAIITIGNNVMLGPNVQLCTATHPLDFKARNSGIEFGLPINIQDNVWIG
                     MGVIVLPGVTIGEGSVIGAGAVVTKDIPPNTLAVGSPAKPIRKIENE"
     gene            304355..305168
                     /locus_tag="SPAC18B11.08c"
                     /db_xref="GeneID:2542581"
     mRNA            join(304355..304535,304674..304731,304771..304860,
                     304919..304955,305000..305168)
                     /locus_tag="SPAC18B11.08c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018275.2"
                     /db_xref="GeneID:2542581"
     CDS             join(304463..304535,304674..304731,304771..304860,
                     304919..304955,305000..305029)
                     /locus_tag="SPAC18B11.08c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592875.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC18B11.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC18B11.08c.1"
                     /db_xref="GeneID:2542581"
                     /db_xref="GOA:Q09714"
                     /db_xref="InterPro:IPR005351"
                     /db_xref="PomBase:SPAC18B11.08c"
                     /db_xref="PomBase:SPAC18B11.08c.1"
                     /translation="MAPAELKRPDLIVPYKARVKANEEVGLSLVSTATCMAALFLRFK
                     LIAWVAFILTFSNLLNANTSPSSSPTSMAFMGIAALVSTYLPQFLNTPNKT"
     gene            305602..306762
                     /gene="rhp6"
                     /locus_tag="SPAC18B11.07c"
                     /gene_synonym="sng1; ubc2"
                     /db_xref="GeneID:2542622"
     mRNA            join(305602..305764,305812..305876,306090..306210,
                     306316..306419,306468..306762)
                     /gene="rhp6"
                     /locus_tag="SPAC18B11.07c"
                     /gene_synonym="sng1; ubc2"
                     /product="ubiquitin-conjugating enzyme E2 2"
                     /transcript_id="NM_001018276.2"
                     /db_xref="GeneID:2542622"
     CDS             join(305723..305764,305812..305876,306090..306210,
                     306316..306419,306468..306591)
                     /gene="rhp6"
                     /locus_tag="SPAC18B11.07c"
                     /gene_synonym="sng1; ubc2"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 2"
                     /protein_id="NP_592876.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC18B11.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC18B11.07c.1"
                     /db_xref="GeneID:2542622"
                     /db_xref="GOA:P23566"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="PomBase:SPAC18B11.07c"
                     /db_xref="PomBase:SPAC18B11.07c.1"
                     /translation="MSTTARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPA
                     DTPFEDGTFKLVLSFDEQYPNKPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDV
                     AAILTSIQSLLNDPNNASPANAEAAQLHRENKKEYVRRVRKTVEDSWES"
     gene            complement(306764..308031)
                     /locus_tag="SPAC18B11.06"
                     /db_xref="GeneID:2542587"
     mRNA            complement(306764..308031)
                     /locus_tag="SPAC18B11.06"
                     /product="putative U3 snoRNP-associated protein Lcp5"
                     /transcript_id="NM_001018277.2"
                     /db_xref="GeneID:2542587"
     CDS             complement(306964..307947)
                     /locus_tag="SPAC18B11.06"
                     /codon_start=1
                     /product="putative U3 snoRNP-associated protein Lcp5"
                     /protein_id="NP_592877.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC18B11.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC18B11.06.1"
                     /db_xref="GeneID:2542587"
                     /db_xref="GOA:Q09713"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="PomBase:SPAC18B11.06"
                     /db_xref="PomBase:SPAC18B11.06.1"
                     /translation="MDVLNKSIQTALEALPKTSSSSSDGVSLVSLKCQLLLSYVQKLA
                     FLMLVKLDDESFLQHQDVVEKLVQLRIEIEKIRPLENRIQYSVDKLLRAAGRKEEIGS
                     IKEPENNGNDKDSQDSLKLHYKPNLSEFADDSDGPASENNVVKEDDKSSISSEDEEEE
                     LRSAKDGIYRPPRIRAVTMDSEKRTRHRPNHLVDEFVSSDMSSVPQSMPSVGSNLEKR
                     GRVIHADERELQKMRERIEYEESNYTRLPKLSKKDLKKSKRVKKHDYGGEDWSLLDRK
                     FHDDDFSNRKLDLTSRAKRRANFEDVNDGSLASPVQIGQSYRKRKKNLKRR"
     gene            complement(308138..310034)
                     /gene="gpi18"
                     /locus_tag="SPAC18B11.05"
                     /db_xref="GeneID:2542588"
     mRNA            complement(join(308138..309719,309751..309839,
                     309889..310034))
                     /gene="gpi18"
                     /locus_tag="SPAC18B11.05"
                     /product="putative dolichyl-phosphate-mannose--glycolipid
                     alpha-mannosyltransferase PIGV"
                     /transcript_id="NM_001355974.1"
                     /db_xref="GeneID:2542588"
     CDS             complement(join(308381..309719,309751..309806))
                     /gene="gpi18"
                     /locus_tag="SPAC18B11.05"
                     /codon_start=1
                     /product="putative dolichyl-phosphate-mannose--glycolipid
                     alpha-mannosyltransferase PIGV"
                     /protein_id="NP_001342795.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC18B11.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC18B11.05.1"
                     /db_xref="GeneID:2542588"
                     /db_xref="GOA:Q09712"
                     /db_xref="InterPro:IPR007315"
                     /db_xref="PomBase:SPAC18B11.05"
                     /db_xref="PomBase:SPAC18B11.05.1"
                     /translation="MYYIGHPSYYRKHIEHVCFQHSGILKKRNYQKNQKKYIMKLNES
                     AMKNAEKKSNSYLAIRMTRSGYNYFKGICVCTFLLSTILYLGIAVIMSHLCVFDDTAM
                     LYLRQNRSRLAESNIFRTLFISWIRWDAIYFVDMAVNGSLFEQEWAFSSLWPKIISFL
                     AFRSKDVVLLGIVSCFASIFFHAIACYALYLLTKSIFSNQKMTAYTVIFYCFSPSGIY
                     MSVGYTESLFAAFSFLGLLLFIKKQQYPAAFLWSLATLIRSNGIFWCIFFGMPAIGTL
                     KISLERLQLTFMQVSQLVGYGTKCLIILVPFFYNQYLGFKLFCPGVAWCNKSLPLIYP
                     AVQEKYWNVGFLRYWTLNNIPNFLFALLSIIPILFALFYSISGSTLHSFRSIKSHLVL
                     SALYLYIGCFHMHTQVLNRMSSALPLLYWSMAHATLYAKSRNLKAFGHCILFVWIVYT
                     VIQAGLYGSFLPPA"
     gene            complement(310157..311712)
                     /gene="ncs1"
                     /locus_tag="SPAC18B11.04"
                     /db_xref="GeneID:2542523"
     mRNA            complement(join(310157..310790,310837..311180,
                     311299..311331,311371..311712))
                     /gene="ncs1"
                     /locus_tag="SPAC18B11.04"
                     /product="calcium-binding protein"
                     /transcript_id="NM_001018279.2"
                     /db_xref="GeneID:2542523"
     CDS             complement(join(310659..310790,310837..311180,
                     311299..311331,311371..311434))
                     /gene="ncs1"
                     /locus_tag="SPAC18B11.04"
                     /codon_start=1
                     /product="calcium-binding protein"
                     /protein_id="NP_592879.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC18B11.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC18B11.04.1"
                     /db_xref="GeneID:2542523"
                     /db_xref="GOA:Q09711"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR028846"
                     /db_xref="PDB:2L2E"
                     /db_xref="PomBase:SPAC18B11.04"
                     /db_xref="PomBase:SPAC18B11.04.1"
                     /translation="MGKSQSKLSQDQLQDLVRSTRFDKKELQQWYKGFFKDCPSGHLN
                     KSEFQKIYKQFFPFGDPSAFAEYVFNVFDADKNGYIDFKEFICALSVTSRGELNDKLI
                     WAFQLYDLDNNGLISYDEMLRIVDAIYKMVGSMVKLPEDEDTPEKRVNKIFNMMDKNK
                     DGQLTLEEFCEGSKRDPTIVSALSLYDGLV"
     gene            311920..314040
                     /locus_tag="SPAC18B11.03c"
                     /db_xref="GeneID:2542613"
     mRNA            join(311920..312212,312274..314040)
                     /locus_tag="SPAC18B11.03c"
                     /product="putative N-acetyltransferase"
                     /transcript_id="NM_001018280.2"
                     /db_xref="GeneID:2542613"
     CDS             join(312182..312212,312274..313586)
                     /locus_tag="SPAC18B11.03c"
                     /codon_start=1
                     /product="putative N-acetyltransferase"
                     /protein_id="NP_592880.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC18B11.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC18B11.03c.1"
                     /db_xref="GeneID:2542613"
                     /db_xref="GOA:Q09710"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="PomBase:SPAC18B11.03c"
                     /db_xref="PomBase:SPAC18B11.03c.1"
                     /translation="MDTYMEEREAGRLEIYSVKRNVLNMFSIVIVSATYSISLDSTVL
                     YPAVYHAIVNQPMLGARIHNCHSKIPIVKKLKTIDLDKVVKYADDQKVDSFCNNALQN
                     FKLCYDDETLPLWMVYVLNDKSELVFIYDHSLFDGGSGPLFHKYVLEGLQMSKTNFSS
                     STVPVSELPLPKNLEKLIDVHPSWFCLMKALWTNSGLPFSKGFRSPSYKGHAPVRPFS
                     SHTIFFSISNAVVKNIKQLSKNIDASFTSIFYSVFMLSIYYAIAKNGKVNLDMLIDVN
                     ARRFLPVAKQTMGNYVFSYVHHLNGFQPSQRQEDYKHTMVDLATEFSHRLKAALSNPR
                     EMSQQIGLLSYIDIEDYLLKSCEKTRGNTAEISNLGYFSFPADSSVKIKNMAFAQPCS
                     SLSAPFVLNVITVADGPCSFSLSIFDDGNTEQTHELAIKIRDKFLSILEKVSMNS"
     gene            complement(312215..316276)
                     /locus_tag="SPNCRNA.636"
                     /db_xref="GeneID:14217894"
     misc_RNA        complement(312215..316276)
                     /locus_tag="SPNCRNA.636"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150999.1"
                     /db_xref="GeneID:14217894"
     gene            313974..315335
                     /locus_tag="SPAC18B11.02c"
                     /db_xref="GeneID:2542607"
     mRNA            313974..315335
                     /locus_tag="SPAC18B11.02c"
                     /product="putative tRNA pseudouridylate synthase"
                     /transcript_id="NM_001018281.2"
                     /db_xref="GeneID:2542607"
     CDS             314030..315214
                     /locus_tag="SPAC18B11.02c"
                     /codon_start=1
                     /product="putative tRNA pseudouridylate synthase"
                     /protein_id="NP_592881.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC18B11.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC18B11.02c.1"
                     /db_xref="GeneID:2542607"
                     /db_xref="GOA:Q09709"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="PomBase:SPAC18B11.02c"
                     /db_xref="PomBase:SPAC18B11.02c.1"
                     /translation="MLKRPKRDPLKDCEYVFKGDGLRRVPPYYYEYITFAKLRWYGKT
                     LLEVFNTEFRDRESGYYEKAIRNGQVKVNNQIGNVDTLIENGYIVSHHAHRHEPPVSD
                     QPVGIVHEDESYVVIDKPAGVPVHPTGRYNHNTVLHILMKENKCSLLYPCNRLDRLTS
                     GLMFFSKSPKAAEEMRVHMISKSLKKEYVARVIGEFPNSGEVICDAPLLTVAPTLGLN
                     RIHPDGKEASTVFKRIAFDGHTSLVLCKPLTGRTHQLRVHLQYLGYPIANDPIYANKR
                     VWGPSLGKNGEGSNESVIMRLSEIGKTETASPLLQYEWYTNETEAEAKARRDKRLGEL
                     LTGKHCSECGTPLYSDPSPEELGIWLHALKYESKDWSYKTQLPKWALDVCCRDPNALP
                     IE"
     gene            315394..317585
                     /locus_tag="SPAC12G12.16c"
                     /db_xref="GeneID:2543216"
     mRNA            315394..317585
                     /locus_tag="SPAC12G12.16c"
                     /product="putative XP-G family Fen1-like nuclease"
                     /transcript_id="NM_001018282.2"
                     /db_xref="GeneID:2543216"
     CDS             315707..317197
                     /locus_tag="SPAC12G12.16c"
                     /codon_start=1
                     /product="putative XP-G family Fen1-like nuclease"
                     /protein_id="NP_592882.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.16c"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.16c.1"
                     /db_xref="GeneID:2543216"
                     /db_xref="GOA:Q09708"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="PomBase:SPAC12G12.16c"
                     /db_xref="PomBase:SPAC12G12.16c.1"
                     /translation="MGVHGLLPIIRKVASEGIRWLQPEFFSKYYPVLAVDGNLLLYRF
                     FRSPNTPLHTNYQHVLWALKLSRYCRKLKTSPIVVFDNLKPNDFKAEEHEKRSLISSQ
                     IVNQRQVVQEQMYFLCNLKNCLIDNNFPTGNFYYEIGPLLSQIGKLLFDLRSLNERDN
                     PFHAQNNAENLENATFVRLIVDKLNDREKTLMIQEKKNHLIHSLRQLLAFSEINDFPS
                     EIRSYLEFILSNLDLECLTLCLKIIKGILTLDELQKAIKLKQTELDKLERRLYRPSPQ
                     NIFEIFEILKILGIPASFSPIGVEAEAFASAISQNNLAYAVATQDTDVLLLGSSMISN
                     FLDLNDNFHLPLQIMDPRKIAQELNLTFDGFQDYCLMCGTDFTSRIPKIGPVRALKLI
                     RYYGNAFDVLKALNVEEKYIIPTDYIKKFLTAKKLFTDLPSNNELFSFIHNIPKEFLH
                     LSDSTYLDLEKQVLRIFNVQIEELDAKTPWYYHYELEKDVKSTYEY"
     gene            complement(316996..319185)
                     /gene="sif3"
                     /locus_tag="SPAC12G12.15"
                     /db_xref="GeneID:2543091"
     mRNA            complement(join(316996..317469,317514..318172,
                     318221..319185))
                     /gene="sif3"
                     /locus_tag="SPAC12G12.15"
                     /product="putative Sad1-interacting factor 3"
                     /transcript_id="NM_001018283.3"
                     /db_xref="GeneID:2543091"
     CDS             complement(join(317431..317469,317514..318172,
                     318221..318941))
                     /gene="sif3"
                     /locus_tag="SPAC12G12.15"
                     /codon_start=1
                     /product="putative Sad1-interacting factor 3"
                     /protein_id="NP_592883.4"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.15"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.15.1"
                     /db_xref="GeneID:2543091"
                     /db_xref="GOA:Q09877"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="PomBase:SPAC12G12.15"
                     /db_xref="PomBase:SPAC12G12.15.1"
                     /translation="MSTKDKLNLPPKRTINTRLSTPVHIPPPINSESTRITPQHGSPP
                     RFGDHRISAAQGLFQRRRNARKIDHPLGWFLKNRHAAAHIPQRTTKTSQKLVLLPENH
                     AVNSFNEEESNYEDLLTPSDAYNLIKLENLPRDKREELGFPRATAYCVCEAFQLPKVK
                     HFLKHYHKVRAKKYDEVLYAVYHLPLVYGRSESCRVSSGPAPDDMPSSASNHNQKHLD
                     SDKPDNENFDSHIISQLYRISEIFVFSYGVVVFWNFSLSQEKDILADLTFGGDNSLMV
                     KPLAEEECEIEDLHFHYAPNTKRPRIYNDMIHIPSADNKMKLAMSHALAQSVKLSRFE
                     LRTDVTMNSALFYPKKLALYGHLGLSRVEVVRMSGHLFQLRVDVNLISNILDTPDFLW
                     DSEPLLLPLYTAFREYLEIGPRTNVLNRRCKVIFDMLDIFGKSSADRKMNSITWIIII
                     LISLFVIIFTLEVILRLRWAHR"
     gene            317718..319171
                     /locus_tag="SPNCRNA.637"
                     /db_xref="GeneID:14218336"
     misc_RNA        317718..319171
                     /locus_tag="SPNCRNA.637"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151000.1"
                     /db_xref="GeneID:14218336"
     gene            319815..321825
                     /gene="pfs2"
                     /locus_tag="SPAC12G12.14c"
                     /db_xref="GeneID:2543089"
     mRNA            319815..321825
                     /gene="pfs2"
                     /locus_tag="SPAC12G12.14c"
                     /product="WD repeat protein Pfs2"
                     /transcript_id="NM_001018284.2"
                     /db_xref="GeneID:2543089"
     CDS             319974..321503
                     /gene="pfs2"
                     /locus_tag="SPAC12G12.14c"
                     /codon_start=1
                     /product="WD repeat protein Pfs2"
                     /protein_id="NP_592884.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.14c"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.14c.1"
                     /db_xref="GeneID:2543089"
                     /db_xref="GOA:Q9UTN4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="PomBase:SPAC12G12.14c"
                     /db_xref="PomBase:SPAC12G12.14c.1"
                     /translation="MERAENARIIQKPMTRRTVDYGSGLSKYIVNRHLRSNRYHIHVP
                     RPNPNQIINLYPPYEYKYNNTSSLCTKYIHTSANKARHVINVVRWTPDGRRLLTGSST
                     GEFTLWNGLTFNFELINQSHDYAVRCAEWSTDGRWLISGDGGGMVKYFEPNLNNVKIV
                     QAHEMEVRDVAFSPNDSKFVTASDDGSLKVWNFHMSTEELKLTGHGWDVKTVDWHPSK
                     GLLASGSKDNLVKFWDPRTGTCIATLHGHKNTIMQASFQKNFGSNYLATVSRDSTCRV
                     FDLRAMKDVRVLRGHEKDVNCVTWHPLYPNLLTTGGSDGSVNHYSLDEPPLLSQQKYH
                     EKHPNVTLSASSYLLYPTAEIPFAHDLGIWSMQYHPLGHLLCTGSNDKTTRFWSRSRP
                     DDKESTMDRHHLGEEQSEAMLSQRKAAIEEDDNYEPDENPLTETLANAHNPQFSGVLN
                     LPGLGTMPSFPSPYQHGQPQIPGMLHASLSNSYAEPSTQNSFIPGLTSKSQDGYPQNY
                     R"
     gene            321764..324129
                     /gene="cid14"
                     /locus_tag="SPAC12G12.13c"
                     /db_xref="GeneID:3361384"
     mRNA            321764..324129
                     /gene="cid14"
                     /locus_tag="SPAC12G12.13c"
                     /product="poly(A) polymerase Cid14"
                     /transcript_id="NM_001018285.2"
                     /db_xref="GeneID:3361384"
     gene            complement(321796..322578)
                     /locus_tag="SPNCRNA.638"
                     /db_xref="GeneID:14218167"
     misc_RNA        complement(321796..322578)
                     /locus_tag="SPNCRNA.638"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151001.1"
                     /db_xref="GeneID:14218167"
     CDS             321924..323978
                     /gene="cid14"
                     /locus_tag="SPAC12G12.13c"
                     /EC_number="2.7.7.1"
                     /codon_start=1
                     /product="poly(A) polymerase Cid14"
                     /protein_id="NP_001018181.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.13c"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.13c.1"
                     /db_xref="GeneID:3361384"
                     /db_xref="GOA:Q9UTN3"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="PomBase:SPAC12G12.13c"
                     /db_xref="PomBase:SPAC12G12.13c.1"
                     /translation="MGKKSVSFNRNNYKKRKNERTEPLPRRIFKNDKPSKFKSKRKEK
                     DKNSDAYDEMLLNNNFTLLDQEEPMVEIGSKKSRNDNDSEGIRDKGGVEISNKNDPYI
                     QFGKADPLEPLEKPDLPEEAIKRGEPTILLGIPKREGRKTNPVHDKAVENNSDFIKFD
                     WNSDEDEDSVSNDKSKNNESLKKSSKNEIPGFMRQRGRFFHEANEKSDSNRKRKRQAY
                     ELDSQSCPWHRQYKVEREVSRIFHQDILHFIDYITPTPEEHAVRKTLVSRINQAVLQK
                     WPDVSLYVFGSFETKLYLPTSDLDLVIISPEHHYRGTKKDMFVLAHHLKKLKLASEVQ
                     VITTANVPIIKFVDPLTKVHVDISFNQPGGLKTCLVVNGFMKKYPALRPLVIIIKHFL
                     NMRALNEVFLGGLSSYAIVCLVVSFLQLHPRLSTGSMREEDNFGVLLLEFLELYGKQF
                     YYDAVGIAVHNGGFYFSKKKMGWLKPNQPYLLSIQDPVDFQNDVSKSSRGLLRVKATF
                     ANGFDLLTSKLYALASRIEREGVNRVKDFPSILSTILSVDEGVRQHREHMLKCYKNNP
                     VPLEPLVEVDALASIDVDKLPLQDVGLQYVEDESDSDETDAAKDDLFKVNESIETNGH
                     ENFQKQALTSTGEQSSSNSRANPSKLFNISSDDSEDEVPIIEDTTASDEESRAKKIRK
                     RF"
     gene            complement(324042..325517)
                     /locus_tag="SPAC12G12.12"
                     /db_xref="GeneID:2542918"
     mRNA            complement(join(324042..324407,324462..325166,
                     325225..325517))
                     /locus_tag="SPAC12G12.12"
                     /product="putative NST UDP-galactose transporter"
                     /transcript_id="NM_001018286.2"
                     /db_xref="GeneID:2542918"
     CDS             complement(join(324194..324407,324462..325166,
                     325225..325280))
                     /locus_tag="SPAC12G12.12"
                     /codon_start=1
                     /product="putative NST UDP-galactose transporter"
                     /protein_id="NP_592886.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.12"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.12.1"
                     /db_xref="GeneID:2542918"
                     /db_xref="GOA:Q09875"
                     /db_xref="InterPro:IPR007271"
                     /db_xref="InterPro:IPR012404"
                     /db_xref="PomBase:SPAC12G12.12"
                     /db_xref="PomBase:SPAC12G12.12.1"
                     /translation="MLLPIIMLTSGVANTVLSKYQDSIAEESEPIKSMAVLQSLNIFL
                     GEACLWFYVLYKRHSQGPGYESLDHLPLKHKVFMALPAIMDICGSTLMNVGLLYTSAS
                     IYQMTRGSLIIFVALFATTLLKRTIGQLQWLSLSFVVLGVAIVGYSGSSSSIGSNPIL
                     GITAVLIGQFFLATQFTIEEYILSFIQVDPSELVAYEGTYGVFFVLLGMIISYYFIGS
                     TTAGYHGWFDYSHVISRFNEVPALYVISGVILVSIAFFNVSGLAITKLHSATTRSLLD
                     IARTFGIWIIAMAMGMESFHLLQFLGFVLLIYGIFTYHSIIKFPLAES"
     gene            326440..328122
                     /locus_tag="SPAC12G12.11c"
                     /db_xref="GeneID:2543045"
     mRNA            join(326440..326856,326942..327391,327498..328122)
                     /locus_tag="SPAC12G12.11c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018287.2"
                     /db_xref="GeneID:2543045"
     CDS             join(326694..326856,326942..327391,327498..327982)
                     /locus_tag="SPAC12G12.11c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592887.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.11c"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.11c.1"
                     /db_xref="GeneID:2543045"
                     /db_xref="GOA:Q09874"
                     /db_xref="InterPro:IPR007518"
                     /db_xref="PomBase:SPAC12G12.11c"
                     /db_xref="PomBase:SPAC12G12.11c.1"
                     /translation="MDNVQEHDPDTQEHNNETQNHKQEDHSNSYQTRTIPFIEPLSRE
                     YQKRIILCQTVNGPCPIIALSNALILKSNVDRPFELPKKRYITPDELTEYLVEFAKAY
                     GLCKNQQSLQDKLTSMHFGQQLNPCLYDIEKFEYGHEIFCTFGVRLVHGWILSDDMGL
                     SDEDLSYLRKLEYYEKVADTFAERRSLLEMQEPLTEQQQDFLNNSTCVDKVMENRYTM
                     QFLTNAGLKKILELVGPGEIVVVFRSSHFSTMYSNPDSFAQFTLVTDSGYARTGEDVV
                     WETFDSQTVETGNGELCAANFIPAVYVLNQRKEEKKKRAKDDEQYAKRLAKEEEERGK
                     KETPKKASNTPRRNKSNTQKSRKQSENCLIS"
     gene            complement(328196..329545)
                     /gene="wdr21"
                     /locus_tag="SPAC12G12.10"
                     /db_xref="GeneID:2541535"
     mRNA            complement(328196..329545)
                     /gene="wdr21"
                     /locus_tag="SPAC12G12.10"
                     /product="WD-repeat family protein wdr21"
                     /transcript_id="NM_001018288.2"
                     /db_xref="GeneID:2541535"
     CDS             complement(328222..329484)
                     /gene="wdr21"
                     /locus_tag="SPAC12G12.10"
                     /codon_start=1
                     /product="WD-repeat family protein wdr21"
                     /protein_id="NP_592888.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.10.1"
                     /db_xref="GeneID:2541535"
                     /db_xref="GOA:Q09873"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="PomBase:SPAC12G12.10"
                     /db_xref="PomBase:SPAC12G12.10.1"
                     /translation="MSGLPFHIPGYYYNSEKKRYFRIISSGQSTPSSNIYTKERLKRG
                     KRFNNISKERTKGKGGNPVFNFSTYLFDRQFSQYPYSCNDDRDYLCAKNLKKINLRQL
                     PVGTELQKIGWLREVNTIILTSKNGDILGCCLTPEDKSGVANEKYTSEGSIQDFSLSR
                     IGLSNNPISSLVCNAMQIFWSTSPSLQNEGQFHISTYNQLLGESNNYRWGSLKLLKTP
                     LCAESIGEMGFAVGGTSKIAIINREGKLTQSLQSKGDVFSLKYLGDNLVIAGCRNKSV
                     LVYDLRTKKECVQRFYHGSSICSMQNLDFSQPKLLVSGLESKISLYDCRFLQSKKRPQ
                     SIMSYMGHSNLLERNLALMKNENGSIFSSAGDDYVLRFWKTDCSLPFKEMRVDDGKYL
                     CRDGSWVKAMNGTGWVLPYGRGLLIYEP"
     gene            complement(<329810..332816)
                     /locus_tag="SPAC12G12.09"
                     /db_xref="GeneID:2542958"
     mRNA            complement(<329810..332816)
                     /locus_tag="SPAC12G12.09"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018289.2"
                     /db_xref="GeneID:2542958"
     CDS             complement(329810..332743)
                     /locus_tag="SPAC12G12.09"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592889.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.09.1"
                     /db_xref="GeneID:2542958"
                     /db_xref="GOA:Q09872"
                     /db_xref="PomBase:SPAC12G12.09"
                     /db_xref="PomBase:SPAC12G12.09.1"
                     /translation="MSFYKEKSINETNLGSFVDESNELFFSALSESSMNHGTPDDSIL
                     LDLVSRSDNKDLYQDSLDVRDNFSNLSSDEIPQSSSYEQTRKPFFHHFNPFEFLEATS
                     PLQQNGKSRDTEKPPSMKEKDLSSNSSSQHDKAFHERVDQGKNKSSTTKYQEFRTVAD
                     YREFSPGQSVNSLKPNSGDEVPSTKSSTSSEMHTQLLKDEQKKILTPAPDVPHDVYCI
                     EPSLGRVFSFPASFVASPLLLEDCNKIASCDLPYSTFYANSQVIDKFSEYFAYVDQDP
                     CHIRVLNANTDQSLILYTQSDVKNLHFGKNKHTKPHLLVMDALSNLYVWKILQKRSEI
                     SVSLLFTIRRANYGICDWIPNSSNMFSMIVKNSLYIVDISNIRSNNISPKVYAKDFNG
                     LQAAKVDLPGPINSYTISSDRSVVAILVNSQIFFYSFPVSNLFSTNPSHRGNWAAIAT
                     MSLQLPSTANSISFLSSPPNNNDIIDKVICVSYANNTILGLFDFGLCAFTQEIEFSNE
                     KEKSPIQQLLTFNNSNMIVAKRNQLLDIFIYSPSDLSNVGVLSNTAALISAVSKGKRF
                     GDSGYINKVISNEVVDHSIVFVTLIGCDSSKLELILALSSGYFQFCIESDSKFDEGTS
                     LEYPNSDKRILARASLTSGLKSNNTLRALSQDLKNCAKSKDDSTTQNLTESLGSVCYP
                     SMPFFNQYVPQNPNEVRENISSVMKSRIHAKFESLHSRVELVVKNSYMKLLEQTISEA
                     ATDEISDLFKLIHSKPFLLEVGFLETGFLANDLENLTSTYRSSNRQLCDFSNRIGNIN
                     QKLEKLLMIERLETSDQSPTSSSNFEESESFAVSKKVLELVRISKNKEALICFTKDPS
                     IEAFRSLQDVPDYSLDDCSSIHLLAFIHVLSKLIIKEEQLSFSRLQLLSRATSRLRTM
                     TLSVFNNSGTLTPELFSSVVRIVLKNVREFVLIGNSSIQKSKHEFLITTLQALLREVD
                     IFLNT"
     gene            332838..333578
                     /locus_tag="SPAC12G12.17"
                     /db_xref="GeneID:9407221"
     mRNA            join(332838..333239,333291..333578)
                     /locus_tag="SPAC12G12.17"
                     /product="putative non-classical export protein 1"
                     /transcript_id="NM_001355975.1"
                     /db_xref="GeneID:9407221"
     gene            complement(333178..334621)
                     /gene="mrpl6"
                     /locus_tag="SPAC12G12.08"
                     /db_xref="GeneID:2542846"
     mRNA            complement(333178..334621)
                     /gene="mrpl6"
                     /locus_tag="SPAC12G12.08"
                     /product="putative mitochondrial ribosomal protein subunit
                     L16"
                     /transcript_id="NM_001018290.2"
                     /db_xref="GeneID:2542846"
     CDS             join(333214..333239,333291..333441)
                     /locus_tag="SPAC12G12.17"
                     /codon_start=1
                     /product="putative non-classical export protein 1"
                     /protein_id="NP_001343064.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.17"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.17.1"
                     /db_xref="GeneID:9407221"
                     /db_xref="GOA:C6Y4B6"
                     /db_xref="InterPro:IPR024242"
                     /db_xref="PomBase:SPAC12G12.17"
                     /db_xref="PomBase:SPAC12G12.17.1"
                     /translation="MSQPYLISKWMDPLFGIFVGTYGYYLYEKEHRPRGRSLRELALR
                     KWNKQAVSQQSMKN"
     CDS             complement(333695..334336)
                     /gene="mrpl6"
                     /locus_tag="SPAC12G12.08"
                     /codon_start=1
                     /product="putative mitochondrial ribosomal protein subunit
                     L16"
                     /protein_id="NP_592890.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.08"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.08.1"
                     /db_xref="GeneID:2542846"
                     /db_xref="GOA:Q09865"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002358"
                     /db_xref="InterPro:IPR019906"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="PomBase:SPAC12G12.08"
                     /db_xref="PomBase:SPAC12G12.08.1"
                     /translation="MFSIDSCLKTRPLTFRIARLGMNFTTCSAARSYVGKKEIIVPKN
                     IQFDLEGEQLQITGPHGTLNMRFPNYLNLSKTNDILKVGMDANIEKQATKKQRAMWGT
                     TRAILANNVKGVTMYWQSIIKLVGIGYRTSLNDGNIHLKIGYANDILVSIPTDVQVEN
                     PTPTSLVLRGIDRQKVTQFAAKIRSFKKPEPYKGKGIYVDGEKPQLKAKRSIS"
     gene            334615..336131
                     /locus_tag="SPAC12G12.07c"
                     /db_xref="GeneID:2542964"
     mRNA            join(334615..334782,334830..336131)
                     /locus_tag="SPAC12G12.07c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018291.2"
                     /db_xref="GeneID:2542964"
     CDS             join(334660..334782,334830..335945)
                     /locus_tag="SPAC12G12.07c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592891.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.07c.1"
                     /db_xref="GeneID:2542964"
                     /db_xref="GOA:Q09871"
                     /db_xref="PomBase:SPAC12G12.07c"
                     /db_xref="PomBase:SPAC12G12.07c.1"
                     /translation="MPSQGNNKNSENITQNPIEGELGSVIVEHLTKRIRNFTKKKQKI
                     LKLEEIAASDSNSLNDDQRKALQGKDAVLTTLNELKELLSQIDATRIRDEKHKRQFEA
                     TENAKRKEEIEAQYREGYDTAQKQVSSLVRFLRFASHNCVHPSDDAPFNSAVEKLLVI
                     VYEGTEKSEKAVADLNDSSTDVVPESEVSFQTISSRVDNFFAAPLPSEQAEELIEDDY
                     AEQPEQAVGQPIEQQSISDDEARQTNRPLNRGIQFLNESEIEGQHVEEPALPSETSVP
                     ANSTLQVPTENVEVDVLGKDGTNIYPTQNQVVEQKQMQQKLDSMSPEWYQAADPSNGV
                     VDGTPKLNSNTRGSSKRPSVNRSQGSGQRGRGGRGFYRGGRGRGGFFNRSKRGQYSNS
                     NNSTSQPSPNAELSNFNPVA"
     gene            336308..338157
                     /locus_tag="SPAC12G12.06c"
                     /db_xref="GeneID:2542936"
     mRNA            336308..338157
                     /locus_tag="SPAC12G12.06c"
                     /product="putative rRNA processing protein"
                     /transcript_id="NM_001018292.2"
                     /db_xref="GeneID:2542936"
     CDS             336428..337519
                     /locus_tag="SPAC12G12.06c"
                     /codon_start=1
                     /product="putative rRNA processing protein"
                     /protein_id="NP_592892.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.06c.1"
                     /db_xref="GeneID:2542936"
                     /db_xref="GOA:Q09870"
                     /db_xref="InterPro:IPR000228"
                     /db_xref="InterPro:IPR013791"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016443"
                     /db_xref="InterPro:IPR020719"
                     /db_xref="InterPro:IPR023797"
                     /db_xref="PomBase:SPAC12G12.06c"
                     /db_xref="PomBase:SPAC12G12.06c.1"
                     /translation="MSTGQLKRFKGCEYLTHRLVLATLSGTPIRVEGIYPDEADPGVK
                     DYQVSFLRLLEKLTNGSVIEISYTGTSFIYRPGNIIGGRVVHDCPTTKGIGYFLEPIL
                     ILCLFAKTPTSLTLTGVTSSNEDIGVDVLRTSVLPSLQKRFQVGDELELRILKRGSAP
                     GGGGEVNFLCPVIKESLPPIRLSEFGRVFRIRGIASSTRVSPAFANRLVESARGVLNP
                     FIPDVFIYTDVRRGDECGNSPGYSITLVAETNKGCSYAAEHCGEAGETPEDVGSFCAK
                     KLLEVIESGGCVDPYTQPSTLTGMLLSSEDVNTIVVGQLGITSQLVVFLRDVKALFNC
                     EYRFKELESGQVEMSCLGKGYLNVNRRIQ"
     gene            338286..339763
                     /gene="taf9"
                     /locus_tag="SPAC12G12.05c"
                     /db_xref="GeneID:2543133"
     mRNA            338286..339763
                     /gene="taf9"
                     /locus_tag="SPAC12G12.05c"
                     /product="SAGA complex/ transcription initiation factor
                     Taf9"
                     /transcript_id="NM_001018293.2"
                     /db_xref="GeneID:2543133"
     CDS             338392..338883
                     /gene="taf9"
                     /locus_tag="SPAC12G12.05c"
                     /codon_start=1
                     /product="SAGA complex/ transcription initiation factor
                     Taf9"
                     /protein_id="NP_592893.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.05c.1"
                     /db_xref="GeneID:2543133"
                     /db_xref="GOA:Q09869"
                     /db_xref="InterPro:IPR003162"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="PomBase:SPAC12G12.05c"
                     /db_xref="PomBase:SPAC12G12.05c.1"
                     /translation="MSSPGISDESIKGPKDVRLIHLILSSLGVPSYSQTVPLQLLTFA
                     HRYTQQLIQDSQVYAEHSRGQNAPISVEDVRLAVASQINHSFTGPPPKEFLLELAMER
                     NRKPLPQIQPSYGFRLPPEKYCLTQPNWIVSNETQQNQPKEENSSDSRMEEDKLDFSV
                     KSE"
     gene            complement(339766..342080)
                     /gene="mcp60"
                     /locus_tag="SPAC12G12.04"
                     /gene_synonym="hsp60"
                     /db_xref="GeneID:2543131"
     mRNA            complement(339766..342080)
                     /gene="mcp60"
                     /locus_tag="SPAC12G12.04"
                     /gene_synonym="hsp60"
                     /product="protein Mcp60"
                     /transcript_id="NM_001018294.2"
                     /db_xref="GeneID:2543131"
     CDS             complement(340107..341855)
                     /gene="mcp60"
                     /locus_tag="SPAC12G12.04"
                     /gene_synonym="hsp60"
                     /codon_start=1
                     /product="protein Mcp60"
                     /protein_id="NP_592894.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.04.1"
                     /db_xref="GeneID:2543131"
                     /db_xref="GOA:Q09864"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="PomBase:SPAC12G12.04"
                     /db_xref="PomBase:SPAC12G12.04.1"
                     /translation="MVSFLSSSVSRLPLRIAGRRIPGRFAVPQVRTYAKDLKFGVDAR
                     ASLLTGVDTLARAVSVTLGPKGRNVLIDQPFGSPKITKDGVTVARSVSLKDKFENLGA
                     RLVQDVASKTNEVAGDGTTTATVLTRAIFSETVRNVAAGCNPMDLRRGIQLAVDNVVE
                     FLQANKRDITTSEEISQVATISANGDTHIGELLAKAMERVGKEGVITVKEGRTISDEL
                     EVTEGMKFDRGYISPYFITDVKSQKVEFENPLILLSEKKVSAVQDILPSLELAAQQRR
                     PLVIIAEDVDGEALAACILNKLRGQLQVVAIKAPGFGDNRRNMLGDLAVLTDSAVFND
                     EIDVSIEKAQPHHLGSCGSVTVTKEDTIIMKGAGDHVKVNDRCEQIRGVMADPNLTEY
                     EKEKLQERLAKLSGGIAVIKVGGSSEVEVNEKKDRIVDALNAVKAAVSEGVLPGAGTS
                     FVKASLRLGDIPTNNFDQKLGVEIVRKAITRPAQTILENAGLEGNLIVGKLKELYGKE
                     FNIGYDIAKDRFVDLNEIGVLDPLKVVRTGLVDASGVASLMGTTECAIVDAPEESKAP
                     AGPPGMGGMGGMPGMM"
     gene            340209..341954
                     /locus_tag="SPNCRNA.639"
                     /db_xref="GeneID:14218236"
     misc_RNA        340209..341954
                     /locus_tag="SPNCRNA.639"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151002.1"
                     /db_xref="GeneID:14218236"
     gene            complement(342090..345182)
                     /gene="cip2"
                     /locus_tag="SPAC12G12.03"
                     /db_xref="GeneID:2543139"
     mRNA            complement(342090..345182)
                     /gene="cip2"
                     /locus_tag="SPAC12G12.03"
                     /product="RNA-binding protein Cip2"
                     /transcript_id="NM_001018295.2"
                     /db_xref="GeneID:2543139"
     CDS             complement(343399..345129)
                     /gene="cip2"
                     /locus_tag="SPAC12G12.03"
                     /codon_start=1
                     /product="RNA-binding protein Cip2"
                     /protein_id="NP_592895.1"
                     /db_xref="GeneID:2543139"
                     /db_xref="GOA:Q09868"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR012677"
                     /translation="MAEGTSQRPLTPLSQAFLSTNTLSPASSPLTFHSEAASLRRKRS
                     NFFPKLDELNGAQDEEMRGLNIPGGSGYLENRYGRDKFTFSDAAVNSAGMGGSGIFSH
                     NNADDGLGDGSSTVLPSSLKQMLDPEISTANNPSAKPRRTRLQTAWKEATNSAGLSLR
                     SASALDVLKNSGPATTSLLSSTTYPFDSLNAFNEPSHSHVPNSASSTALSRGMSNSVT
                     LTAPPEPDEETIPTAIVIKNIPFSLKKEVLFKVFTALDIPRPYAFNYHFDNGVFRGLA
                     FANFHSPEEAKTVVQVLNGYEITGRRLRVEWKRQLPPAERERVERGKQEKRAVEERKN
                     QLKSPFSVANIGAGIDFDLNDPAILNVYSHILLFYYRSDNTNDLVFDSSTTQEERRVA
                     ALLASRLNLNHSVTGDGEAKQVVITMPSTHFTPANNSSANHSPLMAPNASTLNPSSLG
                     ASNLSQPSLANHLSSSGLFDNGLFSSGGLSSNFSSLRRPAPSMHLADSIRSLRGLNDS
                     KAFSDIRSMPATPLELATPFANLNVSSPLDRNATNSSNTLNGSAMNDYFASLTPSNTG
                     AIGSRTFTKN"
     gene            complement(345234..347735)
                     /locus_tag="SPAC12G12.02"
                     /db_xref="GeneID:2543142"
     mRNA            complement(join(345234..346051,346114..346244,
                     346307..346439,346544..347735))
                     /locus_tag="SPAC12G12.02"
                     /product="rRNA-processing protein"
                     /transcript_id="NM_001018296.2"
                     /db_xref="GeneID:2543142"
     gene            345363..346322
                     /locus_tag="SPNCRNA.640"
                     /db_xref="GeneID:14217864"
     misc_RNA        345363..346322
                     /locus_tag="SPNCRNA.640"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151004.1"
                     /db_xref="GeneID:14217864"
     CDS             complement(join(345839..346051,346114..346244,
                     346307..346439,346544..346618))
                     /locus_tag="SPAC12G12.02"
                     /codon_start=1
                     /product="rRNA-processing protein"
                     /protein_id="NP_592896.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.02.1"
                     /db_xref="GeneID:2543142"
                     /db_xref="GOA:Q09867"
                     /db_xref="InterPro:IPR019310"
                     /db_xref="PomBase:SPAC12G12.02"
                     /db_xref="PomBase:SPAC12G12.02.1"
                     /translation="MPKFKGPGLSVLKKKIRDNERLLKKENLPANIRVEHERALLGLQ
                     EQLSMAQLEHKKQKIFERYKKVRFFERKKAERRIKQLEKSLKDETMDDEKRKQCEKSM
                     RKCQIDLMYIKEYPPLTKYVSLYAEGTSEQTEETRNRIWAEMEERFNSGRKHKIPSSG
                     SNRVPVQEKSSTGGDLEDEFLQR"
     gene            346795..350151
                     /locus_tag="SPAC12G12.01c"
                     /db_xref="GeneID:3361381"
     mRNA            346795..350151
                     /locus_tag="SPAC12G12.01c"
                     /product="ubiquitin-protein ligase E3"
                     /transcript_id="NM_001355976.1"
                     /db_xref="GeneID:3361381"
     CDS             347195..349912
                     /locus_tag="SPAC12G12.01c"
                     /codon_start=1
                     /product="ubiquitin-protein ligase E3"
                     /protein_id="NP_001342800.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC12G12.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC12G12.01c.1"
                     /db_xref="GeneID:3361381"
                     /db_xref="GOA:Q09866"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="PomBase:SPAC12G12.01c"
                     /db_xref="PomBase:SPAC12G12.01c.1"
                     /translation="MLNRSKKRNGCYFWVNGSSDEIRYVAVKASPKVNWKTHIIWRSL
                     KNVKCIDSFHGNNEILGAGSSTGNISLLSVKHPEFQAVVTPGYARPCNSLAFSETEHL
                     VAGFAKSRNESSLKLWDLNSLLSDPKSSPLMQSSTLDGVSSVCYKKDTPLLLTGSTSR
                     SVHIIDTRQQLDSVSSVNTQYYSNIVVDPFSPNYFAANSYDGDIAIFDTRYFKSDNYL
                     QIILRNENKKPKNPQLFALKYSEWKPGQLAVLSNNSITLRQLLPCVNGNEGSANNSVF
                     VNYEKKYPVKPNSQCSGIDFFTPSTAFPTHVQILGVINEQPKLFSVHDEVIPFSFNPY
                     NDLIFSFKEKLYPLNSSPFNTLSDVPQFDVSEFVDENSFDSSSSCSSKVFLTTRNNSI
                     NSEDSAHEVLLSYNRVLGSDIQGTILDRVKKGYQFDSQKNSELVSDLYLKDLWSWIHL
                     SHRQSEESLFGDTGDTDFSYQGALGIWFMDTELTSMSDVFEAKESKFLEKKILRLARD
                     VIERLDLDIFTSIQTKRPLRQLALLACGLGMSNDDLLLEIRRLIRKNEHVKAAGLALF
                     HGKIENVVRILSSGNELEKTISTAVAGYITSQGLSNFGSDSLWKEMSRNLSTELEDPY
                     LRAIFAYVSNSDWRDVLDEVSLSLKDRLGIALRFLPDDDLSNYLCDLCHTTVQSGDPE
                     GLLLTGLTPLGMELLQNYIDHTSDVQTAALIAAFVVPKKFLDKRAEDWTESYRELLNR
                     WKLYRERAKFDIFRTELSKNHTGEITRKATEPSIRIICNFCRKPIFPFSNRNECNNLP
                     TPIQRGVSKAGPAKHLGKSCPHCGQPLPKCSVCGFSLGDEDVPQKDDFSQKPQNYVKE
                     VNLQKSRFGLWFSFCLNCGHGAHASHASEWFSTHTICPVPNCDCECKLK"
     gene            complement(350239..353340)
                     /locus_tag="SPAC630.04c"
                     /db_xref="GeneID:2543431"
     mRNA            complement(350239..353340)
                     /locus_tag="SPAC630.04c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018299.2"
                     /db_xref="GeneID:2543431"
     gene            350406..352296
                     /gene="arp3"
                     /locus_tag="SPAC630.03"
                     /gene_synonym="act2"
                     /db_xref="GeneID:2543233"
     mRNA            join(350406..350511,350575..350598,350671..351199,
                     351295..351894,351960..352296)
                     /gene="arp3"
                     /locus_tag="SPAC630.03"
                     /gene_synonym="act2"
                     /product="actin-like protein Arp3"
                     /transcript_id="NM_001018298.2"
                     /db_xref="GeneID:2543233"
     CDS             join(350477..350511,350575..350598,350671..351199,
                     351295..351894,351960..352055)
                     /gene="arp3"
                     /locus_tag="SPAC630.03"
                     /gene_synonym="act2"
                     /codon_start=1
                     /product="actin-like protein Arp3"
                     /protein_id="NP_592898.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.03.1"
                     /db_xref="GeneID:2543233"
                     /db_xref="GOA:P32390"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR015623"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="PDB:3DWL"
                     /db_xref="PomBase:SPAC630.03"
                     /db_xref="PomBase:SPAC630.03.1"
                     /translation="MASFNVPIIMDNGTGYSKLGYAGNDAPSYVFPTVIATRSAGASS
                     GPAVSSKPSYMASKGSGHLSSKRATEDLDFFIGNDALKKASAGYSLDYPIRHGQIENW
                     DHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNPPENRENTAEIMFESFNCAGLYIAVQ
                     AVLALAASWTSSKVTDRSLTGTVVDSGDGVTHIIPVAEGYVIGSSIKTMPLAGRDVTY
                     FVQSLLRDRNEPDSSLKTAERIKEECCYVCPDIVKEFSRFDREPDRYLKYASESITGH
                     STTIDVGFERFLAPEIFFNPEIASSDFLTPLPELVDNVVQSSPIDVRKGLYKNIVLSG
                     GSTLFKNFGNRLQRDLKRIVDERIHRSEMLSGAKSGGVDVNVISHKRQRNAVWFGGSL
                     LAQTPEFGSYCHTKADYEEYGASIARRYQIFGNSL"
     CDS             complement(352427..352927)
                     /locus_tag="SPAC630.04c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592899.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.04c.1"
                     /db_xref="GeneID:2543431"
                     /db_xref="GOA:Q9UUH8"
                     /db_xref="PomBase:SPAC630.04c"
                     /db_xref="PomBase:SPAC630.04c.1"
                     /translation="MGEEISAIDLVMANDQLVSTSDASDIPYDPYSQFWGKVLVLTFG
                     IICVVFVIFMLHHERIKACRTIISAREQQRTQHSIHRRERSSSGASQQFEHHVRQTDC
                     LPLYEPITALNQQYLKTLPTTSTPPPPAIFDENGEFVGDVPSVAGAIERPPSYESLPA
                     PQNDEV"
     gene            complement(353705..357205)
                     /locus_tag="SPAC630.06c"
                     /db_xref="GeneID:2543368"
     mRNA            complement(join(353705..356433,356511..356592,
                     356635..356904,356984..357205))
                     /locus_tag="SPAC630.06c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018301.2"
                     /db_xref="GeneID:2543368"
     gene            353783..356580
                     /gene="gyp7"
                     /locus_tag="SPAC630.05"
                     /db_xref="GeneID:2543609"
     mRNA            353783..356580
                     /gene="gyp7"
                     /locus_tag="SPAC630.05"
                     /product="putative GTPase-activating protein Gyp7"
                     /transcript_id="NM_001018300.2"
                     /db_xref="GeneID:2543609"
     CDS             353900..356131
                     /gene="gyp7"
                     /locus_tag="SPAC630.05"
                     /codon_start=1
                     /product="putative GTPase-activating protein Gyp7"
                     /protein_id="NP_592900.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.05.1"
                     /db_xref="GeneID:2543609"
                     /db_xref="GOA:Q9UUH7"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="PomBase:SPAC630.05"
                     /db_xref="PomBase:SPAC630.05.1"
                     /translation="MTTLESLDMPEMTEVEDDTVDIHIDNSKVALLFSKSKVFVHPTS
                     KMKDNISGYLSLSKSKALGNSSVAGSDILLSWVPDSFLKNRPRDLSVFQNAETLSNGS
                     IREWVEIPQHLDYSFSVRLCSIYSIIFRPPRYGWNYGSIVINLRDSGESLPPLFFHDD
                     ECISTIEYGKQITRDRFDPFDESGNMFWGGTHLLMQLKKYASLEQSSHESQLYLVNPS
                     PEDTVAFQSVELQKVISNNRLNSSSTPPTPRSSSSIFNPFRRALHDLSFTVLERFSRV
                     TNYGKSEVDRLMEHKVTKSILPHLPRELQVLLESKRVQKLTEEYDPARMFLARWAEGI
                     VEQSESNNSQPVNNAGVWTDAQREEDSSLGPFELVYIEERVKRDDPLSVEQWNSMFNA
                     HGKLQVDVHRVLGIIFHGGIQPSLRKEVWPFLLSVYPWDSTSEERRVIYLSLQEEYCT
                     LKRKWYEDIHKQFNDRWFIEQRNRIEKDVHRTDRQHEYFQIEDLPHPDPQSTFTGTNM
                     NMEMMKDILLTYNEYDTELGYVQGMSDLLAPIYVTFNDNALTFWGMVGLMKRLHFNFL
                     RDQSGMHRQLDTLRLLIEFMDPELFAHLEKTDSSNLFCFFRMLLIYFKREFDWEVLLK
                     LWDVLFTNYLSYDYHIFVAYAIAERHREVLLNQTSAFDEVLKYFNELSGKLALEPTLI
                     CAEQCFYQFKNKLALIDRKQMEETNSDEDGSKETDLPTIAPYLRNLLKTSQPQYTPSG
                     KQE"
     CDS             complement(join(356233..356433,356511..356592,
                     356635..356904,356984..356997))
                     /locus_tag="SPAC630.06c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592901.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.06c.1"
                     /db_xref="GeneID:2543368"
                     /db_xref="GOA:Q9UUH6"
                     /db_xref="InterPro:IPR018555"
                     /db_xref="PomBase:SPAC630.06c"
                     /db_xref="PomBase:SPAC630.06c.1"
                     /translation="METVKVTRKDLLLSPENKEIDSLDDVSALLSQRLSNVFEFSIAS
                     EEVQSDEVFEDTYPNDDQATFNLFSDVNTVVTKVTEPSIKNSRPLNYYILEDSPERQR
                     QLQASVFTYDQLMKAKEEKWPACQKLHKVVSIKKEESKHRRRPSKKRRIRMKLLREKE
                     EQLKRQAMAAKRNRFRKNVRKLPNKKKH"
     gene            complement(357325..359228)
                     /locus_tag="SPAC630.07c"
                     /db_xref="GeneID:2543370"
     mRNA            complement(357325..359228)
                     /locus_tag="SPAC630.07c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018302.2"
                     /db_xref="GeneID:2543370"
     CDS             complement(357593..358885)
                     /locus_tag="SPAC630.07c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592902.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.07c.1"
                     /db_xref="GeneID:2543370"
                     /db_xref="GOA:Q9UUH5"
                     /db_xref="PomBase:SPAC630.07c"
                     /db_xref="PomBase:SPAC630.07c.1"
                     /translation="MDQYRDLPKEDPDTAIEYESGVDEESSLKIEKFRVLIFGKDNSQ
                     DDLVKSVFNLSKLSEKEKMPFGIKCESEENPNFESYHSKVGKKSCKRFMRWLKANAFA
                     EERDIDCIWYQLNLLDISDEDILCLQYLQGCLIPIVSIIYDFNEFLSPFTKSFLSKIG
                     ESNTITVKGMPLADVLVFRKKVLKLVSQLSFMTDRKELVYTTCLALEDDDAYTNFVSA
                     QQEDSSCKFYGGILIGVSHCKYAAAGASYPLPIPASGLLAQKLAIGLLCKDIIKLWNL
                     CPESSILTKEILLELPKASDVAKSIGKMILTSMFVPLWLLKGIWEAPATAKIIIGSIA
                     DVTLPVQRMYYFIKAGGKLDVPTIHAFYQHYKEFVRPKCLEHIAEITTFNVVTAFSSE
                     AVYQEAIRLLDRFRYVSKSSEEDLIVPSFVVNDLITYD"
     gene            358613..359235
                     /locus_tag="SPNCRNA.641"
                     /db_xref="GeneID:14217990"
     misc_RNA        358613..359235
                     /locus_tag="SPNCRNA.641"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151005.1"
                     /db_xref="GeneID:14217990"
     gene            complement(359638..361266)
                     /gene="erg25"
                     /locus_tag="SPAC630.08c"
                     /db_xref="GeneID:2543373"
     mRNA            complement(359638..361266)
                     /gene="erg25"
                     /locus_tag="SPAC630.08c"
                     /product="putative C-4 methylsterol oxidase"
                     /transcript_id="NM_001018303.2"
                     /db_xref="GeneID:2543373"
     CDS             complement(360060..360962)
                     /gene="erg25"
                     /locus_tag="SPAC630.08c"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /product="putative C-4 methylsterol oxidase"
                     /protein_id="NP_592903.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.08c.1"
                     /db_xref="GeneID:2543373"
                     /db_xref="GOA:Q9UUH4"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="PomBase:SPAC630.08c"
                     /db_xref="PomBase:SPAC630.08c.1"
                     /translation="MNTTSEVIVGTGFQAIRQQLAQMHPELNFVEQLWLAYYKWFDND
                     VVATGLMSFLLHELIYFGRCIPWMIIDAMPYFRRWKIQPKKVPTLAEQWECTRLVLLS
                     HFTVELPQIWLFDPMCATFGLSTSVPFPPVTKMIWQITLFFFLEDTWHYWAHRLFHYG
                     IFYRFIHKVHHRYSAPFGLSAEYAHPLEIILLGAGTVFVPLMWCYFTHDLHLVTMYIW
                     ITLRLFQAVDSHAGYDFPWSLNKFLPIWAGADHHDYHHMAFKDNFSSSFRWWDAVLKT
                     DQNYHQFKARRLAAKYEAESKKAK"
     gene            complement(361498..362202)
                     /locus_tag="SPNCRNA.642"
                     /db_xref="GeneID:14218191"
     misc_RNA        complement(361498..362202)
                     /locus_tag="SPNCRNA.642"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151006.1"
                     /db_xref="GeneID:14218191"
     gene            <361557..363654
                     /gene="mug177"
                     /locus_tag="SPAC630.15"
                     /db_xref="GeneID:2543435"
     mRNA            <361557..363654
                     /gene="mug177"
                     /locus_tag="SPAC630.15"
                     /product="protein mug177"
                     /transcript_id="NM_001018304.2"
                     /db_xref="GeneID:2543435"
     CDS             361557..361874
                     /gene="mug177"
                     /locus_tag="SPAC630.15"
                     /codon_start=1
                     /product="protein mug177"
                     /protein_id="NP_592904.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.15"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.15.1"
                     /db_xref="GeneID:2543435"
                     /db_xref="GOA:Q9C110"
                     /db_xref="PomBase:SPAC630.15"
                     /db_xref="PomBase:SPAC630.15.1"
                     /translation="MYPKIVARCMIVITKNRESERNVLICYRNVTNVYFSLRILLNRQ
                     NEGNNCKYKLVFSLYRVSFRRMRLNDRQLSCVESVTNGIGLLCLKQADQVCLFTPTVD
                     SHL"
     gene            complement(362248..363714)
                     /gene="mug58"
                     /locus_tag="SPAC630.09c"
                     /db_xref="GeneID:2543381"
     mRNA            complement(362248..363714)
                     /gene="mug58"
                     /locus_tag="SPAC630.09c"
                     /product="putative glycerate kinase"
                     /transcript_id="NM_001018305.2"
                     /db_xref="GeneID:2543381"
     CDS             complement(362769..363602)
                     /gene="mug58"
                     /locus_tag="SPAC630.09c"
                     /codon_start=1
                     /product="putative glycerate kinase"
                     /protein_id="NP_592905.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.09c"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.09c.1"
                     /db_xref="GeneID:2543381"
                     /db_xref="GOA:Q9UUH3"
                     /db_xref="InterPro:IPR010488"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC630.09c"
                     /db_xref="PomBase:SPAC630.09c.1"
                     /translation="MSSLEIIVDKILKFLEKQPKPEGRPFILGISGPQGSGKSTLASA
                     LDTELTRKNESVVKFSLDDFYLTHAEQVELAKNNPNNPLVQHRGLAGTHDVTFLNNVL
                     NAFVKGSDEEVSIPFYDKSKFGGYGDRGDESQWKKANPKTTTYVIFEGWMVGFEPLDS
                     CMLSVRARSTRWQNIEGSLLWVNRKLADYQPIFQKIDSLVELEAQEINYVYRWRLQQE
                     HALKARIHKGMSDEEVIEFVNHYMPQYVFYLGTLSNKVHLNPHCLEIILDENRYPVVM
                     H"
     gene            365155..365226
                     /locus_tag="SPATRNAPRO.01"
                     /db_xref="GeneID:3361379"
     tRNA            365155..365226
                     /locus_tag="SPATRNAPRO.01"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:3361379"
     gene            365204..366442
                     /locus_tag="SPAC630.10"
                     /db_xref="GeneID:2543414"
     mRNA            365204..366442
                     /locus_tag="SPAC630.10"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018306.2"
                     /db_xref="GeneID:2543414"
     CDS             365550..366362
                     /locus_tag="SPAC630.10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592906.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.10.1"
                     /db_xref="GeneID:2543414"
                     /db_xref="GOA:Q9UUH2"
                     /db_xref="InterPro:IPR021867"
                     /db_xref="PomBase:SPAC630.10"
                     /db_xref="PomBase:SPAC630.10.1"
                     /translation="MRPIPVKNRIGKNNIDNAKGLKGNKLIRHYHNLLKEKSRLIASS
                     APIEKIKNVESELENIGIDAYQRASRSGQAEGKGGDSSKILIKWIRTTPCFSYCARLK
                     EPKDLLEIGSVSVDNKCSTCGLFRVSRIDLHSVHPLIKQQDFLERTPEEGLFTGISCS
                     LVLNFAPPELRAKMLLHCTGLLMPPNKEQPPWLFLVLPSPCITNSRYMDEKTLHSIMI
                     QFGFICRQKSISKKIAYYLYSYECFPMKEIDWKKKIVNDGATRNNFFIPCIL"
     gene            366634..367890
                     /gene="vps55"
                     /locus_tag="SPAC630.11"
                     /db_xref="GeneID:2543247"
     mRNA            join(366634..366817,366873..366891,366968..367040,
                     367105..367189,367293..367348,367395..367890)
                     /gene="vps55"
                     /locus_tag="SPAC630.11"
                     /product="putative protein Vps55"
                     /transcript_id="NM_001018307.3"
                     /db_xref="GeneID:2543247"
     CDS             join(366801..366817,366873..366891,366968..367040,
                     367105..367189,367293..367348,367395..367531)
                     /gene="vps55"
                     /locus_tag="SPAC630.11"
                     /codon_start=1
                     /product="putative protein Vps55"
                     /protein_id="NP_592907.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.11"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.11.1"
                     /db_xref="GeneID:2543247"
                     /db_xref="GOA:Q9UUH1"
                     /db_xref="InterPro:IPR007262"
                     /db_xref="PomBase:SPAC630.11"
                     /db_xref="PomBase:SPAC630.11.1"
                     /translation="MSDLRKIIGLSSVLAVGFMLVILSCALFKNWYPLLIVIPFILAP
                     LPNLLTKKYSTSHDFLQEEDRNLLDFGRFTFGATICTGFALPIVFVNVGLIGTAAATM
                     SCVGGSIIFLVITLYSQAFVQHEEEF"
     gene            368040..369950
                     /locus_tag="SPAC630.12"
                     /db_xref="GeneID:2543429"
     mRNA            368040..369950
                     /locus_tag="SPAC630.12"
                     /product="putative lipid phosphatase"
                     /transcript_id="NM_001018308.2"
                     /db_xref="GeneID:2543429"
     CDS             368572..369840
                     /locus_tag="SPAC630.12"
                     /codon_start=1
                     /product="putative lipid phosphatase"
                     /protein_id="NP_592908.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.12"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.12.1"
                     /db_xref="GeneID:2543429"
                     /db_xref="GOA:Q9UUH0"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="PomBase:SPAC630.12"
                     /db_xref="PomBase:SPAC630.12.1"
                     /translation="MKVGRFLVIIAFCFYVLYLEKIIHTRPHKKCDWRSWEQWESTGN
                     PVRIALVADPQLVDDLTYDYPRPLIGIVKWISDQFLRRHWRYLHKSLKPDITFIMGDL
                     MDTGREFATEEFKKDYFRMMNVLDPKFTNKLEIYPGNHDIGFGNHAIVKDIQRFESLF
                     GPTSRSIDVGNHTLVIVDGIRLSNNVNPQVYQPARDFLKSFETNKDNSRPRILLSHVP
                     LFRPAINSCGELREKDDVIKYGLGYQYQNLLLPELSESILKAVEPIAAFAGDDHDYCE
                     VVHNYQVDTREAATTEYNVKAFSMTSGILYPGYQLLSLNYPYDNPKADQKSSYQTKLC
                     ILPNQIQIYVWYGASISIFFALILLRTAIFFFGTDRYSLPLYKTHARRFSLSTTIHLF
                     KKIVRITLSTFISYTWIPFLLFIFLNIFII"
     gene            complement(369791..374217)
                     /gene="tsc2"
                     /locus_tag="SPAC630.13c"
                     /db_xref="GeneID:2543339"
     mRNA            complement(369791..374217)
                     /gene="tsc2"
                     /locus_tag="SPAC630.13c"
                     /product="tuberin"
                     /transcript_id="NM_001018309.2"
                     /db_xref="GeneID:2543339"
     CDS             complement(369945..373964)
                     /gene="tsc2"
                     /locus_tag="SPAC630.13c"
                     /codon_start=1
                     /product="tuberin"
                     /protein_id="NP_592909.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.13c"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.13c.1"
                     /db_xref="GeneID:2543339"
                     /db_xref="GOA:Q9UUG9"
                     /db_xref="InterPro:IPR000331"
                     /db_xref="InterPro:IPR003913"
                     /db_xref="InterPro:IPR018515"
                     /db_xref="InterPro:IPR024584"
                     /db_xref="PomBase:SPAC630.13c"
                     /db_xref="PomBase:SPAC630.13c.1"
                     /translation="MNNKSLLDLSSEPAIKDTDILSYFDANLPFKKRHQIVRSIYHGL
                     KYYIYSSTSIIQVWQNIQDFISTKNDNAAFRELVYNLMMRYVSTQKHLSIIERHTFFQ
                     TIEKDPFQDIAELQLRLKSLSVLTDEGHKISGIENRVGPLLSAWFNQYLQWQSQATEL
                     QGKDADSKLVHLLFFKSLFKFSTNLVKFQWFLVPEPQMLQLVNSVVQICNHARLEDVV
                     TEVLMFFDSMIRYSVIPKASLYDTVLILCSTYISTYSYSKLAQSVIFNLISSPVSNLA
                     FENVFNILQYNRSNVNAVRGAVRLMRFLMLQEVKNDAIASITLSSSIEFTEFPLGFNE
                     NVDFEILGTVYLFLRTPSILNRLNFLDWHRILNILMYCSQYLPLKASTSKEAFSKTAA
                     FANIYDRVLDFLDFEALIPLLQQFQVKLVFFLKDVLPVLKPKIRKKLLRLFETYNLIF
                     PCNQYWVFNLEFLLGIYQCKTFDLEDRALLFKLVEDACSVADENSAPILCSKFLFPVI
                     ESFSKESDDCVVSPVYNMLFFLSVNFQNPGLKDCIDHIFQQLISDTSSVTVRRLATST
                     LIRLFYYYYDLRDAVPIQETLAKMLEILETPSFPFVSRMLCLQFFLRFRANGTSIYIC
                     ENIDLNEPFKVLNVDSELIPAVYPISDSFVNSATVEKHIWERKENDLIKISNHSTEYG
                     KDFVTFPTSSLLRFYRKSMATESNWTILMFMITHLADQISNRSMFIGALEEIYNLLDF
                     MCDIVFERVSISAEIPSNIRKANIMIPILQNVQMLFVYHDQFSRAQEDELVSVFFAGL
                     QKWNEACHVSIHSLMLCCYELPVSIRKQLPAILVTLSRLITKPDLSVHILEFLCSLAR
                     LPDLIANFTDADYRQIFAIALKYIQHRDFTKESKDSNDTESILKNSYSSYVLALAYSV
                     LQIWFLSLRLTERKKFVPWILRGLKLASEGKPLEDLCLVQYDMMQQFCYSNSDINNQT
                     STFVDSDVESETWIRGNSLFTINVSVNSGFLEAVIRRPTGTTQYTFRNEASLQKFLWE
                     ENLTSSKALTRGLLCTPSSFVSHFLDPHGISLYNQPLLLPSNDDSVRRAISVFDRIPV
                     IESLKAGLVYVGYQQRREADILANTNPSEDFLTFLNGLGTLFELKTDQKVFAGGLDRE
                     NDIDGAFAYCWKDKVTQMVFHCTTMMPTNIEHDPGCTLKKRHIGNDFVTIIFNESGLE
                     YDFDTIPSQFNFVNIVITPESESIRRTGRQIKFYKVKALTKYDIDFSLFRRYKIVSSD
                     ALPAIVRDVTLNAAVFSHIYHRSAGDYVHIWAERLRQLKRLREKFQASVLPEDYNLDE
                     QTKTKLQNGTNFSDFTSYL"
     gene            complement(374316..377908)
                     /gene="tup12"
                     /locus_tag="SPAC630.14c"
                     /db_xref="GeneID:2543402"
     mRNA            complement(join(374316..375830,376094..376446,
                     376844..376931,376993..377908))
                     /gene="tup12"
                     /locus_tag="SPAC630.14c"
                     /product="transcriptional corepressor Tup12"
                     /transcript_id="NM_001018310.2"
                     /db_xref="GeneID:2543402"
     CDS             complement(join(374683..375830,376094..376446,
                     376844..376931,376993..377200))
                     /gene="tup12"
                     /locus_tag="SPAC630.14c"
                     /codon_start=1
                     /product="transcriptional corepressor Tup12"
                     /protein_id="NP_592910.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC630.14c"
                     /db_xref="EnsemblGenomes-Tr:SPAC630.14c.1"
                     /db_xref="GeneID:2543402"
                     /db_xref="GOA:Q9UUG8"
                     /db_xref="InterPro:IPR001632"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013890"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="PomBase:SPAC630.14c"
                     /db_xref="PomBase:SPAC630.14c.1"
                     /translation="MLFLVISQTTSFMITVRQFTFTIFKFQFMATSNVSSRVNELLEA
                     VKKEFEDICQKTKTVEAQKDDFEYKAMISAQINEMALMKQTVMDLEMQQSKVKDRYEE
                     EITSLKAQLEARRKEIASGVVPQSSKTKHGRNSVSFGKYGNAGPFNSDNSSKPLILNN
                     GSSGGTPKNLRSPAIDSDGTVLAPIQTSNVDLGSQYYSSPHVRPAVGATMAGSAMRTF
                     PSNLPLGHPPPPSDSANSSVTPIAAPLVVNGKVSGNPPYPAEIIPTSNVPNREEKDWT
                     VTSNVPNKEPPISVQLLHTLEHTSVICYVRFSADGKFLATGCNRAAMVFNVETGKLIT
                     LLQEESSKREGDLYVRSVAFSPDGKYLATGVEDQQIRIWDIAQKRVYRLLTGHEQEIY
                     SLDFSKDGKTLVSGSGDRTVCLWDVEAGEQKLILHTDDGVTTVMFSPDGQFIAAGSLD
                     KVIRIWTSSGTLVEQLHGHEESVYSVAFSPDGKYLVSGSLDNTIKLWELQCVSNVAPS
                     MYKEGGICKQTFTGHKDFILSVTVSPDGKWIISGSKDRTIQFWSPDSPHSQLTLQGHN
                     NSVISVAVSPNGHCFATGSGDLRARIWSYEDL"
     gene            complement(377844..384751)
                     /gene="gti1"
                     /locus_tag="SPAC1751.01c"
                     /db_xref="GeneID:2542344"
     mRNA            complement(377844..384751)
                     /gene="gti1"
                     /locus_tag="SPAC1751.01c"
                     /product="gluconate transporter inducer Gti1"
                     /transcript_id="NM_001018311.2"
                     /db_xref="GeneID:2542344"
     CDS             complement(378192..380354)
                     /gene="gti1"
                     /locus_tag="SPAC1751.01c"
                     /codon_start=1
                     /product="gluconate transporter inducer Gti1"
                     /protein_id="NP_592911.1"
                     /db_xref="GeneID:2542344"
                     /db_xref="GOA:O14367"
                     /db_xref="InterPro:IPR018608"
                     /translation="MTEPGNLQPTFVGFIGTTVDALLLFEACRQNYTHFVDRRPQDRE
                     RERLIRSGSVFVFDEVQSGIKRWTDGIAWSPSRVIGNFLVYRQLCKKNSVSDRKRSSK
                     SRSDSDEEEVSAFTVSVPVDVDVASHVNISSPSAPSLSDNLFPGSSFSASSQQNPSSP
                     GSNDIKSEFAAVKNEYVLSPTSPTTSAAFPSSFSSLPLVSSKPTGTPFVPKSPPSSSP
                     STTNVSNASTSSAPINPRAPQTRRESISSTSSIHYCSSSSLSYLHDTERALVGSLTDS
                     YGFKKSGLIKKTISLMIDGRLHHLISYYTPEDVLNGKLQTPSSFNLFQQLTISKDLLE
                     YKSFRIPPLVEAAESEKISQLSTLEKRTLPSFPYNPFFSSSTAEIDPYHFQGLTLSTS
                     PISGVESSSLSSAISRNQSNLSSFQQQQQFSALQSISNNALNENIEQPPIKMAARHSY
                     PNFLQTLPQYMNDVYNPSGLAFNPVNPNANNSFVNLNLIQFTSPSQALFDYGEGPYVD
                     QKSQYLQPKQPSSNTDSIDQSSYNMSLAASKQFLTSDTQPDVNENYSFISNSIPKNLS
                     TSWNQNMGYHVTNSNSELASQNPLYAQQAVSMESMGNAIQSSAYSAMSTPHGGHYDHY
                     AATAKGKNPLAAENHASGGRLPKVPIPPLSNMRRGSVPIIPSSASLPMRTSGNRFCHY
                     SSLNGNHNRISARTNPYPINNQTMLFTEPLSKERGSLS"
     STS             380774..380792
                     /db_xref="UniSTS:98954"
     gene            383580..385433
                     /locus_tag="SPAC1751.04"
                     /db_xref="GeneID:3361540"
     mRNA            join(383580..384349,384480..384590,384986..385060,
                     385125..385433)
                     /locus_tag="SPAC1751.04"
                     /product="putative pre-ribosomal protein Loc1"
                     /transcript_id="NM_001018312.2"
                     /db_xref="GeneID:3361540"
     CDS             join(384320..384349,384480..384590,384986..385060,
                     385125..385220)
                     /locus_tag="SPAC1751.04"
                     /codon_start=1
                     /product="putative pre-ribosomal protein Loc1"
                     /protein_id="NP_001018183.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC1751.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC1751.04.1"
                     /db_xref="GeneID:3361540"
                     /db_xref="GOA:Q8TFI0"
                     /db_xref="PomBase:SPAC1751.04"
                     /db_xref="PomBase:SPAC1751.04.1"
                     /translation="MVVKKSKPKNQIRVEDLDLPKLNTSKNPQTKIQKKGKKKGKIFA
                     ETKDDLQNILNQVTYELDDKIKSKLQVAHEREAVFSKQSDRKISNNKADKKTGRKNEK
                     K"
     gene            complement(384886..386195)
                     /gene="rsm19"
                     /locus_tag="SPAC1751.02c"
                     /db_xref="GeneID:2542342"
     mRNA            complement(join(384886..385887,385938..386043,
                     386107..386195))
                     /gene="rsm19"
                     /locus_tag="SPAC1751.02c"
                     /product="putative mitochondrial ribosomal protein subunit
                     S19"
                     /transcript_id="NM_001018313.3"
                     /db_xref="GeneID:2542342"
     CDS             complement(join(385755..385887,385938..386043,
                     386107..386149))
                     /gene="rsm19"
                     /locus_tag="SPAC1751.02c"
                     /codon_start=1
                     /product="putative mitochondrial ribosomal protein subunit
                     S19"
                     /protein_id="NP_592912.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC1751.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1751.02c.1"
                     /db_xref="GeneID:2542342"
                     /db_xref="GOA:Q9US30"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="PomBase:SPAC1751.02c"
                     /db_xref="PomBase:SPAC1751.02c.1"
                     /translation="MFWTSVARARSVWKGPNVVDFGVNVQQCIKGNVPIKTAVRSATI
                     LPRMVGAQFMVHNGKSYANVKITEDMIGHKLGEFAPTRKAFHYRQTKNR"
     gene            386266..387856
                     /locus_tag="SPAC1751.03"
                     /db_xref="GeneID:2542347"
     mRNA            join(386266..386394,386458..386614,386786..387856)
                     /locus_tag="SPAC1751.03"
                     /product="translation initiation factor eIF3m"
                     /transcript_id="NM_001018314.2"
                     /db_xref="GeneID:2542347"
     CDS             join(386344..386394,386458..386614,386786..387786)
                     /locus_tag="SPAC1751.03"
                     /codon_start=1
                     /product="translation initiation factor eIF3m"
                     /protein_id="NP_592913.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC1751.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC1751.03.1"
                     /db_xref="GeneID:2542347"
                     /db_xref="GOA:Q09722"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR027528"
                     /db_xref="PomBase:SPAC1751.03"
                     /db_xref="PomBase:SPAC1751.03.1"
                     /translation="MEGSDFILVVDSSVEEQVEELAMYLDNLEANTDKNVLALCREYL
                     ASENVKEVLNLFLTRLPLLAQAPEKELEPILAVFINLIQESAAFEDHVSKFCQALEQI
                     ADQNNNLTPAILSVLSILFNTAVKERQHARLSILTSVVTLTTRYSLFSTLAPNLKYFP
                     DWLKEAGVSVSDHRAFNIFVSKAIQSYDDEQSFAFLLEAVKMDNSTADEAVRELVQRA
                     VNSPKYFFFDDIVTLPPVQQLEQSTLQLLGILSGGMTDDYVSWVAENHAHCQHQKFDE
                     DAIARKMKLLTIASLATQAPNNTLSYGDVAKSLKIDENEVELWIIDVIRAGLVEGRMS
                     QLTKTLSIHRSSYRVFGKHEWVALHEKLAKWGSSLRYMLQVMEQPLSSFTIASSKKGN
                     RDGSAVTASE"
     gene            388233..389229
                     /gene="trm112"
                     /locus_tag="SPAC31A2.02"
                     /db_xref="GeneID:2541708"
     mRNA            join(388233..388415,388452..388621,388721..388813,
                     388859..389229)
                     /gene="trm112"
                     /locus_tag="SPAC31A2.02"
                     /product="putative protein and tRNA methyltransferase
                     regulatory subunit Trm112"
                     /transcript_id="NM_001018315.2"
                     /db_xref="GeneID:2541708"
     gene            complement(388352..389177)
                     /locus_tag="SPNCRNA.643"
                     /db_xref="GeneID:14218367"
     misc_RNA        complement(388352..389177)
                     /locus_tag="SPNCRNA.643"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151007.1"
                     /db_xref="GeneID:14218367"
     CDS             join(388400..388415,388452..388621,388721..388813,
                     388859..388960)
                     /gene="trm112"
                     /locus_tag="SPAC31A2.02"
                     /codon_start=1
                     /product="putative protein and tRNA methyltransferase
                     regulatory subunit Trm112"
                     /protein_id="NP_592914.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.02.1"
                     /db_xref="GeneID:2541708"
                     /db_xref="GOA:Q09723"
                     /db_xref="InterPro:IPR005651"
                     /db_xref="PomBase:SPAC31A2.02"
                     /db_xref="PomBase:SPAC31A2.02.1"
                     /translation="MKLLTANFLNCSNKKCTSSPEAFPLDVVDAKLAIQQLELKPEFL
                     IGIMPRIDWNALLKTTRQLGNYSLPDEKPDLVDDSDEVLLKSLHNVLLETEITEGKMV
                     CGNCGHVYPIFEGIPNMLLSESEI"
     gene            389391..390520
                     /gene="mrpl11"
                     /locus_tag="SPAC31A2.03"
                     /db_xref="GeneID:2542402"
     mRNA            join(389391..389564,389617..390520)
                     /gene="mrpl11"
                     /locus_tag="SPAC31A2.03"
                     /product="putative mitochondrial ribosomal protein subunit
                     L11"
                     /transcript_id="NM_001018316.2"
                     /db_xref="GeneID:2542402"
     CDS             join(389543..389564,389617..390245)
                     /gene="mrpl11"
                     /locus_tag="SPAC31A2.03"
                     /codon_start=1
                     /product="putative mitochondrial ribosomal protein subunit
                     L11"
                     /protein_id="NP_592915.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.03.1"
                     /db_xref="GeneID:2542402"
                     /db_xref="GOA:Q09724"
                     /db_xref="PomBase:SPAC31A2.03"
                     /db_xref="PomBase:SPAC31A2.03.1"
                     /translation="MRCSVAVRASSIYVKNPQLRKSFLHSNYVQLIQESPNFLILQHN
                     NLLPREAKSLRTELKAKVPGSKLQVIRGSIFHHALKVYESIDRLSNGCVDMQKVNLIE
                     THKKAQKIKLDIDNLFVGPLAIFTLGPKLSPEAIRGFMSVLKGYQNKILLLGIRAESK
                     GMDPFEVENLSKIPSLEFLQSSLLSVLSSPASQLRRILDLSKANVAYTLERREPSE"
     gene            complement(390407..391260)
                     /locus_tag="SPAC31A2.04c"
                     /db_xref="GeneID:2543122"
     mRNA            complement(390407..391260)
                     /locus_tag="SPAC31A2.04c"
                     /product="putative proteasome core particle subunit beta
                     4"
                     /transcript_id="NM_001018317.2"
                     /db_xref="GeneID:2543122"
     CDS             complement(390589..391173)
                     /locus_tag="SPAC31A2.04c"
                     /EC_number="3.4.25.1"
                     /codon_start=1
                     /product="putative proteasome core particle subunit beta
                     4"
                     /protein_id="NP_592916.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.04c.1"
                     /db_xref="GeneID:2543122"
                     /db_xref="GOA:Q09720"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="PomBase:SPAC31A2.04c"
                     /db_xref="PomBase:SPAC31A2.04c.1"
                     /translation="MESLLAVQGQDFVLTASSSSAVRGITVLKPDDDKSQILNSHNLM
                     LYCGEAGDTTNFAEYIAANISLYTLRHNLNLSPEATASFTRKQLATSLRSRKPYQVNI
                     LLAGYETNLGKPELFWLDYLATCVRVPYACQGYSSFYCLSIFDRYYKPDLTIDEAVRI
                     MKLCFDELKKRMPIDFKGFICKVVDKDGIREINI"
     gene            complement(391628..396999)
                     /gene="mis4"
                     /locus_tag="SPAC31A2.05c"
                     /db_xref="GeneID:2542657"
     mRNA            complement(join(391628..391915,391956..392612,
                     392652..392787,392828..394611,394656..395123,
                     395167..396502,396546..396741,396781..396999))
                     /gene="mis4"
                     /locus_tag="SPAC31A2.05c"
                     /product="adherin Mis4"
                     /transcript_id="NM_001018318.2"
                     /db_xref="GeneID:2542657"
     CDS             complement(join(391838..391915,391956..392612,
                     392652..392787,392828..394611,394656..395123,
                     395167..396502,396546..396741,396781..396889))
                     /gene="mis4"
                     /locus_tag="SPAC31A2.05c"
                     /codon_start=1
                     /product="adherin Mis4"
                     /protein_id="NP_592917.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.05c.1"
                     /db_xref="GeneID:2542657"
                     /db_xref="GOA:Q09725"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024986"
                     /db_xref="InterPro:IPR026003"
                     /db_xref="PomBase:SPAC31A2.05c"
                     /db_xref="PomBase:SPAC31A2.05c.1"
                     /translation="MLFEMTPETFKKVNSSNRIIKGLQYTPLASSIPLENGLQNVLYP
                     SSKFQNEPLQLNSEESSIMQRYVDMLNPGATFVNDSETFNFYKNALSAMITEPAMPAM
                     RVNASPVLDQKVCNSDSLSELNDFTKSLIQPSMLMCEPKEKPDASSINTNRSSSDNGF
                     LTPSSSPRSPSCSRVFNAVQLCSPKKSKDDITTPKKRLMEDTYSPRESPSKIQRLQDV
                     LLKQLQDTRLLISQVIEAENSEDFSSNSLFIKREDDDGKHISSHAIEKLYMALTKLSR
                     LGACDKLLEEGSIILVKQILEKELKELPVACYSIINLHDSLTQFPNLDFILKTTALVL
                     FIIFLVPSFKKLQNEESILHLLNILHSIFEYTVPEAIDNIVQSKTSDARTSEIQHLSV
                     LLQKVANVLNILSKVAHEIPLSEAVVIRIVYLFPKVSTLDNSFKTKLPNCNSSSFDFL
                     KAPLFQTLQYLFRLYPYQRDFIIEESLTNFSHLPTARSVSRTYRLSNGKSIQYYSTLF
                     VRLIQSCSIQNLFDSEIVQSESKSTEALHSGNLTEHLKTVESILSKSRHEEYRIANHI
                     VAYLLSRSLKQNKTESDNSFAILTKILLEDLLNMLSLPEWCGTETIIRQFAMNLVMTV
                     TNDKQAVSSKNAALDLISLIVNKVLALFDLSLFEKHNIPAPTNFNDIISFIPSITRLN
                     ELSQVSFNHFYFLCKGDISLENILPYNYNKWFSFLLQLRKVCNDSEALKIIDNCIDKN
                     MQKSQEGFQGPSPFKADENDEDIFIISLYHSSLFLNLKFFVSLIIGFLDSPQASLRTK
                     CLRIINQMKTIPSILRTHPEVLAQIISKSNDQSAIVRDTVLDLLGTYIMAYRETIPQI
                     YGCIISGISDPSTIVRKRAIKQLCEVYEATEDLNIRVDIASKLLTRSNDEEETISELS
                     LEVLEKLWFSPASNELDCQKGYEQLTFLEKQKLRVQYFPILKLCAEPSTERHVLLVTS
                     LKTMLTSKEEINLSTLHTQIRLLLSCLFNQLIEVVTEDQVDESTKGILYEIMSTLFVF
                     SRAFPFLFDLSYLHLLKPYLRSASTIEEQRFLYYVVAIFRQVLPFQKEISESFLRSLE
                     SVLLQRLTKAGTATLMEIVPCLCSLFTRLNDYERLKKIVVSCLKSLEEARHSENNFQK
                     MVRLIDLIGLFSRYGDLNRINDDWKHSLDFISPECDDAYVILLGYFQKLLKDAKGQLR
                     IHIIDNMSRICLRETSLFISPLMLSTLDMIIAENNVNEVSVLFKSFLELLAADEDLIF
                     EADQKLSLKGKQNVQSNKSVDRDMLKGTKDKQWIEGVSASLMQHFLPCILDSCFSKNL
                     RYSMLGIEILKCIIHQGLVNPRMCFSTIIALESNAIKETREVAILLHTELHRRHESLI
                     DGLYAQSADLIFSLQKTEEYQTFKLGEFSPFQSAYTIVSADKSSKSRKKLIMQILKPL
                     KLDGIDLPSFTEEKVSFVSFCCVCLAGIPYVSIEEPLMIISTVDSVLATIGPTITGWM
                     KKLDHERFKILAGINLCNLIYLKRYIKYAFSISDSSRPIREKKPLTLLNRGYVDLITS
                     DAKPDIVSKLVIKLFEEENILSGEDQVEGEQLTVV"
     repeat_region   complement(397023..397370)
                     /rpt_type=long_terminal_repeat
     gene            397426..402487
                     /gene="atp25"
                     /locus_tag="SPAC31A2.06"
                     /db_xref="GeneID:2542929"
     mRNA            397426..402487
                     /gene="atp25"
                     /locus_tag="SPAC31A2.06"
                     /product="putative ATP synthase complex assembly protein
                     atp25"
                     /transcript_id="NM_001018319.2"
                     /db_xref="GeneID:2542929"
     CDS             397709..399337
                     /gene="atp25"
                     /locus_tag="SPAC31A2.06"
                     /codon_start=1
                     /product="putative ATP synthase complex assembly protein
                     atp25"
                     /protein_id="NP_592918.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.06.1"
                     /db_xref="GeneID:2542929"
                     /db_xref="GOA:Q09726"
                     /db_xref="InterPro:IPR025656"
                     /db_xref="PomBase:SPAC31A2.06"
                     /db_xref="PomBase:SPAC31A2.06.1"
                     /translation="MPTYRFNYLRFNKLCVSFFRSKFDKRPFASQKFPENLVPDNSSN
                     DANSQPEEVSSKKPWYVDEKHNLFPKKAHFDAVALPPIPKGAPNFLADVLNLLKKKYY
                     ATDLSFVNSPADSFWCDSDLILLASCNCGSEVVSATNGLLRLLKQKNVGPVNVDGLTS
                     ASRRKILERRMRKRSNLSNRQLNTSENNWTCLSIENFGISIHVITKNFREYYKLDNIE
                     HVKDETLYSDLEHGKQSRVSLTSKSTPDNSLPPNFINNHSNVFRRSFHTCNFSLKSAA
                     SLYCDTQDILLNVNSQNLTSTLEKYKKMHLQNPNNFSLDFTLSIFERLRKDSSLQLTT
                     KDINTLFSTIALSPTKLSMASKHSKNLVSERMLYLSLMYKSLVDLKTIDSFSLKLLFL
                     KFMICSCMVKGESNFFLDNRIFLLERIMNRYGIPMTIDTFLLMQFILAKSNRWSEVWR
                     RWDNLRKAGVVFNERLYNHVYLLAFESKNERVINYVLTNIFEDMVSQSPPIPASKLMA
                     TSLKKCVQSLPEKYAHSFPSVRNYIAKMENSMTH"
     gene            complement(399462..402266)
                     /gene="dbp10"
                     /locus_tag="SPAC31A2.07c"
                     /db_xref="GeneID:2543197"
     mRNA            complement(join(399462..401871,401972..402266))
                     /gene="dbp10"
                     /locus_tag="SPAC31A2.07c"
                     /product="putative ATP-dependent RNA helicase Dbp10"
                     /transcript_id="NM_001018320.2"
                     /db_xref="GeneID:2543197"
     CDS             complement(join(399548..401871,401972..402194))
                     /gene="dbp10"
                     /locus_tag="SPAC31A2.07c"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase Dbp10"
                     /protein_id="NP_592919.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.07c.1"
                     /db_xref="GeneID:2543197"
                     /db_xref="GOA:Q09719"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012541"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC31A2.07c"
                     /db_xref="PomBase:SPAC31A2.07c.1"
                     /translation="MSGFQTSDEVDISNSLKAFPVDIATDNQKDKHENVGENVSDEDD
                     GNYIASKLLESNRRTKGKKGNGKASNFQSMGLNQTLLRAIFKKGFKAPTPIQRKTIPL
                     LLEGRDVVGMARTGSGKTAAFVIPMIEHLKSTLANSNTRALILSPNRELALQTVKVVK
                     DFSKGTDLRSVAIVGGVSLEEQFSLLSGKPDIVVATPGRFLHLKVEMKLELSSIEYVV
                     FDEADRLFEMGFAAQLTEILHALPTSRQTLLFSATLPRTLVDFAKAGLQDPVLVRLDV
                     ESKVSADLQSAFFSVKTAEREAALLCILQDIIKLPLKDNVRPREIGNVNNPKKRKRAL
                     ELALKGSESGSPDSTLVFVPTKHHVEYVSELLVQAGYSVSKIYGSLDQEARLNEINNF
                     RLGKTNLLVVTDVASRGIDIPLLANVINYDFPPQPKVFVHRVGRTARAGRTGWAYSLV
                     RAEDAGYLLDLQLFLNRPLVTSSKQVKTDSDCDFTKQIVLGSLPQELVAELLEWVQRI
                     VSRDVELQQLSNVAARGEKLYFRTRATCSAESAKRAKELVDSKGWSSNNPLFGDVSVI
                     EAEEKYAELLSKVSSYRPSETVFEIGQRGHLKTEAAEIMRKRRNKVKPKGIKSEVASD
                     KITDSSPGNMSEASESELEEVFKNPKELSKKKTTDFKDKEYYMSHYAPKESIQETGYA
                     INSGENFTTAARHAILDLTNDEGIEQSRKGGQRWDPKKKKFVNIINDEDGSKGSPKII
                     RGESGVKLPATYRSGRFDEWKASKAFGANDSPIRENKRYKHNKLQTPKPADKFRDNYH
                     KQNKRNREAKERGIGIKVNSELKSAVEIRKARELKEKRLAKNNRPSKKHR"
     repeat_region   402409..402782
                     /rpt_type=long_terminal_repeat
     gene            complement(402719..405389)
                     /gene="apm4"
                     /locus_tag="SPAC31A2.09c"
                     /db_xref="GeneID:2541527"
     mRNA            complement(join(402719..405079,405138..405202,
                     405241..405389))
                     /gene="apm4"
                     /locus_tag="SPAC31A2.09c"
                     /product="putative AP-2 adaptor complex subunit Apm4"
                     /transcript_id="NM_001018322.2"
                     /db_xref="GeneID:2541527"
     gene            402841..403862
                     /gene="mrp20"
                     /locus_tag="SPAC31A2.08"
                     /db_xref="GeneID:2543038"
     mRNA            402841..403862
                     /gene="mrp20"
                     /locus_tag="SPAC31A2.08"
                     /product="putative mitochondrial ribosomal protein subunit
                     L23"
                     /transcript_id="NM_001018321.2"
                     /db_xref="GeneID:2543038"
     CDS             403060..403545
                     /gene="mrp20"
                     /locus_tag="SPAC31A2.08"
                     /codon_start=1
                     /product="putative mitochondrial ribosomal protein subunit
                     L23"
                     /protein_id="NP_592920.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.08"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.08.1"
                     /db_xref="GeneID:2543038"
                     /db_xref="GOA:Q09727"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="PomBase:SPAC31A2.08"
                     /db_xref="PomBase:SPAC31A2.08.1"
                     /translation="MSKIAGKRLVYFPNITFTLCRGLNLQPKFAVFRVPLHVNKFDVR
                     DYLQHVYNLKVVSVKSRIYQGKLFRNQLGQVKRPQSEKRVIVEMEEPFVYPNAPNDLK
                     DWQEGELLPDGSNVKTLSRYPKVLEQVDMKRVNEELSKLQDKQILESQQKIARLLKKK
                     Y"
     CDS             complement(join(403813..405079,405138..405202,
                     405241..405249))
                     /gene="apm4"
                     /locus_tag="SPAC31A2.09c"
                     /codon_start=1
                     /product="putative AP-2 adaptor complex subunit Apm4"
                     /protein_id="NP_592921.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.09c"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.09c.1"
                     /db_xref="GeneID:2541527"
                     /db_xref="GOA:Q09718"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="PomBase:SPAC31A2.09c"
                     /db_xref="PomBase:SPAC31A2.09c.1"
                     /translation="MISGLFIFNLKGDTLICKTFRHDLKKSVTEIFRVAILTNTDYRH
                     PIVSIGSSTYIYTKHEDLYVVAITKGNPNVMIVLEFLESLIQDLTHYFGKLNENTVKD
                     NVSFIFELLDEMIDYGIIQTTEPDALARSVSITAVKKKGNALSLKRSHSSQLAHTTSS
                     EIPGSVPWRRAGIKYRKNSIYIDIVERMNLLISSTGNVLRSDVSGVVKMRAMLSGMPE
                     CQFGLNDKLDFKLKQSESKSKSNNSRNPSSVNGGFVILEDCQFHQCVRLPEFENEHRI
                     TFIPPDGEVELMSYRSHENINIPFRIVPIVEQLSKQKIIYRISIRADYPHKLSSSLNF
                     RIPVPTNVVKANPRVNRGKAGYEPSENIINWKIPRFLGETELIFYAEVELSNTTNQQI
                     WAKPPISLDFNILMFTSSGLHVQYLRVSEPSNSKYKSIKWVRYSTRAGTCEIRI"
     gene            405582..407710
                     /locus_tag="SPAC31A2.10"
                     /db_xref="GeneID:2543083"
     mRNA            join(405582..405924,405964..406032,406134..406168,
                     406268..406460,406503..407710)
                     /locus_tag="SPAC31A2.10"
                     /product="putative Ran GTPase binding protein"
                     /transcript_id="NM_001018323.2"
                     /db_xref="GeneID:2543083"
     CDS             join(405802..405924,405964..406032,406134..406168,
                     406268..406460,406503..407465)
                     /locus_tag="SPAC31A2.10"
                     /codon_start=1
                     /product="putative Ran GTPase binding protein"
                     /protein_id="NP_592922.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.10.1"
                     /db_xref="GeneID:2543083"
                     /db_xref="GOA:Q09721"
                     /db_xref="InterPro:IPR008812"
                     /db_xref="PomBase:SPAC31A2.10"
                     /db_xref="PomBase:SPAC31A2.10.1"
                     /translation="MDQVLSKVTTTAATYATAYAVRTGLQLAGSLVAKRFSKYIQTSA
                     PKSSQFNLELVKSRLEQKIQAITPAVDLIQLVAARGNSSLQNLVPLIIRLRDHIDDFL
                     EFIDYEASGSEKKSPEKADEASEKIFRRCEVLLREIEETIPLINLSLTTAGITLNTAL
                     SNTISPSRLLQAQCFLELSDKRFEESHTEIQIGPKFTVVLYTSFSQPSKSDGPLDVRW
                     QETFAKSDLYIKRVVSASQKFSYVICIDEDLNDGRYHEETVGKPTSAPVFGKKLEISL
                     QRMSLLCYTVSGRLLNISQAKSPVLALQLTSIKDVSALDKAHQDNSEDLNNPFIKNND
                     KTKFHQNIDWIALEKYFEVNALDISDSESEDLSDILSDSEFSIGNRNKNIGNNEYSAQ
                     ISSDPAEEEIANAMHSLKLEPETSIYLTNPGSLSLLEYLLRLCSLQELHQISCLEMTD
                     SQLAAMLNSN"
     gene            complement(407714..409872)
                     /gene="cuf1"
                     /locus_tag="SPAC31A2.11c"
                     /db_xref="GeneID:2543198"
     mRNA            complement(407714..409872)
                     /gene="cuf1"
                     /locus_tag="SPAC31A2.11c"
                     /product="Cu-sensing transcription factor Cuf1"
                     /transcript_id="NM_001018324.2"
                     /db_xref="GeneID:2543198"
     CDS             complement(408030..409265)
                     /gene="cuf1"
                     /locus_tag="SPAC31A2.11c"
                     /codon_start=1
                     /product="Cu-sensing transcription factor Cuf1"
                     /protein_id="NP_592923.1"
                     /db_xref="GeneID:2543198"
                     /db_xref="GOA:Q09728"
                     /db_xref="InterPro:IPR001083"
                     /translation="MVVINNVKMACMKCIRGHRSSTCKHNDRELFPIRPKGRPISQCE
                     KCRIARITRHLHVKCTCNSRKKGSKCSTSSTTDLDSSSASNSSCSIPSSISEKLLPRD
                     NVKTHCPKRSASCCGKKPDVMPLKINLESQTDFMGMPLQSQRPHSESYRMLPEPEKFK
                     SEYGYPSQFLPIEKLTSNVAYPPNYNNYLKSPYQQPTNFPPEIQYNYSHSPQHSIQEA
                     EEAAVYGPPVYRSGYQILYNNNTDSIAAAAATHDLYPQPDVPLTFAMLADGNYVPLPS
                     STNTYGPSNSYGYEININESTNHVDSSYLPHPIQLSNYFTLPSSCAQADAACQCGDNC
                     ECLGCLTHPNNATTLAALNHISALEKETISHTDLHHTFKHEVNSSNNYELTNDELAAS
                     SPLYTSSSVPPSHITTGST"
     gene            411651..414448
                     /locus_tag="SPAC31A2.12"
                     /db_xref="GeneID:2542940"
     mRNA            411651..414448
                     /locus_tag="SPAC31A2.12"
                     /product="putative arrestin/PY protein 1"
                     /transcript_id="NM_001018325.2"
                     /db_xref="GeneID:2542940"
     CDS             412084..413874
                     /locus_tag="SPAC31A2.12"
                     /codon_start=1
                     /product="putative arrestin/PY protein 1"
                     /protein_id="NP_592924.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.12"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.12.1"
                     /db_xref="GeneID:2542940"
                     /db_xref="GOA:Q09729"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="PomBase:SPAC31A2.12"
                     /db_xref="PomBase:SPAC31A2.12.1"
                     /translation="MNILSRKENVASYFDIRVAAEHDLIVIQGLADSAEPTPLSGSVV
                     LCLNEAISVKAISLKLVGKCRISWSEPSPTVRGGQRHNKQEYVVYEKNWIFVPYTGAN
                     RTLRAGNYEYPFHVMLPGDIAESVEGLQSCYVVYRLKASIDRTGLASKMVKKKHIRLI
                     RALPADAIEYTQTISVDNTWPNKIEYTISVPTKAYAIGSYIPIHFVLVPLLKRLTIGK
                     ISITLKEYITLHVAHGYNGLPASKDEVRTVRSLQTEELEEFSDHYELTKNLELPSSLV
                     ECLQDCDLDGIKIRHKLKFSVSLRNPDGHISELRAALPVVLMIPPQLFGDRAEVESLR
                     ENFESFNQPLPSYQNSMYDRLYDGLSYSNLDTPLPSGATTPRRRDSMEPTYASNEAHR
                     RQLIAGLTELALQQQPQGRSPNEHSPSNHPEDFPPSFSLGSNPSSGAASAVITRNPSE
                     TSLADLSRVPSYKEATRSAVPLESPLQSTLPSYEDVARIEHLSRPPSPGIVTPPQRTS
                     PSFFVSPTESTRQSLDSRRSFEHSTSSSSGISPSHSSASLAHLSQASNPNGSSSAPHR
                     PTSARVGSHRNALDALRRARMLPSGFSRRN"
     gene            complement(414245..414930)
                     /gene="sft1"
                     /locus_tag="SPAC31A2.13c"
                     /db_xref="GeneID:2542585"
     mRNA            complement(join(414245..414629,414684..414930))
                     /gene="sft1"
                     /locus_tag="SPAC31A2.13c"
                     /product="putative SNARE protein Sft1"
                     /transcript_id="NM_001018326.2"
                     /db_xref="GeneID:2542585"
     CDS             complement(join(414471..414629,414684..414800))
                     /gene="sft1"
                     /locus_tag="SPAC31A2.13c"
                     /codon_start=1
                     /product="putative SNARE protein Sft1"
                     /protein_id="NP_592925.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.13c"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.13c.1"
                     /db_xref="GeneID:2542585"
                     /db_xref="GOA:Q09730"
                     /db_xref="PomBase:SPAC31A2.13c"
                     /db_xref="PomBase:SPAC31A2.13c.1"
                     /translation="MNDQNERRLETLSGQVSSLKNVTYDIYSRANDYTRIDRATESFS
                     GLSNSVKKSTENFFRVVRSAGRRRIMTMVLAIVGSILIIYYASKWFF"
     gene            414942..418504
                     /gene="bun107"
                     /locus_tag="SPAC31A2.14"
                     /gene_synonym="wdr48"
                     /db_xref="GeneID:2543160"
     mRNA            join(414942..415685,415763..418504)
                     /gene="bun107"
                     /locus_tag="SPAC31A2.14"
                     /gene_synonym="wdr48"
                     /product="WD repeat-containing protein"
                     /transcript_id="NM_001018327.2"
                     /db_xref="GeneID:2543160"
     CDS             join(415406..415685,415763..418371)
                     /gene="bun107"
                     /locus_tag="SPAC31A2.14"
                     /gene_synonym="wdr48"
                     /codon_start=1
                     /product="WD repeat-containing protein"
                     /protein_id="NP_592926.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.14"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.14.1"
                     /db_xref="GeneID:2543160"
                     /db_xref="GOA:Q09731"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR021772"
                     /db_xref="PomBase:SPAC31A2.14"
                     /db_xref="PomBase:SPAC31A2.14.1"
                     /translation="MSVRKRYKVTYVLDSCNDQLGHRLDANCLVLGRYFSEQGSAPVT
                     RALYSGGRDGQLFGWDIGYDYGKASQPLAKIQAHSAWVNDIALTHDSEGVISCSSDST
                     VKLWKPHVLNASCLSTIGEHTDYVKRVSIPKYSKSPLVASGGLDKRIIVWDYNVGQEV
                     MRFEQLPDCSLVVGPRSGVYSLAANNNIIANGGLQKDIQLWDCVSKKRITDLVGHTDN
                     VRDILISDDGRTILTASSDATIKLWSLRAQKCLFSFIAHSDSVWALYSEHPDLKVFYA
                     GDRSGLITRTDIRNQPNNQSCTAICKQDAPVSDIVARQSFIWSTSRDGSILRWKDEPL
                     FNQDVGAALSKHTSSHLSVSSDCPSRHSSDIRNHSCPTLYHDDAEDIYYDLHHTESYS
                     NINLTKTPDYVIHGGIGLLKYRMLGDRRHVLTEDAVGNKCLWDILACKQAGEFDKSED
                     FEKIVQSLDTVQAIPRWASVNCLLGILAVTLDENHYMDAEIYADECPLLKVDSPSDKR
                     INLGVWILKNLFREFIDAELHRDLKFRQNLDVVRSEAKKQIEAQREEARKGNVNMPSA
                     LSPLRIRSRPSPLSLPPEPLLSPTIDYSATPFPLEPPPESPGPSLQIPSNNPVYTNLT
                     DTDSMMGAPDYFSIPARQNRNRKPHTEVVGSPTVVRTKEIIPPKVTREGSFMGRLKKL
                     GRSKSSKSLQTDFMKASVERAASSRVFSTGTSVTSPQALSKTNNTVNNAANTENNTLA
                     KDKQQTSEASSPGTPRELKTTGELIEDLHEQYVHFKDKDTVLSLMKPPNDDTFPMLNL
                     SSQITVIISEESPEAGNSRDIYRSTLENMADDIDLLENIMPFWLGRLLLLNEFPSKTA
                     PTVNFTLQPFPGSGLPLIVNENTRLSASAMLRAQKIMDYSYSKLSQQRKDVSSLQFRC
                     KDVVVTPKMTLATVKARIWRSGDDVVFHYDVAPRSVSEIVDKTQSLNI"
     gene            complement(417823..419996)
                     /gene="dcc1"
                     /locus_tag="SPAC31A2.15c"
                     /db_xref="GeneID:2543078"
     mRNA            complement(join(417823..418720,418759..419220,
                     419268..419502,419602..419996))
                     /gene="dcc1"
                     /locus_tag="SPAC31A2.15c"
                     /product="Ctf18 RFC-like complex subunit Dcc1"
                     /transcript_id="NM_001018328.2"
                     /db_xref="GeneID:2543078"
     CDS             complement(join(418475..418720,418759..419220,
                     419268..419502,419602..419732))
                     /gene="dcc1"
                     /locus_tag="SPAC31A2.15c"
                     /codon_start=1
                     /product="Ctf18 RFC-like complex subunit Dcc1"
                     /protein_id="NP_592927.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.15c"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.15c.1"
                     /db_xref="GeneID:2543078"
                     /db_xref="GOA:Q09732"
                     /db_xref="InterPro:IPR019128"
                     /db_xref="PomBase:SPAC31A2.15c"
                     /db_xref="PomBase:SPAC31A2.15c.1"
                     /translation="MEANEERCILLKYPHPSSDISSEYLLLELDDDLLKTLEENPEEE
                     IVFKSDFDKKASVLCTSDKTYAVRQVVQSNSYLLFDELSPTDWVLNDTCYSFLEVERI
                     YGFIFSDDKISYWDEDSVELKPISLTKDQFIRSVPASRNEVDSFLQKNFFMVKNEFLY
                     RLSPSYICSIIDWIFVIAQQLHIDFASFEFKILKKPAMDDEFDWDSVICVLESISSPI
                     KDNVLPKKFNIDLELTTFWYGRFLLEGINSISSDEFIQLWDNRLPYPCKGLPSLNLLK
                     GYYFHDTPNTIQYLSGDQLPREPSRRFQSLFQLKSKWLYEELWSFVKDLALSKSRVEA
                     LILKYGRKQTSRDGVYINSRGTW"
     gene            419958..423991
                     /gene="gef2"
                     /locus_tag="SPAC31A2.16"
                     /db_xref="GeneID:2543168"
     mRNA            join(419958..422887,422926..423153,423199..423307,
                     423357..423991)
                     /gene="gef2"
                     /locus_tag="SPAC31A2.16"
                     /product="RhoGEF Gef2"
                     /transcript_id="NM_001018329.2"
                     /db_xref="GeneID:2543168"
     CDS             join(420466..422887,422926..423153,423199..423307,
                     423357..423903)
                     /gene="gef2"
                     /locus_tag="SPAC31A2.16"
                     /codon_start=1
                     /product="RhoGEF Gef2"
                     /protein_id="NP_592928.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC31A2.16"
                     /db_xref="EnsemblGenomes-Tr:SPAC31A2.16.1"
                     /db_xref="GeneID:2543168"
                     /db_xref="GOA:Q09733"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR001331"
                     /db_xref="PomBase:SPAC31A2.16"
                     /db_xref="PomBase:SPAC31A2.16.1"
                     /translation="MDVGTMGSRAELLAISIQFGGLWVFRDLLQMNPLFEQDHVFCTF
                     NHPNMGLVLISFAKVDGHILAAYALSKLGPDTFSICYPFSSKLDAFAQTLDLEWQIAS
                     MHKEAAACVYEFLCVESVCLHTGENWRESVIEPEYASYIFDTINVFQSSSLTRELYSL
                     GEPNGVREFVVDAIFDIKVDNSWWEDPSNSYWKTVIGSREMFEDSRKKTSSPSPSFAS
                     SKDAGTIPAIQKKKSLLIEMMETESTYVERLRHLVNDYALPLRDLAKSSKKLLGLYEL
                     NTLFPPCLNKLIQLNSAFLDEFEAIMSDLNFEDIDEKKFEEIDLRLACCFESHFFAFS
                     QHYPRYLEQSNDFGNVLKMASKIPKFVEFHDQVKLNANMNVGLSQLIMEPVQRIPRYS
                     LFLDQIILLTQEGECQHTYVRSVEIIKNIAEMPTVDAEERSRIFAGLQHIIPDLAPNM
                     ISNSRNFIDCIDVTREFLKNGQLHLIPYTLILFNDRICLVQRRSKSSIASTILDLRKQ
                     NPRNSYSKEKRAQYIGSNMNEAVELTRSMVEENTIFLISKYASSPSFFNEYPILKFRC
                     DFENVRTMDRFYQSFQKALSMNKSQPSCLSFSKLNDFVVFFNNYSRFEYEKESKRSDI
                     VCICTNDANVDKHKFLQDGNIVITFFQQDEDFHLSFDSWLGVSLPTEAVIAKEDLREA
                     CLNYLINIKRLLLCPFSNRNFSSLDLYSNLIQHLLSANSSPRKSRLSFGGRPGSPSKI
                     SLSLNRFYNQGGLSKSCATLPSQMYNLDHNNISQKSLKFNTHNTSKASAEKTVEHLEA
                     FKGGFKYHTDLKNLLYPLSEKEKIEGDELYDNILKETFNEELLSHYPPNIIYATFQKY
                     LSSFINRKFGVLLSSSFIQQLNTVENLNLSFNSTDAVYHLKKILQDLPESSLKILENI
                     FSIASDLLLRLPLKDQCDFVTKQLAIALAPSMFGSNAVELVYYLAYHSDRIFGTVEEL
                     PTPVSPANSNNDKQLDESKFQAIAMKEMPERHPKEILPGQIEREAYEDLRRKYHLTLA
                     RLAQMTRLNEDSKKSIPLLYDRFNHDLKLIKQSVQASLIRKQCELDTAKWTLEEYESK
                     LNAKEGCQTNIFI"
     gene            complement(423926..425256)
                     /locus_tag="SPAC13C5.01c"
                     /db_xref="GeneID:3361518"
     mRNA            complement(423926..425256)
                     /locus_tag="SPAC13C5.01c"
                     /product="putative proteasome core particle subunit alpha
                     3"
                     /transcript_id="NM_001355977.1"
                     /db_xref="GeneID:3361518"
     CDS             complement(424477..425223)
                     /locus_tag="SPAC13C5.01c"
                     /EC_number="3.4.25.1"
                     /codon_start=1
                     /product="putative proteasome core particle subunit alpha
                     3"
                     /protein_id="NP_001342794.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13C5.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC13C5.01c.1"
                     /db_xref="GeneID:3361518"
                     /db_xref="GOA:Q09682"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="PomBase:SPAC13C5.01c"
                     /db_xref="PomBase:SPAC13C5.01c.1"
                     /translation="MSRSYDSRTTIFSPEGRLYQVEYALEAINHAGVALGIVAKDGIV
                     LAAEKKVTSKLLEQEESAEKLYHIGDNMLCAVAGLTADANILINYARRVGQQYLQTFN
                     EEMPCEQLVRRVCDLKQGYTQYGGLRPFGVSFLYAGWDHIRGYQLFQSNPSGNYGSWQ
                     ANSIGGNSTSVQSLMRQEYKDDINLDEASAMAVKFLSKTLDSNSLTHEKIEFATITKD
                     TTKNKMVCKIWKSDEINEVLNKYQETQRQS"
     gene            425631..427415
                     /gene="dre4"
                     /locus_tag="SPAC13C5.02"
                     /db_xref="GeneID:2542176"
     mRNA            join(425631..426069,426106..426322,426364..427415)
                     /gene="dre4"
                     /locus_tag="SPAC13C5.02"
                     /product="splicing-associated factor Dre4"
                     /transcript_id="NM_001018331.2"
                     /db_xref="GeneID:2542176"
     CDS             join(426030..426069,426106..426322,426364..427342)
                     /gene="dre4"
                     /locus_tag="SPAC13C5.02"
                     /codon_start=1
                     /product="splicing-associated factor Dre4"
                     /protein_id="NP_592930.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13C5.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC13C5.02.1"
                     /db_xref="GeneID:2542176"
                     /db_xref="GOA:Q09685"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR002713"
                     /db_xref="PomBase:SPAC13C5.02"
                     /db_xref="PomBase:SPAC13C5.02.1"
                     /translation="MSQPLPPGWTEHKAPSGIPYYWNAELKKSTYQRPSFIEKNHSSS
                     VTASQASLAFNTSEKLFVNENAEERKNSRDLRKQLPDRPKFKKRIPNNDSWVVVFTKK
                     NRYFFHNLKSHESYWEPPLEISKDLKILRLPIRKQISKDSSQSQNVDSGKTNHEEIHE
                     SRHLQTEIEEPSGLEESSEESVLYSEEFYEKSDEEEDEEKSHSAEELEFGEEDIMYQL
                     QQLDDETVSYDIQEQATNLSTDDARRVFTELLKDKNIGAYQPWELVYPKLLDDDRFYV
                     LDSGERRKEVFEEYCKSVVSTKKITRRKNTLSDFWTLLHSLPSTLLWPQFKRKYRKSS
                     TLQIPGYSERDFEKLFREFQILRKQPMQDKLLNFKKLCKSKTVDPKNPDEFTESILND
                     TRYAVLTREELDSLACSSN"
     gene            427350..430121
                     /gene="tht1"
                     /locus_tag="SPAC13C5.03"
                     /db_xref="GeneID:2542365"
     mRNA            join(427350..427943,427986..428590,428653..430121)
                     /gene="tht1"
                     /locus_tag="SPAC13C5.03"
                     /product="nuclear membrane protein Tht1"
                     /transcript_id="NM_001018332.2"
                     /db_xref="GeneID:2542365"
     CDS             join(427583..427943,427986..428590,428653..429318)
                     /gene="tht1"
                     /locus_tag="SPAC13C5.03"
                     /codon_start=1
                     /product="nuclear membrane protein Tht1"
                     /protein_id="NP_592931.1"
                     /db_xref="GeneID:2542365"
                     /db_xref="GOA:Q09684"
                     /db_xref="InterPro:IPR007292"
                     /translation="MKYSNVAFSEGLAGFDSLAHVYQALLKKSTCYQEVAATLISKCS
                     LLNTELTIDNRIHSAIQMTLCDFERSQILAPSECVRGSQSECVSKLESTSTWWLSFTS
                     HFHDVNHLCRLANLEMQKELSIEVNMNVTLVQKQFLEMVILHLRNFESVTDKMNQRID
                     KFDGKFNSVIENSFKDINFRVNQEIMGLVELQNHQQEGMVQQKEILSTIKQLKSEIFD
                     INSFFANFIEESAGYSNSLIEKLNEKFTSENAIALSAIGKYTSEFSAFMEKRIKNLIT
                     TTEDSLQQSVQSNIDFVNSGFQPLYDLTIQLKEELQSLKRLSSEQQNLQHEQILQWKS
                     DFLNVSKDHLKVLQQLRPLIDIVEKFMNVYFKGLSNIISSFAFIGFTLFATLSSLFFK
                     VLKIHRRPIIVFGSLSIIFIHIYCFKITSWVNLYGWITCTIARTLSFIKLNIRTFYLT
                     AFLCALLNFLRYLKYRNSKKDTELSLFLPAPEECNIYHNEHIQVQEDNYLCPIENSLI
                     DLFGSENNKEKLGKQENVRFAFLNSESLEQSPWWD"
     gene            complement(429030..430050)
                     /locus_tag="SPNCRNA.644"
                     /db_xref="GeneID:14218360"
     misc_RNA        complement(429030..430050)
                     /locus_tag="SPNCRNA.644"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151008.1"
                     /db_xref="GeneID:14218360"
     gene            430056..431032
                     /locus_tag="SPAC13C5.04"
                     /db_xref="GeneID:2542450"
     mRNA            430056..431032
                     /locus_tag="SPAC13C5.04"
                     /product="putative amidotransferase"
                     /transcript_id="NM_001018333.2"
                     /db_xref="GeneID:2542450"
     gene            complement(430088..431033)
                     /locus_tag="SPNCRNA.645"
                     /db_xref="GeneID:14217870"
     misc_RNA        complement(430088..431033)
                     /locus_tag="SPNCRNA.645"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151009.1"
                     /db_xref="GeneID:14217870"
     CDS             430130..430876
                     /locus_tag="SPAC13C5.04"
                     /codon_start=1
                     /product="putative amidotransferase"
                     /protein_id="NP_592932.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13C5.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC13C5.04.1"
                     /db_xref="GeneID:2542450"
                     /db_xref="GOA:Q09686"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="PomBase:SPAC13C5.04"
                     /db_xref="PomBase:SPAC13C5.04.1"
                     /translation="MDYHIAILNADTPMVEITSAYGDYADMVKSLLQSGSEYYSTEWN
                     LVTKTYEVYKNPNDYPQKEDFPNINAIIITGSKASATSDAPWIKKLISFVKDVLFKYP
                     HIKIVGLCFGHQIVAKAAGVPIIQNPKGWEVSSTVVQLTENGEKFFGRKVININQMHQ
                     DMAVDVPEGFELLGSTEDCEFQIFYKPRQALTFQGHPEFSTEVVNTMVKVLRGTEVFT
                     EQQKEEALKRSENPADNDFLAVSIVKFLLE"
     gene            complement(431367..433274)
                     /locus_tag="SPAC13C5.05c"
                     /db_xref="GeneID:2542320"
     mRNA            complement(join(431367..432982,433028..433113,
                     433154..433274))
                     /locus_tag="SPAC13C5.05c"
                     /product="putative N-acetylglucosamine-phosphate mutase"
                     /transcript_id="NM_001018334.2"
                     /db_xref="GeneID:2542320"
     CDS             complement(join(431562..432982,433028..433113,
                     433154..433203))
                     /locus_tag="SPAC13C5.05c"
                     /EC_number="5.4.2.3"
                     /codon_start=1
                     /product="putative N-acetylglucosamine-phosphate mutase"
                     /protein_id="NP_592933.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13C5.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC13C5.05c.1"
                     /db_xref="GeneID:2542320"
                     /db_xref="GOA:Q09687"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="InterPro:IPR016657"
                     /db_xref="PomBase:SPAC13C5.05c"
                     /db_xref="PomBase:SPAC13C5.05c.1"
                     /translation="MTKNKKYSYGTAGFRTKASDLEAAVYSSGVAAALRSMELKGKTI
                     GVMITASHNPVEDNGVKIIDADGGMLAMEWEDKCTQLANAPSKAEFDFLIKQFLTPTT
                     CQPKVIIGYDTRPSSPRLAELLKVCLDEMSASYIDYGYITTPQLHWLVRLINKSTAAS
                     FLEEGPPITEYYDTLTSAFSKIDPSMQDSPTVSRVVVDCANGVGSQPLKTVAGLVKDS
                     LSIELVNTDVRASELLNNGCGADFVKTKQSPPLALEGKIKPNQLYASIDGDADRLIFY
                     YINQNRKFHLLDGDKISTALVGYLNILVKKSGMPFSLGVVQTAYANGASTEYLQDLGI
                     TTVFTPTGVKHLHKAAKEFDIGVYFEANGHGTVLFSDKALANLAHPFFTPSPVQAAAI
                     EQLQSYSVLINQAIGDAISDLLATISVLNALHWDASAWSNTYKDLPNKLAKVKVSDRT
                     IYKSTDAERRLVSPDGLQEKIDALVAKYEKGRSFVRASGTEDVVRVYAEASTKQAADE
                     LCEKVCQLVL"
     gene            complement(434102..435179)
                     /gene="mug121"
                     /locus_tag="SPAC13C5.06c"
                     /db_xref="GeneID:2542798"
     mRNA            complement(join(434102..434831,434876..435179))
                     /gene="mug121"
                     /locus_tag="SPAC13C5.06c"
                     /product="protein mug121"
                     /transcript_id="NM_001018335.2"
                     /db_xref="GeneID:2542798"
     gene            434104..434843
                     /gene="prl5"
                     /locus_tag="SPNCRNA.05"
                     /gene_synonym="prl05"
                     /db_xref="GeneID:5802857"
     misc_RNA        join(434104..434267,434338..434843)
                     /gene="prl5"
                     /locus_tag="SPNCRNA.05"
                     /gene_synonym="prl05"
                     /product="antisense RNA, poly(A)-bearing (predicted)"
                     /transcript_id="NR_149832.1"
                     /db_xref="GeneID:5802857"
     CDS             complement(join(434524..434831,434876..435101))
                     /gene="mug121"
                     /locus_tag="SPAC13C5.06c"
                     /codon_start=1
                     /product="protein mug121"
                     /protein_id="NP_592934.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13C5.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC13C5.06c.1"
                     /db_xref="GeneID:2542798"
                     /db_xref="GOA:Q09688"
                     /db_xref="PomBase:SPAC13C5.06c"
                     /db_xref="PomBase:SPAC13C5.06c.1"
                     /translation="MKGFVVISRFILTLFILITPGLAGVVNYAENSEWNVPKYGNVLD
                     SNCQGQKPVTFFGSVTEHVSNSWWIKLYDYMMTFISGEKLCMQNVAYEFEDISLCMDV
                     VGSKCIPTLQSTDIEKVVNSTSAYLENSESDLTLGCFQIQRFQEESTLYIRALKSSEP
                     VSCDTVRCIHFNHIPYV"
     gene            complement(435113..436058)
                     /locus_tag="SPNCRNA.646"
                     /db_xref="GeneID:14218293"
     misc_RNA        complement(435113..436058)
                     /locus_tag="SPNCRNA.646"
                     /product="intergenic RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_151010.1"
                     /db_xref="GeneID:14218293"
     gene            435170..439980
                     /gene="rad32"
                     /locus_tag="SPAC13C5.07"
                     /gene_synonym="mre11"
                     /db_xref="GeneID:2542757"
     mRNA            join(435170..436381,436430..436935,437006..437580,
                     437624..437807,437853..439980)
                     /gene="rad32"
                     /locus_tag="SPAC13C5.07"
                     /gene_synonym="mre11"
                     /product="Rad32 nuclease"
                     /transcript_id="NM_001018336.2"
                     /db_xref="GeneID:2542757"
     CDS             join(436214..436381,436430..436935,437006..437580,
                     437624..437807,437853..438369)
                     /gene="rad32"
                     /locus_tag="SPAC13C5.07"
                     /gene_synonym="mre11"
                     /codon_start=1
                     /product="Rad32 nuclease"
                     /protein_id="NP_592935.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13C5.07"
                     /db_xref="EnsemblGenomes-Tr:SPAC13C5.07.1"
                     /db_xref="GeneID:2542757"
                     /db_xref="GOA:Q09683"
                     /db_xref="InterPro:IPR003701"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007281"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="PDB:4FBK"
                     /db_xref="PDB:4FBQ"
                     /db_xref="PDB:4FBW"
                     /db_xref="PDB:4FCX"
                     /db_xref="PomBase:SPAC13C5.07"
                     /db_xref="PomBase:SPAC13C5.07.1"
                     /translation="MPNDPSDMNNELHNENTIRILISSDPHVGYGEKDPVRGNDSFVS
                     FNEILEIARERDVDMILLGGDIFHDNKPSRKALYQALRSLRLNCLGDKPCELELLSDT
                     SLTTGDTAVCNINYLDPNINVAIPVFSIHGNHDDPSGDGRYSALDILQVTGLVNYFGR
                     VPENDNIVVSPILLQKGFTKLALYGISNVRDERLYHSFRENKVKFLRPDLYRDEWFNL
                     LTVHQNHSAHTPTSYLPESFIQDFYDFVLWGHEHECLIDGSYNPTQKFTVVQPGSTIA
                     TSLSPGETAPKHCGILNITGKDFHLEKIRLRTVRPFIMKDIILSEVSSIPPMVENKKE
                     VLTYLISKVEEAITEANAQWYEAQGTVPVVENEKPPLPLIRLRVDYTGGYQTENPQRF
                     SNRFVGRVANATDVVQFYLKKKYTRSKRNDGLYTSAVEDIKINSLRVESLVNEYLKTN
                     RLECLPEDSLGEAVVNFVEKDDRDAIKECVETQLNKQINLLVKKRVTEENLEQEISSI
                     INDLPKISTTKRKDYEELPEEVSETSINIAEHTPVLKHTSSLLDHHSPLATSSSEHEM
                     EATPSPALLKKTNKRRELPSSLTKKNTRTPQRSKEVKKVPARKLSQSTKKSDKNTQST
                     LLFYDPSSTTEAQYLDNEDDEILDD"
     gene            complement(436953..438699)
                     /locus_tag="SPNCRNA.647"
                     /db_xref="GeneID:14218309"
     misc_RNA        complement(436953..438699)
                     /locus_tag="SPNCRNA.647"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151011.1"
                     /db_xref="GeneID:14218309"
     gene            complement(439141..440079)
                     /locus_tag="SPNCRNA.648"
                     /db_xref="GeneID:14218088"
     misc_RNA        complement(439141..440079)
                     /locus_tag="SPNCRNA.648"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151012.1"
                     /db_xref="GeneID:14218088"
     gene            442201..445721
                     /gene="fep1"
                     /locus_tag="SPAC23E2.01"
                     /gene_synonym="gaf2"
                     /db_xref="GeneID:2541522"
     mRNA            442201..445721
                     /gene="fep1"
                     /locus_tag="SPAC23E2.01"
                     /gene_synonym="gaf2"
                     /product="Fe-sensing transcription factor Fep1"
                     /transcript_id="NM_001018337.2"
                     /db_xref="GeneID:2541522"
     CDS             443569..445263
                     /gene="fep1"
                     /locus_tag="SPAC23E2.01"
                     /gene_synonym="gaf2"
                     /codon_start=1
                     /product="Fe-sensing transcription factor Fep1"
                     /protein_id="NP_592936.1"
                     /db_xref="GeneID:2541522"
                     /db_xref="GOA:Q10134"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /translation="MAAKPAPFGQSCSNCHKTTTSLWRRGPDNSLLCNACGLYQKHRK
                     HARPVKSEDLKDISPLIQQVCKNGTCAGDGFCNGTGGSASCTGCPALNNRIRSLNASK
                     SQSGRKSLSPNPSSVPSSTETKASPTPLESKPQIVSDTTTETSNGTSRRRSSHNQHED
                     SSPPHEPSVTFCQNCATTNTPLWRRDESGNPICNACGLYYKIHGVHRPVTMKKAIIKR
                     RKRLVFNGNANESQHNLKRMSSGDSGSSVKQQSTRDGPFSKSFPNGNGHASGNSGEGL
                     AEHGMNTGVLPPASTFPSYNSNFTGFLPSSFNPSPLMTLSRLAAGEPDNNGKVYYSYG
                     PTQEQSILPLPENKHEGLPPYQNEYVPNGIRANQVVYPGQLVAVGNDSSKQLSESTTS
                     NTDNNGVATANQSNPLGMKFHLPPILPVGESVCLPPRTSAKPRIAEGIASLLNPEEPP
                     SNSDKQPSMSNGPKSEVSPSQSQQAPLIQSSTSPVSLQFPPEVQGSNVDKRNYALNVL
                     SQLRSQHDLMIQELHNLNQHIQQIDEWLRSSDNENMASEHIKSSTPAVVASGALQT"
     gene            446000..446071
                     /locus_tag="SPATRNAVAL.01"
                     /db_xref="GeneID:3361513"
     tRNA            446000..446071
                     /locus_tag="SPATRNAVAL.01"
                     /product="tRNA-Val"
                     /db_xref="GeneID:3361513"
     repeat_region   446075..446342
                     /rpt_type=long_terminal_repeat
     gene            complement(446175..446702)
                     /locus_tag="SPNCRNA.649"
                     /db_xref="GeneID:14218037"
     misc_RNA        complement(446175..446702)
                     /locus_tag="SPNCRNA.649"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151013.1"
                     /db_xref="GeneID:14218037"
     gene            <446491..450726
                     /gene="lsd2"
                     /locus_tag="SPAC23E2.02"
                     /gene_synonym="saf140; swm2"
                     /db_xref="GeneID:2541832"
     mRNA            join(<446491..446513,446679..449241,449295..450726)
                     /gene="lsd2"
                     /locus_tag="SPAC23E2.02"
                     /gene_synonym="saf140; swm2"
                     /product="putative histone demethylase SWIRM2"
                     /transcript_id="NM_001018338.2"
                     /db_xref="GeneID:2541832"
     CDS             join(446491..446513,446679..449241,449295..450530)
                     /gene="lsd2"
                     /locus_tag="SPAC23E2.02"
                     /gene_synonym="saf140; swm2"
                     /codon_start=1
                     /product="putative histone demethylase SWIRM2"
                     /protein_id="NP_592937.1"
                     /db_xref="GeneID:2541832"
                     /db_xref="GOA:Q10135"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="InterPro:IPR011991"
                     /translation="MPLGRSSWICCAKYFVNTKSRFNEILPPRFTLIVSFYSMNTSEN
                     DPDGHYDFPEMTEHHSDRASSYANANNVNSTQPQLVSSEQALLAILGGGLQSITPNSV
                     NQNAYSRSTYRTDGGLNSQPVSSLNNQWGNYNPAFLPSRYDSSFHPYTISQAANQPFP
                     QHLLGNSNAGVAQQSGMRTIGLPPTVGSSFPQQKSSTYENFFDANSPSSQQFPSTYPS
                     RSQNPLSSSGDGSTAIHAGPIQHQNSNAFSNYPYPLDASHLSSQQLLSMYRDQVSHGV
                     TPSTFRNHESFMPTQLVSATELSKSVDNAVLPIPPTTAPAVVSPPASSFPLMSSAATS
                     GNISSPALFDSELGARPEGSVAIEPSRVLLQWSSQSSSHTIPSAGASIPTSSLKSFFE
                     HAAEAARKCNLDPRALESFEQHMLSDRLHDPVVLFHYFQIRNSICWLWIKNPTHAISR
                     VEAQGVCVDRCLFQLASLAYEFLVRYGYINYGCLSFDSSFTNETNTGTTSSSASKQKT
                     IAVVGAGLTGLICARQLTGLFSQYSSSFLSKNELPPKVIILEAKERTGGRIYSRALPV
                     SHTSATQINHHTSNSNSISSNSTSLNPKDVTDPSHIPSAIDLGFQFLFSPMDDILLNL
                     LNKQLGIEVTEMTGSDLVYDETDTKVLDMVEVKKLNILWEKLLEYVSVCFFINVEESV
                     RISWISQFQLFIDEMFPDHLSKSLSLNASHEFSFKKTMLILIDEVSSYAKLGNSQKKF
                     LIWCFKVAELDDTLYPLNTVDTDFSKDILIPKVARRGLSQLPWALQSYPSPLNIHYEK
                     FVSKVTIENDKCTLDCKDNSSYEVDQVVIACSPSHFSSNIEFSPGLPNFVTENIKSID
                     FKPGKKVILRYAAAFWRKNIRSFGIIPKSLSQEMNNDENDGKSCFVLRIWNMLPETGV
                     PILVADINPQMTSSSSNETSHLIQELHSLIVDHFQNDSNSSADLLDAWVTNWSRNGVY
                     DGLNSYPNFANDKQQYEKRFRQSQLSYNLGRLHIAGDYIFSCVGCRTLQRSFLSGLSV
                     CTGIIDSLAPISLTIPIIGETSRKELDQFLRNSKVNNFDPNAEAQRHLSYQARYRLKK
                     QERLDEHKEEQEQLVTELLGYLPEPPSKPNANPFLLYQKMQWHVCRALADEDKRRLTG
                     DSTAKATINETRAKLGKTWRQLDDLGKKPWIDEIAAQREAYAGKILRYQRLTKEYEMR
                     AEQIRNDYAAKCQDEPIPDDEARLFMQAQREEEQRKQTQDDNISKSREASDEEYHDDG
                     SSDSGYNGTRY"
     gene            complement(450860..453603)
                     /gene="ste7"
                     /locus_tag="SPAC23E2.03c"
                     /db_xref="GeneID:2541518"
     mRNA            complement(450860..453603)
                     /gene="ste7"
                     /locus_tag="SPAC23E2.03c"
                     /product="meiotic suppressor protein Ste7"
                     /transcript_id="NM_001018339.2"
                     /db_xref="GeneID:2541518"
     CDS             complement(451210..452919)
                     /gene="ste7"
                     /locus_tag="SPAC23E2.03c"
                     /codon_start=1
                     /product="meiotic suppressor protein Ste7"
                     /protein_id="NP_592938.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23E2.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23E2.03c.1"
                     /db_xref="GeneID:2541518"
                     /db_xref="GOA:Q10136"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="PomBase:SPAC23E2.03c"
                     /db_xref="PomBase:SPAC23E2.03c.1"
                     /translation="MFLEIILDSATYSFDRVITGKICFETNAATSPRSFQIQLRIKGY
                     AVYHHGFLSSPSHKHPTTASASDSDEATEIFTHSQPLPIPAGPSSKSHAIDFKFKFPS
                     KSASSLPCSKSNDSMVNICYMLKATISKRYAFLGSSQSAKAELIMVPPNLAGKPLSAN
                     SSFGSSAKTFQLPEFDSVTPSASLYKQPSFNSNPAPITTSSATHTSQFSTSSSSSVNS
                     VHTPVMVPNPYFQYNSSMTAPSSSSSSVAPFVPRRQFSVSSASDPPQTPISMSPPIPP
                     TPSQFSAFMYQNQQSYLSPQSHYENPLSISSRPSPCCPSTPSSAVTLSNGFDSQSNAY
                     NNSGTGPPMLYKFPQRSYTAPNTSFNSQRRMSSITSLPTASFCPVKHGVSPPSLAGNQ
                     PSPLSSPLTNSNVSPSTICSPDNNVTFVNLAPGEKLTFKIEPNDLMDEEEVVENSNMY
                     SIPGKTVATTVCHSSSSSGDFSALSCHRNLSFSESLPTAEDQVHNNHCAVSPSRRSSS
                     NALYLATLPMGYERSNSVSYCSDSSLSSPLPDDNMLQDPHALNMAYAKEFDVLINEVL
                     QSL"
     gene            453735..455859
                     /locus_tag="SPNCRNA.650"
                     /db_xref="GeneID:14218350"
     misc_RNA        453735..455859
                     /locus_tag="SPNCRNA.650"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151014.1"
                     /db_xref="GeneID:14218350"
     gene            456527..456645
                     /locus_tag="SPRRNA.11"
                     /db_xref="GeneID:5802858"
     rRNA            456527..456645
                     /locus_tag="SPRRNA.11"
                     /product="5S ribosomal RNA"
                     /transcript_id="NR_151401.1"
                     /db_xref="GeneID:5802858"
     gene            complement(456931..460811)
                     /locus_tag="SPAC24H6.13"
                     /db_xref="GeneID:2541670"
     mRNA            complement(456931..460811)
                     /locus_tag="SPAC24H6.13"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018340.2"
                     /db_xref="GeneID:2541670"
     CDS             complement(457061..459676)
                     /locus_tag="SPAC24H6.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592939.1"
                     /db_xref="GeneID:2541670"
                     /db_xref="GOA:Q09766"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR022257"
                     /db_xref="InterPro:IPR027815"
                     /translation="MSDSSSSSTSAFVSSLVFNFAIFCAFIGLFLCLRPREKHVYQPR
                     CIIDTQPKEEKPEPSPSSPFGLFAYVVKRSETYLIQYAGVDGYFFIRYLFTFGALCIL
                     GCLVLFPILLPVNATNGVGEKGFDILSFSNVKNHNRFYAHVFLSWLFFGFTIFIIYRE
                     LRYYVIFRHAMQSSGLYNNLPSSSTMLLTELPNSVLNDEETLHELFPNASEFTCVRDL
                     KKLEKKVKKRSDLGNKYESTLNSLINKSVKKHNKLVKKHKPLPSTLDYTAYVKKRPTH
                     RLKFLIGKKVDTIDYCRDTIAELDEVVDKLQTSLEERKKVGSVFIRFRSQTDLQTAYQ
                     AFLYSKKFRKYRFGRALVGIAPEDIVWSNLDLSMYTRRGKKTISNTILTLMIIFWAFP
                     VAVVGCISNVNYLIEKVHFLKFIDHMPPKLLGIITGILPSVALSILMSLVPPFIKFLG
                     KFGGALTVQEIENYCQNWYYAFQVVQVFLVTTMTSAATSAVVQVIKEPASSMTLLASN
                     LPKASNFYISYFLLQGLSIPGGALLQIVTLLLSKVLGRIFDNTPRKKWNRWNQLSAPS
                     WGTVYPVYSLLVTIMICYSIIAPIIIGFAAVAFVLIYFAYSYNLIYVLGHNADAKGRN
                     YPRALFQVFVGLYLAEVCLIGLFVLAKNWGATVLEAVFLGFTVACHLYFKYKFLPLMD
                     AVPISAIESVSERPEIKYPMDLGTSEMKNVGRAYPEILEKLSSSSGSDEFLETSSRTS
                     ENTKEKIDKDDEGFAITNISSVHKMPSFVLSYFSDLAASNRILTGFDRVLQLLPSFYD
                     IPVRVRNVQYVSPALKATPPSVWIPKDPLGLSTYAIEDARGKVDIFDDNTTFNEKGNL
                     QYTGPPPDYDEAIRS"
     gene            460793..461752
                     /locus_tag="SPNCRNA.651"
                     /db_xref="GeneID:14217929"
     misc_RNA        460793..461752
                     /locus_tag="SPNCRNA.651"
                     /product="intergenic RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_151015.1"
                     /db_xref="GeneID:14217929"
     gene            461686..463599
                     /gene="uba3"
                     /locus_tag="SPAC24H6.12c"
                     /db_xref="GeneID:2542099"
     mRNA            461686..463599
                     /gene="uba3"
                     /locus_tag="SPAC24H6.12c"
                     /product="NEDD8-activating enzyme uba3"
                     /transcript_id="NM_001018341.2"
                     /db_xref="GeneID:2542099"
     CDS             461939..463273
                     /gene="uba3"
                     /locus_tag="SPAC24H6.12c"
                     /codon_start=1
                     /product="NEDD8-activating enzyme uba3"
                     /protein_id="NP_592940.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24H6.12c"
                     /db_xref="EnsemblGenomes-Tr:SPAC24H6.12c.1"
                     /db_xref="GeneID:2542099"
                     /db_xref="GOA:Q09765"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR014929"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023318"
                     /db_xref="PomBase:SPAC24H6.12c"
                     /db_xref="PomBase:SPAC24H6.12c.1"
                     /translation="MPSSDVCKAGSHRHSGWIQSLKKPGPFNLDAPENPEETLKSAFS
                     SKILIIGAGGLGCEILKDLALSGFRDLSVIDMDTIDITNLNRQFLFNESNIDEPKANV
                     AASMIMKRIPSTVVTPFYGKIQDKTIEFYKEFKLIICGLDSVEARRWINSTLVAIAKT
                     GDLIPLVDGGSEGLKGQARVIIPTITSCYECSLDMLTPKISYPICTLANTPRLPEHCV
                     EWAYLLEWPRVFLNASVDSFSKQEVFEPLDGKNSNFEPDNIRHIDWLVKRSIERANKF
                     QIPSSSINRFFVQGIVKRIIPAVASTNAIIAASCCNEALKILTESNPFLDNYMMYVGE
                     DGAYTYTFNLEKRSDCPVCGVLSEVYDISASSTVTLKDILNHYSKSYNLQNPSVSTAA
                     GTPLYLASPPALQVATSKNLSQPILSITSVDVNLVITDKNLSTSLSVQLREC"
     gene            464120..468581
                     /locus_tag="SPAC24H6.11c"
                     /db_xref="GeneID:2542625"
     mRNA            464120..468581
                     /locus_tag="SPAC24H6.11c"
                     /product="putative sulfate transporter"
                     /transcript_id="NM_001018342.2"
                     /db_xref="GeneID:2542625"
     CDS             465299..468175
                     /locus_tag="SPAC24H6.11c"
                     /codon_start=1
                     /product="putative sulfate transporter"
                     /protein_id="NP_592941.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24H6.11c"
                     /db_xref="EnsemblGenomes-Tr:SPAC24H6.11c.1"
                     /db_xref="GeneID:2542625"
                     /db_xref="GOA:Q09764"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="PomBase:SPAC24H6.11c"
                     /db_xref="PomBase:SPAC24H6.11c.1"
                     /translation="MPTHSLNQKRSLLYPSIDNGSVPDSSFLSQSFRDTNDIHLLSAR
                     LASVEVDPETLPSNSPETNDDVSNYDYMSISSYQRAHSLASTSRNDFNYRPSEINETR
                     PLLPEREEHSSQLPPAQNQVLPFQSLNAPSKKLRGRISLSKIYQFFFDDKGPILFILN
                     IPAVIIGLLLNILDALSYGLILFPISDPLFKNLGADGLAIYYVSCVVSQLVYSLGGSF
                     FKGSVGSEMIEVIPFFHQIAFTILNRVGEDNPKSVIATTILAYCLSSILTGLVFFILG
                     ILRLGRLIEFFPRHILLGCIGGVGSFLVLTAVEVSSRLEGSVSFNWASLSALFQPMTF
                     AKWSIPLFLSSALEFAQQRWPHPFLIPSFFVIAPAIFYVLVWAIPGMSLEYLRETGWV
                     FSSTETNVPWYHFYSLFSLRDTDWSALLATVPEMCALTFFGILHVPINVPALAISLGL
                     DFVDTDKELIAHGVSNTLSGAVGSIQNYMTYTNSLMFIRSGGNNRLAGIMLALATVAL
                     LVIGPGIIAYIPVWTVGCLIYLLGIELLKESLWDPIGITTKIEYFTICAIVFTMTVVD
                     FVVGIVIGIIMACVFFVIQASSRSALRGIYSGGIVRSTVRRPMNQQRFLNEIGRQIQV
                     CKLSGFLFFGTINGVEKNIAGLIEELNVSNNPLRFLIIDFSLVNGADFSVVQAFLRIR
                     RMLATMNVQLCVCGLDETRSSFKTLTTMCFGGDDNCGCQVFEDVNSSLEYCENMLLDD
                     YDVYRTKLLHKAGYSHTLAVPGKHKQNISMAETFSPSPRHDLLRQVAMSSVKAETKEL
                     SKFEKYAKYEQPFPLLMQVFGEITTKREDFWLGLCPFFKKAFLRKGDLLWRKGDTPSK
                     LVILETGMVKASYQMDRESLSENITCLCVVGELPFFSKTCYNATVVAELDSAVWILDR
                     EGWETMLKSSDKAEVIENEMLYLTLKMTRDKFNVFTNFALNLYR"
     gene            complement(465302..468551)
                     /locus_tag="SPNCRNA.652"
                     /db_xref="GeneID:14217928"
     misc_RNA        complement(465302..468551)
                     /locus_tag="SPNCRNA.652"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151016.1"
                     /db_xref="GeneID:14217928"
     gene            468664..469890
                     /locus_tag="SPAC24H6.10c"
                     /db_xref="GeneID:2542631"
     mRNA            468664..469890
                     /locus_tag="SPAC24H6.10c"
                     /product="putative phospho-2-dehydro-3-deoxyheptonate
                     aldolase"
                     /transcript_id="NM_001018343.2"
                     /db_xref="GeneID:2542631"
     CDS             468720..469826
                     /locus_tag="SPAC24H6.10c"
                     /EC_number="2.5.1.54"
                     /codon_start=1
                     /product="putative phospho-2-dehydro-3-deoxyheptonate
                     aldolase"
                     /protein_id="NP_592942.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24H6.10c"
                     /db_xref="EnsemblGenomes-Tr:SPAC24H6.10c.1"
                     /db_xref="GeneID:2542631"
                     /db_xref="GOA:Q09755"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="PomBase:SPAC24H6.10c"
                     /db_xref="PomBase:SPAC24H6.10c.1"
                     /translation="MDKHTPLLPGDSVFSRCKTEDSRIKGYDPVISPALIQSELAASD
                     ETLAFVSDQRRQAADIIAGRDDRLLLIVGPCSLHDPVAAKEYAIRLQKEAIKHKKDLH
                     IIMRAYLEKPRTTVGWKGLINDPDLDGSYNINKGIRVARRIFLELLETGVGIASEMLD
                     TISPQYLADLICWGAIGARTTESQLHRELASGLSFPIGFKNATDGNIGIAIDAMNSSA
                     NPHHFLSVTKQGVVAIVTTTGNPDTHIILRGGKSGTNFDADSVAGAKAKLEECNKLPS
                     IMIDCSHGNSSKNHKNQPKVAACIAEQVANGQKAITGVMIESHLNEGKQAIPEDDLSS
                     MKYGVSVTDACIGWDDTTAVFEQLAAAVRSRRSH"
     gene            complement(469981..472993)
                     /gene="gef1"
                     /locus_tag="SPAC24H6.09"
                     /db_xref="GeneID:2542635"
     mRNA            complement(join(469981..472802,472858..472993))
                     /gene="gef1"
                     /locus_tag="SPAC24H6.09"
                     /product="RhoGEF Gef1"
                     /transcript_id="NM_001018344.2"
                     /db_xref="GeneID:2542635"
     CDS             complement(join(470583..472802,472858..472899))
                     /gene="gef1"
                     /locus_tag="SPAC24H6.09"
                     /codon_start=1
                     /product="RhoGEF Gef1"
                     /protein_id="NP_592943.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24H6.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC24H6.09.1"
                     /db_xref="GeneID:2542635"
                     /db_xref="GOA:Q09763"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="PomBase:SPAC24H6.09"
                     /db_xref="PomBase:SPAC24H6.09.1"
                     /translation="METLKADLSDMSDSPEYFETLANRDLPRLPGTSKLHRAACIKRK
                     SINLSLPSNSYSLSYRQSDDTDGDVSESQSEYRLSSGRRSRASFARALQDPQTPNTPP
                     VSSQHRRFFSEGSFNLPNSNMSHSLNGDSTASNSSTLTPNRIYGDRNRQDYAQSSRYT
                     LPSLPSSPSYNCPTTLRKIHTNTSSNGTSRRVSGLGSFMAQNSSETSSNRTSAYLPGS
                     STDEQEKRSSVTLASMPSSHSSTASLLSPLDTTSFSTKLDSTILALETDESLSRTISY
                     ATTSLPSTPGKRLSKESLAMSEASSINPEYKRIKKRANLIKELVTTEAAYLNDLIAIQ
                     QSYGLRVKECSALNPVDAQTVFGDIESLLTFTVEFHSRLYQAGEGSWRVNLDTQLIDP
                     LPCNLGLIFLESLSEIGQIYTGYCNRQDSVFKIITKWREKPATASWIMEGDKIVQKYT
                     NAWDLGSLIIKPLQRLLKYPLLLQKIIDVTPESSSERPDLVLSYQLLQELISGINQKQ
                     KPSHKRGSLSASHKRDAAWSLLYKATSNKSRPTTTSTELKTDARLNFQRQVLQDFRQR
                     FAILKALHATLETWYVTVHRGFSVFEKVLAELEGLSALEPEDKPVDTWRKYHLLAHMM
                     TANLPSQIQTSLNSSILNPITNILRVIQKVIQFIISAEFVIPAQKLEAISTLVEKEFH
                     SVVYHFIGIQRSLYENYAQGFLFLIPQDMRDSILEETQDYAELVRAFEPMHYDDEVLL
                     EELMKSVSLAARV"
     gene            complement(473792..475041)
                     /locus_tag="SPAC24H6.08"
                     /db_xref="GeneID:2542626"
     mRNA            complement(473792..475041)
                     /locus_tag="SPAC24H6.08"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018345.2"
                     /db_xref="GeneID:2542626"
     CDS             complement(474035..474697)
                     /locus_tag="SPAC24H6.08"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592944.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24H6.08"
                     /db_xref="EnsemblGenomes-Tr:SPAC24H6.08.1"
                     /db_xref="GeneID:2542626"
                     /db_xref="GOA:Q09762"
                     /db_xref="PomBase:SPAC24H6.08"
                     /db_xref="PomBase:SPAC24H6.08.1"
                     /translation="MTSHQTGKIEVHWNDPSSGIFLSQTQRTSSTSSLKKSASSRRLV
                     YGDDMLAPKPLAGQVLSKSPLPPFSPSKIMNRSISVPPTNISVPQISSNPLNLMKKSS
                     DNDIFTTFNDTTNDCMNEASCEDVRHSLLQIIESKSNLSDSVHKMLGERVKTNLLLQG
                     QLENMEGFWLQKLSQTCRLALTGNISEAKAFIVEIMCAGVVTNCVRWCPVLKTLIENL
                     AI"
     gene            complement(475354..476128)
                     /gene="rps901"
                     /locus_tag="SPAC24H6.07"
                     /gene_synonym="rps9-1; rps9a"
                     /db_xref="GeneID:2542629"
     mRNA            complement(join(475354..476053,476099..476128))
                     /gene="rps901"
                     /locus_tag="SPAC24H6.07"
                     /gene_synonym="rps9-1; rps9a"
                     /product="40S ribosomal protein S9"
                     /transcript_id="NM_001018346.2"
                     /db_xref="GeneID:2542629"
     CDS             complement(join(475493..476053,476099..476113))
                     /gene="rps901"
                     /locus_tag="SPAC24H6.07"
                     /gene_synonym="rps9-1; rps9a"
                     /codon_start=1
                     /product="40S ribosomal protein S9"
                     /protein_id="NP_592945.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24H6.07"
                     /db_xref="EnsemblGenomes-Tr:SPAC24H6.07.1"
                     /db_xref="GeneID:2542629"
                     /db_xref="GOA:Q09757"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005710"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="PomBase:SPAC24H6.07"
                     /db_xref="PomBase:SPAC24H6.07.1"
                     /translation="MPSAPRKQSKTYKVPRRPFESARLDAELKLAGEYGLRNKHEIWR
                     VALTLSKIRRAARELLTLDEKDPKRLFEGNAIIRRLVRLGILDETRMKLDYVLALRIE
                     DFLERRLQTQVFKLGLAKSIHHARVLIFQRHIRVGKQIVNVPSFVVRLDTQKHIDFAL
                     SSPYGGGRPGRCKRKRLRSQEGGEGEEAEEE"
     regulatory      complement(476164..476171)
                     /regulatory_class="promoter"
     regulatory      complement(476183..476192)
                     /regulatory_class="promoter"
     gene            complement(476474..478803)
                     /gene="sld3"
                     /locus_tag="SPAC24H6.06"
                     /gene_synonym="mug175"
                     /db_xref="GeneID:2542628"
     mRNA            complement(join(476474..478606,478655..478803))
                     /gene="sld3"
                     /locus_tag="SPAC24H6.06"
                     /gene_synonym="mug175"
                     /product="DNA replication pre-initiation complex subunit
                     Sld3"
                     /transcript_id="NM_001018347.2"
                     /db_xref="GeneID:2542628"
     CDS             complement(join(476549..478606,478655..478696))
                     /gene="sld3"
                     /locus_tag="SPAC24H6.06"
                     /gene_synonym="mug175"
                     /codon_start=1
                     /product="DNA replication pre-initiation complex subunit
                     Sld3"
                     /protein_id="NP_592946.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC24H6.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC24H6.06.1"
                     /db_xref="GeneID:2542628"
                     /db_xref="GOA:Q09761"
                     /db_xref="InterPro:IPR013948"
                     /db_xref="PomBase:SPAC24H6.06"
                     /db_xref="PomBase:SPAC24H6.06.1"
                     /translation="MNNDHASKKSFCIKAPSNWEKSYLEVWPLVTVPRQCICLRWCIS
                     KEYHEFTCSSLQFIVIRPAGTSVLLGRVKSSKANQLVGIEHVEGSRYALIFLSEKLDF
                     KSLKVIANHQLTKSSKSLSNVSNKPLGDQLFRSNSLMSPSLLKKELHRIQSDASQANE
                     RESQAPHSFVTHDLISSSKDGNSLTHEFANDSVTEMVQDYTPSCSRDVKSLLDHLYNS
                     YFYQLLMTKTPVVFYVKQMVGKTRQLAVEVHNHVEEKALVDELLKFLDNLKSVDDRKS
                     RLLQCFESHLNYKAWHLEFENEAHQYEIKGYRLWLQNILNRENCQITKLDFEREFSQL
                     KLKEYEIRVLLYFEILYLFLKWDPEYARRRANDNSLLDSRDSGKRKSRKKNAKTLNPF
                     ETAQLKLEFTFDGLCIRRTIEQNATERSEDLLLKFCKETIVPYYSSKFPRITRNLLEK
                     CNGLDLLPERSHKHRHSAPPRSKLISSKSEAGRALPGNTSGASISNTSSPHSEASISK
                     DYEILKRRRSNSGVHSLTRSDSSFNGFERDTRRRSSDIARIKNREINLPSSSLSKQRN
                     SMHDISTNFPRRNLSFTEKLTMASLQGQSEESVQPKTTSSLSRSKTLSILEGSVSKRS
                     EPSMDSILVQATPRKSSSVITELPDTPIKMNSLDKASACTVENHIVTESPAHKSNKAQ
                     LFVCVPTTPVKKKSASP"
     gene            complement(479228..482556)
                     /gene="cdc25"
                     /locus_tag="SPAC24H6.05"
                     /gene_synonym="sal2"
                     /db_xref="GeneID:2542632"
     mRNA            complement(join(479228..482185,482286..482556))
                     /gene="cdc25"
                     /locus_tag="SPAC24H6.05"
                     /gene_synonym="sal2"
                     /product="M phase inducer phosphatase Cdc25"
                     /transcript_id="NM_001355978.1"
                     /db_xref="GeneID:2542632"
     CDS             complement(479750..481540)
                     /gene="cdc25"
                     /locus_tag="SPAC24H6.05"
                     /gene_synonym="sal2"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /product="M phase inducer phosphatase Cdc25"
                     /protein_id="NP_001342797.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24H6.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC24H6.05.1"
                     /db_xref="GeneID:2542632"
                     /db_xref="GOA:P06652"
                     /db_xref="InterPro:IPR000751"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="PomBase:SPAC24H6.05"
                     /db_xref="PomBase:SPAC24H6.05.1"
                     /translation="MDSPLSSLSFTNTLSGKRNVLRPAARELKLMSDRNANQELDFFF
                     PKSKHIASTLVDPFGKTCSTASPASSLAADMSMNMHIDESPALPTPRRTLFRSLSCTV
                     ETPLANKTIVSPLPESPSNDALTESYFFRQPASKYSITQDSPRVSSTIAYSFKPKASI
                     ALNTTKSEATRSSLSSSSFDSYLRPNVSRSRSSGNAPPFLRSRSSSSYSINKKKGTSG
                     GQATRHLTYALSRTCSQSSNTTSLLESCLTDDTDDFELMSDHEDTFTMGKVADLPESS
                     VELVEDAASIQRPNSDFGACNDNSLDDLFQASPIKPIDMLPKINKDIAFPSLKVRSPS
                     PMAFAMQEDAEYDEQDTPVLRRTQSMFLNSTRLGLFKSQDLVCVTPKQSTKESERFIS
                     SHVEDLSLPCFAVKEDSLKRITQETLLGLLDGKFKDIFDKCIIIDCRFEYEYLGGHIS
                     TAVNLNTKQAIVDAFLSKPLTHRVALVFHCEHSAHRAPHLALHFRNTDRRMNSHRYPF
                     LYYPEVYILHGGYKSFYENHKNRCDPINYVPMNDASHVMTCTKAMNNFKRNATFMRTK
                     SYTFGQSVLASPDVNDSPTAMHSLSTLRRF"
     gene            complement(482607..485408)
                     /gene="hxk1"
                     /locus_tag="SPAC24H6.04"
                     /db_xref="GeneID:2542634"
     mRNA            complement(482607..485408)
                     /gene="hxk1"
                     /locus_tag="SPAC24H6.04"
                     /product="hexokinase 1"
                     /transcript_id="NM_001018349.2"
                     /db_xref="GeneID:2542634"
     CDS             complement(483447..484901)
                     /gene="hxk1"
                     /locus_tag="SPAC24H6.04"
                     /EC_number="2.7.1.4"
                     /EC_number="2.7.1.7"
                     /EC_number="2.7.1.2"
                     /EC_number="2.7.1.1"
                     /codon_start=1
                     /product="hexokinase 1"
                     /protein_id="NP_592948.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24H6.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC24H6.04.1"
                     /db_xref="GeneID:2542634"
                     /db_xref="GOA:Q09756"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="PomBase:SPAC24H6.04"
                     /db_xref="PomBase:SPAC24H6.04.1"
                     /translation="MSLHDAYHWPSRTPSRKGSNIKLNKTLQDHLDELEEQFTIPTEL
                     LHRVTDRFVSELYKGLTTNPGDVPMVPTWIIGTPDGNEHGSYLALDLGGTNLRVCAVE
                     VQGNGKFDITQSKYRLPQELKVGTREALFDYIADCIKKFVEEVHPGKSQNLEIGFTFS
                     YPCVQRSINDASLVAWTKGFDIDGVEGESVGPLLSAALKRVGCNNVRLNAILSDTTGT
                     LVASNYASPGTEIGVIFGTGCNACYIEKFSEIPKLHKYDFPEDMNMIINCEWCDFDNQ
                     HVVLPRTKYDVAIDEESPRPGLQTYEKMIAGCYLGDILRRILLDLYEQGALFNGQDVT
                     KIRDPLAMDTSVLSAIEVDPFENLDETQTLFEETYGLKTTEEERQFIRRACELIGTRS
                     ARLSACGVCALVRKMNKPSMIVGTDGSVYNLYPRFKDRLAQAFKDILGEEIGSKVVTI
                     PAEDGSGVGAALVSALEAKGKALTSDILAEHLKN"
     gene            485606..487008
                     /locus_tag="SPNCRNA.653"
                     /db_xref="GeneID:14218214"
     misc_RNA        485606..487008
                     /locus_tag="SPNCRNA.653"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151017.1"
                     /db_xref="GeneID:14218214"
     gene            485703..486330
                     /locus_tag="SPNCRNA.551"
                     /db_xref="GeneID:9407092"
     misc_RNA        485703..486330
                     /locus_tag="SPNCRNA.551"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150920.1"
                     /db_xref="GeneID:9407092"
     gene            complement(485723..488811)
                     /gene="cul3"
                     /locus_tag="SPAC24H6.03"
                     /gene_synonym="pcu3"
                     /db_xref="GeneID:2542637"
     mRNA            complement(join(485723..486131,486188..486597,
                     486649..486822,486867..486931,486984..487093,
                     487133..488517,488574..488811))
                     /gene="cul3"
                     /locus_tag="SPAC24H6.03"
                     /gene_synonym="pcu3"
                     /product="cullin 3"
                     /transcript_id="NM_001018350.2"
                     /db_xref="GeneID:2542637"
     CDS             complement(join(485960..486131,486188..486597,
                     486649..486822,486867..486931,486984..487093,
                     487133..488517,488574..488615))
                     /gene="cul3"
                     /locus_tag="SPAC24H6.03"
                     /gene_synonym="pcu3"
                     /codon_start=1
                     /product="cullin 3"
                     /protein_id="NP_592949.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24H6.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC24H6.03.1"
                     /db_xref="GeneID:2542637"
                     /db_xref="GOA:Q09760"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016157"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="PomBase:SPAC24H6.03"
                     /db_xref="PomBase:SPAC24H6.03.1"
                     /translation="MQRSAKLKIRAPRKFSANQVDFATHWEVLQRAIGDIFQKSTSQL
                     SFEELYRNAYILVLHKYGEKLYNHVQDVIRSRLKEETVPAIYKNYDASLLGNALLDIR
                     KNDSYSTSWSRSLEAAHRFLSSLVNSWKDHIVSMQMISSVLKYLDKVYSKSADKVPVN
                     ENGIYIFREVVLLNSFEIGEKCVETILILVYLERKGNTINRPLINDCLDMLNSLPSEN
                     KKETLYDVLFAPKFLSYTRNFYEIESSTVIGVFGVVEYLKKAEKRFEEEKERSKNYLF
                     TKIASPLLSVVEDELLSKHLDDLLENQSTGFFSMIDSSNFEGLQLVYESFSRVELGVK
                     SLKKYLAKYVAHHGKLINETTSQALEGKMAVGRLSSNATMATLWVQKVLALWDRLNTI
                     ISTTMDADRSILNSLSDAFVTFVDGYTRAPEYISLFIDDNLKKDARKAIEGSIEATLQ
                     NSVTLFRFISEKDVFEKYYKTHLAKRLLNNRSISSDAELGMISRLKQEAGNVFTQKLE
                     GMFNDMNLSQELLQEYKHNSALQSAKPALDLNVSILASTFWPIDLSPHKIKCNFPKVL
                     LAQIDQFTDFYLSKHTGRKLLWYPSMGSADVRVNFKDRKYDLNVSTIASVILLLFQDL
                     KENQCLIFEEILEKTNIEVGDLKRNLQSLACAKYKILLKDPKGREVNAGDKFYFNENF
                     VSNLARIKISTVAQTRVEDDSERKRTLEKVDESRKHQADACIVRVMKDRKVCEHNQLM
                     AEVTRQLNPRFHPSPMMIKRRIEALIEREYLQRQADNGRIYEYLA"
     gene            488339..489482
                     /locus_tag="SPAC24H6.02c"
                     /db_xref="GeneID:2542642"
     mRNA            join(488339..489029,489074..489482)
                     /locus_tag="SPAC24H6.02c"
                     /product="putative TIM23 translocase complex subunit
                     Tim15"
                     /transcript_id="NM_001018351.2"
                     /db_xref="GeneID:2542642"
     CDS             join(488779..489029,489074..489350)
                     /locus_tag="SPAC24H6.02c"
                     /codon_start=1
                     /product="putative TIM23 translocase complex subunit
                     Tim15"
                     /protein_id="NP_592950.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC24H6.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC24H6.02c.1"
                     /db_xref="GeneID:2542642"
                     /db_xref="GOA:Q09759"
                     /db_xref="InterPro:IPR007853"
                     /db_xref="InterPro:IPR024158"
                     /db_xref="PomBase:SPAC24H6.02c"
                     /db_xref="PomBase:SPAC24H6.02c.1"
                     /translation="MWSFARYTQKFCLRNLQLKNFSNKVKVSSLLFCSPNVRNISNWQ
                     CKRFTQSDAKDLASGVPSVKSDADQLQPKPTYNVSFTCTVCNTRSNHNFSKQAYHNGT
                     VLVQCPKCKNRHLMADHLKIFSEERVTIEDILAKKGETFKKGYGQVINGNVVEFKPPQ
                     FKIRPAKSSSSNSSK"
     gene            complement(489023..489562)
                     /locus_tag="SPNCRNA.654"
                     /db_xref="GeneID:14217927"
     misc_RNA        complement(489023..489562)
                     /locus_tag="SPNCRNA.654"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151018.1"
                     /db_xref="GeneID:14217927"
     gene            489871..492181
                     /locus_tag="SPAC24H6.01c"
                     /db_xref="GeneID:2541508"
     mRNA            join(489871..490262,490338..490771,490812..490931,
                     490979..491149,491186..491858,491905..492181)
                     /locus_tag="SPAC24H6.01c"
                     /product="putative MBOAT family O-acyltransferase"
                     /transcript_id="NM_001018352.3"
                     /db_xref="GeneID:2541508"
     CDS             join(490016..490262,490338..490771,490812..490931,
                     490979..491149,491186..491858,491905..492011)
                     /locus_tag="SPAC24H6.01c"
                     /codon_start=1
                     /product="putative MBOAT family O-acyltransferase"
                     /protein_id="NP_592951.3"
                     /db_xref="EnsemblGenomes-Gn:SPAC24H6.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC24H6.01c.1"
                     /db_xref="GeneID:2541508"
                     /db_xref="GOA:Q09758"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="PomBase:SPAC24H6.01c"
                     /db_xref="PomBase:SPAC24H6.01c.1"
                     /translation="MLRLFRFDVLETSTKDTERPNSKSSRLSSTSGSSHPSSSSRLTV
                     RSAVPEKSAFGSIEFIFYFSVILSILTIACFKIHYVSSPKHPNYKNIEKYLKPGWLFG
                     QKVDSADFQYSAFRENMPILLLVIIVYNFLWRLVKLVFTKNTNDELAIKNNYRLCFSL
                     LFALLVYGTGVIYVLTIALINYLISKSLKNSIFNPLLTWTLDISVVFFKEYFAYCKFS
                     SLHPGLGFLDQYTGILERWYVLFNITMLRLVSFNMDYYWSLKHNSEKLNTLIFDKDRE
                     PTTLTFRERVDYSCLDEDYNLKNFLTYIFYAPLYLAGPIISFNNFMSQMKYPTVSTLK
                     YRNLLYAIRFLVCVLTMEFLLHYAYVTAISKDGNWNQYSAVESAMISFIVLFMTWLKL
                     LIPWRLFRLWSLIDDIEPPENIVRCMCNNYSAVGFWRAWHRSFNRWLIRYIYVPLGGS
                     NHSILNLFIIFTFVALWHDISWELFAWGWLIVLFILPERLCCFMSRRTGLTKHPYYRY
                     ISGFGAALNIYFMIICNLIGFAVGIDGIKNVLVSFFLTLKGAMSAIAAFIMFFSAVQI
                     MFQIRVNEEEEGINLRC"
     gene            complement(491816..492201)
                     /gene="prl47"
                     /locus_tag="SPNCRNA.47"
                     /db_xref="GeneID:5802859"
     misc_RNA        complement(491816..492201)
                     /gene="prl47"
                     /locus_tag="SPNCRNA.47"
                     /product="antisense RNA, poly(A)-bearing RNA (predicted)"
                     /transcript_id="NR_150854.1"
                     /db_xref="GeneID:5802859"
     gene            492335..497927
                     /locus_tag="SPAPB21F2.02"
                     /db_xref="GeneID:2543220"
     mRNA            join(492335..492476,492512..492630,492673..494385,
                     494423..494615,494667..497927)
                     /locus_tag="SPAPB21F2.02"
                     /product="putative family protein DOPEY"
                     /transcript_id="NM_001018353.2"
                     /db_xref="GeneID:2543220"
     CDS             join(492461..492476,492512..492630,492673..494385,
                     494423..494615,494667..497689)
                     /locus_tag="SPAPB21F2.02"
                     /codon_start=1
                     /product="putative family protein DOPEY"
                     /protein_id="NP_592953.1"
                     /db_xref="EnsemblGenomes-Gn:SPAPB21F2.02"
                     /db_xref="EnsemblGenomes-Tr:SPAPB21F2.02.1"
                     /db_xref="GeneID:2543220"
                     /db_xref="GOA:Q9C0Z4"
                     /db_xref="InterPro:IPR007249"
                     /db_xref="PomBase:SPAPB21F2.02"
                     /db_xref="PomBase:SPAPB21F2.02.1"
                     /translation="MNTIIDASNDAKYRKYQDAIRKCIALFQTVEQWPDYISFLTKLH
                     KVLQTHSSFVNIPCSLLVSRALAECLSPGLPSGVHKKTLEVYDYIFTIIGSKTLTNEL
                     STWSYGLTPFFSISSIKTKHDYINIIKKHYVSLGVGIRPCFQAVFISLLSGLEEDVDE
                     SSQEVYHLLDDLVKVLNDEKFAWGCIWSTILSFPSQRPGALAYLLRVCNNLAEEDIQT
                     RVIQPDSGLVVRSFAAAISDNDILVQRGYMDALLNYFPIQSTFYKDVKPFDLKLLHMS
                     VASIVLRNDLSLNRRFYAWLMGLSKDTELSISDSSITVDENTLQQNMAIFFEGVKDLL
                     SSKNSLMSFYKAFRILYALSDRRPLFTIVESQILPCVLHSYETLTNVFHRDDSKHLYE
                     SAVDHGRRLIMKFSDSELHTFLFHCVNKIVANTTENSDSAEAVKFILDSQNFFFESIN
                     TEYSFIIFTNLLMHLEKTSPNSDVDGVSMTILTICKILLNNFDWNFFNYNNSAIDSYA
                     KCTLNLDSDFENGILTYEILYKKCKCSLLSLLKQYIKDSHVHHEVLLISLNLIKEASD
                     TEFENEFLDLSLQGFKDNSWSFQTLGSFVKQLPSRILINSTACVNVILDRIWCELCMF
                     SYFREEELLSVIWTLQEKLQTRIIESYFSTCIVKEQLELRAPTIYYTPFYNLLKKSAQ
                     QSLFHFVFDRPLLLLLNSLLEDESGRDYTAMMNWINASSSLQLRVLELMTENLLSLSP
                     NLTSVNSLETAMTRYNINEDQRNSEASRCVYFLKLCTRIISYFQDLHPKEGRLKSAKQ
                     VEELCLVTWADALLIQKKSLTYSSFLAFLVKLCLDIVLTPQNIKTSTDVYIIQTWALR
                     LLYQITSIWENPLKFESSLIVGLFALVQEVERSPSSTYRSFILSLLQMLEFLLSRLDG
                     TIDLSSEQHYLLSNFVLVGMLNDDPGLSPKWLHAIKKLLPLLLQNLQLLMVNPIQSLC
                     KFVHSFLDQHESMYLKYPDPVKDYACMDVFIAKLKMLSELVSAALLEFTYSPGPKKSN
                     LEANGIIGNVISGVFAAESSGVSIDVNKRLSMLLTMQDALQTLFLSYSWHIRSSYADK
                     TSKVFMNDSSVLKEASLSGLKEFYFCEPLECVETLVQIYLENNVECCQCIWDIFSFLS
                     DSEPQYIVKQLVSSFFAREGIASYAGPSSLTAKITQLDILCCMSDFVSRVEGENTSKI
                     FTEISKFVREIISSSNSFKNYLLVCLRMLLEVAKNVNTYCESRQQKDFIDLMGKTLSS
                     VLFHAGKSSDPNLTVDFLAYHKAAADTFEVAKTQKKTSSVYLFVKYLDPSLLDFFCSE
                     FVPKITELSKEEDKLVAWATSIVNVFITPLVKARTFPESLTTYHLDLLLVLSKHPFLS
                     KSWRRDFWEIFNDNSLFRFDIDQLRKLSPVIYTALYQEISRLNDLITKSDLGVTTLFT
                     SRDTQLGARQSNICRITILMLSSPRDFFLPSLPPLIDLVKRLITSDPEGVLKKDLFLF
                     IRALALRTSSKHLLPLWPIVVSELLIIFKSYCMPNVAISKETLLDACRLLDFLTALKL
                     EEFALHEWVVMLSPLDAVYWSGKTSRKSLVQKVSERLQEQASEKDDKSSVESEHSILT
                     STTRTPSLGIYTTDAQLRNFLNRISIDAYEESYSFSTIDIQSFENSIYREVLQRFSNA
                     PLSPFSSIKAPSSLAGSSN"
     gene            498111..499027
                     /locus_tag="SPAPB21F2.03"
                     /db_xref="GeneID:2543463"
     mRNA            join(498111..498173,498215..499027)
                     /locus_tag="SPAPB21F2.03"
                     /product="putative ribosome biogenesis protein"
                     /transcript_id="NM_001018354.2"
                     /db_xref="GeneID:2543463"
     CDS             join(498171..498173,498215..498730)
                     /locus_tag="SPAPB21F2.03"
                     /codon_start=1
                     /product="putative ribosome biogenesis protein"
                     /protein_id="NP_592954.1"
                     /db_xref="EnsemblGenomes-Gn:SPAPB21F2.03"
                     /db_xref="EnsemblGenomes-Tr:SPAPB21F2.03.1"
                     /db_xref="GeneID:2543463"
                     /db_xref="GOA:Q9C0Z3"
                     /db_xref="PomBase:SPAPB21F2.03"
                     /db_xref="PomBase:SPAPB21F2.03.1"
                     /translation="MPKAKKRVSLASKASSRLPSSGKPSQQASIPNVELSSTVTSNSQ
                     VLNNDPLKETKKDKRKDRHFNWQQKFSNPKISASARKRRNRKARENLKVNVSSIGEVL
                     PEIDLDISVANSRLKPVIKDSLSSKQTKSSMKRNTVEEIERFQAILKHPSFVSNPLET
                     VREHLGNSLDSR"
     gene            complement(498878..500674)
                     /locus_tag="SPAC227.01c"
                     /db_xref="GeneID:2541909"
     mRNA            complement(498878..500674)
                     /locus_tag="SPAC227.01c"
                     /product="EXS domain-containing protein"
                     /transcript_id="NM_001018355.2"
                     /db_xref="GeneID:2541909"
     CDS             complement(499284..500405)
                     /locus_tag="SPAC227.01c"
                     /codon_start=1
                     /product="EXS domain-containing protein"
                     /protein_id="NP_592955.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.01c.1"
                     /db_xref="GeneID:2541909"
                     /db_xref="GOA:Q9UTD8"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="PomBase:SPAC227.01c"
                     /db_xref="PomBase:SPAC227.01c.1"
                     /translation="MALIEDLNHFINYFPLVLRLFFLVVFGLYSFTLILHLLVINRVD
                     VFSLLHTPLPVNRSQQANAPLWQLSFSLSILGTLLFVIAESLYLISGSDELAYVPVFI
                     FGVIVFMPVHKFWFFQRKVFTRQCLRILGGSYRPDYKFPDVIFSDLLTSYSRVIADLW
                     LAGAILIYVTDSPNNSHRKQYENEVIMSMIAAYPYAIRFRQCLIERSSADNSSDKFWS
                     TLNSIKYFTAFPAIFLGIFAKKRFSFLWFLWNTSSAINSTYSFWWDVSMDWSLPFFKQ
                     PLSIQNWKFGVRRLFPTFTFAVVSAIDFVLRMAWVVRVLPEHQSAFFTTDFGIFIMQF
                     LEVFRRCVWVFFRIEAEASKSLAYVNISDRSDIPTIHPD"
     gene            complement(<501117..>501485)
                     /locus_tag="SPAC227.19c"
                     /db_xref="GeneID:9407191"
     mRNA            complement(join(<501117..501248,501366..>501485))
                     /locus_tag="SPAC227.19c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001355979.1"
                     /db_xref="GeneID:9407191"
     CDS             complement(join(501117..501248,501366..501485))
                     /locus_tag="SPAC227.19c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_001343065.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.19c"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.19c.1"
                     /db_xref="GeneID:9407191"
                     /db_xref="GOA:C6Y4B7"
                     /db_xref="PomBase:SPAC227.19c"
                     /db_xref="PomBase:SPAC227.19c.1"
                     /translation="MMGSMVSNGYLLLFTCWFLFVFGLMTIFNFVEIPLYVDGDVSPI
                     RSYYPCILILTCTVVFFVWLFFNWLGLKYFRHSPSAMRR"
     gene            501407..504208
                     /locus_tag="SPNCRNA.655"
                     /db_xref="GeneID:14217912"
     misc_RNA        501407..504208
                     /locus_tag="SPNCRNA.655"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151019.1"
                     /db_xref="GeneID:14217912"
     gene            complement(501751..502444)
                     /locus_tag="SPAC227.02c"
                     /db_xref="GeneID:2541919"
     mRNA            complement(501751..502444)
                     /locus_tag="SPAC227.02c"
                     /product="putative rRNA processing protein Rrp15"
                     /transcript_id="NM_001018356.2"
                     /db_xref="GeneID:2541919"
     CDS             complement(501767..502384)
                     /locus_tag="SPAC227.02c"
                     /codon_start=1
                     /product="putative rRNA processing protein Rrp15"
                     /protein_id="NP_592956.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.02c.1"
                     /db_xref="GeneID:2541919"
                     /db_xref="GOA:Q9UTD7"
                     /db_xref="InterPro:IPR012459"
                     /db_xref="PomBase:SPAC227.02c"
                     /db_xref="PomBase:SPAC227.02c.1"
                     /translation="MAKSQRSQIKNEDISFVSQEDDSSKKFVKDDSENSEEELEDLNS
                     EDEFYQSNSSEDEIEEEVQESTIADDIADILNQQVTQTDEQDTPVLSLSKKSKKALRK
                     SNAEKKDSKLRTSRRRERLRKEMVGRVTSVVAVNAETAKALFTHERELRRIARRGVVQ
                     LFNAVRTAQLQSSLNRENISGGRTAREQKVKELSKASFLDLIKSQ"
     gene            complement(502577..504324)
                     /locus_tag="SPAC227.03c"
                     /db_xref="GeneID:2541928"
     mRNA            complement(502577..504324)
                     /locus_tag="SPAC227.03c"
                     /product="putative NAD+ transporter"
                     /transcript_id="NM_001018357.2"
                     /db_xref="GeneID:2541928"
     CDS             complement(502978..504093)
                     /locus_tag="SPAC227.03c"
                     /codon_start=1
                     /product="putative NAD+ transporter"
                     /protein_id="NP_592957.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.03c.1"
                     /db_xref="GeneID:2541928"
                     /db_xref="GOA:Q9UTD6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PomBase:SPAC227.03c"
                     /db_xref="PomBase:SPAC227.03c.1"
                     /translation="MVDDSLKDAIAGGAAGLASSLVVAPLDVVKTRKQAQKAFYSTGG
                     GKNTMVLGGTLSSMRTIFHNEGIAGLYRGVGPMMLGYLPSWSIYFVVYEKCKVLFGVN
                     KKYTSLHEIDSSKVGIKASLDSSDKQFYRYWGGQIFSAVIAGAASVTLTNPIWVVKTR
                     LVTQSHPRASSFVDKIAAATTVQFRNLQTDAPSVKWRMPRFWLKRRTNVKSSPSQHPV
                     NPPTGPACSPAYNNTFDAFRKIYKYEGLAAFYRGLFPSLFGTLHVGIQFPLYEYFKSF
                     LDDFFGKKSNFHIVLAATLSKIAASTVTYPHEVLRTRLQSLDAPTHNSATLLIRDIWR
                     SEGWRKYYSGMATNFIRTIPASSVTFLSFEIVRKWLN"
     gene            504201..504900
                     /locus_tag="SPNCRNA.656"
                     /db_xref="GeneID:14217910"
     misc_RNA        504201..504900
                     /locus_tag="SPNCRNA.656"
                     /product="intergenic RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_151020.1"
                     /db_xref="GeneID:14217910"
     gene            504835..505775
                     /locus_tag="SPAC227.04"
                     /db_xref="GeneID:2541913"
     mRNA            504835..505775
                     /locus_tag="SPAC227.04"
                     /product="putative autophagy C terminal domain family
                     protein"
                     /transcript_id="NM_001018358.2"
                     /db_xref="GeneID:2541913"
     CDS             505053..505592
                     /locus_tag="SPAC227.04"
                     /codon_start=1
                     /product="putative autophagy C terminal domain family
                     protein"
                     /protein_id="NP_592958.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.04.1"
                     /db_xref="GeneID:2541913"
                     /db_xref="GOA:Q9UTD5"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="PomBase:SPAC227.04"
                     /db_xref="PomBase:SPAC227.04.1"
                     /translation="MSFKSQLLILAQKLSKGGISCELIEFDECILKLEWHTELLDKND
                     SLLYEQEEDDILSLMNPMITMHAWIRDSPSFEVPQFFFQPYANGSDPLTKMEQIFELL
                     EGSSQNLAYDALAIGDCPGTVGIAWYIHPCRTRDYFEMLQIDKEDPKYLSLWLLYIHQ
                     VLSPLTQPIIKAVDDAEKS"
     gene            505902..>506355
                     /locus_tag="SPAC227.05"
                     /db_xref="GeneID:2542066"
     mRNA            505902..>506355
                     /locus_tag="SPAC227.05"
                     /product="putative prefoldin subunit 4"
                     /transcript_id="NM_001018359.2"
                     /db_xref="GeneID:2542066"
     CDS             505984..506355
                     /locus_tag="SPAC227.05"
                     /codon_start=1
                     /product="putative prefoldin subunit 4"
                     /protein_id="NP_592959.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.05.1"
                     /db_xref="GeneID:2542066"
                     /db_xref="GOA:Q9UTD4"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016661"
                     /db_xref="PomBase:SPAC227.05"
                     /db_xref="PomBase:SPAC227.05.1"
                     /translation="MEQVPVLAEDQRNLNEFSVLHSRKAIQELDIKNLKTQIEDIVDA
                     KNECELLDEDDGDDIPALKVGDAFFQVSLPVLLDQLEQSEESLEKQVDVLRSSMEKDE
                     TRIQELKSMLYSKFHDQINLD"
     gene            506520..507605
                     /locus_tag="SPAC227.06"
                     /db_xref="GeneID:2541426"
     mRNA            506520..507605
                     /locus_tag="SPAC227.06"
                     /product="putative Rab GTPase-binding protein"
                     /transcript_id="NM_001018360.2"
                     /db_xref="GeneID:2541426"
     CDS             506543..507292
                     /locus_tag="SPAC227.06"
                     /codon_start=1
                     /product="putative Rab GTPase-binding protein"
                     /protein_id="NP_592960.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.06.1"
                     /db_xref="GeneID:2541426"
                     /db_xref="GOA:Q9UTD3"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="PomBase:SPAC227.06"
                     /db_xref="PomBase:SPAC227.06.1"
                     /translation="MAHEIEIDSEADLGRTTFEAEDLYKQRTPITKPPAPRLQSRRAS
                     MQETPWTIKDSFNVETKDVVQRCIHTLIPTVNFFDVVDDRPDLYGPFWITTTVIQALF
                     FSNSITEYARYATGHGTSGYSIKKLISAASIIYGYTTIIAVLLWGILVWNKCNPKLLD
                     CLCLYGYANIVWLPVSLATPPFGLLSTLASHIVKYVLTGIGLLISIVFLTRNLYPICQ
                     QAGSNLCKLLLFGIIVFHCLLALSLQLIFFS"
     gene            complement(507522..509960)
                     /gene="pab1"
                     /locus_tag="SPAC227.07c"
                     /db_xref="GeneID:2541519"
     mRNA            complement(join(507522..508159,508203..509485,
                     509563..509603,509648..509960))
                     /gene="pab1"
                     /locus_tag="SPAC227.07c"
                     /product="protein phosphatase regulatory subunit Pab1"
                     /transcript_id="NM_001018361.2"
                     /db_xref="GeneID:2541519"
     CDS             complement(join(508136..508159,508203..509485,
                     509563..509603,509648..509691))
                     /gene="pab1"
                     /locus_tag="SPAC227.07c"
                     /codon_start=1
                     /product="protein phosphatase regulatory subunit Pab1"
                     /protein_id="NP_592961.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.07c.1"
                     /db_xref="GeneID:2541519"
                     /db_xref="GOA:Q12702"
                     /db_xref="InterPro:IPR000009"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018067"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="PomBase:SPAC227.07c"
                     /db_xref="PomBase:SPAC227.07c.1"
                     /translation="MDDIEDSLDQWKFAQCFGDKGDVEDITEADIISAVEFDHTGDYL
                     ATGDKGGRVVLFERNHSKKGCEYKFFTEFQSHEPEFDYLKSLEIEEKINKIRWCKRTN
                     RAHFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHD
                     MIIAAYPRRVYANAHAYHINSISVNSDAETYISADDLRINLWNLSISDHSFNIVDIKP
                     ENMEELTEVITSAEFHPINCNHLMYSSSKGNIKLLDLRQSALCDNPCKLFEDQEDQDS
                     KSFFSEIISSISDVKFSQNGRYILSRDYLTLKIWDVNMEKAPVKTIPLHDVLRSKLCD
                     LYENDCIFDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRGQIVLQADKAAFRA
                     RKSAANNVPKLNAVKNNDWRSQPQAAMGSASVGLDPDNLDYNKKILHASWHPFEDSVA
                     IAATNNLFVFSKL"
     gene            510357..511293
                     /locus_tag="SPNCRNA.657"
                     /db_xref="GeneID:14218275"
     misc_RNA        510357..511293
                     /locus_tag="SPNCRNA.657"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151021.1"
                     /db_xref="GeneID:14218275"
     gene            complement(510410..511433)
                     /gene="yth1"
                     /locus_tag="SPAC227.08c"
                     /db_xref="GeneID:2541506"
     mRNA            complement(join(510410..510720,510780..511070,
                     511167..511433))
                     /gene="yth1"
                     /locus_tag="SPAC227.08c"
                     /product="cleavage and polyadenylation specificity factor
                     complex subunit Yth1"
                     /transcript_id="NM_001018362.2"
                     /db_xref="GeneID:2541506"
     CDS             complement(join(510669..510720,510780..511070,
                     511167..511336))
                     /gene="yth1"
                     /locus_tag="SPAC227.08c"
                     /codon_start=1
                     /product="cleavage and polyadenylation specificity factor
                     complex subunit Yth1"
                     /protein_id="NP_592962.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.08c.1"
                     /db_xref="GeneID:2541506"
                     /db_xref="GOA:Q9UTD1"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="PomBase:SPAC227.08c"
                     /db_xref="PomBase:SPAC227.08c.1"
                     /translation="MTDYIKDKAIAADFSSVQFRFDNYLKQNFNFGRSALLNSGNGRD
                     SGSKMGSVVCKHWLRGLCKKGEQCDFLHEYNLKKMPPCHFYAERGWCSNGEECLYLHL
                     DPSKQVGVCAWYNMGFCPLGPICRGKHVRKPRPCPKYLAGFCPLGPNCPDAHPKHSEP
                     PHPPQKRKDW"
     gene            511350..513382
                     /locus_tag="SPAC227.09"
                     /db_xref="GeneID:2541481"
     mRNA            join(511350..511508,511662..513382)
                     /locus_tag="SPAC227.09"
                     /product="putative folylpolyglutamate synthase"
                     /transcript_id="NM_001355981.1"
                     /db_xref="GeneID:2541481"
     CDS             511807..513060
                     /locus_tag="SPAC227.09"
                     /codon_start=1
                     /product="putative folylpolyglutamate synthase"
                     /protein_id="NP_001342926.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.09.1"
                     /db_xref="GeneID:2541481"
                     /db_xref="GOA:Q9UTD0"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="PomBase:SPAC227.09"
                     /db_xref="PomBase:SPAC227.09.1"
                     /translation="MPIQLGLQRMLQLLKHLGNPQESFCAVQIAGTNGKGSICSYIYT
                     SLLQAAIKTGRYTSPHFLEPRDTISINGQIASEEIFNTCWKQVIEVDRRFRTKATEFE
                     LLTATAFQCFHHSGVRVAVIETGMGGRLDATNVFEEPVLSIISRICLDHQAFLGNTLE
                     AIAKEKAGIFKKNVPCVVDGLNEVNVLNQLKLSAEETRAHPFYLAKGKSGENKNEWII
                     NTPNWGTNTFSTPLKGDYQGQNLACAVTALDILSSSFSIMLPHVQNGVKNTSWPGRLD
                     IRSVPSLGDILFDGAHNKEAAIELAKFVNSQRREHNKSVSWVVAFTNTKDVTGIMKIL
                     LRKGDTVIATNFSSVSGMPWIKSMEPEVIKNSISSESSVECYTADNLTISEILRLAKE
                     KNSSVIVCGSLYLLGDMYRYLKLDV"
     gene            513820..514921
                     /locus_tag="SPAC227.10"
                     /db_xref="GeneID:2541498"
     mRNA            join(513820..513858,513908..513998,514046..514169,
                     514244..514921)
                     /locus_tag="SPAC227.10"
                     /product="putative prefoldin subunit 2"
                     /transcript_id="NM_001018364.2"
                     /db_xref="GeneID:2541498"
     CDS             join(513831..513858,513908..513998,514046..514169,
                     514244..514345)
                     /locus_tag="SPAC227.10"
                     /codon_start=1
                     /product="putative prefoldin subunit 2"
                     /protein_id="NP_592964.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.10.1"
                     /db_xref="GeneID:2541498"
                     /db_xref="GOA:Q9UTC9"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR027235"
                     /db_xref="PomBase:SPAC227.10"
                     /db_xref="PomBase:SPAC227.10.1"
                     /translation="MAEQPSRQQILQTQYNSYKSRLQQIAQKIVDLETDADEHKLVMD
                     TLNSMDNNRRCFRMIHGVLVERTVGTVVPILKTTQEGIQTAMNGLLDQYKQLEAEFQK
                     FQKDNKIQVVRQ"
     gene            complement(513967..517252)
                     /locus_tag="SPAC227.11c"
                     /db_xref="GeneID:2541459"
     mRNA            complement(join(513967..515082,515222..515482,
                     515534..517252))
                     /locus_tag="SPAC227.11c"
                     /product="putative misfolded glycoprotein sensor Yos9"
                     /transcript_id="NM_001018365.3"
                     /db_xref="GeneID:2541459"
     CDS             complement(join(514552..515082,515222..515482,
                     515534..515674))
                     /locus_tag="SPAC227.11c"
                     /codon_start=1
                     /product="putative misfolded glycoprotein sensor Yos9"
                     /protein_id="NP_592965.3"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.11c"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.11c.1"
                     /db_xref="GeneID:2541459"
                     /db_xref="GOA:Q9UTC8"
                     /db_xref="InterPro:IPR009011"
                     /db_xref="InterPro:IPR012913"
                     /db_xref="PomBase:SPAC227.11c"
                     /db_xref="PomBase:SPAC227.11c.1"
                     /translation="MFSSSMFPHLILPAIGSSKVRTMVLPFAFVGFFIFPICLASLLD
                     WNDAYEYPKYSFEWSNVSILEGDIDSIKEKTEKTKLSSLFYAGKHEYFCVYPNASLIK
                     QNSTTEPSYDLQELRIQGTEKINELANVFLIENRGYWTYDYVYGQHVRQYHLEPQQGS
                     DKVLANPMYILGTAPNTQTKKNLEENWAIGFVEGKAYLQTTFRNGTMCDITKRPRHVI
                     LSYECSTNSDTPEITQYQEVSSCAYSMTIHVPGLCSLPAFKIQEDIPSEKIVCYNVIK
                     EKSNEVDHKDSQHVVDEVAQTSPPEVKEVETQSS"
     gene            515661..517504
                     /locus_tag="SPAC227.12"
                     /db_xref="GeneID:2541477"
     mRNA            join(515661..515833,515896..517504)
                     /locus_tag="SPAC227.12"
                     /product="putative Prp4 family U4/U5/U6 small nuclear
                     ribonucleoprotein complex subunit"
                     /transcript_id="NM_001018366.2"
                     /db_xref="GeneID:2541477"
     CDS             join(515797..515833,515896..517247)
                     /locus_tag="SPAC227.12"
                     /codon_start=1
                     /product="putative Prp4 family U4/U5/U6 small nuclear
                     ribonucleoprotein complex subunit"
                     /protein_id="NP_592966.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.12"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.12.1"
                     /db_xref="GeneID:2541477"
                     /db_xref="GOA:Q9UTC7"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR003648"
                     /db_xref="InterPro:IPR014906"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027106"
                     /db_xref="PomBase:SPAC227.12"
                     /db_xref="PomBase:SPAC227.12.1"
                     /translation="MNENEGISLGELETRPFSEGITRFTKEQAAYYAEQKEKDRIKAL
                     KIPYEDSKVREYLRRYGEPITYFGEDALARRQRLQQLMIEKSLEGDNPLDVDQGASEN
                     IEKETYVQGSHELLVARKKIALYSLEKAKLRLKKEREISEIPVPEIVLSGKSSIEHLQ
                     KAELMGSQIGGERPIAIVRFSNNGNHFASGSWGGQVKVWNSDNLSEVQLFRGHTDRVS
                     GLDWYPLCQAWDADSEQLTLATGAADNTVCLWKASQSTPLLRLEGHLARVGRVAFHPS
                     GDYLVSASFDTTWRLWDVHTGVELLMQEGHSEGIFSIACQPDGSLVSSGGNDAIGRIW
                     DLRSGKSIMVLDEHIRQIVAMAWSPNGYQLATSSADDTVKIWDLRKVSLAHTIPAHSS
                     LVSDVRYIESGVNRFIATSGYDGCVKLWNPLNCSLIKSMVGHEEKVMSVDGYGDRFIS
                     SGYDRTIKLWYP"
     gene            complement(517416..519017)
                     /gene="isu1"
                     /locus_tag="SPAC227.13c"
                     /db_xref="GeneID:2541513"
     mRNA            complement(517416..519017)
                     /gene="isu1"
                     /locus_tag="SPAC227.13c"
                     /product="Fe-sulfur cluster assembly protein Isu1"
                     /transcript_id="NM_001018367.2"
                     /db_xref="GeneID:2541513"
     CDS             complement(517865..518443)
                     /gene="isu1"
                     /locus_tag="SPAC227.13c"
                     /codon_start=1
                     /product="Fe-sulfur cluster assembly protein Isu1"
                     /protein_id="NP_592967.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.13c"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.13c.1"
                     /db_xref="GeneID:2541513"
                     /db_xref="GOA:Q9UTC6"
                     /db_xref="InterPro:IPR002871"
                     /db_xref="InterPro:IPR011339"
                     /db_xref="PomBase:SPAC227.13c"
                     /db_xref="PomBase:SPAC227.13c.1"
                     /translation="MSVFRRSVQCVGVLPSILAQRSSLLARPANLQFLKTNSSKFVPQ
                     VTANVSRRMYHKNVLDHYNNPRNVGTLPKGDPDVGIGLVGAPACGDVMRLAIRVNKDG
                     VIEDVKFKTFGCGSAIASSSYVTTMVKGMTLEEASKIKNTQIAKELCLPPVKLHCSML
                     AEDAIKSAVKHYRSKQLTPVGTTAGAIESATA"
     gene            519257..520194
                     /locus_tag="SPNCRNA.658"
                     /db_xref="GeneID:14218220"
     misc_RNA        519257..520194
                     /locus_tag="SPNCRNA.658"
                     /product="intergenic RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_151022.1"
                     /db_xref="GeneID:14218220"
     gene            520174..522766
                     /locus_tag="SPAC227.14"
                     /db_xref="GeneID:2541483"
     mRNA            join(520174..520694,520800..521133,521215..522766)
                     /locus_tag="SPAC227.14"
                     /product="putative uridine kinase"
                     /transcript_id="NM_001355982.1"
                     /db_xref="GeneID:2541483"
     CDS             join(520933..521133,521215..521721)
                     /locus_tag="SPAC227.14"
                     /codon_start=1
                     /product="putative uridine kinase"
                     /protein_id="NP_001342927.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.14"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.14.1"
                     /db_xref="GeneID:2541483"
                     /db_xref="GOA:Q9UTC5"
                     /db_xref="InterPro:IPR000764"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC227.14"
                     /db_xref="PomBase:SPAC227.14.1"
                     /translation="MALQVDAPDVSSYDELYNRAVELLKHQQRVLIGLAGGPGSGKST
                     LCAILAKAWNERFGSEIVKIIPMDGFHYSLEELDRFDNPEKARALRGAEWTFDADLFY
                     SLVRLMKKITDRELYAPSFDHAIGDPVVDDICVEPKNRILIFEGNYLLLNKPPWSDAC
                     KLYDIKAYLPVEHSVARARVAHRHLVSGLCATEEEAIERTDRNDMINLTFVEKNMVTP
                     DIVLQQLRLKTVKTSSL"
     gene            523097..526412
                     /locus_tag="SPAC227.15"
                     /db_xref="GeneID:2541494"
     mRNA            523097..526412
                     /locus_tag="SPAC227.15"
                     /product="putative protein phosphatase regulatory subunit
                     Reg1"
                     /transcript_id="NM_001018369.2"
                     /db_xref="GeneID:2541494"
     CDS             523246..525867
                     /locus_tag="SPAC227.15"
                     /codon_start=1
                     /product="putative protein phosphatase regulatory subunit
                     Reg1"
                     /protein_id="NP_592969.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.15"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.15.1"
                     /db_xref="GeneID:2541494"
                     /db_xref="GOA:Q9UTC4"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="PomBase:SPAC227.15"
                     /db_xref="PomBase:SPAC227.15.1"
                     /translation="MSNKPDANDQCMVKETISRMSMSKEKPFLRRNYSSPSFNDSVNS
                     VNDEFQTYQLPNGEFSDNMNDLYFPFRKGNESLMTENSNYPISEQDTQHNHISDFPSR
                     RMQLDGMNHSNNDTYSTAIPFSKDSSVFDAVGQQSSVPIHINPAYTNSHQNSYSLNET
                     YLSYDFFDNHRGASSSAVSKDGLASPRPTKDVDADDTTWYFTSSPSFQPLKDSDRSQT
                     KNTHEETSPIVSSPEDDADAAFKPSSLPSTSISASSNAFYKPAAPDNERPLDPHITPY
                     LRLQLLTTGADDNDIRKNALTQVDYLSYDWKETDIWASWREITKTKANYDNGIRLENA
                     SWRTWMKHKFKLKTISPETLNWLKECDVTWLYGPLLHTSMPSRHHSHRKKEKEKEKSK
                     APRVTPLTHKTNDDEANHSETSSGSSLAKKPILKRRTPQELLLSGRDLTPWPQIRRFD
                     SLLARNRGDIFSNRNHATIRSALFSQRYPSHSKRHIHFNDRVQQCIAVDIDSLPSDSE
                     SASYNTDDANSVVSPSKDGISTTTVSSDATRSSQSSHFRIIEDLPDSKLKYSLEDQAT
                     YDQSSRYPGRHFGKTGRSHFPRAPEYYGENDFEEDEVYRDDRHYENEHDEYDPNLIYY
                     DNEPTEENRLVFEDTNNTFIDTDSDDSNADESQFLEYANDSPNSSESLESLNNQSYSS
                     SPYSVFSHPPPYMGRQSLNDSPQTSDFKASNLNDSSSNVHSIFQTRETTSPSVQNKTP
                     TKYHRELKSSKDGHEQASPLVSSSPSGSFTSQISPAATTTATNLDAVSLSPSTVRTGS
                     QISDIGNDAISTTRKTVRAFLENANPYSTNNDGNPSNNTSDVEVNETSMNDNSEEPIS
                     SNWLVDLFQKSLKSFRE"
     gene            526641..528541
                     /locus_tag="SPNCRNA.659"
                     /db_xref="GeneID:14217911"
     misc_RNA        526641..528541
                     /locus_tag="SPNCRNA.659"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151023.1"
                     /db_xref="GeneID:14217911"
     gene            complement(527782..528906)
                     /gene="psf3"
                     /locus_tag="SPAC227.16c"
                     /db_xref="GeneID:2541474"
     mRNA            complement(join(527782..528064,528124..528269,
                     528326..528460,528567..528625,528673..528906))
                     /gene="psf3"
                     /locus_tag="SPAC227.16c"
                     /product="GINS complex subunit Psf3"
                     /transcript_id="NM_001018370.2"
                     /db_xref="GeneID:2541474"
     CDS             complement(join(528003..528064,528124..528269,
                     528326..528460,528567..528625,528673..528771))
                     /gene="psf3"
                     /locus_tag="SPAC227.16c"
                     /codon_start=1
                     /product="GINS complex subunit Psf3"
                     /protein_id="NP_592970.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.16c"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.16c.1"
                     /db_xref="GeneID:2541474"
                     /db_xref="GOA:Q9UTC3"
                     /db_xref="InterPro:IPR010492"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="PomBase:SPAC227.16c"
                     /db_xref="PomBase:SPAC227.16c.1"
                     /translation="MDYYDIDSILSENQKVPCTSTVSIPGLGHEGRMVPTGSKVELPF
                     WLAEVLAINSFVSIHMPAPFSSVVRNALKANPNSVSIRDITTHYYHFAEKMLHLISDD
                     SLVQISLNTLRSRAMLIADASLNPQGALQQNSQFIEGLDDFEKHILRVSHNAHRSLIN
                     WQNSTS"
     gene            complement(529167..530275)
                     /locus_tag="SPAC227.17c"
                     /db_xref="GeneID:2541488"
     mRNA            complement(529167..530275)
                     /locus_tag="SPAC227.17c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018371.2"
                     /db_xref="GeneID:2541488"
     CDS             complement(529801..530166)
                     /locus_tag="SPAC227.17c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_592971.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.17c"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.17c.1"
                     /db_xref="GeneID:2541488"
                     /db_xref="GOA:Q9UTC2"
                     /db_xref="InterPro:IPR021475"
                     /db_xref="PomBase:SPAC227.17c"
                     /db_xref="PomBase:SPAC227.17c.1"
                     /translation="MNNFKENDEKSTFGQYAELDKILDLKKGIPEDPCSLQYYFDQMA
                     MCLTVFSQMNHYYRYGEYNRCKGNFKDFKWCLSTKSKAHEEAQEGLRKRRLQQWMKFR
                     QGPNSEDIWKMRTSPKSSE"
     gene            530261..531981
                     /gene="lys3"
                     /locus_tag="SPAC227.18"
                     /gene_synonym="SPAC2F7.01"
                     /db_xref="GeneID:2541500"
     mRNA            530261..531981
                     /gene="lys3"
                     /locus_tag="SPAC227.18"
                     /gene_synonym="SPAC2F7.01"
                     /product="saccharopine dehydrogenase Lys3"
                     /transcript_id="NM_001018372.2"
                     /db_xref="GeneID:2541500"
     CDS             530522..531628
                     /gene="lys3"
                     /locus_tag="SPAC227.18"
                     /gene_synonym="SPAC2F7.01"
                     /EC_number="1.5.1.7"
                     /codon_start=1
                     /product="saccharopine dehydrogenase Lys3"
                     /protein_id="NP_592972.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC227.18"
                     /db_xref="EnsemblGenomes-Tr:SPAC227.18.1"
                     /db_xref="GeneID:2541500"
                     /db_xref="GOA:Q09694"
                     /db_xref="InterPro:IPR007698"
                     /db_xref="InterPro:IPR007886"
                     /db_xref="InterPro:IPR027281"
                     /db_xref="PomBase:SPAC227.18"
                     /db_xref="PomBase:SPAC227.18.1"
                     /translation="MVAPHLWLRAETKPLEERSALTPRTAKILADAGFQITIERSSQR
                     AFKDKEFERLGFPMVPEGSWRHAPKDAYIIGLKELPENDNSPLKHTHIQFAHCYKNQE
                     GWREVLSRFPAGNGLLYDLEFLQDDNGRRVAAFGYHAGFAGSAISCLVWAHQLLHPNK
                     QFPAIRPFPNEKSLVRHVARQVRLALKKNNNQYPRILVIGALGRCGTGACDLASKIGI
                     PFDNILRWDINETKKGGPFTEITESDIFVNCIYLSMPIPKFCTVESLNVPNRKLRVVC
                     DVSCDTTNPNNPIPIYNVNTTFDHPTVEVKGVTTPPPLEVISIDHLPTLLPRESSEAF
                     SEALIPSLLALKDVDNAPVWVRAKKLYETMVQKL"
     gene            complement(531794..533731)
                     /locus_tag="SPAC2F7.02c"
                     /db_xref="GeneID:2541901"
     mRNA            complement(531794..533731)
                     /locus_tag="SPAC2F7.02c"
                     /product="putative NLI-interacting factor-like phosphatase
                     family protein"
                     /transcript_id="NM_001018373.2"
                     /db_xref="GeneID:2541901"
     CDS             complement(532432..533409)
                     /locus_tag="SPAC2F7.02c"
                     /codon_start=1
                     /product="putative NLI-interacting factor-like phosphatase
                     family protein"
                     /protein_id="NP_592973.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.02c.1"
                     /db_xref="GeneID:2541901"
                     /db_xref="GOA:Q09695"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="PomBase:SPAC2F7.02c"
                     /db_xref="PomBase:SPAC2F7.02c.1"
                     /translation="MKSTKTQPSPEREREPSFFQKLFGNLCSCFQDASIDEKPTYTPA
                     KPVKKAPSVVQPRRVSRTLRSSESVHTNHGPERVFESPTPARTSISLESAISPNGTTN
                     EQDIAQQGDMIDSHVHFGEQPTEPIDFADPPLPEVKRYGEGNWLLPPIAKEDEGKKCL
                     ILDLDETLVHSSFKYIEPADFVVSIEIDGLQHDVRVVKRPGVDEFLKKMGDMFEIVVF
                     TASLAKYADPVLDMLDHSHVIRHRLFREACCNYEGNFVKDLSQLGRNLEDSIIIDNSP
                     SSYIFHPSHAVPISSWFNDMHDMELIDLIPFLEHLARVPDVSTVLNLQL"
     gene            complement(534120..537869)
                     /gene="pom1"
                     /locus_tag="SPAC2F7.03c"
                     /db_xref="GeneID:2541889"
     mRNA            complement(534120..537869)
                     /gene="pom1"
                     /locus_tag="SPAC2F7.03c"
                     /product="DYRK family protein kinase Pom1"
                     /transcript_id="NM_001018374.2"
                     /db_xref="GeneID:2541889"
     CDS             complement(534462..537725)
                     /gene="pom1"
                     /locus_tag="SPAC2F7.03c"
                     /EC_number="2.7.12.1"
                     /codon_start=1
                     /product="DYRK family protein kinase Pom1"
                     /protein_id="NP_592974.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.03c.1"
                     /db_xref="GeneID:2541889"
                     /db_xref="GOA:Q09690"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PomBase:SPAC2F7.03c"
                     /db_xref="PomBase:SPAC2F7.03c.1"
                     /translation="MGYLQSQKAVSLGDENTDALFKLHTSNRKSANMFGIKSELLNPS
                     ELSAVGSYSNDICPNRQSSSSTAADTSPSTNASNTNISFPEQEHKDELFMNVEPKGVG
                     SSMDNHAITIHHSTGNGLLRSSFDHDYRQKNSPRNSIHRLSNISIGNNPIDFESSQQN
                     NPSSLNTSSHHRTSSISNSKSFGTSLSYYNRSSKPSDWNQQNNGGHLSGVISITQDVS
                     SVPLQSSVFSSGNHAYHASMAPKRSGSWRHTNFHSTSHPRAASIGNKSGIPPVPTIPP
                     NIGHSTDHQHPKANISGSLTKSSSESKNLSTIQSPLKTSNSFFKELSPHSQITLSNVK
                     NNHSHVGSQTKSHSFATPSVFDNNKPVSSDNHNNTTTSSQVHPDSRNPDPKAAPKAVS
                     QKTNVDGHRNHEAKHGNTVQNESKSQKSSNKEGRSSRGGFFSRLSFSRSSSRMKKGSK
                     AKHEDAPDVPAIPHAYIADSSTKSSYRNGKKTPTRTKSRMQQFINWFKPSKERSSNGN
                     SDSASPPPVPRLSITRSQVSREPEKPEEIPSVPPLPSNFKDKGHVPQQRSVSYTPKRS
                     SDTSESLQPSLSFASSNVLSEPFDRKVADLAMKAINSKRINKLLDDAKVMQSLLDRAC
                     IITPVRNTEVQLINTAPLTEYEQDEINNYDNIYFTGLRNVDKRRSADENTSSNFGFDD
                     ERGDYKVVLGDHIAYRYEVVDFLGKGSFGQVLRCIDYETGKLVALKIIRNKKRFHMQA
                     LVETKILQKIREWDPLDEYCMVQYTDHFYFRDHLCVATELLGKNLYELIKSNGFKGLP
                     IVVIKSITRQLIQCLTLLNEKHVIHCDLKPENILLCHPFKSQVKVIDFGSSCFEGECV
                     YTYIQSRFYRSPEVILGMGYGTPIDVWSLGCIIAEMYTGFPLFPGENEQEQLACIMEI
                     FGPPDHSLIDKCSRKKVFFDSSGKPRPFVSSKGVSRRPFSKSLHQVLQCKDVSFLSFI
                     SDCLKWDPDERMTPQQAAQHDFLTGKQDVRRPNTAPARQKFARPPNIETAPIPRPLPN
                     LPMEYNDHTLPSPKEPSNQASNLVRSSDKFPNLLTNLDYSIISDNGFLRKPVEKSRP"
     gene            537888..540012
                     /gene="pmc2"
                     /locus_tag="SPAC2F7.04"
                     /gene_synonym="med1"
                     /db_xref="GeneID:2542516"
     mRNA            join(537888..538628,538675..539322,539365..540012)
                     /gene="pmc2"
                     /locus_tag="SPAC2F7.04"
                     /gene_synonym="med1"
                     /product="mediator complex subunit Pmc2/Med1"
                     /transcript_id="NM_001018375.2"
                     /db_xref="GeneID:2542516"
     CDS             join(538395..538628,538675..539322,539365..539847)
                     /gene="pmc2"
                     /locus_tag="SPAC2F7.04"
                     /gene_synonym="med1"
                     /codon_start=1
                     /product="mediator complex subunit Pmc2/Med1"
                     /protein_id="NP_592975.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.04.1"
                     /db_xref="GeneID:2542516"
                     /db_xref="GOA:Q09696"
                     /db_xref="InterPro:IPR019680"
                     /db_xref="PomBase:SPAC2F7.04"
                     /db_xref="PomBase:SPAC2F7.04.1"
                     /translation="MDRPHLFSEVHFRRNASNPNQINWTRYWIDCLSSVPWNDISVTG
                     FEYLAKKYGLEVFQDSSKPNEVVLSLAGKIILIDITVPINASPKDINVVLAFANASGE
                     QYNNPVAEKLLKDAIYNCNTPLFEKNVKWLATFDHSSPSVQQSCFQYLDSLSSSLNAI
                     YEAELSLLAQEENVIMHGNGKPLSNYEGQLGLRIVYWKLLDKTYSTQIFMDNLSHESL
                     PHLLFGYNLLNSPPILQSSKINWALENTLTPIPTTMELVFDDINLIIPEQGVKPLLDL
                     LHVHDITIPWPVQNYSHMLGLPSKSTVNYKFINKNQAIQLTGFDVSARSLRHVPFHHP
                     KQIRGILAIVRQYLLLQLILENIKSADLAETAASSSLHLSLYFKEHPIVHAQYQEINK
                     LNNSEQIIIVLSVLSDGRLNVDYMSSGGKELSKQQSHVFQKLIQQTCNIGLAIEVFIK
                     KVVN"
     gene            complement(539919..541640)
                     /locus_tag="SPAC2F7.05c"
                     /db_xref="GeneID:2541629"
     mRNA            complement(539919..541640)
                     /locus_tag="SPAC2F7.05c"
                     /product="eukaryotic translation initiation factor 5"
                     /transcript_id="NM_001018376.2"
                     /db_xref="GeneID:2541629"
     CDS             complement(540125..541312)
                     /locus_tag="SPAC2F7.05c"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 5"
                     /protein_id="NP_592976.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.05c.1"
                     /db_xref="GeneID:2541629"
                     /db_xref="GOA:Q09689"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="PomBase:SPAC2F7.05c"
                     /db_xref="PomBase:SPAC2F7.05c.1"
                     /translation="MATINIRRDVKDSFYRYRMPKLQSKIEGKGNGIKTVIPNMSDIA
                     KALGRPPLYVTKFFGFELGAQTTIIADMDRYIVNGAHDAGKLQDLLDVFIRRFVLCAS
                     CQNPETELSINKKDQTISYDCKACGYRGVIDGRHKLTGVIVKNPPAKKKSHKHKRDSP
                     VAEEEDGAEDELTRRIRQEAAELPTAEVVNDEDWAVDTSEEAVRARVQELEGNMKDSL
                     TLSDLRGDEEEAESSRYDQFGEWLEDNYPGVSDVEIYKKMKEENIHHKSKAIVVLVQC
                     IITSPYVGEFEKHGALFKKLCTTDKHERALLGGFERLMENTELVHIDVVPKVLLEIYQ
                     NDLVSDDMFEKWGAKASKKYVSRETSKKIHEAAEPFLTWLAEASDESESEDEEEEEED
                     DDE"
     gene            complement(541576..543735)
                     /gene="pol4"
                     /locus_tag="SPAC2F7.06c"
                     /db_xref="GeneID:2541638"
     mRNA            complement(541576..543735)
                     /gene="pol4"
                     /locus_tag="SPAC2F7.06c"
                     /product="DNA polymerase X family"
                     /transcript_id="NM_001018377.2"
                     /db_xref="GeneID:2541638"
     gene            541795..543483
                     /locus_tag="SPNCRNA.552"
                     /db_xref="GeneID:9407040"
     misc_RNA        541795..543483
                     /locus_tag="SPNCRNA.552"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150921.1"
                     /db_xref="GeneID:9407040"
     gene            541797..544030
                     /locus_tag="SPNCRNA.660"
                     /db_xref="GeneID:14218081"
     misc_RNA        541797..544030
                     /locus_tag="SPNCRNA.660"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151025.1"
                     /db_xref="GeneID:14218081"
     CDS             complement(542037..543557)
                     /gene="pol4"
                     /locus_tag="SPAC2F7.06c"
                     /EC_number="2.7.7.6"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /product="DNA polymerase X family"
                     /protein_id="NP_592977.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.06c.1"
                     /db_xref="GeneID:2541638"
                     /db_xref="GOA:Q09693"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR002008"
                     /db_xref="InterPro:IPR002054"
                     /db_xref="InterPro:IPR010996"
                     /db_xref="InterPro:IPR018944"
                     /db_xref="InterPro:IPR019843"
                     /db_xref="InterPro:IPR022312"
                     /db_xref="InterPro:IPR027421"
                     /db_xref="InterPro:IPR028207"
                     /db_xref="InterPro:IPR029398"
                     /db_xref="PomBase:SPAC2F7.06c"
                     /db_xref="PomBase:SPAC2F7.06c.1"
                     /translation="MKILASSTNYVLHNRLSNSQYEDARSKIVNFGGEFTNDAAKADY
                     IFVNYSQINRVRRELRTIGTPLETCVSCKLIVKIDWLNEPKESLTPGNPYVIWHRKPE
                     MKVGSPYTPSTRPASHTEAPNDFENHETPNTENNNEVKSIDNVDQEGSVYPTTKEYPY
                     VLEIPRYACQRKTPLKCVNQAFVNALSVLKTCREVNGESVRTRAYGMAIATIKAFPLP
                     IDSAEQLEKMPGCGPKIVHLWKEFASTGTLKEAEEFQKDPASKILLLFYNIFGVGASH
                     AAEWYQKGWRTIEQVRKHKDSFTKQIKVGLEFYEDFCKTVTIEEATEIYETIVSRMPD
                     GIKIQSCLVGGFRRGKPVGADVDMVLSPSHTHSTKHLVDVLLRILDEEFQFRLISVQE
                     HSCGGKKGYVMLAVILSNSSKINRRVDIIVVPPAYIGSAVLGWSGGIFFLRDLKLYAN
                     SHLGLSYDSFEIINLKTGKDICPDEFNEWKDPVEAEKDIFRYFSLEYIEPKFRNTG"
     gene            complement(544127..>546240)
                     /gene="cph2"
                     /locus_tag="SPAC2F7.07c"
                     /gene_synonym="rco1"
                     /db_xref="GeneID:2541422"
     mRNA            complement(544127..>546240)
                     /gene="cph2"
                     /locus_tag="SPAC2F7.07c"
                     /gene_synonym="rco1"
                     /product="Clr6 histone deacetylase-associated PHD
                     protein-2 Cph2"
                     /transcript_id="NM_001018378.2"
                     /db_xref="GeneID:2541422"
     CDS             complement(544417..546240)
                     /gene="cph2"
                     /locus_tag="SPAC2F7.07c"
                     /gene_synonym="rco1"
                     /codon_start=1
                     /product="Clr6 histone deacetylase-associated PHD
                     protein-2 Cph2"
                     /protein_id="NP_592978.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.07c.1"
                     /db_xref="GeneID:2541422"
                     /db_xref="GOA:Q09698"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="PomBase:SPAC2F7.07c"
                     /db_xref="PomBase:SPAC2F7.07c.1"
                     /translation="MDAKPWNHTSEAFQASILEDLKIIQKAGAERNAKSSHGSINSRS
                     ASPNKATSRRNRAQNGNSNGRASVDNSDDGSKDDLDYSPSVKRKHVNGEGAEKGDHDT
                     SNNGPSITKLRRKVRRTYDTKDGFVAWNTLDDDFRPIVPDQERSRKINPQKGNNNNLL
                     KENKSLKTTAKDLSDISSSSMKKANNSSKPLFSGKLTFKANIPVPTSEVVTENNVTRN
                     VTVYSNQKHLGNESENFNDMEGRAEDISSNELLPTPEEYPYRYNNDYCSACHGPGNFL
                     CCETCPNSFHFTCIDPPIEEKNLPDDAWYCNECKHHSLYNELDEQEELESNVKEEGTM
                     VDVWMQLCTYIDSHNPIQFHLPHSISSFFRGVGSGVMGEYIETDVLKHLKSSRRSNGE
                     ERDPLLLKSKSGTPILCFRCHKSALVSQSILACDYCNSYWHPDCLNPPLATLPSNLRK
                     WKCPNHSDHVTPRYRLPEKAKVIRVGLPRGFKNKGNIVIDENEDEPSVQTIQLQGKIR
                     VVPSKPFKLNFLEQIRDNVINLRKMVEQDEQLCIETFSKFDFYATRDCELPLRILCDV
                     ANDNLENDDYVLALRDLLRISKWDPNQPVPAPFDLANLLSY"
     gene            complement(<546664..>548562)
                     /gene="snf5"
                     /locus_tag="SPAC2F7.08c"
                     /db_xref="GeneID:2541801"
     mRNA            complement(<546664..>548562)
                     /gene="snf5"
                     /locus_tag="SPAC2F7.08c"
                     /product="SWI/SNF complex subunit Snf5"
                     /transcript_id="NM_001018379.1"
                     /db_xref="GeneID:2541801"
     CDS             complement(546664..548562)
                     /gene="snf5"
                     /locus_tag="SPAC2F7.08c"
                     /codon_start=1
                     /product="SWI/SNF complex subunit Snf5"
                     /protein_id="NP_592979.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.08c.1"
                     /db_xref="GeneID:2541801"
                     /db_xref="GOA:Q09699"
                     /db_xref="InterPro:IPR006939"
                     /db_xref="PomBase:SPAC2F7.08c"
                     /db_xref="PomBase:SPAC2F7.08c.1"
                     /translation="MDKDIGSAVAELQVCSTHYAMTIVSCGFHSPQSLMNADLQHCLL
                     ADQNYLLNNSNKNKGSIIEENTRKPFQSARNLQTSLKTHPESAITRYGLGYAGFGNGW
                     TALKPKILFPSQKRRVKGRFTFPFSRRSNLAQSKLPVDLVPIRLEIDADRYKLRDSFT
                     WNLYDKCISLDQFAEQICIDYDIPLHNVHIVQNISKSIQAQINDYEPRKAQSNLSFVS
                     DVSSSTSETVYAHEPSDSLAKASKQQIPTVQNDLRILIKLDITIGRLNLIDQFEWNLF
                     APESSAEEFATVMCLDLGLSGEFCTAVAHSIREQCQMYIKYLSLIGYLFDGSEIEDEE
                     VRSYILPPLKNTLRFSDMESSSFAPMIYELNDAEMERQDRGYDREARRMRRRQGRAKH
                     GIMLPDLRDIPKIHRSLFPSSSVPSDDDFMHALSLSTNSDGETLNEINTNNPEREHLI
                     VRLKVDSQKLKIIVEQSQTLTLNNFQQRKLTPLPNSMSFDSLNEFESERNTPSTYGQN
                     ISPLPQFSSPSLSSDAFLTNSNSSESALVHMQKLNLPDFTPSWVKRCVIETFAKFPND
                     RFNVIVKPALNPAERMTVRICCHDCINEYFTAGPGFTFGNFHIHLLSSSHQQKKEVRM
                     NTVLDRNT"
     gene            548568..549658
                     /locus_tag="SPNCRNA.661"
                     /db_xref="GeneID:14218341"
     misc_RNA        548568..549658
                     /locus_tag="SPNCRNA.661"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151026.1"
                     /db_xref="GeneID:14218341"
     gene            complement(<548768..550726)
                     /locus_tag="SPAC2F7.09c"
                     /db_xref="GeneID:2541882"
     mRNA            complement(<548768..550726)
                     /locus_tag="SPAC2F7.09c"
                     /product="putative GTPase-like protein"
                     /transcript_id="NM_001018380.2"
                     /db_xref="GeneID:2541882"
     CDS             complement(548768..550243)
                     /locus_tag="SPAC2F7.09c"
                     /codon_start=1
                     /product="putative GTPase-like protein"
                     /protein_id="NP_592980.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.09c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.09c.1"
                     /db_xref="GeneID:2541882"
                     /db_xref="GOA:Q09700"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC2F7.09c"
                     /db_xref="PomBase:SPAC2F7.09c.1"
                     /translation="MSFTKFCRGCGQTLQSANESATGYIKPLKLSGIFSKGSVSNLLK
                     KNLDEQAIFNNAFKNLNPQIKKHFPNTTSFPFHEKEIGRTDLLWCQRCHDLKFHSRIR
                     PKELLQEPQTTLPDIISTVNNDKSTCLIIQVIDVTEVIFQDFVSATQYTHFPVFHLFT
                     HADVLPPKKPYWLFPGLGISSKYAMLYTSHSFNLVDKLLGRINPLLCSRGHVYVVGEA
                     NSGKSTLLKTLAKRGNGVFNELLLDSFLPGTTQAIKGYPTQYFGSCFKQLSEGLIFDT
                     PGYRGNLKSLLPWVDTKLLTSLVPKTRSRNKQLTSKPVQYRVRFGQSIILGGLVRVTP
                     FEINEDGNHEVGKPIMFKKEDPSSTTIHFLFSTLKNKKTKGNTNNMKPLLIKLFTKLP
                     AHITSITKLQSLENSTKNDNVPLVTHSPSPMHSSFTVSIKPTQLSENVFDPTSSGELV
                     IHNFGFLSFSASRPMNLLVESVNPKAVSWRSAKPVVPKFNK"
     gene            550630..553595
                     /gene="akr1"
                     /locus_tag="SPAC2F7.10"
                     /db_xref="GeneID:2541757"
     mRNA            550630..553595
                     /gene="akr1"
                     /locus_tag="SPAC2F7.10"
                     /product="putative palmitoyltransferase Akr1"
                     /transcript_id="NM_001018381.2"
                     /db_xref="GeneID:2541757"
     CDS             551011..552939
                     /gene="akr1"
                     /locus_tag="SPAC2F7.10"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /product="putative palmitoyltransferase Akr1"
                     /protein_id="NP_592981.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.10.1"
                     /db_xref="GeneID:2541757"
                     /db_xref="GOA:Q09701"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="PomBase:SPAC2F7.10"
                     /db_xref="PomBase:SPAC2F7.10.1"
                     /translation="MGSLFLAASQGELDTVKNLISSEKIDVNATDEGGATALHWAALN
                     QQIPICKFLLEHGADVNAIGGDLQAAPIHWAAKRGSVKTVHYLVQHGADPLLKDKQGF
                     NCLHLAVHAASPLLVVYLLHLDISVDLRDDQQHTPLMWASYHGNEPITNCLLRWGADV
                     LATDEDKMTPLHWSIVGGNLKCMKLILKEGGIPCTAVTANLSGQLKTPWALASELRVS
                     HLFKQALISNGLKVKETSEEPEKWVVVPSKFQFSQKTFIIFCFLSSFIITGVFFFIMS
                     ICPMVISLIIAPLWIYFTFKYITTCIHANIDIVHFYLETPFLAGIFSSIFFWVWCHSL
                     LYIVPKTLPIKPLSSLLFVLISFTCIGLYVRTAFQNPGYVDKIGAVVQRREEISKLLD
                     KDLFNQSHYCLKCFQVKPPRSYHCGACKRCINRYDHHCPWTGNCVGARNHRTFLLFVF
                     TLSTLIPIYFYVAFYYLQNIPIQKKYESYRCLFISGTICQWSLKDMFVLVASLTLFVN
                     WCWVVVLAFTQICQVAHNVTTAEFRLFKRYGTLVPPTKQNSSPKNGHGIHGSFLRTVC
                     GILGLDQCILLIRESNCFVRCFPSRAELGSQNSTSLSRNLSTVNPYDEGSIIKNCKTF
                     WKQNFLNDGRQDEATRHV"
     gene            555277..559051
                     /gene="nrd1"
                     /locus_tag="SPAC2F7.11"
                     /gene_synonym="msa2"
                     /db_xref="GeneID:2541755"
     mRNA            555277..559051
                     /gene="nrd1"
                     /locus_tag="SPAC2F7.11"
                     /gene_synonym="msa2"
                     /product="RNA-binding protein Nrd1"
                     /transcript_id="NM_001018382.2"
                     /db_xref="GeneID:2541755"
     gene            555300..556109
                     /locus_tag="SPNCRNA.154"
                     /db_xref="GeneID:9406903"
     misc_RNA        555300..556109
                     /locus_tag="SPNCRNA.154"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150428.1"
                     /db_xref="GeneID:9406903"
     CDS             556631..558220
                     /gene="nrd1"
                     /locus_tag="SPAC2F7.11"
                     /gene_synonym="msa2"
                     /codon_start=1
                     /product="RNA-binding protein Nrd1"
                     /protein_id="NP_592982.1"
                     /db_xref="GeneID:2541755"
                     /db_xref="GOA:Q09702"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="PDB:2RT3"
                     /translation="MSSSSPSSQSRLSVPGRTPHLPPLTIPHTVSAEGLATPNTPHAL
                     LPTGLLMGSPFVQSPTSYTSMHGLPFSTTQMAAAPAHPTTGYNVSRVTSPNVANFAPG
                     YFPLPNNTTQPVKTVYVGNLPPNTPIDEILSCVRTGPIESAWILPEKNCAFISFLDPS
                     HATAFFQDAALKRLTIRGTEVKVGWGKNSASNSSVLLAVQQSGACRNVFLGNLPNGIT
                     EDEIREDLEPFGPIDQIKIVTERNIAFVHFLNIAAAIKAVQELPLNPKWSKRRIYYGR
                     DRCAVGLKQPAYFSKGQVGVVGGYPVMGYPPPSPVLQKPDLIMTGNRTVYIGNIHADT
                     TIEEICNAVRGGLLHNIRYLQEKHICFVTFVDPVSAFRFFEMSNIHGLVIRNRRLKIG
                     WGKHSGPLPSNIALAVAGGASRNIYIGNADDSLTIERLKEDFEEFGEIEYVNFFREKN
                     CAFVNFTSLASAINAIDRIKQKKGYENYRISYGKDRCGNPPRTNSKSDVLSVSSDMSM
                     PVDLVVPQQGISGFMPTNSNI"
     gene            complement(558909..560549)
                     /gene="wrs1"
                     /locus_tag="SPAC2F7.13c"
                     /db_xref="GeneID:2541841"
     mRNA            complement(558909..560549)
                     /gene="wrs1"
                     /locus_tag="SPAC2F7.13c"
                     /product="putative tryptophan-tRNA ligase Wrs1"
                     /transcript_id="NM_001018383.2"
                     /db_xref="GeneID:2541841"
     CDS             complement(559317..560504)
                     /gene="wrs1"
                     /locus_tag="SPAC2F7.13c"
                     /EC_number="6.1.1.2"
                     /codon_start=1
                     /product="putative tryptophan-tRNA ligase Wrs1"
                     /protein_id="NP_592983.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.13c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.13c.1"
                     /db_xref="GeneID:2541841"
                     /db_xref="GOA:Q09692"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="PomBase:SPAC2F7.13c"
                     /db_xref="PomBase:SPAC2F7.13c.1"
                     /translation="MSVEEQIVTPWDVKGSIVDGEEKGIDYERLIVQFGTRKITPEQL
                     ERFEKLTGKKPHLLLRRGAFFSHRDFDMILDRYEQKKPFYLYTGRGPSSDSMHLGHMI
                     PFMFCKWLQDVFQVPLVIQLTDDEKFLFKQGVSLEDCQRFARENAKDIIAVGFDPKKT
                     FIFMNSTYVGGAFYQNVVRIAKCITANQSKACFGFTDSDSIGKIHFASIQAAPSFSSS
                     FPHIFNGAKDIPCLIPCAIDQDPYFRLTRDVSGRLKFKKPALLHSRFFPALQGPQSKM
                     SASKDSSAIFMTDTPNKIKNKINRHAFSGGGATIEIHREKGGNPDVDVAYQYLSFFLD
                     DDEKLKQLYNTYKAGTLSTGEMKGECIKLLQQFVSDFQAARSKVDEATLDMFMDGSRK
                     LEW"
     gene            complement(560824..562179)
                     /locus_tag="SPAC2F7.14c"
                     /db_xref="GeneID:2541813"
     mRNA            complement(560824..562179)
                     /locus_tag="SPAC2F7.14c"
                     /product="putative exosome subunit Rrp4"
                     /transcript_id="NM_001018384.2"
                     /db_xref="GeneID:2541813"
     CDS             complement(560978..561967)
                     /locus_tag="SPAC2F7.14c"
                     /codon_start=1
                     /product="putative exosome subunit Rrp4"
                     /protein_id="NP_592984.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.14c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.14c.1"
                     /db_xref="GeneID:2541813"
                     /db_xref="GOA:Q09704"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR025721"
                     /db_xref="InterPro:IPR026699"
                     /db_xref="PomBase:SPAC2F7.14c"
                     /db_xref="PomBase:SPAC2F7.14c.1"
                     /translation="MVTILKPEEFYVSSEADIVNDVSMTEMEDEIMEDEQMGLVDGED
                     VLEEFDKSIHQNLVTPGQLVTDDPQFMRGHGTYFEDGGIYASVAGSVQRVNKLISVKP
                     LRSKYVPEIGDLIIGKIAEVQPKRWKVDIGAKQNAVLMLSSINLPGGIQRRKLETDEL
                     QMRSFFQEGDLLVAEVQQYFSDGSVSIHTRSLKYGKLRNGVFLKVPPALVVRSKSHAY
                     ALAGGVDIILSVNGYVWVSKHNENQHSSVSITRLEEEASESIYSNENDEIDGYTRLNI
                     SRVSICIKGLASRSLPLTQASITNFYESSLVFSNLQDLTVPKNMDQIAMEAMQ"
     repeat_region   complement(563321..563628)
                     /rpt_type=long_terminal_repeat
     gene            563698..565073
                     /gene="rsm24"
                     /locus_tag="SPAC2F7.15"
                     /db_xref="GeneID:2541429"
     mRNA            join(563698..564464,564553..565073)
                     /gene="rsm24"
                     /locus_tag="SPAC2F7.15"
                     /product="putative mitochondrial ribosomal protein subunit
                     S24"
                     /transcript_id="NM_001018385.2"
                     /db_xref="GeneID:2541429"
     CDS             join(564170..564464,564553..565034)
                     /gene="rsm24"
                     /locus_tag="SPAC2F7.15"
                     /codon_start=1
                     /product="putative mitochondrial ribosomal protein subunit
                     S24"
                     /protein_id="NP_592985.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.15"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.15.1"
                     /db_xref="GeneID:2541429"
                     /db_xref="GOA:Q09705"
                     /db_xref="InterPro:IPR017081"
                     /db_xref="InterPro:IPR019349"
                     /db_xref="PomBase:SPAC2F7.15"
                     /db_xref="PomBase:SPAC2F7.15.1"
                     /translation="MAFNPLLSLLKADAIFLGQLSKSSFCATSRAFSVFYFTRFKRSA
                     YVSAPFGIEPHDEKELKTIDDNVHSNNLSWQKIQEHEVIRELYRKAAYELPGLTPYTQ
                     SFKKPADSQIFRFESDVQMSSFEKMNPKVVVTFKVTNIPLLEEKQRHVLRLLVGPRYN
                     PEEDLVRISSDKYSSALQNKYHLIKILTSLIEESKRNAEKFSHVPLNTGHWKYKKCDK
                     RMPQEWLADATTLTSKKKTTIGKQSHNTVLERESIATTDE"
     gene            complement(565035..569485)
                     /gene="pld1"
                     /locus_tag="SPAC2F7.16c"
                     /db_xref="GeneID:2542065"
     mRNA            complement(565035..569485)
                     /gene="pld1"
                     /locus_tag="SPAC2F7.16c"
                     /product="phospholipase D Pld1"
                     /transcript_id="NM_001018386.2"
                     /db_xref="GeneID:2542065"
     CDS             complement(565168..569277)
                     /gene="pld1"
                     /locus_tag="SPAC2F7.16c"
                     /EC_number="3.1.4.4"
                     /codon_start=1
                     /product="phospholipase D Pld1"
                     /protein_id="NP_592986.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.16c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.16c.1"
                     /db_xref="GeneID:2542065"
                     /db_xref="GOA:Q09706"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR015679"
                     /db_xref="InterPro:IPR016555"
                     /db_xref="PomBase:SPAC2F7.16c"
                     /db_xref="PomBase:SPAC2F7.16c.1"
                     /translation="MTIHQGGNSVIDNVPYSLNTNVNDSIYSEKGTGRKDAEDHTPSK
                     ITDLEKNVDHSIPSFPENDPKNYSEFVNLNPPKRPDLEHTRGSSWHTASENVNDLAAN
                     DSTRVQTPEFITQTMEDENVEVPPLERDERDAAAAHTSKANRNSARQMWAQLMASVRK
                     FKREDEKPILKENLPAINLFEAGIPASLPIAKHFIRDKSGQPVLPIITDLIKVSVLDV
                     EPKHNRIHSTFTIQVEYGTGPHAIRWLIYRQLRDFINLHSHFLFFEFQHRFSGRRMKL
                     PKFPKEVLPYLVKLRGYQKILYSNPSDQLIDETHSISDISWESHSQDGDRTTGQPRHA
                     NNGRKKHGNFWTIQGNTLGVYLQEMIHNLQFFPEVNVLYSFLEFSSLGLYLAGAGTFH
                     GKEGFATLKRNYSPTQYMLCCNTTMMKTRSQPFWIIVSESCIILCDNMLSMQPADVFI
                     WDVDFEITRKNFRKAHSKDTNEKIRLSHHSFKIKNRQKVMKLSVRSGRWLQQFINSVQ
                     VAQGLTAWCEIHRFDSFAPVRTNVAVQWMVDARDHMWNVSRAIKNAKRCIMIHGWWLS
                     PELQMRRPYSMAHKWRIDRILNEKAHEGVMVYIMIYRNIDATIPIDSFHTKEHLQSLH
                     PNIYVIRSPSHFRQNALFWAHHEKLVVVDDAITFIGGIDLCFGRYDTPQHILYDDKPV
                     ADKTGLCEQTWRGKDYSNARVHDFFDLTEPYKDMYDRLAVPRMGWHDVSMCIIGQPAR
                     DAARHFVQRWNYLIQCKKPARKTPLLIPPPDFTTDQLTDSQLTGTCEVQVLRSAGLWS
                     LGLVDTVEQSIQNAYVTCIEKSEHFIYIENQFFVTSTTCEGTTIENRVGDALVERIIR
                     AHKNNEKWRGVIMIPLLPGFEGQIDLQEGGSLRLIVECQYRSICHGEHSIFGRLNAKG
                     IDGSKYLRFYGLRGWAHLGENHELVTEMIYVHAKILIADDRVAVIGSANINERSLLGN
                     RDSEIAAVIRDTLTIDSKMDGKPYKVGKFAHTLRKRLMREHLGLETDVLEQREYNMDG
                     LDRDTEWKRVEVWTPDEGNAINGSAYTAEELKMKYRSQSQFTTTPDILRKAEKSMKKL
                     DQRVSLIPSSIEFNIKTQKDKVEFEKNYEKSKKGPDVIANALVGGIPLSLKTKEDSLY
                     ELSKFSQCGEDQRPMVLKDPDHLVPEPSRPHCGNGLVFYDDIPLLEVNPISGETIPKF
                     DASSFEDPVCDEFFEDIWSKVASNNTTIYRHIFRCVPDDEMLTWESYNEWKKYGKRFK
                     EEQARWRQEELSNLHETHEKSENDPKNPKAGSQGSGNTSASEDSKTEKPKTRTNNGLQ
                     VPDKRVVYDLLRGIRGQLVELPLKWMSTESNARNWLSSIDKIPPLEIYD"
     gene            569550..571876
                     /locus_tag="SPAC2F7.17"
                     /db_xref="GeneID:2541478"
     mRNA            join(569550..570406,570549..570647,570885..571876)
                     /locus_tag="SPAC2F7.17"
                     /product="putative peptide chain release factor"
                     /transcript_id="NM_001018387.2"
                     /db_xref="GeneID:2541478"
     CDS             join(570236..570406,570549..570647,570885..571805)
                     /locus_tag="SPAC2F7.17"
                     /codon_start=1
                     /product="putative peptide chain release factor"
                     /protein_id="NP_592987.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2F7.17"
                     /db_xref="EnsemblGenomes-Tr:SPAC2F7.17.1"
                     /db_xref="GeneID:2541478"
                     /db_xref="GOA:Q09691"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR005139"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="PomBase:SPAC2F7.17"
                     /db_xref="PomBase:SPAC2F7.17.1"
                     /translation="MLLTKKVLWYFRHGIEYQIRSIACKKGYSEHNVSRVLIEKARSL
                     SSEYLQFHQVNNKDQSAMTNDTDLAKRIARLRRVHNAYSKFKSLSEQISDLKQMEAQE
                     SDAEVKMMAVTEINEISNKIPKSIEDLENTLLPQADSYALPALIEIRPGVGGTEAAIF
                     ANELVEMYFQYANFKGWNCKFISKSAVQGLEAITEAIFSIEGEGAYGHLMLEGGVHRV
                     QRTPATETKGRVHTSTASVIVLPQVSNDESSSLYDSSEVKIEVMRSRGAGGQHVNRTE
                     SAVRLTHIPTGITVSMQDSRSQHQNKEKAFLVLNSRLAALNAAKENEAERLKRKNQVT
                     SSDRSEKLRTYNFNQNRVTDHRIGLSMHDLSTFMQGEEKFDEFLEKIRIWNREQLLLH
                     SEIV"
     gene            complement(570753..574417)
                     /gene="rga8"
                     /locus_tag="SPAC13A11.01c"
                     /gene_synonym="SPAC2F7.18c"
                     /db_xref="GeneID:2542617"
     mRNA            complement(join(570753..574224,574269..574417))
                     /gene="rga8"
                     /locus_tag="SPAC13A11.01c"
                     /gene_synonym="SPAC2F7.18c"
                     /product="putatiRho-type GTPase-activating protein Rga8"
                     /transcript_id="NM_001018388.2"
                     /db_xref="GeneID:2542617"
     CDS             complement(join(571994..574224,574269..574371))
                     /gene="rga8"
                     /locus_tag="SPAC13A11.01c"
                     /gene_synonym="SPAC2F7.18c"
                     /codon_start=1
                     /product="putatiRho-type GTPase-activating protein Rga8"
                     /protein_id="NP_592988.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC13A11.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC13A11.01c.1"
                     /db_xref="GeneID:2542617"
                     /db_xref="GOA:Q09697"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="PomBase:SPAC13A11.01c"
                     /db_xref="PomBase:SPAC13A11.01c.1"
                     /translation="MISSFSNGFWSKDYATGVKKLFDCLDNGVEENEQVKNLLKLYKE
                     ANEEFGEKLQEITKECLKGKKPENTEDGATSNKAFEGLRSEIANQGKQHIRIAKDLET
                     LIIAPFSKMSIDHSQKLQTSQQVLTNQIKSYEKKYYTLKKTKSAYYNKCRNLEDYEEE
                     SKESNETTSEAITDLTTVSSPQQQSLLENDDDLIQLGFMEFRPEELKEVLAQVLQEIP
                     LQDYRVPILGTYPNTCSGNIIVSWLQENLPVPTLVAAEAFGQDLIAQGFLRHMGVGGS
                     FVNSTNFHYQWKDKAFQFAGLNSVDSLVENAKALPLVGEYLSDYISHRKLYSSETQSQ
                     RLKREVLDANKIYSESVVDLDKCRTLVEETIADHLQFLQKCETDRVLYYKDFFMDLST
                     IISNFLPSMKLLADQIVVYQEIIQPESDIRYILESAATGPFLPRVEIYEDYYNDIKDQ
                     IFGVDVEFLSHRDKKRVPIIVSTILSYLDLLYPTLASDEVRQNIWLVNSPLSSVHQLR
                     EALNHSSSVTKEVLSQYTPSVVIGVLKLYFLELPDSIVPSSAFELIRSIYMNHSNDTP
                     YRLRLLQNLLSQLRRVNLATLSAIITHLNRLITLTPNKETFTINLANSLSLCISRPAT
                     WNLGIQHDKHPTKFMEDLLTYGPSIFEELRKLNSSKRVSDRVLYQSSATPRSTDVSPT
                     RPDSISSVRSHTAVESPRSSFEELQPSEIPAESEFTLENVPTSLIRSSYALNTRKTRR
                     NFSHSSASNESAAIFIDQDAKIVNEAVASRDSSLSGS"
     gene            complement(574652..577171)
                     /gene="erg11"
                     /locus_tag="SPAC13A11.02c"
                     /db_xref="GeneID:2542599"
     mRNA            complement(574652..577171)
                     /gene="erg11"
                     /locus_tag="SPAC13A11.02c"
                     /product="putative sterol 14-demethylase"
                     /transcript_id="NM_001018389.2"
                     /db_xref="GeneID:2542599"
     CDS             complement(575135..576622)
                     /gene="erg11"
                     /locus_tag="SPAC13A11.02c"
                     /EC_number="1.14.13.70"
                     /codon_start=1
                     /product="putative sterol 14-demethylase"
                     /protein_id="NP_592990.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13A11.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC13A11.02c.1"
                     /db_xref="GeneID:2542599"
                     /db_xref="GOA:Q09736"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="PomBase:SPAC13A11.02c"
                     /db_xref="PomBase:SPAC13A11.02c.1"
                     /translation="MAFSLVSILLSIALAWYVGYIINQLTSRNSKRPPIVFHWIPFVG
                     SAVAYGMDPYVFFRECRAKYGDVFTFVCMGRKMTAFLGVQGNDFLFNGKLADLNAEEA
                     YSHLTTPVFGKDVVYDIPNHVFMEHKKFIKSGLGFSQFRSYVPLILNEMDAFLSTSPD
                     FGPGKEGVADLLKTMPVMTIYTASRTLQGAEVRKGFDAGFADLYHDLDQGFSPVNFVF
                     PWLPLPRNRRRDRAHKIMQKTYLKIIKDRRSSTENPGTDMIWTLMSCKYRDGRPLKEH
                     EIAGMMIALLMAGQHTSAATIVWVLALLGSKPEIIEMLWEEQKRVVGENLELKFDQYK
                     DMPLLNYVIQETLRLHPPIHSHMRKVKRDLPVPGSKIVIPANNYLLAAPGLTATEEEY
                     FTHATDFDPKRWNDRVNEDENAEQIDYGYGLVTKGAASPYLPFGAGRHRCIGEQFAYM
                     HLSTIISKFVHDYTWTLIGKVPNVDYSSMVALPLGPVKIAWKRRN"
     gene            577199..578150
                     /locus_tag="SPNCRNA.155"
                     /db_xref="GeneID:9406975"
     misc_RNA        577199..578150
                     /locus_tag="SPNCRNA.155"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150439.1"
                     /db_xref="GeneID:9406975"
     gene            578392..579948
                     /gene="mcp7"
                     /locus_tag="SPAC13A11.03"
                     /gene_synonym="mug32"
                     /db_xref="GeneID:2542548"
     mRNA            join(578392..578586,578681..579948)
                     /gene="mcp7"
                     /locus_tag="SPAC13A11.03"
                     /gene_synonym="mug32"
                     /product="protein Mcp7"
                     /transcript_id="NM_001018390.2"
                     /db_xref="GeneID:2542548"
     CDS             join(578521..578586,578681..579247)
                     /gene="mcp7"
                     /locus_tag="SPAC13A11.03"
                     /gene_synonym="mug32"
                     /codon_start=1
                     /product="protein Mcp7"
                     /protein_id="NP_592991.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13A11.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC13A11.03.1"
                     /db_xref="GeneID:2542548"
                     /db_xref="GOA:Q09739"
                     /db_xref="InterPro:IPR005647"
                     /db_xref="PomBase:SPAC13A11.03"
                     /db_xref="PomBase:SPAC13A11.03.1"
                     /translation="MPPKGLSLAEKRRRLEAIFHDSKDFFQLKEVEKLGSKKQIVLQT
                     VKDVLQSLVDDNIVKTEKIGTSNYYWSFPSDAKRSRESVLGSLQAQLDDLKQKSKTLD
                     ENISFEKSKRDNEGTENDANQYTLELLHAKESELKLLKTQLSNLNHCNPETFELKNEN
                     TKKYMEAANLWTDQIHTLIAFCRDMGADTNQIREYCSIPEDLDDLQLPIL"
     gene            complement(579353..581553)
                     /gene="ubp8"
                     /locus_tag="SPAC13A11.04c"
                     /db_xref="GeneID:2542135"
     mRNA            complement(join(579353..579789,579835..579899,
                     579953..580250,580296..580983,581084..581216,
                     581295..581553))
                     /gene="ubp8"
                     /locus_tag="SPAC13A11.04c"
                     /product="SAGA complex ubiquitin Ubp8"
                     /transcript_id="NM_001018391.2"
                     /db_xref="GeneID:2542135"
     CDS             complement(join(579720..579789,579835..579899,
                     579953..580250,580296..580983,581084..581216,
                     581295..581390))
                     /gene="ubp8"
                     /locus_tag="SPAC13A11.04c"
                     /codon_start=1
                     /product="SAGA complex ubiquitin Ubp8"
                     /protein_id="NP_592992.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13A11.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC13A11.04c.1"
                     /db_xref="GeneID:2542135"
                     /db_xref="GOA:Q09738"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="PomBase:SPAC13A11.04c"
                     /db_xref="PomBase:SPAC13A11.04c.1"
                     /translation="MPGDVEGCQHLKLKPADVENYQKICTQIFSCHFVPRRCSTCKRI
                     NKRSIRCLSCHSVGCLWGHHGEEHAMEHTHMIGVDVKNGHTYCFGCQDYVYQTELETL
                     RFKIKNIKAWQSDHKRLPEKYNQMVCLEAYRKYPPVCATAGLRGIQNLGATCFMSVIL
                     QSILHNPLVRNLFFSGFHTSTDCKRPTCMTCAIDDMFSSIYNSKNKSTFYGPTAVLNL
                     MWKLSKSLCGYSQQDGHEFFVYLLDQMHTESGGGTSMPCTCPIHRIFSGSLKNVVTCL
                     DCKKERVAVDPLMDISLDINEPTLQGCLERFVSKEKVQYSCHSCGSKNAIKQLVFDKL
                     PPTICMQLKRFEQNNFAMSTKIDKQVSYPAFLRMRYNFNQDDVDYQLYSVVCHKGTLD
                     TGHYIAYTYYQNQWFLLDDTTIVEVKESEVLNSQAYLLFYHERQILYSDEMTVKTEN"
     gene            582273..584402
                     /locus_tag="SPAC13A11.05"
                     /db_xref="GeneID:2542130"
     mRNA            582273..584402
                     /locus_tag="SPAC13A11.05"
                     /product="peptidase family M17"
                     /transcript_id="NM_001018392.2"
                     /db_xref="GeneID:2542130"
     CDS             582492..584033
                     /locus_tag="SPAC13A11.05"
                     /codon_start=1
                     /product="peptidase family M17"
                     /protein_id="NP_592993.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13A11.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC13A11.05.1"
                     /db_xref="GeneID:2542130"
                     /db_xref="GOA:Q09735"
                     /db_xref="InterPro:IPR000819"
                     /db_xref="InterPro:IPR008283"
                     /db_xref="InterPro:IPR011356"
                     /db_xref="PomBase:SPAC13A11.05"
                     /db_xref="PomBase:SPAC13A11.05.1"
                     /translation="MKGLGLSTRTFNWSSLSSILLPRIPLATTKADSLILAVRHDKQV
                     FSEDYRQVVDQYFETSPKKNDIRLFWNTQGFVRLAIVQLEENVSEKSVRSAAAEAAKI
                     LKSNGAKSIAVDGMGFPKDAALGAALATYDFSLRRDHLSVYQDEKVVEKENLFTSPAP
                     ERLTFQLLSNTSEKKTATAEENAFKVGLIEAAAQNLARSLMECPANYMTSLQFCHFAQ
                     ELFQNSSKVKVFVHDEKWIDEQKMNGLLTVNAGSDIPPRFLEVQYIGKEKSKDDGWLG
                     LVGKGVTFDSGGISIKPSQNMKEMRADMGGAAVMLSSIYALEQLSIPVNAVFVTPLTE
                     NLPSGSAAKPGDVIFMRNGLSVEIDNTDAEGRLILADAVHYVSSQYKTKAVIEASTLT
                     GAMLVALGNVFTGAFVQGEELWKNLETASHDAGDLFWRMPFHEAYLKQLTSSSNADLC
                     NVSRAGGGCCTAAAFIKCFLAQKDLSFAHLDIAGVMDKQLNSWDCDGMSGRPVRTIIE
                     VARKY"
     gene            complement(584478..587656)
                     /locus_tag="SPNCRNA.662"
                     /db_xref="GeneID:14217869"
     misc_RNA        complement(584478..587656)
                     /locus_tag="SPNCRNA.662"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151027.1"
                     /db_xref="GeneID:14217869"
     gene            complement(585266..587631)
                     /locus_tag="SPNCRNA.553"
                     /db_xref="GeneID:9407112"
     misc_RNA        complement(585266..587631)
                     /locus_tag="SPNCRNA.553"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_150922.1"
                     /db_xref="GeneID:9407112"
     gene            585355..587495
                     /locus_tag="SPAC13A11.06"
                     /db_xref="GeneID:3361478"
     mRNA            585355..587495
                     /locus_tag="SPAC13A11.06"
                     /product="putative pyruvate decarboxylase"
                     /transcript_id="NM_001355983.1"
                     /db_xref="GeneID:3361478"
     CDS             585597..587312
                     /locus_tag="SPAC13A11.06"
                     /EC_number="4.1.1.1"
                     /codon_start=1
                     /product="putative pyruvate decarboxylase"
                     /protein_id="NP_001342796.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC13A11.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC13A11.06.1"
                     /db_xref="GeneID:3361478"
                     /db_xref="GOA:Q09737"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="PomBase:SPAC13A11.06"
                     /db_xref="PomBase:SPAC13A11.06.1"
                     /translation="MSGDILVGEYLFKRLEQLGVKSILGVPGDFNLALLDLIEKVGDE
                     KFRWVGNTNELNGAYAADGYARVNGLSAIVTTFGVGELSAINGVAGSYAEHVPVVHIV
                     GMPSTKVQDTGALLHHTLGDGDFRTFMDMFKKVSAYSIMIDNGNDAAEKIDEALSICY
                     KKARPVYIGIPSDAGYFKASSSNLGKRLKLEEDTNDPAVEQEVINHISEMVVNAKKPV
                     ILIDACAVRHRVVPEVHELIKLTHFPTYVTPMGKSAIDETSQFFDGVYVGSISDPEVK
                     DRIESTDLLLSIGALKSDFNTGSFSYHLSQKNAVEFHSDHMRIRYALYPNVAMKYILR
                     KLLKVLDASMCHSKAAPTIGYNIKPKHAEGYSSNEITHCWFWPKFSEFLKPRDVLITE
                     TGTANFGVLDCRFPKDVTAISQVLWGSIGYSVGAMFGAVLAVHDSKEPDRRTILVVGD
                     GSLQLTITEISTCIRHNLKPIIFIINNDGYTIERLIHGLHASYNEINTKWGYQQIPKF
                     FGAAENHFRTYCVKTPTDVEKLFSDKEFANADVIQVVELVMPMLDAPRVLVEQAKLTS
                     KINKQ"
     gene            588543..590751
                     /locus_tag="SPAC3H8.02"
                     /db_xref="GeneID:2543637"
     mRNA            588543..590751
                     /locus_tag="SPAC3H8.02"
                     /product="putative sec14 cytosolic factor family
                     phosphatidylinositol transporter"
                     /transcript_id="NM_001018394.2"
                     /db_xref="GeneID:2543637"
     CDS             588925..590259
                     /locus_tag="SPAC3H8.02"
                     /codon_start=1
                     /product="putative sec14 cytosolic factor family
                     phosphatidylinositol transporter"
                     /protein_id="NP_592995.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC3H8.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC3H8.02.1"
                     /db_xref="GeneID:2543637"
                     /db_xref="GOA:Q10138"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="PomBase:SPAC3H8.02"
                     /db_xref="PomBase:SPAC3H8.02.1"
                     /translation="MPEGAGRPWNLTELEEEKLKTMWSYLFKLFGITLLERTESWYTV
                     KTHLSDDSSSSSSHRLSSVSYAKSRTRLELTSSSHGSDTRSFNDKTKNVHLERVEKIA
                     SEWDPEGLRVCFWDAVNCDDPDGLLLRFLRARKWNVEAALEMFMKTVHWRSREMNVGE
                     IVCNADHLDKDDDFVRQLRIGKCFIFGEDKHNRPVCYIRARLHKVGDVSPESVERLTV
                     WVMETARLILKPPIETATVVFDMTDFSMSNMDYGPLKFMIKCFEAHYPECLGECIVHK
                     APWLFQGVWSIIKSWLDPVVVSKVKFTRNYRDLQQYINPDNILKEFGGPNPWRYTYPE
                     PCQNEAEALKNVEARKSLRAKKDAIAKQYEEVTMDWILNNGDMAEVKQKRRKLASQLI
                     DAYWNLDKYIRARSVYDRMGLIAPQTSHTLLLSQPTNGDVKESMVEVTSSAT"
     gene            590691..592152
                     /gene="img2"
                     /locus_tag="SPAC3H8.03"
                     /db_xref="GeneID:2543635"
     mRNA            join(590691..591246,591418..592152)
                     /gene="img2"
                     /locus_tag="SPAC3H8.03"
                     /product="putative mitochondrial ribosomal protein subunit
                     Img2"
                     /transcript_id="NM_001018395.2"
                     /db_xref="GeneID:2543635"
     gene            complement(590784..592586)
                     /locus_tag="SPNCRNA.663"
                     /db_xref="GeneID:14218216"
     misc_RNA        complement(590784..592586)
                     /locus_tag="SPNCRNA.663"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151028.1"
                     /db_xref="GeneID:14218216"
     CDS             join(591067..591246,591418..591555)
                     /gene="img2"
                     /locus_tag="SPAC3H8.03"
                     /codon_start=1
                     /product="putative mitochondrial ribosomal protein subunit
                     Img2"
                     /protein_id="NP_592996.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC3H8.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC3H8.03.1"
                     /db_xref="GeneID:2543635"
                     /db_xref="GOA:Q10139"
                     /db_xref="InterPro:IPR007740"
                     /db_xref="PomBase:SPAC3H8.03"
                     /db_xref="PomBase:SPAC3H8.03.1"
                     /translation="MRSSLKPVLSNLRFNSTIASESLRFHVSRTPSKNLPVYLDYKQR
                     GTKILTLIRKIHGDSNALRLRLISTLKMSPKDVYVNKLTNQVVLKGNHIVTVREWLQD
                     QGF"
     gene            592226..593906
                     /locus_tag="SPAC3H8.04"
                     /db_xref="GeneID:2543634"
     mRNA            592226..593906
                     /locus_tag="SPAC3H8.04"
                     /product="putative chromosome segregation protein"
                     /transcript_id="NM_001018396.2"
                     /db_xref="GeneID:2543634"
     CDS             592743..593759
                     /locus_tag="SPAC3H8.04"
                     /codon_start=1
                     /product="putative chromosome segregation protein"
                     /protein_id="NP_592997.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC3H8.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC3H8.04.1"
                     /db_xref="GeneID:2543634"
                     /db_xref="GOA:Q10140"
                     /db_xref="InterPro:IPR025261"
                     /db_xref="PomBase:SPAC3H8.04"
                     /db_xref="PomBase:SPAC3H8.04.1"
                     /translation="MPACYCATSTSLENNELLYKNIRNLFSTSRSFPIEQEWMNLKSI
                     SQMKDFFSNFPGNSKANNHFLCNSPLKFEIFNNEKSVKPSNGPHLFTRCSCRCNKLLS
                     GDYITQQQPIDASAEHSLNAKGINTYSLKNCFQRSGFIGSYEESLFSGHMPYCSSVPF
                     EFSIEIGVISFCRCKPSLVFPPHLKINFVAYSLVGNVDNVQFPYIGRFRLRSQKSDKV
                     MNKGYPFGYRIPSVGQLQLILRQTNGLVIKVFLVPYNVSSMVDCSKTWIRQKHYLQQL
                     DDKSGKILSHLKFGLQLQIICTSAGHHYLYDSQRIIFVQQSLGGLYGNTKIVNETLLS
                     ESCR"
     gene            complement(593901..597586)
                     /gene="mms1"
                     /locus_tag="SPAC3H8.05c"
                     /db_xref="GeneID:2543633"
     mRNA            complement(join(593901..594731,594771..594859,
                     594900..597586))
                     /gene="mms1"
                     /locus_tag="SPAC3H8.05c"
                     /product="putative E3 ubiquitin ligase complex subunit
                     Mms1"
                     /transcript_id="NM_001018397.2"
                     /db_xref="GeneID:2543633"
     CDS             complement(join(593977..594731,594771..594859,
                     594900..597277))
                     /gene="mms1"
                     /locus_tag="SPAC3H8.05c"
                     /codon_start=1
                     /product="putative E3 ubiquitin ligase complex subunit
                     Mms1"
                     /protein_id="NP_592998.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC3H8.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC3H8.05c.1"
                     /db_xref="GeneID:2543633"
                     /db_xref="GOA:Q10141"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="PomBase:SPAC3H8.05c"
                     /db_xref="PomBase:SPAC3H8.05c.1"
                     /translation="MAEIIHHSNVFTWAFHVSEYDGAPLLLLGSFSSVASVSLKRSGD
                     LLLFERFTLPARTRSVALLSSHFLQSESGRHSIANILIATENGKCYLLQLVKTPEKAF
                     PTIRIRDEFVLDTRMYNHEQLGKSIDLCPNASLWATNSFAGDIVFFFSHHPSLSKQVF
                     AQLSIDGIILHTIFVPPKRSSSSCVTYVCLFLDSNSNPRINVYRWSKTETFSDASSYI
                     TFSIPVPSEFSLASHIIPCSNIPDHFLVLLETKICLLSVPQIECGDLKFLQTDLPCSG
                     SHNYPLSIANDNETPNCCYLTYENGDLYRIRYSILSIDINLIGKTGSSLGNLILPCYP
                     YIVFCGDCSDTLVYDVSVSPMSFFGSLIACAPMWDFVYSSSRHNTLLDEDINCNTVYA
                     TAGIGKSGCLVTMRYGCSSTTLLEAILTEGAVLSGIINSNHNSEFYAWLTYPWQTQIL
                     RLHLDGVVEDVTESLFLDDIKALYVINYQNTFIIITGKSIYAVTPSCTKYNLLEVSGD
                     EEFVLAAYNELIFIVKKDLMNFKSQLLTLKLNTLSNGTLELQSLPDSFDLHDVPTCIT
                     SFSLERKLLVILVHPSPYFECVFYDETSHSSVYKVPLTGFQFGYLPHSISYLRKSNRA
                     VYVLISSNSTLLTVYVTLTLEGVPDFKVYSNPISTDLPLTLQSPSDEFSTIYAWSDYL
                     YIVGIDMETEQPTLNQILEVNDSFTCVSGIYDIPNKFQNSESRIIVYYSNNTLYLSEL
                     WLPQRTFSSKLNLAATPKRLLVDKYTNTLIIGCCHVLVNEITTSGLAFYDLTNSRLFP
                     VNWPSMDIKGKPIFKPEELLYSMSFWIVADDQKRKYRYLCIGTGVRKNGLTTGRLLIL
                     TMNKDHDSNAIELRNVITINMKDPIYSVCSIGKHGLCYATGRKIGVKMLDLDSKKFCN
                     SDCELPVRSPIVSMSTYKDYVYTSSLRDSVAVFQYDSENNSLNLVCSDTSSRLGIDCF
                     YISQKKLLFSCDKDRLLTCFKVEGEVCTSTREQMLQPILTTVSQTKTNALTNHLKYSV
                     IRVDKDNHNIVWGLMGCTLDGNIFKILMPNDPTSSDTIIYSDT"
     gene            complement(597665..598076)
                     /locus_tag="SPNCRNA.664"
                     /db_xref="GeneID:14218244"
     misc_RNA        complement(597665..598076)
                     /locus_tag="SPNCRNA.664"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151029.1"
                     /db_xref="GeneID:14218244"
     gene            597723..598290
                     /locus_tag="SPNCRNA.156"
                     /db_xref="GeneID:9407215"
     misc_RNA        597723..598290
                     /locus_tag="SPNCRNA.156"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150450.1"
                     /db_xref="GeneID:9407215"
     gene            complement(598131..599439)
                     /locus_tag="SPNCRNA.665"
                     /db_xref="GeneID:14218059"
     misc_RNA        complement(598131..599439)
                     /locus_tag="SPNCRNA.665"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151030.1"
                     /db_xref="GeneID:14218059"
     gene            598473..600805
                     /gene="aur1"
                     /locus_tag="SPAC3H8.06"
                     /db_xref="GeneID:2543632"
     mRNA            598473..600805
                     /gene="aur1"
                     /locus_tag="SPAC3H8.06"
                     /product="putative inositol phosphorylceramide synthase
                     Aur1"
                     /transcript_id="NM_001018398.2"
                     /db_xref="GeneID:2543632"
     CDS             598916..600184
                     /gene="aur1"
                     /locus_tag="SPAC3H8.06"
                     /codon_start=1
                     /product="putative inositol phosphorylceramide synthase
                     Aur1"
                     /protein_id="NP_592999.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC3H8.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC3H8.06.1"
                     /db_xref="GeneID:2543632"
                     /db_xref="GOA:Q10142"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="PomBase:SPAC3H8.06"
                     /db_xref="PomBase:SPAC3H8.06.1"
                     /translation="MSALSTLKKRLAACNRASQYKLETSLNPMPTFRLLRNTKWSWTH
                     LQYVFLAGNLIFACIVIESPGFWGKFGIACLLAIALTVPLTRQIFFPAIVIITWAILF
                     YSCRFIPERWRPPIWVRVLPTLENILYGSNLSSLLSKTTHSILDILAWVPYGVMHYSA
                     PFIISFILFIFAPPGTLPVWARTFGYMNLFGVLIQMAFPCSPPWYENMYGLEPATYAV
                     RGSPGGLARIDALFGTSIYTDGFSNSPVVFGAFPSLHAGWAMLEALFLSHVFPRYRFC
                     FYGYVLWLCWCTMYLTHHYFVDLVGGMCLAIICFVFAQKLRLPQLQTGKILRWEYEFV
                     IHGHGLSEKTSNSLARTGSPYLLGRDSFTQNPNAVAFMSGLNNMELANTDHEWSVGSS
                     SPEPLPSPAADLIDRPASTTSSIFDASHLP"
     gene            complement(600826..601749)
                     /gene="pac10"
                     /locus_tag="SPAC3H8.07c"
                     /db_xref="GeneID:2543378"
     mRNA            complement(join(600826..601282,601327..601425,
                     601475..601749))
                     /gene="pac10"
                     /locus_tag="SPAC3H8.07c"
                     /product="putative prefoldin subunit 3 Pac10"
                     /transcript_id="NM_001018399.2"
                     /db_xref="GeneID:2543378"
     CDS             complement(join(600883..601282,601327..601425,
                     601475..601485))
                     /gene="pac10"
                     /locus_tag="SPAC3H8.07c"
                     /codon_start=1
                     /product="putative prefoldin subunit 3 Pac10"
                     /protein_id="NP_593000.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC3H8.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC3H8.07c.1"
                     /db_xref="GeneID:2543378"
                     /db_xref="GOA:Q10143"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016655"
                     /db_xref="PomBase:SPAC3H8.07c"
                     /db_xref="PomBase:SPAC3H8.07c.1"
                     /translation="MSSSNPRGIPPAQFFEFKELSMEEAQGHLEKFQEAIAKYKFMET
                     SVVRRVASLDDKIPDIRKTLQSVQFLKERQGDSFTVTYELNDTLNAKAEVEAKDNVYL
                     WLGANVMLEYTVEEAEALLTQKLNSAEETLKACKEDLEFLRAQVTTMEVNTARVYNYT
                     VLLRKKTKM"
     gene            complement(601848..603993)
                     /locus_tag="SPAC3H8.08c"
                     /db_xref="GeneID:2543636"
     mRNA            complement(601848..603993)
                     /locus_tag="SPAC3H8.08c"
                     /product="putative transcription factor"
                     /transcript_id="NM_001018400.2"
                     /db_xref="GeneID:2543636"
     CDS             complement(602060..603751)
                     /locus_tag="SPAC3H8.08c"
                     /codon_start=1
                     /product="putative transcription factor"
                     /protein_id="NP_593001.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC3H8.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC3H8.08c.1"
                     /db_xref="GeneID:2543636"
                     /db_xref="GOA:Q10144"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="PomBase:SPAC3H8.08c"
                     /db_xref="PomBase:SPAC3H8.08c.1"
                     /translation="MSSSPPALKKFRKRSPKSCLICRRRKVKCDRQQPCSRCKERNEV
                     CTYADDTIDKMNVGPHPSHSENASDSETTLEVSPDINPKKNEKFDFYGWRSLFELIKY
                     RKDSDMCSSRPSFSIQAYSSYKDNVVVESLANLLPPFCISQKIVNLFFKTLNVVCPIY
                     DQETVEKSLNNIESPESFSYEDAFTLLPIIAATIQLSDLPDVILNFYNSAGITPLESS
                     RLINLKLNEISEQEYKHLCLPDKEIIQMLLLRAYATKFRTRIRGVNTDLCRSIHVSTL
                     VTPLFQVTEKIGKNTSDLWFALCEIDGLECVLKYRPPFIQHDTYGRLKPLRCFFNDDI
                     SYNFHLLLGRLLDCGVSIYKSVHSLTVSKFIDKLESYESQLSLILVDIEAKFYDPSNE
                     DIQFRYIFLKMVFWTARVNLYQCFITLDSGILEDEETIIGNLGESCIQCVRLLISQIT
                     ILEKRGWLLVALLEIIHALMLAAFCRDKGFEVPSDLGDITLYVQERMVDIVTFDDGMA
                     VRFGYVLRFINSMLHPNEPPMQDAEPETTEDPSKLFADIFDFTSNYFIPSALLDQ"
     gene            604128..606113
                     /locus_tag="SPNCRNA.666"
                     /db_xref="GeneID:14217967"
     misc_RNA        604128..606113
                     /locus_tag="SPNCRNA.666"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151031.1"
                     /db_xref="GeneID:14217967"
     gene            complement(604312..607742)
                     /gene="nab3"
                     /locus_tag="SPAC3H8.09c"
                     /db_xref="GeneID:2543638"
     mRNA            complement(join(604312..604959,605015..605355,
                     605438..607742))
                     /gene="nab3"
                     /locus_tag="SPAC3H8.09c"
                     /product="putative poly(A)-binding protein Nab3"
                     /transcript_id="NM_001018401.2"
                     /db_xref="GeneID:2543638"
     CDS             complement(join(604496..604959,605015..605355,
                     605438..606849))
                     /gene="nab3"
                     /locus_tag="SPAC3H8.09c"
                     /codon_start=1
                     /product="putative poly(A)-binding protein Nab3"
                     /protein_id="NP_593002.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC3H8.09c"
                     /db_xref="EnsemblGenomes-Tr:SPAC3H8.09c.1"
                     /db_xref="GeneID:2543638"
                     /db_xref="GOA:Q10145"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="PomBase:SPAC3H8.09c"
                     /db_xref="PomBase:SPAC3H8.09c.1"
                     /translation="MSSSSKDSSFQVETPVQNILETSTNSELQDQVSSPYEPDYNSPV
                     KQAAASISALQTQDDTLFNNVDERTLENKDGNKSDDANFDQVSGIPSGSLEIPILNSA
                     TSNIRLTPSDTYNNIPVSDTNNEEISKNIYGAPILESTSSDFQSKDSLSTTQPSVSGG
                     NGSTSQSPPSLDVEQNKPFSISNEPVEQETENSSTKDLQVYDFQTASEHLPEQSLQNT
                     TYYDPSKTYSSVNFEEIEYGKSHEKLDLPYRTTDFIPYSKDLSTSPEAHRTSIYSYSA
                     NLPNYYNEHNELHEHHNPQTPSSPESAYSPENLQLNHEAQNVEYLGNNAAEKSLQMNL
                     EDEQRFQQFLKDEESIMSNWYPGQFPSASRLFLGHLNTKSLSKRNLWKVFKIYGPLAQ
                     IVLKANYGFVQFFTNEDCARALNAEQGNFVRGQKLHLEISKIQKKYQNQIENMKKGSH
                     VTKSNQYSEMIGNLPYPTSSRKRTRSPLMSKGKSYDRKGSISMSKNFSPDCEILVTED
                     CPKEFVWGVEKVFQERRLNIHTTCLYRDSNLQVIIKSCIINSVKSIILINAGLAHLGK
                     VSVQVFKDGSSDSEVRCDEYAAVDVMVAASIVHHAKTSLMHSAASSTPSYNGERIVPD
                     VPSPCISTNPNLPALVGSLDSVNLHHLLGFIQNTYSTTSYIPTRVSFNPNDTGGSFGT
                     ITSQSQFVVNEMPKNYARDNYEALHSQESRQRSSVAGNKQLQKILEQLAELKQPDF"
     gene            complement(608406..608831)
                     /locus_tag="SPNCRNA.667"
                     /db_xref="GeneID:14218266"
     misc_RNA        complement(608406..608831)
                     /locus_tag="SPNCRNA.667"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151032.1"
                     /db_xref="GeneID:14218266"
     gene            608893..610703
                     /gene="spo20"
                     /locus_tag="SPAC3H8.10"
                     /gene_synonym="sec14"
                     /db_xref="GeneID:2543628"
     mRNA            join(608893..609150,609199..609501,609698..609820,
                     609884..610703)
                     /gene="spo20"
                     /locus_tag="SPAC3H8.10"
                     /gene_synonym="sec14"
                     /product="sec14 cytosolic factor family Sec14"
                     /transcript_id="NM_001018402.2"
                     /db_xref="GeneID:2543628"
     CDS             join(608992..609150,609199..609501,609698..609820,
                     609884..610159)
                     /gene="spo20"
                     /locus_tag="SPAC3H8.10"
                     /gene_synonym="sec14"
                     /codon_start=1
                     /product="sec14 cytosolic factor family Sec14"
                     /protein_id="NP_593003.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC3H8.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC3H8.10.1"
                     /db_xref="GeneID:2543628"
                     /db_xref="GOA:Q10137"
                     /db_xref="InterPro:IPR001071"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="PomBase:SPAC3H8.10"
                     /db_xref="PomBase:SPAC3H8.10.1"
                     /translation="MSETISDPYPLTNPNAPLGHPGHLNSTQQATLDSMRLELQKLGY
                     TERLDDATLLRFLRARKFNLQQSLEMFIKCEKWRKEFGVDDLIKNFHYDEKEAVSKYY
                     PQFYHKTDIDGRPVYVEQLGNIDLKKLYQITTPERMMQNLVYEYEMLALKRFPACSRK
                     AGGLIETSCTIMDLKGVGITSIHSVYSYIRQASSISQDYYPERMGKFYVINAPWGFSS
                     AFNLIKGFLDEATVKKIHILGSNYKSALLEQIPADNLPAKLGGNCQCPGGCELSDAGP
                     WHEEQWMNKN"
     gene            610842..613338
                     /gene="rrp6"
                     /locus_tag="SPAC1F3.01"
                     /gene_synonym="SPAC3H8.11"
                     /db_xref="GeneID:2543630"
     mRNA            join(610842..611152,611211..613338)
                     /gene="rrp6"
                     /locus_tag="SPAC1F3.01"
                     /gene_synonym="SPAC3H8.11"
                     /product="putative exosome 3'-5' exoribonuclease subunit
                     Rrp6"
                     /transcript_id="NM_001018403.2"
                     /db_xref="GeneID:2543630"
     CDS             join(610886..611152,611211..613277)
                     /gene="rrp6"
                     /locus_tag="SPAC1F3.01"
                     /gene_synonym="SPAC3H8.11"
                     /codon_start=1
                     /product="putative exosome 3'-5' exoribonuclease subunit
                     Rrp6"
                     /protein_id="NP_593004.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F3.01"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F3.01.1"
                     /db_xref="GeneID:2543630"
                     /db_xref="GOA:Q10146"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012588"
                     /db_xref="PomBase:SPAC1F3.01"
                     /db_xref="PomBase:SPAC1F3.01.1"
                     /translation="MDESELFKGLMNSTAYCSELAKVDIPFYKSIDTEFNENIKSVSS
                     RFMRLIELLLSKVDRSRAEDIVDVEDIDNRWAEVSDTLDILFEKADYSIDKAQGLLKK
                     PAIETHASTSDVANKKPKKEKLPYKVIHAAHLTKPQLRFRVQPNNSREFVWSWKLTEK
                     PHSLVPLEKIIAQVKLDPSLKNSLPHPYEPEIQNSVYPPWVSEMSNPIDTGSVDETEP
                     IWVSTESQLSDMLKELQNSKEIAVDLEHHDYRSFRGFVCLMQISNREKDWIVDTLELR
                     EELEALNVVFTNPNIIKVFHGATMDIIWLQRDFGLYVVNLFDTYYATKVLGFEGHGLA
                     FLLQKYCDYDADKRYQMADWRIRPLPREMLKYAQSDTHYLLYIWDHLRNELISKSAER
                     KENLMQSVFNSSKQISLRKYELEPYDPIYGLGTDGWRNVLTKFGSSKIIGREALMIYR
                     ALHDWRDSVARKEDESVRYVLPNRLLIAIAASKPVEAADVFSISKQLTPIARMYVEDI
                     VKVVQEAEKLYNEQVDREKSQFKEVEKQNQPLAVFSESNTLGDYKVDSSVFEISKQNR
                     SKLKTLLANGSAFWIEGQSQDDLRKARKERLFIVNQNIPFSLTLPCTQGHVESELNVK
                     QSTVTEAANPSLNGEKKQEPIVIRDLGLNKQKRDSSKLNHKEPSNPIEERNEDIEPSE
                     ASTSVSKKRKQKKKKKNSGKLTIEAEHVSNDSPIINEAPFDYKNQKNFIADLDSDVGK
                     NKFGKRGFNPLNKVSLPKRNTRELKKRKVSDGKSTSY"
     gene            complement(613369..617324)
                     /gene="mkh1"
                     /locus_tag="SPAC1F3.02c"
                     /db_xref="GeneID:2542175"
     mRNA            complement(613369..617324)
                     /gene="mkh1"
                     /locus_tag="SPAC1F3.02c"
                     /product="MEK kinase (MEKK) Mkh1"
                     /transcript_id="NM_001018404.2"
                     /db_xref="GeneID:2542175"
     CDS             complement(613498..616848)
                     /gene="mkh1"
                     /locus_tag="SPAC1F3.02c"
                     /codon_start=1
                     /product="MEK kinase (MEKK) Mkh1"
                     /protein_id="NP_593005.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F3.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F3.02c.1"
                     /db_xref="GeneID:2542175"
                     /db_xref="GOA:Q10407"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PomBase:SPAC1F3.02c"
                     /db_xref="PomBase:SPAC1F3.02c.1"
                     /translation="MAADIGSQSSGSLEERFEQSLHLQNVDKQDWSLNSVLQFLKLYK
                     FNKEWEDVFIKSRIEMDLFINLADQSKAEEFAFKNKLSKESAIQLSSCIRKTLLAPSS
                     TRVPSKNSSYETLTYSAKDSSDDVFTETNSGFRSSNQNSSLKSFQSVPDSNVNVFGGF
                     GGSVVDNNELLSTGKNSHQTTSLNLEGSPINLHAYKGTVTSIINDDSRNINKKTLSKQ
                     PVSEHKEKQTSFLRRFRVPGFSRDKDKTKDCPSSNSNPFHLASSNVKTLDASLDQGEW
                     VPRIHRLESQIGLISKKKSFVLATMDDMKFTVVDITNVQNATQLRKLIAKSMYLDISI
                     DQFDLFLTEVGGAQYIEILDDRKLDIARLYSDEFGTIKFFVKPSQNEESGMDSDTYLS
                     FGTKSSSTYKADDDSIYHRKEDFKKQPSYPVLTSDFEITDAGPNLSLSGHQPDNKYYK
                     GFSSAPNLAVVPELPSRRFRGFEKIRGAKGEMATKILDATEAQSEKNKFTVCRPHKKV
                     TLKMPLNSGSSAPQSPSSNTSASVLTRNFVAHRDPPPPPTETSSLRRKNTLTRRPSIR
                     HARSSPYIDTGHNEASKFSHTSFDPKASSKSSNSLKESVEALSEIPFEDAPALDESDL
                     SGDPFWAIQPKQSSSQVPKENHHNIQSKLSINTEAATDLKANELSSPKTPEYCRGDDR
                     SISLSPLSYRLRKSKHIRESPPSSKVINSGNWEVRPSADDLYEDVDRFFPRYDLDKVL
                     VVDQSRMVSSPSKVSIRPKMKSVRLLAREASEARKEIRHNARRNKSGNLLRRSSTKLW
                     GSRIVELKPDTTITSGSVVSQNATFKWMKGELIGNGTYGKVFLAMNINTGELIAVKQV
                     EIPQTINGRHDQLRKDIVDSINAEISMIADLDHLNIVQYLGFEKTETDISIFLEYVSG
                     GSIGRCLRNYGPFEEQLVRFVSRQVLYGLSYLHSKGIIHRDLKADNLLIDFDGVCKIS
                     DFGISKHSDNVYDNDANLSMQGSIFWMAPEVIHNDHQGYSAKVDVWSLGCVVLEMLAG
                     RRPWSTDEAIQAMFKLGTEKKAPPIPSELVSQVSPEAIQFLNACFTVNADVRPTAEEL
                     LNHPFMKCDEEFNFKDTNLYDMLCKRKS"
     repeat_region   617366..617715
                     /rpt_type=long_terminal_repeat
     gene            617816..622703
                     /locus_tag="SPAC1F3.03"
                     /db_xref="GeneID:2542372"
     mRNA            join(617816..617945,617993..618422,618471..620376,
                     620420..622703)
                     /locus_tag="SPAC1F3.03"
                     /product="putative Lgl family protein"
                     /transcript_id="NM_001018405.2"
                     /db_xref="GeneID:2542372"
     CDS             join(617844..617945,617993..618422,618471..620376,
                     620420..620996)
                     /locus_tag="SPAC1F3.03"
                     /codon_start=1
                     /product="putative Lgl family protein"
                     /protein_id="NP_593006.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F3.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F3.03.1"
                     /db_xref="GeneID:2542372"
                     /db_xref="GOA:Q10408"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013905"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="PomBase:SPAC1F3.03"
                     /db_xref="PomBase:SPAC1F3.03.1"
                     /translation="MSFFKKKLSKGKEILSKSNLKTHTSSNASLSIDDLNRFGFSLNP
                     VLWCLDHQQGLLAIVSSTNRIYIYGKQHVQSVIVPDCSTIVHIALCAAYLIVIDSRNT
                     VLSYPLMKHRDLSKPAATYFLKQKVTCTVTDPTIDWVFFGMSDGSVVPWDVTRHCLGK
                     FKVPNLYVPRHEEWRMMGYSYAPVPGKLSPVVSVQIHPKDLGVILIAYPDGVVLYSIR
                     TDEVIRFYELEYAPGSTAAVLSPHNYRRPIVKGIEWSPWGDHFVSYYTDSTFAFWDVD
                     QEYPVQVRNFVDSNIHTYTPMQRNPPKTELEPIRSMRWCCCEDPTVSFILMLGGLPKE
                     APVKGISLFSYRNLPAKKDVETFAEFFANPNSQRFFPFIDIPPVRDMLVIPSSSPHYN
                     GSHNPKNLLLLSEDNSLSLLDISTGNISNMSLSIPPSLCFLASDFRVIAFQTVTKKVW
                     NQIEDTISVNSHYSCLFGGSPSPGYLKKLDERNLLITSTGLSLSIWDISQGFMNPSLC
                     VNLDFSSVMRKHLTPSAFITTASFSTYNPEFSCADSFGRVIVCKRKNHKENLPAQLAN
                     GIYRLDDTLVLEGTLHAQYYIDLKRGRVTLNQMSNIGFVCIGYQDGGITIIDMRGPHI
                     LCNTSISELGLERRGKPDPDFLTSAEFVVMNPKGSPSSIYVVTGTYRGMTLLFRIDPS
                     SSGRFSAYFESSRQLDIKNIYKICSLTQDGQIATATGSSLQSVGYPLPQEVFLVYIGD
                     SGISVFNKINNQVGNLDWRKPVCCRAALVLSTVSKHMGSVVCVNSDLSVNWYSLPNLR
                     EERKMQLPLDIDKNRLKEGDILGNGDYIFPTLGAHELAFGCVLGSGRTLANLAPMMLI
                     THNASHVPPRPSKSLWNWLLGEQSTSAEELDILLGGENRAESKVHTLETPKVISARPA
                     ESVKQPLTPVPSMTSQSAQSYIPPRRQQQQKGFFAQINDHLAQRGNMLGGIENTMDDL
                     EEMSAEWANEIKDSLAGTKKDLILSGLKSYIP"
     gene            complement(621054..622267)
                     /gene="tsr3"
                     /locus_tag="SPAC1F3.04c"
                     /db_xref="GeneID:2542142"
     mRNA            complement(join(621054..621852,621989..622267))
                     /gene="tsr3"
                     /locus_tag="SPAC1F3.04c"
                     /product="putative SSU-rRNA maturation protein Tsr3"
                     /transcript_id="NM_001018406.2"
                     /db_xref="GeneID:2542142"
     CDS             complement(join(621189..621852,621989..622191))
                     /gene="tsr3"
                     /locus_tag="SPAC1F3.04c"
                     /codon_start=1
                     /product="putative SSU-rRNA maturation protein Tsr3"
                     /protein_id="NP_593007.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F3.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F3.04c.1"
                     /db_xref="GeneID:2542142"
                     /db_xref="GOA:Q10409"
                     /db_xref="InterPro:IPR007177"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR022968"
                     /db_xref="PomBase:SPAC1F3.04c"
                     /db_xref="PomBase:SPAC1F3.04c.1"
                     /translation="MGPRSSNRRSNAKDGFKGSNKASKFPLPLAMWDFGHCNPNACSG
                     KRLERLGCVRNLRIGQKFRGVVITPNGKVPVSPADKEYFDNGGASVVECSWARIEEIP
                     FSRIGGRCERLLPYLVASNPVNYGRPWRLNCAEALAACMYIVGYPNEARLLMDNFKWG
                     HSFFEVNEELLDIYAQCHDAQDIQEKEKKYLEEMEASYQEQRNQTTDDIWSAGNLNHK
                     PTLNTSSTHSNSEESRSPLHEPSEASLAHDEHSIPTDDNEETLTNLQANDVDEDEVWR
                     KIVRMKVHSTDT"
     gene            623091..625407
                     /locus_tag="SPAC1F3.05"
                     /db_xref="GeneID:2541469"
     mRNA            join(623091..623305,623375..623462,623518..623593,
                     623752..625407)
                     /locus_tag="SPAC1F3.05"
                     /product="adaptin family protein"
                     /transcript_id="NM_001018407.2"
                     /db_xref="GeneID:2541469"
     CDS             join(623272..623305,623375..623462,623518..623593,
                     623752..625086)
                     /locus_tag="SPAC1F3.05"
                     /codon_start=1
                     /product="adaptin family protein"
                     /protein_id="NP_593008.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F3.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F3.05.1"
                     /db_xref="GeneID:2541469"
                     /db_xref="GOA:Q10410"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR004152"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR018205"
                     /db_xref="PomBase:SPAC1F3.05"
                     /db_xref="PomBase:SPAC1F3.05.1"
                     /translation="MRSSQTLSKYIDKATDQFNLEPNLALNIEIADLINEKKGNTPRE
                     AALLILKRVNSANPTVSYLALHLLDICVKNCGYPFHFQIASEEFLNGFVSRFPNHPIS
                     RMNKIQSKMLEMLEEWNYMLCKNNRHREDFSRIHDIRELMAFRGYKFPAVDEDSIAVM
                     KPNNSLRSAQELAREDLEAHKAKLQELLRRGTPMDLAEANALMKVIAGYDEENTEDYS
                     ALAAADLESIRSKALRVKQFLVNQTVSLEEGTLADAVESLKVYQTKIARILREENEDE
                     YYVQKLLSLNDLLINVIEECSNSDLIHSGTNVVSSQPNVVESHVPPSSNDTKQESSLI
                     DLMKLTEEPAVPSPSLPTNVPANQSLSMLSSLSNSMSSTSNGALNSPSYSQAAIPNTN
                     SSLTSILQSDSLMISTQLTSVQKSSGFASYSVQFSNCSLTWPVSEVVFQVAVVKSLKL
                     QLLPHTGDAIIAPGKQNAAHEIMNITNIPADASDLRIRWRVQWIIGTDHRVEQGESHL
                     PL"
     gene            complement(625173..631401)
                     /gene="spo15"
                     /locus_tag="SPAC1F3.06c"
                     /db_xref="GeneID:2541649"
     mRNA            complement(625173..631401)
                     /gene="spo15"
                     /locus_tag="SPAC1F3.06c"
                     /product="sporulation protein Spo15"
                     /transcript_id="NM_001018408.2"
                     /db_xref="GeneID:2541649"
     CDS             complement(625430..631303)
                     /gene="spo15"
                     /locus_tag="SPAC1F3.06c"
                     /codon_start=1
                     /product="sporulation protein Spo15"
                     /protein_id="NP_593009.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F3.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F3.06c.1"
                     /db_xref="GeneID:2541649"
                     /db_xref="GOA:Q10411"
                     /db_xref="PomBase:SPAC1F3.06c"
                     /db_xref="PomBase:SPAC1F3.06c.1"
                     /translation="MSNQSSSGSNTSDLDEESASSLVSSAASPFIDSDLETPRPNISR
                     ASTGQLAEDGDTSSQHEDSSEELKRQEVRGMRRHSDLSIDAKLGSSEGSTASSALPLT
                     PRSPSNASWLLVRGGLLDSPILDINSVTQKSNLLNELKQVRSKLAALEHENGILSLQL
                     SSSNKKDKNTSSVTTLTSEEDVSYFQKKLTNMESNFSAKQSEAYDLSRQLLTVTEKLD
                     KKEKDYEKIKEDVSSIKASLAEEQASNKSLRGEQERLEKLLVSSNKTVSTLRQTENSL
                     RAECKTLQEKLEKCAINEEDSKLLEELKHNVANYSDAIVHKDKLIEDLSTRISEFDNL
                     KSERDTLSIKNEKLEKLLRNTIGSLKDSRTSNSQLEEEMVELKESNRTIHSQLTDAES
                     KLSSFEQENKSLKGSIDEYQNNLSSKDKMVKQVSSQLEEARSSLAHATGKLAEINSER
                     DFQNKKIKDFEKIEQDLRACLNSSSNELKEKSALIDKKDQELNNLREQIKEQKKVSES
                     TQSSLQSLQRDILNEKKKHEVYESQLNELKGELQTEISNSEHLSSQLSTLAAEKEAAV
                     ATNNELSESKNSLQTLCNAFQEKLAKSVMQLKENEQNFSSLDTSFKKLNESHQELENN
                     HQTITKQLKDTSSKLQQLQLERANFEQKESTLSDENNDLRTKLLKLEESNKSLIKKQE
                     DVDSLEKNIQTLKEDLRKSEEALRFSKLEAKNLREVIDNLKGKHETLEAQRNDLHSSL
                     SDAKNTNAILSSELTKSSEDVKRLTANVETLTQDSKAMKQSFTSLVNSYQSISNLYHE
                     LRDDHVNMQSQNNTLLESESKLKTDCENLTQQNMTLIDNVQKLMHKHVNQESKVSELK
                     EVNGKLSLDLKNLRSSLNVAISDNDQILTQLAELSKNYDSLEQESAQLNSGLKSLEAE
                     KQLLHTENEELHIRLDKLTGKLKIEESKSSDLGKKLTARQEEISNLKEENMSQSQAIT
                     SVKSKLDETLSKSSKLEADIEHLKNKVSEVEVERNALLASNERLMDDLKNNGENIASL
                     QTEIEKKRAENDDLQSKLSVVSSEYENLLLISSQTNKSLEDKTNQLKYIEKNVQKLLD
                     EKDQRNVELEELTSKYGKLGEENAQIKDELLALRKKSKKQHDLCANFVDDLKEKSDAL
                     EQLTNEKNELIVSLEQSNSNNEALVEERSDLANRLSDMKKSLSDSDNVISVIRSDLVR
                     VNDELDTLKKDKDSLSTQYSEVCQDRDDLLDSLKGCEESFNKYAVSLRELCTKSEIDV
                     PVSEILDDNFVFNAGNFSELSRLTVLSLENYLDAFNQVNFKKMELDNRLTTTDAEFTK
                     VVADLEKLQHEHDDWLIQRGDLEKALKDSEKNFLRKEAEMTENIHSLEEGKEETKKEI
                     AELSSRLEDNQLATNKLKNQLDHLNQEIRLKEDVLKEKESLIISLEESLSNQRQKESS
                     LLDAKNELEHMLDDTSRKNSSLMEKIESINSSLDDKSFELASAVEKLGALQKLHSESL
                     SLMENIKSQLQEAKEKIQVDESTIQELDHEITASKNNYEGKLNDKDSIIRDLSENIEQ
                     LNNLLAEEKSAVKRLSTEKESEILQFNSRLADLEYHKSQVESELGRSKLKLASTTEEL
                     QLAENERLSLTTRMLDLQNQVKDLSNIKDSLSEDLRTLRSLEDSVASLQKECKIKSNT
                     VESLQDVLTSVQARNAELEDEVSRSVDKIRRRDDRCEHLSGKLKKLHSQLEEQHETFF
                     RAEQQRMTQLGFLKETVKKQEKLLKKLNLRQEQLIPRSSILVYESYIRDIEKEIIVLQ
                     ERLNGIELSQQLPKGYFGYFFKTNRVEMEVLDSFKQQVAKLQFLAGAEFIVKFKEDLE
                     KCAAEEKEKQATFDNYSEKVENLGKSIEALYFALNREISFRKSLALSKSAYHNLLVRD
                     SPKFNPDSQITYSIPVTNTKQSLLRSAILCVISLQRLRLLGQRHSFCEEVIENLSCV"
     gene            complement(631511..633102)
                     /gene="rsc58"
                     /locus_tag="SPAC1F3.07c"
                     /db_xref="GeneID:2541419"
     mRNA            complement(join(631511..632424,632499..633102))
                     /gene="rsc58"
                     /locus_tag="SPAC1F3.07c"
                     /product="RSC complex subunit Rsc58"
                     /transcript_id="NM_001018409.2"
                     /db_xref="GeneID:2541419"
     CDS             complement(join(631556..632424,632499..632841))
                     /gene="rsc58"
                     /locus_tag="SPAC1F3.07c"
                     /codon_start=1
                     /product="RSC complex subunit Rsc58"
                     /protein_id="NP_593010.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F3.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F3.07c.1"
                     /db_xref="GeneID:2541419"
                     /db_xref="GOA:Q10412"
                     /db_xref="PomBase:SPAC1F3.07c"
                     /db_xref="PomBase:SPAC1F3.07c.1"
                     /translation="MNAESCSLILSYISSAPAGNLVLNCTATTNKQTLEANLKSAVYQ
                     RYPEFLEDWTNVCVHIIHSYFPKDADYWNVDKLYTSVNRITTLEQSKVVGKEIKNGFT
                     FDAENSTASLENDLQPQFRSHALFMVGSAGPLFSSTARTSRLDSRLPDGGIIAKPVAL
                     LPTPSVANSQEYTLDKLSPPSTAKPPASVIEFNPSLAKLPTVKYLQSGPFSSIAPYKN
                     SSSSVIPDSSFHSVACYRASSHYKEAPVEKSIDIDIIQNNLSLLEEDSWTSVPIQGEL
                     VELNKLLQHLQLLQNQRITSHNVLSDEERQISVQVQNLILKLAKDYDMSPEDFLMDDF
                     TLSLTQYGAFYRGTLPLSAQPLELPSQQLLRSQSNAALRSNSLSMNGSLSPSSTNVPL
                     QSYRRTTKSRR"
     gene            632595..633291
                     /locus_tag="SPNCRNA.668"
                     /db_xref="GeneID:14218323"
     misc_RNA        632595..633291
                     /locus_tag="SPNCRNA.668"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151033.1"
                     /db_xref="GeneID:14218323"
     gene            complement(<633148..>633474)
                     /locus_tag="SPAC1F3.08c"
                     /db_xref="GeneID:2541431"
     mRNA            complement(<633148..>633474)
                     /locus_tag="SPAC1F3.08c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018410.1"
                     /db_xref="GeneID:2541431"
     CDS             complement(633148..633474)
                     /locus_tag="SPAC1F3.08c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_593011.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F3.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F3.08c.1"
                     /db_xref="GeneID:2541431"
                     /db_xref="GOA:Q10413"
                     /db_xref="PomBase:SPAC1F3.08c"
                     /db_xref="PomBase:SPAC1F3.08c.1"
                     /translation="MVIYCNWLELKGLLETNDFLYLMRCCYMYDTVSLVSNAPNIYSI
                     PFFYDRICYDYKNILLKYELFIIYYYYYLLICLSPHFFPIKRIRPFHENPLHSFVYRI
                     MISSEA"
     gene            633652..>636959
                     /gene="mug161"
                     /locus_tag="SPAC1F3.09"
                     /db_xref="GeneID:2541461"
     mRNA            join(633652..634971,635069..635235,635349..636176,
                     636234..636314,636385..>636959)
                     /gene="mug161"
                     /locus_tag="SPAC1F3.09"
                     /product="putative CwfJ family splicing factor mug161"
                     /transcript_id="NM_001018411.2"
                     /db_xref="GeneID:2541461"
     gene            complement(633767..634868)
                     /locus_tag="SPNCRNA.669"
                     /db_xref="GeneID:14218260"
     misc_RNA        complement(633767..634868)
                     /locus_tag="SPNCRNA.669"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151034.1"
                     /db_xref="GeneID:14218260"
     gene            complement(634898..639430)
                     /gene="oct1"
                     /locus_tag="SPAC1F3.10c"
                     /db_xref="GeneID:2541640"
     mRNA            complement(634898..639430)
                     /gene="oct1"
                     /locus_tag="SPAC1F3.10c"
                     /product="putative peptidase Oct1"
                     /transcript_id="NM_001018412.2"
                     /db_xref="GeneID:2541640"
     CDS             join(634937..634971,635069..635235,635349..636176,
                     636234..636314,636385..636959)
                     /gene="mug161"
                     /locus_tag="SPAC1F3.09"
                     /codon_start=1
                     /product="putative CwfJ family splicing factor mug161"
                     /protein_id="NP_593012.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F3.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F3.09.1"
                     /db_xref="GeneID:2541461"
                     /db_xref="GOA:Q10414"
                     /db_xref="InterPro:IPR006767"
                     /db_xref="InterPro:IPR006768"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="PomBase:SPAC1F3.09"
                     /db_xref="PomBase:SPAC1F3.09.1"
                     /translation="MIFYDKLKPADVLVIGSADGRVIEAIEYIADLHKQHGFKFAICL
                     GNLFSHKRTTSADVVKLKNEKVKVPIPVYFGVGTAGLPESIISHMAMYGPEVAPNLFC
                     MGICGFMKTFYKFTIAQLGGSYNEEKYYQPPEKFEQSLNEKCFHRSDVQKLSKRCDIL
                     FSSEWPEDVQENSTLPERKLPKGCMPLAALAANCMPQYFFVPGPVYYEREPYKNSAAI
                     NVNTGTVTHFVALAPFKNSKNEKFSYAFTLYPLTTEYMQPAPPNCTASPFEHRPIPLK
                     RASEDQIIPQQTNKFHKSKSSTALFKSKKDSSSSLNKMHKSESHSALNNLHKSESGTS
                     LNNRRSKVGPGSCFFCLSNPNVALHLIVAIGNEAYMALPKGPLTTTASNTPALASSGH
                     VLIIPIAHASALSTLSDTSYEKTLNEMNRFRKAVTDMYNACDSDALVYEISRANGVHL
                     HWQMIPIPKISSHRIESVFLEMAKEAGYDFEERDVEPHELNYFRVFLPSGKILIHRLQ
                     LRERFDLQFGRRAAAKILGLEDRVDWRKCVQTEDEEKAESEAFKMCFKPYDFT"
     CDS             complement(637023..639311)
                     /gene="oct1"
                     /locus_tag="SPAC1F3.10c"
                     /EC_number="3.4.24.59"
                     /codon_start=1
                     /product="putative peptidase Oct1"
                     /protein_id="NP_593013.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1F3.10c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1F3.10c.1"
                     /db_xref="GeneID:2541640"
                     /db_xref="GOA:Q10415"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="PomBase:SPAC1F3.10c"
                     /db_xref="PomBase:SPAC1F3.10c.1"
                     /translation="MQVRTLLTLGKKKVIGNRQCILSLYRKYSNVQSRKAEDQLLRQI
                     FDDQNIAVNQITKRNGIQGVGLFRNHFLSDKDTGFLRLAETASEKCKAVIEDLLLEDT
                     EDGSIVVSKFDRISNLLCSVIDLFEFVRCAHPDKMVVMKAEEAYSYLFELMNTLNTHQ
                     GLYEKLKCSLQQTPTLKDTDPEAYTVGRVFLQDFEKSGVNLESSKRNSFVKKSSESAT
                     LGRAFFNNSMNRPQRYLTISKQRLAGSDPYFVRSLSKNDKNFIMIPTVGYEGTQALIS
                     VANPDVRKEIYMEGHKGTVEEVELLNSYLRSKAEVAKLVGKSSFADLQLIDKMANAPK
                     HVVEFLENLSLKNSSVLKKILNNLALMKKKELNLNFLPSFDVWDREYYTARYKQSLIN
                     QKPSLNPSITNYRRFFSVGTVIQGLSRLFSSLYGLRFVPADISPGEVWHPDVNKVNVY
                     NENDHVMGVIYFDLFARTGKTDGAAHFTIRSSRELDLTSFDDSISLGFDDATNIRVKD
                     NKRYQIPVISLLCNFVRSSGMDPTFLDLWDVKTLFHEMGHAMHSILGHTKYQNLAGTR
                     CATDFVELPSIIMEFFMSNPAVLPLYARYEGTEIPLPVQVLNHHNMVENSSAPLDLQS
                     QICMAMVDQLFHSKVVLDPSFNSIDEVTNVTRKFSGFESAPPAAWYLQFSHLYGYSAT
                     YYSYIFDTVLASLIFSKLFAGNPLSREAGEKFRKAILRWGGSRSPWECVAEALEQPIL
                     ATGGEEAMRRIGSEGIKATSTF"
     gene            639405..641280
                     /locus_tag="SPAC1D4.01"
                     /db_xref="GeneID:5802861"
     mRNA            639405..641280
                     /locus_tag="SPAC1D4.01"
                     /product="hepatocellular carcinoma-associated antigen 59
                     domain-containing protein"
                     /transcript_id="NM_001355984.1"
                     /db_xref="GeneID:5802861"
     CDS             639411..640175
                     /locus_tag="SPAC1D4.01"
                     /codon_start=1
                     /product="hepatocellular carcinoma-associated antigen 59
                     domain-containing protein"
                     /protein_id="NP_001342820.1"
                     /db_xref="GeneID:5802861"
                     /db_xref="GOA:Q10148"
                     /db_xref="InterPro:IPR010756"
                     /translation="MNSIHIKKKSNRSFRRRKVFGNEKEFDLEELDDNDIRLRQALEA
                     TKRRKIRNSIIGINAEKLLNQETKKEKQLNTANEPHEANDQTSAQSSKLIEAQLPTVE
                     DRFAKQTNEVDINTHLLNFVEKKLKQERLAQNYSENGETNALNTKNESTVQNIKNSLH
                     PNEHSFIRDAAALGAIREVDLGIISTDVDNLKNGRKRQKKRARMKEKLDSKALRTSED
                     AARDEFIEKMLKPISQDEESKGIYRRFRVYKDGTQD"
     gene            complement(639545..641680)
                     /locus_tag="SPAC1D4.02c"
                     /db_xref="GeneID:2542452"
     mRNA            complement(join(639545..640947,640997..641184,
                     641281..641401,641448..641680))
                     /locus_tag="SPAC1D4.02c"
                     /product="putative GRASP family protein"
                     /transcript_id="NM_001018414.2"
                     /db_xref="GeneID:2542452"
     CDS             complement(join(640399..640947,640997..641184,
                     641281..641401,641448..641627))
                     /locus_tag="SPAC1D4.02c"
                     /codon_start=1
                     /product="putative GRASP family protein"
                     /protein_id="NP_593015.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1D4.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1D4.02c.1"
                     /db_xref="GeneID:2542452"
                     /db_xref="GOA:Q10149"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR007583"
                     /db_xref="InterPro:IPR024958"
                     /db_xref="PomBase:SPAC1D4.02c"
                     /db_xref="PomBase:SPAC1D4.02c.1"
                     /translation="MFGGLKNFIKEKSEALAGIHRESDESCGFRVLKVENDSKAYNAR
                     IESYYDFITAVNGILLNGDPSMFMALLRDSSPEVTLEVFSLKGQITRKVNIKINSDEK
                     IGMVLQWASIAPAVDAIWHILNVIDDSPVARASLVPYEDYIVGTPEGMMTGEKALSDL
                     IESHLNRPLRLYIYNHYRDSTRQVTIVPNRHWGGNGAIGCGVGHGVLHRLPAPLSGPP
                     PQPGDIVFSNPMLGGPDHKVSQPSETENFLPTPEPPKIASANAGSSNEISIPHYQRHK
                     KSHKGAIQDSSIQSYLDEEEKLSRELDHKTKDASSTNDSQTTPLPPPPPVAVNSTNDE
                     SAPQNEELVKN"
     gene            complement(641845..643775)
                     /gene="aut12"
                     /locus_tag="SPAC1D4.03c"
                     /db_xref="GeneID:2542459"
     mRNA            complement(join(641845..642131,642218..643775))
                     /gene="aut12"
                     /locus_tag="SPAC1D4.03c"
                     /product="putative autophagy associated protein Aut12"
                     /transcript_id="NM_001018415.2"
                     /db_xref="GeneID:2542459"
     CDS             complement(join(641885..642131,642218..643512))
                     /gene="aut12"
                     /locus_tag="SPAC1D4.03c"
                     /codon_start=1
                     /product="putative autophagy associated protein Aut12"
                     /protein_id="NP_593016.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1D4.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1D4.03c.1"
                     /db_xref="GeneID:2542459"
                     /db_xref="GOA:Q10150"
                     /db_xref="InterPro:IPR004353"
                     /db_xref="PomBase:SPAC1D4.03c"
                     /db_xref="PomBase:SPAC1D4.03c.1"
                     /translation="MEPTSEHSSIKEEVENDNVHRSHESECGSLLLNPGNVLMAAPSV
                     SEDDQEVSRSTPELRSHVENVEQLLSDILHDNSSPLNVSTSVSSSSNNTAVDEIIKLL
                     SLISFDLAKQKRTYLIFSSSGKPVFSNIVDDSIEPSTVGALQAIISSFEVSKEELTSF
                     STFSNVIVVLSKNPLYLVGVSPSTTLSAAYLLSELNLLYCQILTGVTAKAMQLTLNSR
                     PNFDLRRLIGSNEQFLKELCDQLNDYELVPTLNAISPLPLRSSFRDQLSQLLLRETPK
                     SLLFTFIAIRGRLVCMVKAKKLLLHANDLYLLFLSLFRTQSFNDSMEHWVPVCFPTLN
                     PDAYIYIYSYFLCKDTVLIMGSSESGVFFEMQSVKCKVAQEIQDHGWLKKLIYCEEMD
                     RTTPRNPGSPCISHYLFYSKKYSQFYTPGYSFSTPNFNTRTLYAIYASLHDQAFHKKN
                     SFSINMTVHESLLLFTWSTASFDFHCIANATTSSQLLIANVNKILRWIRREENRLFIQ
                     TNLSF"
     gene            complement(643960..644683)
                     /locus_tag="SPNCRNA.670"
                     /db_xref="GeneID:14218154"
     misc_RNA        complement(643960..644683)
                     /locus_tag="SPNCRNA.670"
                     /product="intergenic RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_151036.1"
                     /db_xref="GeneID:14218154"
     gene            complement(644623..648097)
                     /locus_tag="SPAC1D4.05c"
                     /db_xref="GeneID:2542527"
     mRNA            complement(join(644623..647677,647730..648097))
                     /locus_tag="SPAC1D4.05c"
                     /product="EXS domain-containing protein"
                     /transcript_id="NM_001018417.2"
                     /db_xref="GeneID:2542527"
     gene            644667..646547
                     /gene="cct2"
                     /locus_tag="SPAC1D4.04"
                     /db_xref="GeneID:2542212"
     mRNA            join(644667..644713,644750..644881,644929..646547)
                     /gene="cct2"
                     /locus_tag="SPAC1D4.04"
                     /product="chaperonin-containing T-complex beta subunit
                     Cct2"
                     /transcript_id="NM_001018416.2"
                     /db_xref="GeneID:2542212"
     CDS             join(644711..644713,644750..644881,644929..646377)
                     /gene="cct2"
                     /locus_tag="SPAC1D4.04"
                     /codon_start=1
                     /product="chaperonin-containing T-complex beta subunit
                     Cct2"
                     /protein_id="NP_593017.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1D4.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC1D4.04.1"
                     /db_xref="GeneID:2542212"
                     /db_xref="GOA:Q10147"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012716"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="PomBase:SPAC1D4.04"
                     /db_xref="PomBase:SPAC1D4.04.1"
                     /translation="MSLNPHQIFNESGIQERGENARLSSFVGAIAVGDLVKSTLGPKG
                     MDKILQSNSSGDIVVTNDGATILKSIALDNAAAKVLVNISKVQDDEVGDGTTSVCVFA
                     AELLRQAEIMVNAKIHPQVIIDGYRIATKTAIDALRASSIDNSSDPAKFRSDLENIAR
                     TTLSSKILSQNKNHFAQLAVDAVLRLKGSTNLDNIQIIKILGGKLDDSFLDEGFILNK
                     TIGVNCPKVMENANILIANTAMDTDKVKVFGARVRVDTTGKLAELERAEREKMKAKVE
                     KIKSHNINCFINRQLIYNWPEQLFADAGIMSIEHADFDGIERLSLVTGGEIASTFDHP
                     ELVKLGHCKKIEEIIIGEDKMIKFSGVEAGEACTIVLRGATHQLLDESERAIHDALAV
                     LSQTVAESRVTLGGGCAEMLMAKAVEEAATHEPGKKAVAVSAFAKALSQLPTILADNA
                     GFDSSELVAQLKAAHYDGNDTMGLDMDEGEIADMRAKGILEALKLKQAVVSSGSEGAQ
                     LLLRVDTILKAAPRPRERM"
     CDS             complement(join(646593..647677,647730..647808))
                     /locus_tag="SPAC1D4.05c"
                     /codon_start=1
                     /product="EXS domain-containing protein"
                     /protein_id="NP_593018.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1D4.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1D4.05c.1"
                     /db_xref="GeneID:2542527"
                     /db_xref="GOA:Q10151"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="PomBase:SPAC1D4.05c"
                     /db_xref="PomBase:SPAC1D4.05c.1"
                     /translation="MDLEVVEFPLHHKLALPFRIGLLVIVGTWLWSVCYHLIYILNRY
                     QPISPNPRGSLNSKWYHLLQIPLSNRHTDLEENTEFKANLVSPVDFHAGYCFAAILSI
                     SWATGFILFLKKTQGDIGGLYSHPIYPLLWVITAFILIVFPFPWRYRSSQRGLRKSII
                     RVFLFFQADFRSPYKDFIVSEIFTSYAKALGDFYIFGCVLQGHISKFTLRPDLKCDGT
                     FFVPLAMAYPFIVAILQCLHYGLSRRKHTFKINLLSALKHATALPVIYLSAIIHAKQT
                     KFTLTSGHGYLFWLWILSALLSSAYTFLWDVFIDWRIRFPFHKSINHKRFPMFIYAIG
                     CFINFILRVTWSMKLHPRLHQFHEYEMGIFSFEMLEILRRFLWLFFHLDAISS"
     gene            complement(<648301..>649393)
                     /gene="csk1"
                     /locus_tag="SPAC1D4.06c"
                     /db_xref="GeneID:2543327"
     mRNA            complement(join(<648301..648501,648614..648829,
                     648890..>649393))
                     /gene="csk1"
                     /locus_tag="SPAC1D4.06c"
                     /product="cyclin-dependent kinase-activating kinase Csk1"
                     /transcript_id="NM_001018418.1"
                     /db_xref="GeneID:2543327"
     CDS             complement(join(648301..648501,648614..648829,
                     648890..649393))
                     /gene="csk1"
                     /locus_tag="SPAC1D4.06c"
                     /EC_number="2.7.1.-"
                     /codon_start=1
                     /product="cyclin-dependent kinase-activating kinase Csk1"
                     /protein_id="NP_593019.1"
                     /db_xref="GeneID:2543327"
                     /db_xref="GOA:P36615"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /translation="MKSVGHFVPWLTDIRHLTDGTISEVFVGERKNSKKLYVIKVQGL
                     VFKRPPHDAMRGKLILESIGHPHIERIVDSFIDNEAGSVYLITSFKSFVLSDVMDEIS
                     IDTKCKIVLQISSALEYLEKHGILHRDIHPNNILLDSMNGPAYLSDFSIAWSKQHPGE
                     EVQELIPQIGTGHYRAIETLFGCHSYGHEVDRWTFGILIAELFSNQALFDDGSSEGWP
                     SELRLTSSIIQTLGTPNPSMWPELSTFPDWNKFIFHEYPPKPWSEILPSVDTSIQYIV
                     SHLVTYSNRASPSFVIESFPKVSARLSQYA"
     gene            complement(<649449..>649889)
                     /locus_tag="SPAC1D4.07c"
                     /db_xref="GeneID:2542589"
     mRNA            complement(<649449..>649889)
                     /locus_tag="SPAC1D4.07c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018419.1"
                     /db_xref="GeneID:2542589"
     CDS             complement(649449..649889)
                     /locus_tag="SPAC1D4.07c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_593020.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1D4.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1D4.07c.1"
                     /db_xref="GeneID:2542589"
                     /db_xref="PomBase:SPAC1D4.07c"
                     /db_xref="PomBase:SPAC1D4.07c.1"
                     /translation="MISKTIKTLIITKIFFSFKQTKRKKNKNKKRILSILPYYKNSYS
                     DFISVLQMYKVHIRMVSIYIFLKALSNIFLASSCEITVRLSSGGHPSPPVHIYMSALI
                     KVCKKSKPHLQTHCIKRKTYCVKHLAISNFQSFILQRFSCFLFC"
     gene            650465..652224
                     /gene="pis1"
                     /locus_tag="SPAC1D4.08"
                     /db_xref="GeneID:2542487"
     mRNA            join(650465..650893,651173..652224)
                     /gene="pis1"
                     /locus_tag="SPAC1D4.08"
                     /product="putative CDP-diacylglycerol--inositol
                     3-phosphatidyltransferase Pis1"
                     /transcript_id="NM_001018420.2"
                     /db_xref="GeneID:2542487"
     CDS             join(650814..650893,651173..651848)
                     /gene="pis1"
                     /locus_tag="SPAC1D4.08"
                     /EC_number="2.7.8.11"
                     /codon_start=1
                     /product="putative CDP-diacylglycerol--inositol
                     3-phosphatidyltransferase Pis1"
                     /protein_id="NP_593021.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1D4.08"
                     /db_xref="EnsemblGenomes-Tr:SPAC1D4.08.1"
                     /db_xref="GeneID:2542487"
                     /db_xref="GOA:Q10153"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR014387"
                     /db_xref="PomBase:SPAC1D4.08"
                     /db_xref="PomBase:SPAC1D4.08.1"
                     /translation="MRVKFLKLSNDFPFCSGQAMSGVLDTFILTLCLGFTRVFLVLIS
                     LYFMSWHPNYCTIVYLYSSLLDAFDGWAARKLHQATNFGAILDMVTDRCATSCLLCFL
                     CAAYPKYAIIFQLLVSLDLASHYMHMYSTLHQGASSHKTVTKKHNWMLRLYYGNNKVL
                     FIFCAANEMFFVALYLLSFTPRTPPKLGYLPVPSFIYSTGELPLSYPTLLAVLCGPIC
                     LAKQIINVVQLVNAANALVKMDVEQRRAAKKLQ"
     gene            complement(652225..653321)
                     /gene="rtf2"
                     /locus_tag="SPAC1D4.09c"
                     /db_xref="GeneID:2542468"
     mRNA            complement(join(652225..652529,652576..652698,
                     652763..653178,653222..653321))
                     /gene="rtf2"
                     /locus_tag="SPAC1D4.09c"
                     /product="replication termination factor Rtf2"
                     /transcript_id="NM_001018421.2"
                     /db_xref="GeneID:2542468"
     CDS             complement(join(652359..652529,652576..652698,
                     652763..653178,653222..653234))
                     /gene="rtf2"
                     /locus_tag="SPAC1D4.09c"
                     /codon_start=1
                     /product="replication termination factor Rtf2"
                     /protein_id="NP_593022.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1D4.09c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1D4.09c.1"
                     /db_xref="GeneID:2542468"
                     /db_xref="GOA:Q10154"
                     /db_xref="InterPro:IPR006735"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR027370"
                     /db_xref="InterPro:IPR027799"
                     /db_xref="PomBase:SPAC1D4.09c"
                     /db_xref="PomBase:SPAC1D4.09c.1"
                     /translation="MGNDGGSLPTRNELVKEPGKVPPLDIDFKRSVKSSQFSQCAITD
                     EPLYPPIVSCGLGKLYNKASILQMLLDRSSVPKSPSHIKSLKDVVQLQVELDDSGKVL
                     WLCPITRHVMSDTYQFAYIVPCGHVFEYSALKQFGEKMCFQCNQVYEEKDVIPINPNA
                     EQLKTLSKRLLDLALSEKTHSLNKASKKSNKNGDKKRKHVSKSNSKHAKHELRTNRML
                     DGENVKSETSVTDMERVKRVKI"
     gene            653449..656657
                     /gene="trz1"
                     /locus_tag="SPAC1D4.10"
                     /gene_synonym="sptrz1"
                     /db_xref="GeneID:2542457"
     mRNA            join(653449..654158,654196..656657)
                     /gene="trz1"
                     /locus_tag="SPAC1D4.10"
                     /gene_synonym="sptrz1"
                     /product="putative 3' tRNA-processing endonuclease tRNAse
                     Z L2 Trz1"
                     /transcript_id="NM_001018422.2"
                     /db_xref="GeneID:2542457"
     CDS             join(653774..654158,654196..656240)
                     /gene="trz1"
                     /locus_tag="SPAC1D4.10"
                     /gene_synonym="sptrz1"
                     /EC_number="3.1.26.11"
                     /codon_start=1
                     /product="putative 3' tRNA-processing endonuclease tRNAse
                     Z L2 Trz1"
                     /protein_id="NP_593023.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1D4.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC1D4.10.1"
                     /db_xref="GeneID:2542457"
                     /db_xref="GOA:Q10155"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR027794"
                     /db_xref="PomBase:SPAC1D4.10"
                     /db_xref="PomBase:SPAC1D4.10.1"
                     /translation="MSKTVNFRATKNFYLQFVSVSSRDTSCIPCIHLFFDSKRYVFGS
                     VGEGCQRAILSQQLRLSKIKDVFLMQGSSISSPDTYDSSSSSSTTSVSDMLQLDDRDK
                     VIVSERNSMCSTVNYPTWWDSCGGFPGFLLSLNDISEPGETGEASPFVLHGPSEVHQF
                     LSSMRHFTYHTNVNLTVQGYTSAEAPVFVDENICVTPVVVSLVKNSFKKRKHENINRG
                     TNARPLKEDRANTSPHWYSHVSNDTSFVVENAMYNTPAPLEPDKPELFISYIVQSHPT
                     PGKFDAAKAKSLGITKGLDCGRLARGEPVTLENGKTVYPKEVIGPSIPGSSFFIIHCP
                     NELVIDLVIENHKWTNAPKPVCVIHSVTPEVYKNPRYQSWISSFPSEVSHLIASTEVN
                     EVINYPRSAVAIATLNLLDSKVFPLGFNCYEVKNVQKNNRIAFAKPKLRFAFGKKTGI
                     DDSEVGVSIEELKDKILKEKPDYKSFVEEAQKYVSDKPKAPSFAGSDIQICTLGTGSA
                     MPSLYRNVSSTYVRIPVDKKCMEDSAISMKNILLDCGEGTLGRLSRQYGDNLKYEIAS
                     LRWIYISHMHADHHAGVIGVLKAWTKYSDGRSKLFITAPPQFEFWLLEYSRIDYLPLS
                     NIVFISNSALRTDRKPSALESSRLSSLFKEFDLVSFRTVPAIHCPYSYCMEITNSSGW
                     KIAYSGDTRPSEDFANIAKDSTLLIHEATLEDSMHEIAIKKQHSTYSEALEVAKKAGT
                     KNVILTHFSQRYPKLPDIDISTEDLHIALAFDGMTLKISDISLFRYFGKPLAYLFNEE
                     NLKEESDPLKF"
     gene            complement(656076..660381)
                     /gene="lkh1"
                     /locus_tag="SPAC1D4.11c"
                     /gene_synonym="kic1"
                     /db_xref="GeneID:3361532"
     mRNA            complement(656076..660381)
                     /gene="lkh1"
                     /locus_tag="SPAC1D4.11c"
                     /gene_synonym="kic1"
                     /product="dual-specificity"
                     /transcript_id="NM_001018423.3"
                     /db_xref="GeneID:3361532"
     CDS             complement(656760..658832)
                     /gene="lkh1"
                     /locus_tag="SPAC1D4.11c"
                     /gene_synonym="kic1"
                     /EC_number="2.7.11.1"
                     /EC_number="2.7.10.1"
                     /codon_start=1
                     /product="dual-specificity"
                     /protein_id="NP_001018187.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC1D4.11c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1D4.11c.1"
                     /db_xref="GeneID:3361532"
                     /db_xref="GOA:Q10156"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PomBase:SPAC1D4.11c"
                     /db_xref="PomBase:SPAC1D4.11c.1"
                     /translation="MHSLKRRRNHAPDWQDFYKNGVPQEVIVIEDSASPRLTPNLPPP
                     FSVHQLQSFVPPQPPSSSSPSTTGTVAVPINGANAVYPSTNSVSLPQSYDPWLDANGV
                     VPLPHDVASHPSYMVQSPTSYHACSNNQSPFPHSHHPPLHNPLPVSCQPVLRPPPVPQ
                     VPSHWYPVSLPSPNLPHQPISKPPVIPNLPKLQVHPNRLPHPIHNHPYSSPTSYPPPL
                     CPATYCPSNPPQLAPATAIAPSSQSSQHKSVNYSVTPSSINNHTAVPLSPTLAVWLPM
                     TQPTFQPPSANVYQPASNANQVITPVSISDYRPPKKRKRAAWPPYKKVDRVNVPVVHD
                     TTAFDPSTFDDDDGHYKVVPNSKFANRYTVVRLLGHGTFGKVIQCYDQSTGRHCAIKV
                     TRAIPKYREASLIELRVLQTIAHSDPTNENKCIQLRDYFDYRKHICIVTDLFGWSVFD
                     FLKNNNYIPFPLKHIQMLSQQLFKSVAFLHSLGLVHTDLKPENVLLVSNASRTIRLPY
                     RNYSQKVLNSCEIRLIDFGSATFEDEYHSSVVSTRHYRAPEIILGLGWSYPCDVWSIG
                     CILVELFTGQALFQTHEDSEHLCMMEKILGPFDRNMISRSSRTSQRFFKSDGKVRYPL
                     SNTPKKSINYLQSLQTLEQIFAVSSPEVALLLDLLKKVFVYDPKRRITAKEALWHPFF
                     TQPISSNL"
     gene            660084..664108
                     /locus_tag="SPNCRNA.671"
                     /db_xref="GeneID:14218229"
     misc_RNA        660084..664108
                     /locus_tag="SPNCRNA.671"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151037.1"
                     /db_xref="GeneID:14218229"
     gene            complement(660778..664180)
                     /locus_tag="SPNCRNA.672"
                     /db_xref="GeneID:14218089"
     misc_RNA        complement(660778..664180)
                     /locus_tag="SPNCRNA.672"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151038.1"
                     /db_xref="GeneID:14218089"
     gene            complement(663144..663352)
                     /locus_tag="SPNCRNA.79"
                     /db_xref="GeneID:5802862"
     misc_RNA        complement(663144..663352)
                     /locus_tag="SPNCRNA.79"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_151166.1"
                     /db_xref="GeneID:5802862"
     gene            664310..667647
                     /gene="rad15"
                     /locus_tag="SPAC1D4.12"
                     /gene_synonym="rhp3"
                     /db_xref="GeneID:2542203"
     mRNA            664310..667647
                     /gene="rad15"
                     /locus_tag="SPAC1D4.12"
                     /gene_synonym="rhp3"
                     /product="transcription factor TFIIH complex subunit
                     Rad15"
                     /transcript_id="NM_001018424.2"
                     /db_xref="GeneID:2542203"
     gene            complement(664677..665246)
                     /locus_tag="SPNCRNA.673"
                     /db_xref="GeneID:14218303"
     misc_RNA        complement(664677..665246)
                     /locus_tag="SPNCRNA.673"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151039.1"
                     /db_xref="GeneID:14218303"
     CDS             664782..667100
                     /gene="rad15"
                     /locus_tag="SPAC1D4.12"
                     /gene_synonym="rhp3"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /product="transcription factor TFIIH complex subunit
                     Rad15"
                     /protein_id="NP_593025.1"
                     /db_xref="GeneID:2542203"
                     /db_xref="GOA:P26659"
                     /db_xref="InterPro:IPR001945"
                     /db_xref="InterPro:IPR006554"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR010643"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /translation="MKFYIDDLPILFPYPRIYPEQYQYMCDLKHSLDAGGIALLEMPS
                     GTGKTISLLSLIVSYQQHYPEHRKLIYCSRTMSEIDKALAELKRLMAYRTSQLGYEEP
                     FLGLGLTSRKNLCLHPSVRREKNGNVVDARCRSLTAGFVREQRLAGMDVPTCEFHDNL
                     EDLEPHSLISNGVWTLDDITEYGEKTTRCPYFTVRRMLPFCNVIIYSYHYLLDPKIAE
                     RVSRELSKDCIVVFDEAHNIDNVCIESLSIDLTESSLRKASKSILSLEQKVNEVKQSD
                     SKKLQDEYQKLVRGLQDANAANDEDQFMANPVLPEDVLKEAVPGNIRRAEHFIAFLKR
                     FVEYLKTRMKVLHVIAETPTSFLQHVKDITFIDKKPLRFCAERLTSLVRALQISLVED
                     FHSLQQVVAFATLVATYERGFILILEPFETENATVPNPILRFSCLDASIAIKPVFERF
                     RSVIITSGTLSPLDMYPKMLQFNTVMQESYGMSLARNCFLPMVVTRGSDQVAISSKFE
                     ARNDPSVVRNYGNILVEFSKITPDGLVAFFPSYLYLESIVSSWQSMGILDEVWKYKLI
                     LVETPDPHETTLALETYRAACSNGRGAVLLSVARGKVSEGVDFDHHYGRAVIMFGIPY
                     QYTESRVLKARLEFLRDTYQIREADFLTFDAMRHAAQCLGRVLRGKDDHGIMVLADKR
                     YGRSDKRTKLPKWIQQYITEGATNLSTDMSLALAKKFLRTMAQPFTASDQEGISWWSL
                     DDLLIHQKKALKSAAIEQSKHEDEMDIDVVET"
     gene            667815..669742
                     /gene="byr1"
                     /locus_tag="SPAC1D4.13"
                     /gene_synonym="ste1; ste3"
                     /db_xref="GeneID:2542137"
     mRNA            667815..669742
                     /gene="byr1"
                     /locus_tag="SPAC1D4.13"
                     /gene_synonym="ste1; ste3"
                     /product="MAP kinase kinase Byr1"
                     /transcript_id="NM_001018425.2"
                     /db_xref="GeneID:2542137"
     gene            complement(667910..669749)
                     /locus_tag="SPNCRNA.674"
                     /db_xref="GeneID:14218161"
     misc_RNA        complement(667910..669749)
                     /locus_tag="SPNCRNA.674"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151040.1"
                     /db_xref="GeneID:14218161"
     CDS             668153..669175
                     /gene="byr1"
                     /locus_tag="SPAC1D4.13"
                     /gene_synonym="ste1; ste3"
                     /EC_number="2.7.1.-"
                     /codon_start=1
                     /product="MAP kinase kinase Byr1"
                     /protein_id="NP_593026.1"
                     /db_xref="GeneID:2542137"
                     /db_xref="GOA:P10506"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /translation="MFKRRRNPKGLVLNPNASVKSSDNDHKEELINNQKSFESNVEAF
                     MEQCAHMNRRPAWISDLDNSSLEVVRHLGEGNGGAVSLVKHRNIFMARKTVYVGSDSK
                     LQKQILRELGVLHHCRSPYIVGFYGAFQYKNNISLCMEYMDCGSLDAILREGGPIPLD
                     ILGKIINSMVKGLIYLYNVLHIIHRDLKPSNVVVNSRGEIKLCDFGVSGELVNSVAQT
                     FVGTSTYMSPERIRGGKYTVKSDIWSLGISIIELATQELPWSFSNIDDSIGILDLLHC
                     IVQEEPPRLPSSFPEDLRLFVDACLHKDPTLRASPQQLCAMPYFQQALMINVDLASWA
                     SNFRSS"
     repeat_region   complement(669786..670131)
                     /rpt_type=long_terminal_repeat
     gene            670203..675444
                     /gene="tho2"
                     /locus_tag="SPAC1D4.14"
                     /gene_synonym="SPAC22F3.14c"
                     /db_xref="GeneID:3361454"
     mRNA            join(670203..670427,670483..675444)
                     /gene="tho2"
                     /locus_tag="SPAC1D4.14"
                     /gene_synonym="SPAC22F3.14c"
                     /product="putative THO complex subunit Tho2"
                     /transcript_id="NM_001355985.1"
                     /db_xref="GeneID:3361454"
     CDS             join(670379..670427,670483..675320)
                     /gene="tho2"
                     /locus_tag="SPAC1D4.14"
                     /gene_synonym="SPAC22F3.14c"
                     /codon_start=1
                     /product="putative THO complex subunit Tho2"
                     /protein_id="NP_001342811.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1D4.14"
                     /db_xref="EnsemblGenomes-Tr:SPAC1D4.14.1"
                     /db_xref="GeneID:3361454"
                     /db_xref="GOA:Q09779"
                     /db_xref="InterPro:IPR021418"
                     /db_xref="InterPro:IPR021726"
                     /db_xref="PomBase:SPAC1D4.14"
                     /db_xref="PomBase:SPAC1D4.14.1"
                     /translation="MTSLPEKDQQGEVSVSENQKKLSEEWEPYIDKLVASNRTRDERV
                     ESIQELFQKCVIEEKLPVDIFFSIFSLAFERLEEKNTLASYVIDTLWLFDTEWIKNFH
                     EGSHDKAEKRLVSIGKGLKEFLPEEWLLSRLDCKFLENINVVPNGDFLNRKIVRTNTS
                     LLYRQKKFNLLREESEGFSHLMINFFDALTCLRNKSLNEDYLIVQVNKSIISTIGAFD
                     LDPNKVLDLILLLFSENLLDSWRFFLSILRNSPWGPNKERKFWNQLPDREKETFLNNL
                     SNANGIFNFDERFTNTKSIMSQVLGHNLQYMYKEDDENLESYFMMVALLIKYNFISID
                     NIWAHLSPSDEELGKELGKYKDKLDEQTFKAKGNALTMAAPLPDDEIEDGETMDGQKA
                     EAVPEIKKAKPSQKLGLLKSLLSIGDLSSSLLILGRYPFLLRAYPELSNLYHKLLHIS
                     ISSIYANYSPLKLLPNDVRERLKQPKFIPEDSRLREITLRPPKEKNLVFSLDPFADRF
                     NKTESEVFYYFENYDEDIPILRNLTEFYNIAIPWLRLSGLALCHDPVIVTKLCRIGQK
                     CVDNSSESRTLWLDIIRSLLLPLITLIDVNTGLSYELFELLSKFDSSTRYALYGEWSS
                     TSMKKFPELKLQNSITEKETKGILRRLTKTNVKQFGRLLAKVCHSNPCTVFSIALNQI
                     ETYDNLVEVVVDSARFITALDFDALTFIILSSFSNEFKKRLKSDGTSIAHWLQGLASF
                     CGRVFRRYSSLDCTSIVEYVIKQFKVNQMFDLVILKELLSQMTGLQPWTNLSDNQIQG
                     AAGGPVLRQLSLSLIYENPDVVRKSSMRLFNTLQKNGLATQLLVLLSQKYSTCIYDVT
                     DENSHLKLISSLQDECSDVLYLLMEFLNMVCSPKSYYKLIPSFEQLIQDFHIQPQVAF
                     YLSRYKNLDHSLTGSNTEDAMDIDYENTSSPNTASNPVWSIDNSVITELLPKQIWDYF
                     SPNFYLTFWKLSLYDVFVPLERYEFERSRAFDQIRQTDAANTFYSRHRHDRQKIMQLS
                     NSLQNELKEHINSLESVRKVLQGDCVKWFIPNGVFPNGTRLEHARFNCARYLWTLCIA
                     PRLKMSPHDALYCAKFVKLLHSLGTPNFSTMSFLEILFNSQLPSFIFSMTQREADNFG
                     RFLYEVLYDITSWYRDKILYERECLANGALPGFRLYWSDEQNDPDLSAVLPYNKFVLL
                     FSKWHKYLTSYFESCLLSTEYMHIYNSVIILEKILPCFPLIIESGSALKRAAERLKDE
                     EKREDLKVLALGYFAKLSKKQPEWVSFNSFSGTVRPSNSEKLQRPQQLSVAATSAVDS
                     KTASISEEQAKIDKQKVALNPSAPEFVPDSTPSDAVASETDNKNLVENKAVEKRVEAR
                     SSANERKQEERRRKTTPEGNRRALRTRTPTNEDIQRSDSKLREDQSRDRTPQSRSFTN
                     ENNDNLRSVSRHTRREPQQAQNLNARREHESQKSDRWRQNGNVNRNPRVSNNNSTNVS
                     RERSSEANHRTSNDNKRDEVTEGKDKNKRQDISGESNSRQNNAISRAGRSNGSNRGND
                     SRDADGRRSTHYASNKRPRSSDSQSPSNLREEDERENSRRRARQDDRRDRDSRQQRDR
                     PRDRTSRSAREEKRRKIQ"
     gene            complement(673984..678307)
                     /gene="tsc1"
                     /locus_tag="SPAC22F3.13"
                     /db_xref="GeneID:2541869"
     mRNA            complement(673984..678307)
                     /gene="tsc1"
                     /locus_tag="SPAC22F3.13"
                     /product="hamartin"
                     /transcript_id="NM_001018427.2"
                     /db_xref="GeneID:2541869"
     CDS             complement(675539..678238)
                     /gene="tsc1"
                     /locus_tag="SPAC22F3.13"
                     /codon_start=1
                     /product="hamartin"
                     /protein_id="NP_593028.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22F3.13"
                     /db_xref="EnsemblGenomes-Tr:SPAC22F3.13.1"
                     /db_xref="GeneID:2541869"
                     /db_xref="GOA:Q09778"
                     /db_xref="InterPro:IPR007483"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PDB:4KK0"
                     /db_xref="PDB:4KK1"
                     /db_xref="PomBase:SPAC22F3.13"
                     /db_xref="PomBase:SPAC22F3.13.1"
                     /translation="MPLQSLVKALWNVLHEEESEGYPDLTELIAEVESYQQRYPKQNP
                     TNSQKIRHILDEIYEKTPFNNTRRRILWLAVLKTVIPLLILDRQAVGEWWDQIFFPFL
                     NSPTQLKPVFSDLKSILFYILIFHDEDEWGGDLRRECAEETITRLVDLYVSKAIENLG
                     DVESQEQRNQTIECLVNVLVHYGIQRPKELSSCFCHHFLNPPTRIPILSVMVEVIRRQ
                     GPRLYEIPQTGFYDLVLKCAEFDTSPILLSYALSFILMILSHICNSLDDSLYRLFCIY
                     LRFSMIDPTSGFPSSTASGNWEVFHDFMSTYASTTTSQTDSSYNDVHDIVGSSQPDYL
                     ESLDYSQLFSILYALYPINFLEFLRDPKLYASKHNFQIRYSFNQELLSTKSDGLLGRH
                     LAHSNFLKYTAETELTDKSRWTRLDSIAVVALCNSLNAVGIAESVMDPFGGKLPTTYE
                     ETSSATGLLAYPNESHDIASEPFSISWPQNPSISGSVHSATTFDKAQLSNTEDSYDNI
                     SHGTSYSEGVSSIHMVKGERGSNNLELTSESLSSTNDTIRRLQRDLLFLQNELRFEKF
                     VRQQHLQNIGKLHREHILDMAVESERQKLLLTNKRYKAQIELLNSEIDKHRSESQAAL
                     NRRVKWENDFNNKIKALREEKKAWKSEESELKSSIESLISQLESIRNSQIDIAFSKNQ
                     LELKLQLYETKLKEYEQHLSCVNISKKQVSSSSDTSFGNTKMDSSMILSNSEAVSDEQ
                     ERELIESEKHRMKLESENLHLQANIELLKKDLEAINVVYEAKIFDLEKRLSSEANAPE
                     LHNPVNLNYDAQLSKISEIKENYDELLTRYRELEGKFLESQAEVEELKNFQKPLVDTG
                     SSIHSSPGLQQSKFIIRNDSLHPKVGPPRRQSTDTSRSTFRQY"
     gene            complement(678571..680480)
                     /locus_tag="SPNCRNA.675"
                     /db_xref="GeneID:14218371"
     misc_RNA        complement(678571..680480)
                     /locus_tag="SPNCRNA.675"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151041.1"
                     /db_xref="GeneID:14218371"
     gene            678585..679442
                     /locus_tag="SPNCRNA.158"
                     /db_xref="GeneID:9407029"
     misc_RNA        678585..679442
                     /locus_tag="SPNCRNA.158"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150471.1"
                     /db_xref="GeneID:9407029"
     gene            679062..681890
                     /gene="rgs1"
                     /locus_tag="SPAC22F3.12c"
                     /db_xref="GeneID:2541764"
     mRNA            679062..681890
                     /gene="rgs1"
                     /locus_tag="SPAC22F3.12c"
                     /product="G-protein-signaling regulator Rgs1"
                     /transcript_id="NM_001018428.2"
                     /db_xref="GeneID:2541764"
     CDS             680176..681621
                     /gene="rgs1"
                     /locus_tag="SPAC22F3.12c"
                     /codon_start=1
                     /product="G-protein-signaling regulator Rgs1"
                     /protein_id="NP_593029.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22F3.12c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22F3.12c.1"
                     /db_xref="GeneID:2541764"
                     /db_xref="GOA:Q09777"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="PomBase:SPAC22F3.12c"
                     /db_xref="PomBase:SPAC22F3.12c.1"
                     /translation="MPALHNPSSPPPSYEAVTSYRNGNSIDSGDKRQQCSRLMKITSN
                     GRPYSKDFLELFSTMVISTNFSRNRYRFSYVENSCTLLQLLSTLENLQLSQVNRIKSR
                     CGSKVLKSTTKFTIPKTAAKCLCNTFLNARLLQIVNNPSARKFSNEKCLLQLTRKGYS
                     VVSEFLQHNGHNSQAELYASKWNHSAPVIVSISRFSSTDQILKDSSFCEMLLVRMLGS
                     VHEIGKSKNPLLVPVYSVSSPSPKDSLSKVTKYQMFGIDIAEWLMCNTMLLDWSEMET
                     VASDLLIHSYIAYENNSETPLKFSYAKGVSYFLTGKGIATLGWTKNVSNNKLINKINE
                     VEKGSTNKEILETILRKPNLQTYFFEFLKKNFCDENQRFYSEVCEFNDYFSHANETND
                     HEAIRESFAHACGIYNCFLSSNAPNAVNLPSDLYEKITNHMALAMEVEPLNEWLQLIH
                     ILLLEAQTAVLDLMAGDSLLKFLELNGGLGI"
     gene            682835..683660
                     /gene="snu23"
                     /locus_tag="SPAC22F3.11c"
                     /db_xref="GeneID:2541763"
     mRNA            join(682835..683034,683102..683109,683160..683660)
                     /gene="snu23"
                     /locus_tag="SPAC22F3.11c"
                     /product="putative U4/U5/U6 small nuclear
                     ribonucleoprotein complex subunit Snu23"
                     /transcript_id="NM_001018429.3"
                     /db_xref="GeneID:2541763"
     CDS             join(682874..683034,683102..683109,683160..683446)
                     /gene="snu23"
                     /locus_tag="SPAC22F3.11c"
                     /codon_start=1
                     /product="putative U4/U5/U6 small nuclear
                     ribonucleoprotein complex subunit Snu23"
                     /protein_id="NP_593030.3"
                     /db_xref="GeneID:2541763"
                     /db_xref="GOA:Q09776"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /translation="MDRYNPPRRNGNSKKNEVVITGGRTQRIDFEKDVNKTTILPRWS
                     FGRPKRPWSCTQHLRKTRTVIIEKRATLEEVKERMEYWRRQLLEPEKGSEEYSLKERV
                     ERYHQELEAKKLRRKQKKVNKEKNSPRLVGENTELAAIMGISSFGSTNL"
     gene            683990..686347
                     /gene="gcs1"
                     /locus_tag="SPAC22F3.10c"
                     /gene_synonym="apd1"
                     /db_xref="GeneID:2541881"
     mRNA            join(683990..684093,684345..686347)
                     /gene="gcs1"
                     /locus_tag="SPAC22F3.10c"
                     /gene_synonym="apd1"
                     /product="glutamate-cysteine ligase Gcs1"
                     /transcript_id="NM_001018430.2"
                     /db_xref="GeneID:2541881"
     CDS             join(684010..684093,684345..686270)
                     /gene="gcs1"
                     /locus_tag="SPAC22F3.10c"
                     /gene_synonym="apd1"
                     /EC_number="6.3.2.2"
                     /codon_start=1
                     /product="glutamate-cysteine ligase Gcs1"
                     /protein_id="NP_593031.1"
                     /db_xref="GeneID:2541881"
                     /db_xref="GOA:Q09768"
                     /db_xref="InterPro:IPR004308"
                     /db_xref="InterPro:IPR012340"
                     /translation="MGLLVLGTPLDWPESKKYCDYVRENGIMQFLHMYDTYISKKQDV
                     LLWGDEIECIVVSMDDKSKKARVSLRQEDILNALGKYEETFRHVDFGPVYAALRNETC
                     PKKIDAILSEVAKNPADYVERIGGNSNKDTIEITSSTKPHAQNAVPTFHPEYGRYMLE
                     STPGAPYGSTLKDFTFVEYNMRLRRKIIENHLLPNELPLTITNFFRLGTPGFTDPEVE
                     ANGAISRSFFLPDDVINTHVRFPTLTANIRQRRGRKVAMNVPIFFDKNTIKPFHDPTV
                     PWDRNLFPEDANARDGAALDNHIYMDSMGFGMGCCCLQITFQAKSCDEARLLYDQLTP
                     ITPLMLALSAGTPAFRGYLADQDCRWNVIAGAVDDRTEEEMKTVPKSRYDSVDLYISN
                     DKRNLPEYNDVPVVINQDCYDKLIKDCIDERLAKHMAHIFSRDPLVIFSDSILQDNSV
                     SNAHFENLNSTNWQSMRFKPPPPGSDIGWRVEFRSMEIQITDFENAAYSIFVVMLSRA
                     ILSFNLNLYMPISLVDENMKAAHARDAIHRKKFWFRCNPFPDASTDDESGQFRQLTID
                     ELFNGEHRENGFPGLITIVRSYLYSCNPDAKTICLIERYIRLISQRANGQCLTAASWI
                     RNFITTHPSYKQDSVVNDEINYDLIRRIAKIVDGDYDDTLLGKCS"
     gene            686543..689179
                     /gene="res2"
                     /locus_tag="SPAC22F3.09c"
                     /gene_synonym="mcs1; pct1"
                     /db_xref="GeneID:2541871"
     mRNA            join(686543..686824,686989..689179)
                     /gene="res2"
                     /locus_tag="SPAC22F3.09c"
                     /gene_synonym="mcs1; pct1"
                     /product="MBF transcription factor complex subunit Res2"
                     /transcript_id="NM_001018431.2"
                     /db_xref="GeneID:2541871"
     CDS             join(686593..686824,686989..688730)
                     /gene="res2"
                     /locus_tag="SPAC22F3.09c"
                     /gene_synonym="mcs1; pct1"
                     /codon_start=1
                     /product="MBF transcription factor complex subunit Res2"
                     /protein_id="NP_593032.1"
                     /db_xref="GeneID:2541871"
                     /db_xref="GOA:P41412"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR020683"
                     /translation="MAPRSSAVHVAVYSGVEVYECFIKGVSVMRRRRDSWLNATQILK
                     VADFDKPQRTRVLERQVQIGAHEKVQGGYGKYQGTWVPFQRGVDLATKYKVDGIMSPI
                     LSLDIDEGKAIAPKKKQTKQKKPSVRGRRGRKPSSLSSSTLHSVNEKQPNSSISPTIE
                     SSMNKVNLPGAEEQVSATPLPASPNALLSPNDNTIKPVEELGMLEAPLDKYEESLLDF
                     FLHPEEGRIPSFLYSPPPDFQVNSVIDDDGHTSLHWACSMGHIEMIKLLLRANADIGV
                     CNRLSQTPLMRSVIFTNNYDCQTFGQVLELLQSTIYAVDTNGQSIFHHIVQSTSTPSK
                     VAAAKYYLDCILEKLISIQPFENVVRLVNLQDSNGDTSLLIAARNGAMDCVNSLLSYN
                     ANPSIPNRQRRTASEYLLEADKKPHSLLQSNSNASHSAFSFSGISPAIISPSCSSHAF
                     VKAIPSISSKFSQLAEEYESQLREKEEDLIRANRLKQDTLNEISRTYQELTFLQKNNP
                     TYSQSMENLIREAQETYQQLSKRLLIWLEARQIFDLERSLKPHTSLSISFPSDFLKKE
                     DGLSLNNDFKKPACNNVTNSDEYEQLINKLTSLQASRKKDTLYIRKLYEELGIDDTVN
                     SYRRLIAMSCGINPEDLSLEILDAVEEALTREK"
     gene            689345..691122
                     /gene="rok1"
                     /locus_tag="SPAC22F3.08c"
                     /db_xref="GeneID:2541786"
     mRNA            689345..691122
                     /gene="rok1"
                     /locus_tag="SPAC22F3.08c"
                     /product="putative ATP-dependent RNA helicase Rok1"
                     /transcript_id="NM_001018432.2"
                     /db_xref="GeneID:2541786"
     CDS             689483..690928
                     /gene="rok1"
                     /locus_tag="SPAC22F3.08c"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase Rok1"
                     /protein_id="NP_593033.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22F3.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22F3.08c.1"
                     /db_xref="GeneID:2541786"
                     /db_xref="GOA:Q09775"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC22F3.08c"
                     /db_xref="PomBase:SPAC22F3.08c.1"
                     /translation="MDALKLLTTNVKFKNKVPQPSIKEKEAKKLQGITKGKAKVTGNN
                     PVDPIEEFPEGILCENLKKQNITECTTIQRYAIPTIGSKRDLLACAPTGSGKTIAYLF
                     PILQKLQLHVPGGYRAIIVAPTRELCEQIYRQAEKLSFGTSLKIIELSKSNEKIQEKA
                     PKLREKYDMCIGTPMRLVQAIQTGLSFEKVEFFVMDEADRLFEPGFIEQTDHILSACT
                     SSNICKSLFSATIPSRVEELAKVVTVDPIRIIVGLKDAATDSIDQRLLFVGSDTSKIV
                     ILRQMISNGELKPRVVIFVQDIERAKALYTELLFDEIHVGVIHGELPQAKREEALAKF
                     RKGEIWVLIATDLLARGIDFHGVKMVINFDFPQSVHSYIHRIGRTGRAGNTGQAVTFF
                     TKEDGEYIKLIAGVMRSSGCEVPNWVMALPKPSKEMKKKLKKSPPKRKRITTRASYDR
                     QKEQRKKEYIKKVKKEASIKKHNEATGDSGQ"
     gene            691472..692077
                     /gene="atp20"
                     /locus_tag="SPAC22F3.07c"
                     /db_xref="GeneID:2541878"
     mRNA            join(691472..691656,691706..691803,691853..692077)
                     /gene="atp20"
                     /locus_tag="SPAC22F3.07c"
                     /product="putative F0-ATPase subunit G"
                     /transcript_id="NM_001018433.2"
                     /db_xref="GeneID:2541878"
     CDS             join(691530..691656,691706..691803,691853..691984)
                     /gene="atp20"
                     /locus_tag="SPAC22F3.07c"
                     /codon_start=1
                     /product="putative F0-ATPase subunit G"
                     /protein_id="NP_593034.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22F3.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22F3.07c.1"
                     /db_xref="GeneID:2541878"
                     /db_xref="GOA:Q09774"
                     /db_xref="InterPro:IPR006808"
                     /db_xref="PomBase:SPAC22F3.07c"
                     /db_xref="PomBase:SPAC22F3.07c.1"
                     /translation="MFSTSRIISRINYNFLRKSHYSTKTVAEQAKGRFTPLIQKLSAV
                     QQPIMYWANVSKELVQQVYHSQKIAPPSNTHSPFLFWKSQSSEAWGRNFFIAVEIVGI
                     FCAGQMVGRRKITPYH"
     gene            <692567..>693061
                     /locus_tag="SPAC22F3.15"
                     /db_xref="GeneID:9407311"
     mRNA            join(<692567..692725,692849..>693061)
                     /locus_tag="SPAC22F3.15"
                     /product="GatB/YqeY domain protein"
                     /transcript_id="NM_001355986.1"
                     /db_xref="GeneID:9407311"
     CDS             join(692567..692725,692849..693061)
                     /locus_tag="SPAC22F3.15"
                     /codon_start=1
                     /product="GatB/YqeY domain protein"
                     /protein_id="NP_001343066.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22F3.15"
                     /db_xref="EnsemblGenomes-Tr:SPAC22F3.15.1"
                     /db_xref="GeneID:9407311"
                     /db_xref="GOA:C6Y4B8"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR019004"
                     /db_xref="PomBase:SPAC22F3.15"
                     /db_xref="PomBase:SPAC22F3.15.1"
                     /translation="MYNTYAIIVHVSKLRNSHLFANASAIPNLQAVIRKKLLDSMKSR
                     QKDVASTLKVFLSEIEYANKSSKPVTTDLDVLRVLKKNIKKRKQAIEQFRKAERLDLA
                     EKEESQIQTLRQFLPEHASNI"
     gene            693514..697130
                     /gene="lon1"
                     /locus_tag="SPAC22F3.06c"
                     /db_xref="GeneID:2541875"
     mRNA            693514..697130
                     /gene="lon1"
                     /locus_tag="SPAC22F3.06c"
                     /product="Lon protease"
                     /transcript_id="NM_001018434.2"
                     /db_xref="GeneID:2541875"
     CDS             693831..697034
                     /gene="lon1"
                     /locus_tag="SPAC22F3.06c"
                     /EC_number="3.4.21.-"
                     /codon_start=1
                     /product="Lon protease"
                     /protein_id="NP_593035.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22F3.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22F3.06c.1"
                     /db_xref="GeneID:2541875"
                     /db_xref="GOA:Q09769"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027065"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027503"
                     /db_xref="PomBase:SPAC22F3.06c"
                     /db_xref="PomBase:SPAC22F3.06c.1"
                     /translation="MITRLSGACLRRSGAKRNWPREHLVHRSLLASFSTTQRVLKCSV
                     GPFRTSNVVFKSKEPKDNKPLDNKNDPKKTHNEDESHTNESLPSTDKKKKKDNDDFKQ
                     NLKSSSNKTEEKYSATQASKSKNDEFELGGEENEDEMPLNGEFNKNVPAKYSVPDVYP
                     QLLALPIARRPLFPGFYKAIVTKNPSVSEAIKELIKKRQPYIGAFLLKDENTDTDVIT
                     NIDQVYPVGVFAQITSIFPAKSGSEPALTAVLYPHRRIRITELIPPKEDADSAASSDA
                     AELETDKSSNLSSNGEVKSDLKQDNGKEEPEKEVESTPSILQNFKVSLVNVENVPNEP
                     FKRQDPVIKAVTSEIMNVFKDIANVSPLFREQIANFSISQTSGNVFDEPAKLADFAAA
                     VSAADHRELQEVLEATNIGDRLQKALYVLKKELLNAQLQHKINKEIEQKITQRHKEYL
                     LTEQLKQIKRELGQELDSKEALVTEFKKRTESLSMPDHVKKVFNDELSKFQHLEPMAA
                     EFNITRNYLDWITQLPWGKRSVENFDLDHAKEVLDRDHYGLKDVKDRVLELVAVGKLR
                     GTMQGKIMCLVGPPGVGKTSVGKSIASALNREFFRFSVGGLTDVAEIKGHRRTYIGAM
                     PGKIVQALKKVQTENPLILIDEIDKVGKSHQGDPASALLELLDSEQNSAFLDYYMDIP
                     LDVSSVLFVCTANTIDTIPPPLLDRMEVIELSGYVSAEKVNIAKGYLIPQAKAACGLK
                     DANVNISDDAIKGLISYYAHESGVRNLKKSIEKIFRKTSFSIVKEIDDELNSKEKSTG
                     KSGKKTSPQSSEDAANKEASSVPLKVPDKVNIEIEEKDLTKYLGPPIYTSQRLYDTTP
                     PGVVMGLGWTPMGGVSMYVETIVKNILSSNSTPSLERTGQLGDVMKESSEISYSFSKS
                     FLSKHFPNNKFFEHARLHMHCPEGSISKDGPSAGITMATSLLSLALDTPVPATTAMTG
                     ELTLTGKILRIGGLREKTVAAKLSGMKEILFPKSNLADWEQLPDYVKEGLTGVPVAWY
                     DDVFKRVFSNIDAEKCNNLWPNLIKSSSKQHQISPSH"
     gene            697191..703040
                     /gene="alp41"
                     /locus_tag="SPAC22F3.05c"
                     /db_xref="GeneID:2541769"
     mRNA            join(697191..697355,697401..697455,697496..697568,
                     697621..697766,697805..697885,697928..701453,
                     701508..703040)
                     /gene="alp41"
                     /locus_tag="SPAC22F3.05c"
                     /product="ADP-ribosylation factor Alp41"
                     /transcript_id="NM_001355987.1"
                     /db_xref="GeneID:2541769"
     gene            complement(697195..697871)
                     /locus_tag="SPNCRNA.676"
                     /db_xref="GeneID:14218147"
     misc_RNA        complement(697195..697871)
                     /locus_tag="SPNCRNA.676"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151042.1"
                     /db_xref="GeneID:14218147"
     CDS             join(697291..697355,697401..697455,697496..697568,
                     697621..697766,697805..697885,697928..698068)
                     /gene="alp41"
                     /locus_tag="SPAC22F3.05c"
                     /codon_start=1
                     /product="ADP-ribosylation factor Alp41"
                     /protein_id="NP_001342799.1"
                     /db_xref="GeneID:2541769"
                     /db_xref="GOA:Q09767"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /translation="MGLLTILRQQKLKEREVRVLLLGLDNAGKTTILKCLLNEDVNEV
                     SPTFGFQIRTLEVEGLRFTIWDIGGQKTLRNFWKNYFESTEAIIWVVDSLDDLRLEEC
                     RNTLQELLVEEKLLFTSILVLANKSDVSGALSSEEISKILNISKYKSSHWRIFSVSAL
                     TGLNIKDAISWLANDLKEIKLGTIDY"
     gene            complement(697960..>702533)
                     /gene="mug62"
                     /locus_tag="SPAC22F3.04"
                     /db_xref="GeneID:2541797"
     mRNA            complement(join(697960..698177,698223..698441,
                     698480..698841,698884..699104,699148..699363,
                     699410..>702533))
                     /gene="mug62"
                     /locus_tag="SPAC22F3.04"
                     /product="putative AMP binding enzyme"
                     /transcript_id="NM_001018436.2"
                     /db_xref="GeneID:2541797"
     CDS             complement(join(698033..698177,698223..698441,
                     698480..698841,698884..699104,699148..699363,
                     699410..702533))
                     /gene="mug62"
                     /locus_tag="SPAC22F3.04"
                     /codon_start=1
                     /product="putative AMP binding enzyme"
                     /protein_id="NP_593037.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22F3.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC22F3.04.1"
                     /db_xref="GeneID:2541797"
                     /db_xref="GOA:Q09773"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="PomBase:SPAC22F3.04"
                     /db_xref="PomBase:SPAC22F3.04.1"
                     /translation="MKPSENEKIHPVRHSKYEDKSKLPFETIPDPVLKYVKRARDAEL
                     QPQLAKVSQKLFADISTATAAEKLQFTVPRRARFEINDPRNPTFSMMALQDIISVLEY
                     RRNKNPTSTAHICIDKKGKEAVSYSWDKILNRAKQFASVAQNHVGLKPGTRVILYYRK
                     SEASEYIISIFGCLLLGIVVIPLSPSSSSESLKLVVNEEKVRVAFTTEATYRIFIKDT
                     EVNNAKSLAWWKSNDFTNYKFEQIKQYRMRANDTVLIDYTFSSSTYNDIKAVYTTKTF
                     LSQMRNLTSSMITNPARQAGWKLHNFEDSKDVLITNFHPSMPLGLIMGVFNSVFAGYC
                     TIFCDEEVLKTPGLLAYLITKYRCTYSLFDYAGLKQTVYNYQEDPKSTLSFKKNYTPN
                     LSSLKLCMVECEVVDPEFNIIVSDRWLQPLGTNNSKEVITPILCLRKFGGIPISFKDW
                     MISYTNRQKHERQMADTCYQEILVLKSSIEKEKVEIVPFLDIRKYSPNEVLCMSPFWY
                     PIPEASVAVVNEDSKNICKVGEVGEIWVYSDCLPKLKAASVINNPQGEQLTDYENNQE
                     NKFEKNNSFMDSGLKGFLHNEKIFVLGNKDEQIRQYRKTMVADKLMEEKYVHYSHYLI
                     KKIMKYVPEIFDGVAFEIEIDKAVYSVLVLESPIIKRSLIRNNRLKGRDLFSELVKIT
                     ESSFQVTQDIFKLDVLSILIAPYKSLPRSRYMGIQAINTNKCKLAFLSGNLPVSYVRF
                     FMDSALPKSKINLNNSKGIWSKDASKHHREIISLNVKQKMDPYKHQNKVSKARENLLN
                     HFTILDFLKTKSAKTPTSPAILTFNAIEKTKVELTWAHFELKVASHVEYMQLSVKAKA
                     RSHILLLYYDPLEFLISIHSCFHLGVIPIPFQIREISQLIGEIEEFTKIAKAFNVEAI
                     LVDHKVLISLKSRDISNHFQQTCIDLNMKAPKIFETTGIPISKRAKKALNLITPGELN
                     NKGKVALISINKLEDGSIIPTQFSHSSLLAFCHEQKEFVIGNEEKPIIGGIEFSSGMG
                     LLHTALLGVYAGVPTLLIKQENLCNNGSLLFEAIEQNSLSKVMIPLNICQKSFSTAQG
                     CNSIVINSTLSSIIVPCYDRPISSRVNSIIEDIARIGLAPNKVKLAYSHPINPFVCWN
                     ADSSMEKMKDYFDANQLRSGLVNVREDVLRNRQPLLYGSGTSTLYNEICIVHPEEKYI
                     CQEGEIGEIWINGKHGSYCENNELNSGCELLVQETLDKKSYSRTGQLGFIHHLKKKDQ
                     NMEKVPVLYTLDFIWNTLELNGLNHSVKDIEETIELVHPNICTDGCILFQASGSVVIL
                     LEVHSQQKFASLIPIIVATALAAHEIILDCVAFVPKGTFLRRPTGEKRRADILKQWTG
                     GDLKHMTSYLIRQDFLLNEDFVGTELIGTTDSYDYSDENLIINSSQLNLL"
     gene            complement(703075..703147)
                     /locus_tag="SPATRNAVAL.02"
                     /db_xref="GeneID:3361528"
     tRNA            complement(703075..703147)
                     /locus_tag="SPATRNAVAL.02"
                     /product="tRNA-Val"
                     /db_xref="GeneID:3361528"
     gene            703669..707990
                     /gene="rdh54"
                     /locus_tag="SPAC22F3.03c"
                     /gene_synonym="mug34; tid1"
                     /db_xref="GeneID:2541798"
     mRNA            join(703669..703967,704015..704113,704205..704280,
                     704322..704536,704573..704763,704816..704889,
                     704925..705056,705095..705158,705195..705293,
                     705333..705490,705529..705601,705637..706252,
                     706292..706361,706404..706652,706688..707990)
                     /gene="rdh54"
                     /locus_tag="SPAC22F3.03c"
                     /gene_synonym="mug34; tid1"
                     /product="ATP-dependent DNA helicase Rdh54"
                     /transcript_id="NM_001018437.2"
                     /db_xref="GeneID:2541798"
     CDS             join(703789..703967,704015..704113,704205..704280,
                     704322..704536,704573..704763,704816..704889,
                     704925..705056,705095..705158,705195..705293,
                     705333..705490,705529..705601,705637..706252,
                     706292..706361,706404..706652,706688..706828)
                     /gene="rdh54"
                     /locus_tag="SPAC22F3.03c"
                     /gene_synonym="mug34; tid1"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase Rdh54"
                     /protein_id="NP_593038.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC22F3.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22F3.03c.1"
                     /db_xref="GeneID:2541798"
                     /db_xref="GOA:Q09772"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC22F3.03c"
                     /db_xref="PomBase:SPAC22F3.03c.1"
                     /translation="MKRRATFQCPLIESTIKHQSTNYTKTETATTSHEVSENANEHKG
                     KSNIDINKIAYYNVVWRKITMKKHKTWEGDGFLVREDSNLTLYNSDFTRLGSCHSRVP
                     QIKEGELLRISGKEISIEKEISAESYEAGTHIDDSLRDVHMPEMKRKFKPPLRPNTMY
                     QTISALPKPRHDPTVLGALVMSRPKTWDPRTHVDVVIDPFLSKHLYSHQREGVSFLYD
                     CLLGMEGKCGYSAILADEMGLGKTLQTITVVWTLLKQSYYANRSSTINNAMVVAPVTL
                     LKNWENEFYNWLGHERIHVYIARCAEDFQEFTSNKTYSIIITGYETVCTYLRNYGCGI
                     DIDLLICDEAHRLKSMSSQTWITLNKLKTRKRLLLTGTPLQNDLSEYFSMVNFIIPGS
                     LGTPNSFKAQYERPILRSRSMNASSRDISLGAARLQRLFEFTSNFTLRRKANILAKHL
                     PPRTDIVLFIKPTHQQENVYGHVLDGFKSSVDQKGYYLKILTRLSKICNSTILLRNEK
                     ENFLSTELQDKHVFEQENMLLSSSKLQILAALLKSFQRGCQKAVIVSQYKETLELIEL
                     FLSILHVRFCKLLGSTPFSERDLIVHNFNTSSFKEFSVLLLSSKAGGCGLNLTGSTRL
                     IIYEPSWNPAQDLQALSRIYRSGQKRPVCIYTFLSSGMLDERIFIRQNTKQGLSSSFI
                     DSDASQKKNFFTGEDIKTLFSYSKTETCLTYELAFDSDEIDSLTKKKDPLTKIDHTID
                     SPNTKEKDKEISSWKKASEYMDTNLGKKCPENAFQGWTWQFPNDLSIMNGVEDYIPLE
                     PLPINCLMHKKFE"
     gene            complement(705042..708014)
                     /gene="atf31"
                     /locus_tag="SPAC22F3.02"
                     /db_xref="GeneID:2541860"
     mRNA            complement(705042..708014)
                     /gene="atf31"
                     /locus_tag="SPAC22F3.02"
                     /product="transcription factor Atf31"
                     /transcript_id="NM_001018438.2"
                     /db_xref="GeneID:2541860"
     CDS             complement(706844..707473)
                     /gene="atf31"
                     /locus_tag="SPAC22F3.02"
                     /codon_start=1
                     /product="transcription factor Atf31"
                     /protein_id="NP_593039.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22F3.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC22F3.02.1"
                     /db_xref="GeneID:2541860"
                     /db_xref="GOA:Q09771"
                     /db_xref="InterPro:IPR002112"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="PomBase:SPAC22F3.02"
                     /db_xref="PomBase:SPAC22F3.02.1"
                     /translation="MTYETNTPTEESIIPKHEDGEEYNSIYLSRFEKDISISQTLDFS
                     QFMQTQILLTAKRKALELGDDRSPINNDPYNIRRSDFDELSEYTASKSPSIISEASHN
                     SPSRELDDSGDENTSKLTGTKQSMLKARNRQAAQKCRIKKKKYLQTLQDQVNYYTSEN
                     KELLQSANDLREEIIKLRTLVFAHRDCPVSKACSKALFLMGKEKPLTPP"
     gene            complement(707948..710479)
                     /locus_tag="SPAC1296.01c"
                     /db_xref="GeneID:3361436"
     mRNA            complement(join(707948..708127,708168..708931,
                     708979..709339,709428..709644,709745..709830,
                     709896..710366,710413..710479))
                     /locus_tag="SPAC1296.01c"
                     /product="putative phosphoacetylglucosamine mutase"
                     /transcript_id="NM_001355988.1"
                     /db_xref="GeneID:3361436"
     CDS             complement(join(708055..708127,708168..708931,
                     708979..709339,709428..709644,709745..709830,
                     709896..710023))
                     /locus_tag="SPAC1296.01c"
                     /EC_number="5.4.2.3"
                     /codon_start=1
                     /product="putative phosphoacetylglucosamine mutase"
                     /protein_id="NP_001342798.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1296.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1296.01c.1"
                     /db_xref="GeneID:3361436"
                     /db_xref="GOA:Q09770"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016657"
                     /db_xref="PomBase:SPAC1296.01c"
                     /db_xref="PomBase:SPAC1296.01c.1"
                     /translation="MSDAEDSDSIVNEFVTAIVRESDKFAKVHSYPMQYGTGGYRADA
                     ELLSSVAFRTGVIASFLSAKLHGQPVGLMVTASHNASSENGLKIVNILSSLDSSKWEA
                     YLDQVVNADSADELTVCLTSILKKAKIIPGSEARVFVGYDSRSTSEILAQAVIDGIVV
                     CKAKYENFGLLTTPQLHYMVKASQTYGTPDAIGEPTERGYFEKLSKAYQSLMTGKKIK
                     GTVLIDAANGVGAAKIKELAKYIDPKLFPIEIVNDNIDNPELLNNSCGADFVRTQQKP
                     PNGISAPKHARCASFDGDADRIVYFAFGSHSFHLLDGDKICALFAQFLIDLIRSTGLD
                     LQVGIVQTAYANGASTAFFQKTLKVPVLCVSPGLKHLYHAAQAYDVGVFFEANGHGTI
                     LVSHAALSKIISHEVLSPAQFNALKTLKTVFELINQTDGDAITNLLLVEVILAHKNCT
                     LKEWNQLYSEIPSRLIRCEVEDRSIYTTTDAEQKLVTPEGLQEKIDALVAKYTGGRAF
                     VRSSGTEDAVRVYAEASSRGESEDLALRIVELLH"
     gene            711238..712354
                     /gene="cox4"
                     /locus_tag="SPAC1296.02"
                     /db_xref="GeneID:2543025"
     mRNA            join(711238..711412,711768..712354)
                     /gene="cox4"
                     /locus_tag="SPAC1296.02"
                     /product="putative cytochrome c oxidase subunit IV"
                     /transcript_id="NM_001018441.2"
                     /db_xref="GeneID:2543025"
     CDS             join(711301..711412,711768..712150)
                     /gene="cox4"
                     /locus_tag="SPAC1296.02"
                     /codon_start=1
                     /product="putative cytochrome c oxidase subunit IV"
                     /protein_id="NP_593042.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1296.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC1296.02.1"
                     /db_xref="GeneID:2543025"
                     /db_xref="GOA:P79010"
                     /db_xref="InterPro:IPR002124"
                     /db_xref="InterPro:IPR020893"
                     /db_xref="PomBase:SPAC1296.02"
                     /db_xref="PomBase:SPAC1296.02.1"
                     /translation="MFMNSMLRVSRQRAAVRSTVSLYRGFVSASIRRNEQNVVKAAAQ
                     ELANAKEPSDLIGPGGRDGEVPTDLEQATGLERYELLSELSGRDAFDMKPLDASRKGT
                     LTDPIMVTSLDPYRHIGCTGSPSGSHNLIWMTVYKDKLRRCPECGSVYKLKFMGDPNA
                     EHSH"
     gene            complement(712217..714070)
                     /gene="sxa2"
                     /locus_tag="SPAC1296.03c"
                     /db_xref="GeneID:2541701"
     mRNA            complement(712217..714070)
                     /gene="sxa2"
                     /locus_tag="SPAC1296.03c"
                     /product="serine carboxypeptidase Sxa2"
                     /transcript_id="NM_001018442.2"
                     /db_xref="GeneID:2541701"
     CDS             complement(712491..714014)
                     /gene="sxa2"
                     /locus_tag="SPAC1296.03c"
                     /EC_number="3.4.16.5"
                     /codon_start=1
                     /product="serine carboxypeptidase Sxa2"
                     /protein_id="NP_593043.1"
                     /db_xref="GeneID:2541701"
                     /db_xref="GOA:P32825"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /translation="MLSLFLKSLFAIIIIELTIIHALPTYTVHWKCSIQQANTSSASS
                     NQTVQPRQHAAPSSDRIKSLPEFKGSLPELYSGYLEANSDKSLFYTYAPAVVDSETFI
                     VWLQGGPGCAGTLGFFSENGPIEISQSSPSPSLNPESWTNFANMLWLDQPFGTGYSQG
                     QAAYTTTIEEASSDFVNALKSFYQKFPHLMKKKLYLVGESYGSIWSANFAEALLSEPS
                     LNINFMGVGIVSGLTADYETQEQITASIWVEHISKLGYYFNNTSSTISEEFKKRNKEC
                     QYDSVLNRLTFPTEQYPIWRPEYNFSTSTSLRKREALDGEDIGNVFNSISGCDLYSLS
                     NFLLYLENSCVITYDVSLDCSFNEYNDPLITYLNREDVRSSLHATKASTALTSGEGVF
                     ADGCNFDLYKKIVSNNVESVLVEIIPRLTEKYKVSFLAGALDLQILWTGTLLALQNTT
                     WNGWQGFTQSPGSLETTNGFTLDERNLAFTLSNSVGHMAPSKDPQMVREWLENTLLY"
     gene            715377..716978
                     /gene="mug65"
                     /locus_tag="SPAC1296.04"
                     /db_xref="GeneID:2543049"
     mRNA            join(715377..715535,715583..715721,715994..716146,
                     716223..716978)
                     /gene="mug65"
                     /locus_tag="SPAC1296.04"
                     /product="putative spore wall assembly protein"
                     /transcript_id="NM_001018443.2"
                     /db_xref="GeneID:2543049"
     CDS             join(715480..715535,715583..715721,715994..716146,
                     716223..716621)
                     /gene="mug65"
                     /locus_tag="SPAC1296.04"
                     /codon_start=1
                     /product="putative spore wall assembly protein"
                     /protein_id="NP_593044.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC1296.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC1296.04.1"
                     /db_xref="GeneID:2543049"
                     /db_xref="GOA:O94611"
                     /db_xref="InterPro:IPR006614"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="PomBase:SPAC1296.04"
                     /db_xref="PomBase:SPAC1296.04.1"
                     /translation="MTESERTSHLDILYENQRGIMLCGVPYFSEKSLLNFDPAPWVDQ
                     HFVASPVSTKTATCPDPSWEWAWQRWYIDMSGDVDESGWQYGFSFTMNNWHGKPVSLH
                     SFVRRRRWIRKRKKKELRRDELPLVPESFTISSSYPIQRSSTQTRSSFEDDSSDFDLS
                     EVTTIPALLRALQDSRIDREKLEALATFLASASIDEKVYVKNCKKDLLKNFVFEHSCR
                     KANELLNASLTAAEASTSQVALRESPTPQD"
     gene            complement(716874..718168)
                     /locus_tag="SPAC1296.05c"
                     /db_xref="GeneID:2542980"
     mRNA            complement(join(716874..717585,717674..718168))
                     /locus_tag="SPAC1296.05c"
                     /product="putative cyclin L family cyclin"
                     /transcript_id="NM_001018444.2"
                     /db_xref="GeneID:2542980"
     CDS             complement(join(716940..717585,717674..717804))
                     /locus_tag="SPAC1296.05c"
                     /codon_start=1
                     /product="putative cyclin L family cyclin"
                     /protein_id="NP_593045.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1296.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1296.05c.1"
                     /db_xref="GeneID:2542980"
                     /db_xref="GOA:O94612"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="PomBase:SPAC1296.05c"
                     /db_xref="PomBase:SPAC1296.05c.1"
                     /translation="MADSLVHSLASSSQLEAFDSFEYAEELCTLGSEWIQEAGVLLNL
                     TQNCVIVCLILFRRYCTLYPPRVPDLDAIVMACVSIGSKTTETPASVQDICNVVVYLK
                     ERFKDTNFEARGFIAHDLYSEEMYSSRNRLSNMELEVLRALNFDTHIVIPHKLAIHYL
                     QTLQLIDNKKLLQITWNFLNDASRTRLCVLYPPFSLACGCIAMAARVIGMKLPKDWYR
                     VFDTTKEEIDSLTSILENFYKTSAIAHKTLYLIFTEQVSA"
     gene            complement(718119..718190)
                     /locus_tag="SPATRNAGLU.01"
                     /db_xref="GeneID:3361525"
     tRNA            complement(718119..718190)
                     /locus_tag="SPATRNAGLU.01"
                     /product="tRNA-Glu"
                     /note="tRNA Glutamic acid"
                     /db_xref="GeneID:3361525"
     gene            complement(719090..723684)
                     /gene="vps17"
                     /locus_tag="SPAPJ696.01c"
                     /db_xref="GeneID:2543324"
     mRNA            complement(join(719090..722243,722288..722493,
                     722542..722995,723063..723684))
                     /gene="vps17"
                     /locus_tag="SPAPJ696.01c"
                     /product="retromer complex subunit Vps17"
                     /transcript_id="NM_001018446.2"
                     /db_xref="GeneID:2543324"
     gene            719380..721549
                     /gene="tah18"
                     /locus_tag="SPAC1296.06"
                     /db_xref="GeneID:2542966"
     mRNA            join(719380..719581,719663..719740,719791..719888,
                     719926..720024,720066..721549)
                     /gene="tah18"
                     /locus_tag="SPAC1296.06"
                     /product="putative NADPH-dependent diflavin oxidoreductase
                     Tah18"
                     /transcript_id="NM_001018445.2"
                     /db_xref="GeneID:2542966"
     CDS             join(719447..719581,719663..719740,719791..719888,
                     719926..720024,720066..721410)
                     /gene="tah18"
                     /locus_tag="SPAC1296.06"
                     /codon_start=1
                     /product="putative NADPH-dependent diflavin oxidoreductase
                     Tah18"
                     /protein_id="NP_593046.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC1296.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC1296.06.1"
                     /db_xref="GeneID:2542966"
                     /db_xref="GOA:O94613"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR028879"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="PomBase:SPAC1296.06"
                     /db_xref="PomBase:SPAC1296.06.1"
                     /translation="MKNSHIYILYGSETGTAEGLAESLFRSLTRMGYDVLVNSMDDFN
                     LENLLRPLQCVFICSTTGQGEMPLNMRKFWRFLLRKKLPNTFLNDMQYAVFGCGDTSY
                     TRFNWASKKLDSRLRQLGAQSFSSRGEGDEQHPDGVEGVFAYWCNHLYSQLAAIKTPS
                     RPAFGEFDLLPPSFQIIIDESLGCKVKGFEDNNIVRHSRGKIEATLVHNKRISNIKHW
                     QDVRHLAFKIPNFERWKPGDVAVLYPWNDDMSVNSFIECMGWESIKYSPLIISSNVAE
                     RKLPWFPNILNVFNLVKYVLSIHSVPSRTFFEMASHFSNNKMHKERLQEFSSYKNIDD
                     YYDYTTRPRRTVLETLQEFKSVQIPIEYALDAFPVIRGRQYSIANRCDNSTGILELAV
                     ALVKYQTILKSPRQGICSRWICDLHENTSFNIDILPGFLNLSYQSNKPLIMVGPGTGV
                     APLRALIQERIYNGLKENLLFFGCRNKSMDFLFEKDWEKYTEEGTLKLFCAFSRDQEK
                     KKYVQHSIQENGELVYNLLNEKDGMFFVSGSSGKMPSSVKDAIAGIVSKYSGCSISDG
                     YSFVTSLEKKNRYYQETW"
     CDS             complement(join(721617..722243,722288..722493,
                     722542..722995,723063..723425))
                     /gene="vps17"
                     /locus_tag="SPAPJ696.01c"
                     /codon_start=1
                     /product="retromer complex subunit Vps17"
                     /protein_id="NP_593047.1"
                     /db_xref="EnsemblGenomes-Gn:SPAPJ696.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAPJ696.01c.1"
                     /db_xref="GeneID:2543324"
                     /db_xref="GOA:Q9URW7"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR014461"
                     /db_xref="InterPro:IPR015404"
                     /db_xref="PomBase:SPAPJ696.01c"
                     /db_xref="PomBase:SPAPJ696.01c.1"
                     /translation="MSSQHSTDDLMNSHVFSGGFSTLDDKGFQDVPIHTDMPGSISVE
                     PSSEDANVGSVNGNINETPVFEADRLIAEATMNPSAASSTTGENSISQTGSGPFLRIR
                     IVDIEAENSKDPVIKMNVQTTLPAYRSKLYKNVRRTHAEFKKFAKYLISTHPECLIPA
                     VPEAKTSVSSGIKEDLIYLKSGLQSWLNYVSTNPNLLYDPELQLFVESDYGYSPLINT
                     GNPTSGLKRKALKQFPLPPDPCQALANLRPIVKSFYKNAKDAEIKLEKLVNRKQSLAL
                     THADLGQSLIDYSVEEQHNGLANALNRVGKMLQAISDVRIMQSSKQLVTLADSLCYAS
                     DNAFVVKEILSNRHILMRDLISSKNQTNSYLSAANRLQDSPKISKARTDDALQALEVA
                     RVHEKLLSDKVDFVTLNLVKESKTYTKKTSVSLQKAIREYVEKEAYYERRLLSIMESI
                     RPHIRNIDPFGGLSRLGREEYPRRLSNPPPSQKTNQDAWTNRKRPGYSSSFDGSSQST
                     FNPSNNDGAHNTSENADELVEPPIGNERLDPKSVANLLNAI"
     gene            724145..725946
                     /locus_tag="SPAPJ696.02"
                     /db_xref="GeneID:2543305"
     mRNA            join(724145..724325,724378..724418,724506..725946)
                     /locus_tag="SPAPJ696.02"
                     /product="putative actin cortical patch component Lsb4"
                     /transcript_id="NM_001018447.2"
                     /db_xref="GeneID:2543305"
     CDS             join(724289..724325,724378..724418,724506..725720)
                     /locus_tag="SPAPJ696.02"
                     /codon_start=1
                     /product="putative actin cortical patch component Lsb4"
                     /protein_id="NP_593048.1"
                     /db_xref="EnsemblGenomes-Gn:SPAPJ696.02"
                     /db_xref="EnsemblGenomes-Tr:SPAPJ696.02.1"
                     /db_xref="GeneID:2543305"
                     /db_xref="GOA:Q9URW6"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007461"
                     /db_xref="PomBase:SPAPJ696.02"
                     /db_xref="PomBase:SPAPJ696.02.1"
                     /translation="MGLHNPLPSSLKSECKKAGKILTSFVDPRQTLGAQEVIPPSVLT
                     NAKGLVIMTVLKAGFLFSGRIGSGLIVARLDDGTWSAPSAVMTGGMGVGAQIGSELTD
                     FVIILNSKAAVQTFARLGSITLGGNLSIAAGPLGRNAEAGGGASVGGMAPMFSYSKTK
                     GLFAGVSLEGSVLVERRDANRSLYRGDITAKRLLSGQVAQPAAADPLYRVLNSKIFNL
                     NRGDEGDIYNDVPIYADDEPEDIWGPSSKSTKRRDSADRSSSYSRRGDSYRSNRSRAH
                     DDDDEDDYSFSRSKSLSRKTAGGSLRSSKMDNRRSKYADTPSPRRSRSYSDEDEESVY
                     SSDVSTESSSQFSSRSSEYSKPSRPTAPKPKFKQDSLGPNQARAMYSFAGEQPGDLSF
                     QKGDIIDIVERSGSHDDWWTGRIGYREGIFPANYVKLS"
     gene            complement(725865..728242)
                     /locus_tag="SPAC22G7.01c"
                     /db_xref="GeneID:2541673"
     mRNA            complement(join(725865..727731,727846..727901,
                     727987..728242))
                     /locus_tag="SPAC22G7.01c"
                     /product="putative Fe-responsive transcriptional
                     regulator"
                     /transcript_id="NM_001355989.1"
                     /db_xref="GeneID:2541673"
     CDS             complement(join(726081..727731,727846..727901,
                     727987..728076))
                     /locus_tag="SPAC22G7.01c"
                     /EC_number="3.4.11.9"
                     /codon_start=1
                     /product="putative Fe-responsive transcriptional
                     regulator"
                     /protein_id="NP_001342933.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22G7.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22G7.01c.1"
                     /db_xref="GeneID:2541673"
                     /db_xref="GOA:Q09795"
                     /db_xref="InterPro:IPR000587"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="PomBase:SPAC22G7.01c"
                     /db_xref="PomBase:SPAC22G7.01c.1"
                     /translation="MVVHTGNRLNKLRELMKERGYTLYVVPSEDAHSSEYTCDADARR
                     AFISGFDGSAGCAVIGETSAALFTDGRYFNQASQQLDENWTLMKQGFTGVPTWEEYCT
                     QMTKCNEKVGIDSSLITFPAAKALRESLFLKSGAVLVGDHDNLVDIVWGASRPKEPLE
                     KLIVQEIKYAGLGVDEKLHNLREAMKEQKIEAFVVSMLDEVAWLYNLRGADVPYNPVF
                     FAYSLVTLDEAFLYVDERKVTPEVSKHLDGFVKILPYDRVFSDAKNSNLTRIGISSKT
                     SWCIATSFGETKVMPILSPISQAKGIKNDAELKGMKECHIRDGCALVEYFAWLDEYLN
                     SGNKINEFDAATKLEQFRRKNNLFMGLSFETISSTGPNGAVIHYSPPATGSAIIDPTK
                     IYLCDSGAQYKDGTTDVTRTWHFGEPSEFERQTATLALKGHIALANIVFPKGTTGYMI
                     DVLARQYLWKYGLDYLHGTGHGVGSFLNVHELPVGIGSREVFNSAPLQAGMVTSNEPG
                     FYEDGHFGYRVENCVYITEVNTENRFAGRTYLGLKDLTLAPHCQKLIDPSLLSPEEVK
                     YLNEYHSEVYTTLSPMLSVSAKKWLSKHTSPI"
     gene            728335..731867
                     /gene="kap111"
                     /locus_tag="SPAC22G7.02"
                     /db_xref="GeneID:2541467"
     mRNA            join(728335..728452,728494..728619,728664..730685,
                     730726..730963,731004..731188,731227..731322,
                     731369..731550,731616..731867)
                     /gene="kap111"
                     /locus_tag="SPAC22G7.02"
                     /product="putative karyopherin Kap111"
                     /transcript_id="NM_001018449.2"
                     /db_xref="GeneID:2541467"
     CDS             join(728420..728452,728494..728619,728664..730685,
                     730726..730963,731004..731188,731227..731322,
                     731369..731550,731616..731706)
                     /gene="kap111"
                     /locus_tag="SPAC22G7.02"
                     /codon_start=1
                     /product="putative karyopherin Kap111"
                     /protein_id="NP_593051.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22G7.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC22G7.02.1"
                     /db_xref="GeneID:2541467"
                     /db_xref="GOA:Q09796"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PomBase:SPAC22G7.02"
                     /db_xref="PomBase:SPAC22G7.02.1"
                     /translation="MDGNEIAHAKKLVYDLYSGSLSPSAIAATEKELQKAQRSQQGWN
                     IGLFMLQSKDVYEQFFGALTLQMKINTQLETLSDKDLVQLFVQLLQKLLWDDGLPALV
                     ERKVICTLASLTIKYELEKKEEASLKVIYCLFCNKLEFFNADMNAASVLNNLFPPASS
                     RNAQLTASYINELLLELSFSIYTKENEDALFNNVFRPCSNIIVSVLVFIFTNYSLDLS
                     KEKNVAALEEALNCMIAISSYLAKASVSVQSVLPAFTECMDLTVNCIALDEVSEKAMN
                     CLADLLANYSNFITQPTIERLWTILTGPWGETHLQQELEDPDSGEENDYSFLNIVIGF
                     AEAMLPQIIDHIQEEKSIRLLYILASLLSFPGYAIVEEKVSWRTLEFWTTLIEDFSMS
                     KAATDPSKDEIFKQIAFSVVEKAWWKMLLPSPEQWNSWPSSSRDSFNSYRRDLGDLLE
                     SSYSIFGERLYAMYITTIENFFSDGTGSPQSLEVSFYCLCCILEYDTNDSDTLDAWLT
                     RLFETSFAIKASAFQNPQLLKTCSQLLSSCSCFLQNHPQYLNISLPVLFDALHISETS
                     IQMTVSRSIHTLCTTCASHLLTEIDGFMAVVEELTPKLVYVPSVLEKIYSSVGYVTQR
                     IEDIELRISYLMRLLNCILAQLQPSLYPNLEIFENVLKSCLQSVAGVALSQSPIGESP
                     IIDVEQSTQETTFWQQSCIAEFQAKLISFLTHSESMALQYSDVVGLICKIMIAGLNEV
                     EPSPFSLPIVTTIQYFCDRFTEFPAAVLLTLGSAILTCPYGQTDIIDKVLIDMCSSIQ
                     NSVVIINEESFMNNIDITVELYHFFSIILQKHPSFLETMYPDFTQLILNRAINLLGKP
                     ERLLESAAGQFIISFITSEKSDLLNTHTDFVNAIRSPLIAKILLGFGGNASRSSLPLL
                     SDILGKLKAQNFSATRACLTQSLEEEGFPSRNVSNEIKRRFLTDLLKARIKDKVKQFW
                     ILCKGLESTPYGNSSWTF"
     gene            complement(729850..732457)
                     /locus_tag="SPNCRNA.677"
                     /db_xref="GeneID:14218222"
     misc_RNA        complement(729850..732457)
                     /locus_tag="SPNCRNA.677"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151043.1"
                     /db_xref="GeneID:14218222"
     gene            731933..732759
                     /locus_tag="SPAC22G7.03"
                     /db_xref="GeneID:2541683"
     mRNA            731933..732759
                     /locus_tag="SPAC22G7.03"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018450.2"
                     /db_xref="GeneID:2541683"
     CDS             731938..732648
                     /locus_tag="SPAC22G7.03"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_593052.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22G7.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC22G7.03.1"
                     /db_xref="GeneID:2541683"
                     /db_xref="GOA:Q09797"
                     /db_xref="PomBase:SPAC22G7.03"
                     /db_xref="PomBase:SPAC22G7.03.1"
                     /translation="MQQLIKEHFGNGGKVRSTSIEYPIFVHSGSISAMLLTLVNALEC
                     NDVDEGVLVYPTGSTNPMENILRMENPFDGFLAKEAYSIHFQSVLERIQLIPCSHVDD
                     LEKIVEVRLKHAKLILGIADISKLLKIRGCLNGRYLSRYLMLCLQNSKILIVCETGGL
                     QERIPIIEDISINEDTQRTVSLETIYATWIPTFWESKRKSHEKDEGRLVDRRHKVLVD
                     WLANTCFRGMSLKDHSAL"
     gene            732826..736603
                     /gene="ubp13"
                     /locus_tag="SPAC22G7.04"
                     /gene_synonym="pan2"
                     /db_xref="GeneID:2541684"
     mRNA            join(732826..732897,732942..733040,733085..733251,
                     733369..733495,733536..734113,734151..735457,
                     735495..736603)
                     /gene="ubp13"
                     /locus_tag="SPAC22G7.04"
                     /gene_synonym="pan2"
                     /product="putative poly(A)-specific ribonuclease complex
                     subunit Pan2"
                     /transcript_id="NM_001018451.2"
                     /db_xref="GeneID:2541684"
     CDS             join(732880..732897,732942..733040,733085..733251,
                     733369..733495,733536..734113,734151..735457,
                     735495..736465)
                     /gene="ubp13"
                     /locus_tag="SPAC22G7.04"
                     /gene_synonym="pan2"
                     /codon_start=1
                     /product="putative poly(A)-specific ribonuclease complex
                     subunit Pan2"
                     /protein_id="NP_593053.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC22G7.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC22G7.04.1"
                     /db_xref="GeneID:2541684"
                     /db_xref="GOA:Q09798"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028881"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="PomBase:SPAC22G7.04"
                     /db_xref="PomBase:SPAC22G7.04.1"
                     /translation="MDAWKEITKTTENDGVSTCSLSSIAFDPYSELVWTGHKNGQIKS
                     SFGPSLTSYTQFIGHEGPVHQVLPQERGVFSLSSKSLRLSNRKGTIRWRYQDSDCIDY
                     RAMFYQSRNNPEVVIGGYHQKLTVVNAERGISIHKDKNVSDIFIMRRNRLLCCGSTNG
                     EIILRDPNSFQPVNKVVAHTGTISDIDTSGNLLLSCGYSLRHGTYMLDPFVKVWDLRN
                     LSSLVPIPFPAGPTIIRMHPKLSTTAVVCSCSGQFHIVDTGNPLDAKLMQIPLTSYLT
                     GMDIASTGDAMVFTDVEDNIHLWSPLENPSFSDLKLPIQLPNTSTETVQLENNDPLNS
                     IGLPYYKDELLSSWSKYLIFDVGKPILDSNLLIAKQISENSHPVPQEIKSFHRNQIIE
                     VPWLNRKLISEGATPKFHSERQKDIMSGNDIEGSASYFEEIEDTISGPDSIPKFYQRP
                     VIKYSKFGIEDFDFGFYNKTKYAGLETDITNSYCNSVLQLLSYVPSFSKAAISHSLGP
                     CDLMECLLCELGFLFAMLKESTGRNCQATNFLRAFSNSSFAQSLGIVFDDYSDGTFPD
                     SFVIQKFTKFMLTEISRIADYEDKKDGTSFPVSFLLKSFCIPEMQTYRCGICGITSQK
                     IKSSLYIIDLHYPSQQLESILSFEWLFKMSLDRRVDLPPGWCEYCLAHQPFLLRSFIR
                     SLPDCLFINTQVKHHEHWKLWARKNWLPKKLHLRRVNDTMQCVSQKISNLDKDQQSLS
                     VYVLRGIIYEIRQNGEEPHFVSTIRVSDNTSSDNPDDNRWYIFNDFLVKEVTEEEALT
                     VHGPWKIPIIVYYEKLDTKIPQWDEVSDYTLLYQPYSLNKNPPINKIQPLTTDEMLYP
                     KMLVGIDSEFVALQQEETEVRSDGTKSTIKPSKLSLARVSVLRGEGPNKGLPFIDDYV
                     ATDDKVTDYLTEYSGIHPGDLDPDRSPYNVVPLKVAYKKLRLLVNAGCIFVGHGLQKD
                     FRIINLLVPPEQVVDTVDLFFLSSRQRKLSLKFLAWYLLDEEIQLTEHDSIEDALTAL
                     KLYDCYDKLKSQGKLEETLDNIYEVGRRFKFRPPSVASMSLEDRNSYGDESVISNQTN
                     "
     gene            complement(736520..738893)
                     /locus_tag="SPNCRNA.678"
                     /db_xref="GeneID:14218373"
     misc_RNA        complement(736520..738893)
                     /locus_tag="SPNCRNA.678"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151044.1"
                     /db_xref="GeneID:14218373"
     gene            736722..738782
                     /locus_tag="SPAC22G7.05"
                     /db_xref="GeneID:2541654"
     mRNA            join(736722..737037,737165..738782)
                     /locus_tag="SPAC22G7.05"
                     /product="putative krr family protein"
                     /transcript_id="NM_001018452.2"
                     /db_xref="GeneID:2541654"
     CDS             join(736797..737037,737165..738720)
                     /locus_tag="SPAC22G7.05"
                     /codon_start=1
                     /product="putative krr family protein"
                     /protein_id="NP_593054.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22G7.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC22G7.05.1"
                     /db_xref="GeneID:2541654"
                     /db_xref="GOA:Q09799"
                     /db_xref="InterPro:IPR018034"
                     /db_xref="InterPro:IPR024626"
                     /db_xref="PomBase:SPAC22G7.05"
                     /db_xref="PomBase:SPAC22G7.05.1"
                     /translation="MPRKKSAAKKAREALVQKKVINSNVPTDKKSIDQLQENVTSKSH
                     LLEESSSEDEEINSFQINEEYAKRFEHNKKREELQKLEAKYGEQMANGVDGEGSDESS
                     SEEEEDSDGELVTPEVDAAILRMIVKIRNKDPDLYDSQQKYFDEVEKDVQGSLKSKDG
                     FRSVTLKDYHRQKLLSGEILDAEEDEPMPNDANPTHVEEQERLRKETIAAFHDVNGNK
                     DAVSNESDEDGDFLVKKEKTKKQLEEEEHGYERFLLESAQSKEARKVLEDLSSSYVKQ
                     RPSVLVNTEDDENGIKPSDEDFLLKYMMNRGWRTSNTKQPSYEEIIDEVDAENRFDED
                     AEEFENKFNFRFEEEAGSQIVSHPRNVADSLRRKDDSRKRARDRKKERLEEASQKRLE
                     EVNRLKNLKRKELEEKLNQVIEIAGSKNIDVSKLDLDEDFDPEKWESKMSEIFNENYY
                     EEDSAKKPEFGDDIDIDDIAQVDNGSEDLGSIENKTVEDTGNREKSKKSLRKDIREKK
                     RKIDEYVEEKYGVPEAVIVKNSKFRYQQVAPETFGLDILDILNASDADLNNYVGLKKM
                     TPYRTPEEIARDKKKYGKKKRLREWKKQVFGK"
     gene            complement(739167..746117)
                     /gene="ura1"
                     /locus_tag="SPAC22G7.06c"
                     /db_xref="GeneID:2541544"
     mRNA            complement(739167..746117)
                     /gene="ura1"
                     /locus_tag="SPAC22G7.06c"
                     /product="bifunctional carbamoyl-phosphate
                     synthase/aspartate carbamoyltransferase Ura1"
                     /transcript_id="NM_001018453.2"
                     /db_xref="GeneID:2541544"
     CDS             complement(739300..746034)
                     /gene="ura1"
                     /locus_tag="SPAC22G7.06c"
                     /EC_number="2.1.3.2"
                     /EC_number="3.5.2.3"
                     /EC_number="6.3.5.5"
                     /codon_start=1
                     /product="bifunctional carbamoyl-phosphate
                     synthase/aspartate carbamoyltransferase Ura1"
                     /protein_id="NP_593055.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22G7.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22G7.06c.1"
                     /db_xref="GeneID:2541544"
                     /db_xref="GOA:Q09794"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="PomBase:SPAC22G7.06c"
                     /db_xref="PomBase:SPAC22G7.06c.1"
                     /translation="MSGLLPSLSSSFPLVQSEALGMPRTHGPKPSENDPKEPTCSPSP
                     AFYSVNGEMKDYKLMALELEDKSVLQGYSFGADHSVSGELVFQTGMVGYPESLTDPSY
                     RGQILVFTFPTVGNYGVPDRRILDEISGLPKYFESNQIHVAAIIISSYSQNYSHFLAH
                     SSLGEWLKEQGIPGIFGIDTRALTKKIRDQGSMLGRLLIQKDESPINPSSITGLGKDW
                     STAFEDIPWKNPNTENLTSQVSIKEPKLYEPHPTTAIKKADGKIIRILVIDVGMKYNQ
                     IRCFLNRGVELLVVPWDYDFTKETYDGLFISNGPGDPSLMDLVVDRVKRVLESKTVPV
                     FGICFGHQIMARAAGASTTKMKFGNRGHNIPCTCMISGRCYITSQNHGYAVDASSLSN
                     GWKELFVNANDGSNEGIYNTEYPFFSVQFHPESTPGPRDTEFLFDVFIDVVKRSADAK
                     SLQPFKLPGGTIEENRSRHPLVDAKRVLILGSGGLSIGQAGEFDYSGSQAIKALREEG
                     IYTILINPNIATIQTSKGLADKVYFLPVNADFVRKVIKQERPDSIYVTFGGQTALNVG
                     IELKDEFEQLGVKVLGTPIDTIITTEDRELFARAMDEINEKCAKSASASSIEEAIKVS
                     KDISFPVIVRAAYALGGLGSGFADNEAELIDLCTLAFATSPQVLIERSMKGWKEIEYE
                     VVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLTDEDYNMLRTTAVNVIRHLGV
                     VGECNIQYALNPFTKEYCIIEVNARLSRSSALASKATGYPLAFTAAKLGLNIPLNEVK
                     NSVTKVTCACFEPSLDYVVVKIPRWDLKKFTRVSTQLSSAMKSVGEVMSIGRTFEEAI
                     QKAIRAIDYSNTGFNVKDALMSIDTELQTPSDQRLFAIANAMASGYSVDRIWELTRID
                     KWFLEKLMGLIRTSQLISKHDISSLPISLLKTAKQLGFADVQIAAFMNSTELAVRRIR
                     TEAGIRPFVKQIDTVAAEFPAFTNYLYTTYNAVEHDIHFNDKGVMVLGSGVYRIGSSV
                     EFDWCAVRAVRTLRDRGVKTIMVNYNPETVSTDYDEADRLYFENIGLETVLDIYEQES
                     SSGIIIAMGGQTANNIALPLHRENVKILGTSPEMIDGAENRFKFSRMLDDIGVDQPKW
                     KELTSFDEADKFCDTVGYPVLVRPSYVLSGAAMNTVYSQSDLHSYLQQAVAINKDHPV
                     VISKYIENAKEIELDAVAREGKMVMHVISEHVENAGVHSGDATLVLPPQDLAPTTIER
                     IVDAAAKIGEALNITGPYNIQFIAKDNEIKVIECNVRASRSFPFVSKVIGVDMISMAT
                     DVIMGNPIQPYPDVDLPRDYVAVKVPQFSFSRLSGADPVLGVEMASTGEVACFGHNKF
                     EAYLKAMISTGFRLPKKNILISIGSYKEKAELLPYVKKLYENNYNIFATAGTSDYFME
                     SGVPCKYLADLPAEEANNEYSLSAHLANNMIDMYINLPSNNRYRRPANYISSGYKSRR
                     LAIDYSVPLVTNVKCAKLMIEAICRNLDFSLSTVDFQSSFQTANLPGLINISAFLPEF
                     TSEAVSDYTKECIASGFTMARFLPFSTSSTLADKDSLSAVKKLALDHAHCDYNFSVIA
                     SSTNEVTISELTSESGCLFFHFEKDDSGIDHVTAVASHFNVWPDTQTVMTDAKSTTLA
                     SLLLLASLHNRRIHITNVSSKDDLNLIVLAKQRSLPVTFDVSVYSLFLNQNDYPGATF
                     LPTADDQVEIWNKLSYIDCFSIGSIPSRLAKFVGNTAFTGFGVREAIPLLLTAVNEGR
                     LTLKDVVDRFYSNPKAIFRLHDQDDSGVQLEVDRSVSWSSKDWTPFNGKKLYGSIQSV
                     QFDGHDVFFDGELNFEHTYGRDYSSASLADKSKATRKVSALMSPGLPHAAPSLAEAFG
                     QAPENKAHPDISLNMTPNFKPSHELVQLINSSPFYRKHIISVHQVTRSDLHVLFAIAH
                     QMRIIVERQGVIDLCYGKLLCTMFFEPSTRTSSSFDAAMQRLGGKVVAVTASASSVNK
                     GESLADTIRTLGCYGDAIVLRHPSIESARIAANFSPVPIINGGNGSKEHPTQAFLDLY
                     TIREELGSVNGLTITFIGDLKYGRTVHSLARLLAFWHVELHLVSPEQLALPDDVKDDI
                     RANGLNFIEHRELTKEVVAQSDVLYCTRVQKERFASVDEYEKLKDSFIVDNSVLASAK
                     SHCIVMHPLPRNREISEEVDFDQRRAAYFRQMRYGLYIRMALLACVMGATEVAN"
     gene            complement(746537..748971)
                     /locus_tag="SPAC22G7.07c"
                     /db_xref="GeneID:2541669"
     mRNA            complement(746537..748971)
                     /locus_tag="SPAC22G7.07c"
                     /product="mRNA
                     (2'-O-methyladenosine-N(6)-)-methyltransferase"
                     /transcript_id="NM_001018454.2"
                     /db_xref="GeneID:2541669"
     CDS             complement(747143..748402)
                     /locus_tag="SPAC22G7.07c"
                     /EC_number="2.1.1.62"
                     /codon_start=1
                     /product="mRNA
                     (2'-O-methyladenosine-N(6)-)-methyltransferase"
                     /protein_id="NP_593056.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC22G7.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22G7.07c.1"
                     /db_xref="GeneID:2541669"
                     /db_xref="GOA:Q09800"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PomBase:SPAC22G7.07c"
                     /db_xref="PomBase:SPAC22G7.07c.1"
                     /translation="MPCILYMDDTSCLIDLPTSLQFNKHILPTRTKPVVKPYLLPEKS
                     TSDYENSGKGTVGQVLQSLQRVRRALQLRSLDDNQSTDKSHHVQFQDIVYRSNTSASE
                     IHFQAENAPLVQWYSDIFKVLVKAPVIQFEDQCLQWLKMLNTIPPSYSFITIKSKDTV
                     ELGLEEIYQQCVQNDGASAIKLKLKGSKVITESSETNCRDSIYYIPARSSFIMGDVEK
                     TAQILLEAIDGHLEKPKCIIIDPPWPNKSVARSSVYKVNRNLGYLKALPIQESLSKTG
                     VVAVWCTNKEKYVNFVKKVLFKKWNLTLVSTWTWLKITAFGEPLFDVYSNMRKPWEQL
                     LIGVTSEYTSVYSDKIPPTFTIIGIPDYHSRKPSLKPFISRWFNCSANESLPVLEIFG
                     RSLTPNWITWGREPLLFMHELYWSSDN"
     gene            749523..751846
                     /gene="ppk8"
                     /locus_tag="SPAC22G7.08"
                     /db_xref="GeneID:2541663"
     mRNA            join(749523..749995,750113..751846)
                     /gene="ppk8"
                     /locus_tag="SPAC22G7.08"
                     /product="putative serine/threonine protein kinase Ppk8"
                     /transcript_id="NM_001018455.2"
                     /db_xref="GeneID:2541663"
     CDS             join(749930..749995,750113..751588)
                     /gene="ppk8"
                     /locus_tag="SPAC22G7.08"
                     /codon_start=1
                     /product="putative serine/threonine protein kinase Ppk8"
                     /protein_id="NP_593057.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22G7.08"
                     /db_xref="EnsemblGenomes-Tr:SPAC22G7.08.1"
                     /db_xref="GeneID:2541663"
                     /db_xref="GOA:Q09792"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PomBase:SPAC22G7.08"
                     /db_xref="PomBase:SPAC22G7.08.1"
                     /translation="MAVITEENSNNLFCTDSLELTSNKQDDQVISNYLKPVRSYPYIK
                     YSRSSLLLTASTTLPENFVISFTNSIESEESDKSDYLLDHAHSLQELSTTHSSLSSTL
                     TSMSEESSSTESKFATLNDGINGGNPYSRLYRKNPSSDPNDIPPQFHFKKKSKSFYSS
                     MYDKMKIRINILPNGNDNFIKKRNSGFALAPIACYNHTSDLRKLLKHKVTGSNASIFK
                     RINPRSRKRVVNPECSVTDTPYGKLNNVIGEGASSFIRVINDRNKLPIYVAKVFRPPL
                     DTSLLRRYVRYFIAEYTFASTLRHPNIIKVLDIIYKRHTILQIIEYVPYDLFTFITKG
                     HCSALKADQMFFQLLDGVAYMHSLGIAHRDIKLDNIMLDENLNVKIIDFGTAFVFHYP
                     FESTTLMSDGVVGSKPYVAPEVLTQKPYDPSAVDVWSCAIVYCCIALKRFPWKVPHTS
                     DKRFNLYVTQRNDPNTKSQLIESLPMNSRDTIYHMLDIDFNTRCSISGARSTTWMQQV
                     RKTLI"
     gene            complement(751647..753492)
                     /gene="nup45"
                     /locus_tag="SPAC22G7.09c"
                     /db_xref="GeneID:2541890"
     mRNA            complement(join(751647..751800,751840..752131,
                     752188..752296,752343..752429,752473..753079,
                     753156..753492))
                     /gene="nup45"
                     /locus_tag="SPAC22G7.09c"
                     /product="nucleoporin Nup45"
                     /transcript_id="NM_001018456.2"
                     /db_xref="GeneID:2541890"
     CDS             complement(join(751673..751800,751840..752131,
                     752188..752296,752343..752429,752473..753079,
                     753156..753210))
                     /gene="nup45"
                     /locus_tag="SPAC22G7.09c"
                     /codon_start=1
                     /product="nucleoporin Nup45"
                     /protein_id="NP_593058.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22G7.09c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22G7.09c.1"
                     /db_xref="GeneID:2541890"
                     /db_xref="GOA:Q09793"
                     /db_xref="InterPro:IPR024882"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="PomBase:SPAC22G7.09c"
                     /db_xref="PomBase:SPAC22G7.09c.1"
                     /translation="MFGLNKTPSFGSTGTQNQNTGTSAGTGLFSSNTFGNNTQANTPA
                     STGFGGVTGGAFGQTKPQTGGSLFGNKPNATSTTPGLNLFGQNPQAAPGGSLFGASTT
                     KPQAPGGLFNQNQTQAQPAQAAPTGGLFGLSGQNQTQSQTQPAQANTSLFGQSNIGTT
                     GGLFDQNRPNTSTFGQFSTQPASAGLFGQSTQPSGSTGFGLSNNTQTTPFFSAAQQQP
                     STTQLPSNPAINATTRYSSLNANTQKFLDDLDKEIFSQIQLAEELQTKLGTVSELVES
                     VPNDVAEVQRRLSSVSTALLIDSDEIETTKRVVDEDTSNARISSRILDVFKTPGATYP
                     FASNDPLMNYFEQFTENAKKRTDLYAATIGELEQHLEQVETTPQNNSPEALLKTIKEE
                     HKLFMALSNRFAQVHDEVKRLQVNTSTSLPFIS"
     gene            753624..755676
                     /locus_tag="SPAC22G7.10"
                     /db_xref="GeneID:2541873"
     mRNA            join(753624..753841,753887..753939,753987..755676)
                     /locus_tag="SPAC22G7.10"
                     /product="fip1-like pre-mRNA polyadenylation factor"
                     /transcript_id="NM_001018457.2"
                     /db_xref="GeneID:2541873"
     CDS             join(753704..753841,753887..753939,753987..754830)
                     /locus_tag="SPAC22G7.10"
                     /codon_start=1
                     /product="fip1-like pre-mRNA polyadenylation factor"
                     /protein_id="NP_593059.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22G7.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC22G7.10.1"
                     /db_xref="GeneID:2541873"
                     /db_xref="GOA:Q09801"
                     /db_xref="InterPro:IPR007854"
                     /db_xref="PomBase:SPAC22G7.10"
                     /db_xref="PomBase:SPAC22G7.10.1"
                     /translation="MSNADQHMDVDEDEYLYGETIEERNDGVTVSNAKSPEQASEESD
                     DSDIEFIIETKPGERAEPLGGSIATLGSTRPSAKPQVEKTAVEVKTTEPQDLSTAETA
                     PKVDIDAVPTIDGKNIFEIDLESFDDKPWRKPGADISDYFNYGFDEFTWAAYCAKQTT
                     LRDDFSPQKFMASLAQIPGPLPSGNVPSPAEFQAMMASGFPPFMPIPPPIGGPQEDMG
                     YSRNFPVHASSNYNTTHTSGGGVHSGAATPNAYVNNNPSSSRRESESPANSPNITSSA
                     GMTHAQPTHNPTSSYGNGASTNYNASRPPSNHPHSSNYPSSSRRKPSPDRYSNYSSRG
                     SGGRYRRNRY"
     gene            complement(754932..755637)
                     /locus_tag="SPAC22G7.11c"
                     /db_xref="GeneID:2541751"
     mRNA            complement(754932..755637)
                     /locus_tag="SPAC22G7.11c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018458.2"
                     /db_xref="GeneID:2541751"
     CDS             complement(755080..755502)
                     /locus_tag="SPAC22G7.11c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_593060.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC22G7.11c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22G7.11c.1"
                     /db_xref="GeneID:2541751"
                     /db_xref="GOA:Q09802"
                     /db_xref="InterPro:IPR018824"
                     /db_xref="PomBase:SPAC22G7.11c"
                     /db_xref="PomBase:SPAC22G7.11c.1"
                     /translation="MPDPNRVLAGKKATLHNPNVSQQAKERAEDYIESHSSGQETGDY
                     SAQAGGRDLDYEDLGDYDEDADFDNEEGLNVLGDESGFVDDPMKTGDLVEEDQLEGKN
                     IENVRGGYKATMHNPNVSKQAKTRAQRALEEIDDETQA"
     gene            complement(756479..757153)
                     /gene="sss1"
                     /locus_tag="SPAC4G8.02c"
                     /db_xref="GeneID:2543140"
     mRNA            complement(join(756479..756610,756779..756881,
                     756989..757153))
                     /gene="sss1"
                     /locus_tag="SPAC4G8.02c"
                     /product="putative translocon gamma subunit Sss1"
                     /transcript_id="NM_001018459.2"
                     /db_xref="GeneID:2543140"
     CDS             complement(join(756598..756610,756779..756881,
                     756989..757085))
                     /gene="sss1"
                     /locus_tag="SPAC4G8.02c"
                     /codon_start=1
                     /product="putative translocon gamma subunit Sss1"
                     /protein_id="NP_593061.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC4G8.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC4G8.02c.1"
                     /db_xref="GeneID:2543140"
                     /db_xref="GOA:Q09827"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR008158"
                     /db_xref="InterPro:IPR022943"
                     /db_xref="InterPro:IPR023391"
                     /db_xref="PomBase:SPAC4G8.02c"
                     /db_xref="PomBase:SPAC4G8.02c.1"
                     /translation="MADNADDLFQIPKNFYKEGSHFIKRCVKPDRKEFLSISKAVATG
                     FVLMGLIGYIIKLIHIPINKVLVGGA"
     gene            complement(757915..762714)
                     /locus_tag="SPAC4G8.03c"
                     /db_xref="GeneID:2543684"
     mRNA            complement(757915..762714)
                     /locus_tag="SPAC4G8.03c"
                     /product="putative RNA-binding protein"
                     /transcript_id="NM_001018460.2"
                     /db_xref="GeneID:2543684"
     CDS             complement(758208..760550)
                     /locus_tag="SPAC4G8.03c"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="NP_593062.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC4G8.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC4G8.03c.1"
                     /db_xref="GeneID:2543684"
                     /db_xref="GOA:Q09829"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PomBase:SPAC4G8.03c"
                     /db_xref="PomBase:SPAC4G8.03c.1"
                     /translation="MVNRDAYNELNLNKKSQETNRKPSPLSSYTSISRELDYANQSPF
                     SSNSFSPTELKARTSATFDVRSASTSPINASDFHKYSHDPFQRLFKAKGNASFSKTKS
                     FPSSVTYSPSEETFPLTSGMNKSVHEYPFTLSESAISSSHKSSIPERRNFDSSVSVSN
                     PLLHWNNVDTLLRDGSLENVNNSRQDQFLPYKTFSSTISNSDFLHRESSFSSLIDEES
                     KLASLRNLNINDRPPLPVLKNSERNLLHRQLLSNHPFFSQNNVSLSTNSKNYSTDFTK
                     IQSDSSLLQNRQQNHRIETDQLSHFPDHLDPSRIPSPYQPSSLQPLESRKLHSKVDVH
                     SKKLNALSQLNPILRSENVLQNDNHHSSLSMDNDPTNVSTKNRNNQTVGEHPYVDDNK
                     KKKKGPAKPKEKATLGKTVNSFFGSHSTSNYSKVPLSAKLTGEKSDDLSNLLKNKGKK
                     KSQDNQIPHLVGFLGHLSTICKDQYGCRYLQKLLDENPKVNASLFFPEIRQSVVQLMI
                     DPFGNYMCQKLFVYASREQKLSMLNGIGEGIVDICSNLYGTRSMQNIIDKLTSNEQIS
                     LLLKIIIPSLTTLACDNNGTHVLQKCIAKFPPEKLEPLFLSMEENLITLATNRHGCCI
                     LQRCLDRTNGDIQERLVNSIIKSCLLLVQNAYGNYLVQHVLELNIQPYTERIIEKFFG
                     NICKLSLQKFSSNAIEQCIRTASPSTREQMLQEFLSFPNIEQLLDDCYANYVMQRFLN
                     VADESQKFLILRSISHVIPKIQNTRHGRHILAKLTSSTSS"
     gene            762720..764810
                     /locus_tag="SPNCRNA.679"
                     /db_xref="GeneID:14217976"
     misc_RNA        762720..764810
                     /locus_tag="SPNCRNA.679"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151045.1"
                     /db_xref="GeneID:14217976"
     gene            765526..767503
                     /locus_tag="SPNCRNA.680"
                     /db_xref="GeneID:14218090"
     misc_RNA        765526..767503
                     /locus_tag="SPNCRNA.680"
                     /product="intergenic RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_151047.1"
                     /db_xref="GeneID:14218090"
     gene            767446..770246
                     /locus_tag="SPAC4G8.04"
                     /db_xref="GeneID:2543572"
     mRNA            join(767446..769748,769812..770246)
                     /locus_tag="SPAC4G8.04"
                     /product="putative GTPase-activating protein"
                     /transcript_id="NM_001018462.2"
                     /db_xref="GeneID:2543572"
     CDS             join(767709..769748,769812..770090)
                     /locus_tag="SPAC4G8.04"
                     /codon_start=1
                     /product="putative GTPase-activating protein"
                     /protein_id="NP_593064.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC4G8.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC4G8.04.1"
                     /db_xref="GeneID:2543572"
                     /db_xref="GOA:Q09830"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="PomBase:SPAC4G8.04"
                     /db_xref="PomBase:SPAC4G8.04.1"
                     /translation="MQPSVSDSSVYLSSAPTKPIASGSVATGIDSMPSKVDITPCDLL
                     ENSKSSAPLFVECNQESLHSIPGSLHLVPDASIERLIEKHGAVNLLRQLAKDVAERDS
                     FISDLKFHFESREYVFRELLREHGLDPVLANTKLSQRHSASFFPSSQEPSIPENPSSL
                     TGEKPHLYARIDSAINEPFTPSDRLSPSSLVPLLKLPALDHAVSSSSSSDLPSDPNSA
                     SYIASSKQKASSLKLTSSLKKFYSWTSSSSLQHTRENLHDSTSSLRDHDPSLLSSSKF
                     FRSSPRCSTPSVSSTFVSATSEPEVETYSVSTKNSSSNKNLRSSLSKLLSTSNLNNKP
                     LSLSSTAPSMPSIGSVELGNMIPKETQPPSMRNDWKDYLDNNSKEILDQFGFLQKRPS
                     HDTPLCPEDIKLNQKQTLSFYESNYGLVDDFFGNELDGLNDSPLLLNKKDILLDMKES
                     TRQKNWSLFFQRLYKKYKITDEDTIGLLGISSIGVKGRHGKKRWHKFRELVKNGVPLC
                     YKAKVWLECSGAYQLHSPGYYEELLSRTDEVESASVAQIDMDINRTMAKNVFFGGKGP
                     GIPKLRRILVAYSRHNPHIGYCQGMNVIGAFLLLLYASEEDAFYMLMSIIENVLPPKY
                     FTPDLMTSRADQLVLKSFVKESLPEIYSHLELLGVDLDAISFHWFLSVYTDTLPTNIS
                     FRIFDMLFCDGYVCLFRVALTILKSLKQQILACNSSSAIYSFLSDLVQYSFQPDSFIK
                     EAADRWSKLVTEKSIERKRNLAISSLNLAVNY"
     gene            770502..772666
                     /gene="ppk14"
                     /locus_tag="SPAC4G8.05"
                     /db_xref="GeneID:2543432"
     mRNA            770502..772666
                     /gene="ppk14"
                     /locus_tag="SPAC4G8.05"
                     /product="putative serine/threonine protein kinase Ppk14"
                     /transcript_id="NM_001018463.2"
                     /db_xref="GeneID:2543432"
     CDS             770623..772323
                     /gene="ppk14"
                     /locus_tag="SPAC4G8.05"
                     /codon_start=1
                     /product="putative serine/threonine protein kinase Ppk14"
                     /protein_id="NP_593065.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC4G8.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC4G8.05.1"
                     /db_xref="GeneID:2543432"
                     /db_xref="GOA:Q09831"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PomBase:SPAC4G8.05"
                     /db_xref="PomBase:SPAC4G8.05.1"
                     /translation="MNELHDGESSEEGRINVEDHLEEAKKDDTGHWKHSGTAKPSKFR
                     AFIRLHFKDSRKFAFSRKKEKELTSEDSDAANQSPSGAPESQTEEESDRKIDGTGSSA
                     EGGDGSGTDSISVIKKSFFKSGRKKKDVPKSRNVSRSNGADTSVQREKLKDIFSPHGK
                     EKELAHIKKTVATRARTYSSNSIKICDVEVGPSSFEKVFLLGKGDVGRVYLVREKKSG
                     KFYAMKVLSKQEMIKRNKSKRAFAEQHILATSNHPFIVTLYHSFQSDEYLYLCMEYCM
                     GGEFFRALQRRPGRCLSENEAKFYIAEVTAALEYLHLMGFIYRDLKPENILLHESGHI
                     MLSDFDLSKQSNSAGAPTVIQARNAPSAQNAYALDTKSCIADFRTNSFVGTEEYIAPE
                     VIKGCGHTSAVDWWTLGILFYEMLYATTPFKGKNRNMTFSNILHKDVIFPEYADAPSI
                     SSLCKNLIRKLLVKDENDRLGSQAGAADVKLHPFFKNVQWALLRHTEPPIIPKLAPID
                     EKGNPNISHLKESKSLDITHSPQNTQTVEVPLSNLSGADHGDDPFESFNSVTVHHEWD
                     "
     gene            complement(772650..774027)
                     /gene="trm12"
                     /locus_tag="SPAC4G8.06c"
                     /db_xref="GeneID:2543551"
     mRNA            complement(772650..774027)
                     /gene="trm12"
                     /locus_tag="SPAC4G8.06c"
                     /product="putative tRNA methyltransferase Trm12"
                     /transcript_id="NM_001018464.2"
                     /db_xref="GeneID:2543551"
     CDS             complement(772673..773929)
                     /gene="trm12"
                     /locus_tag="SPAC4G8.06c"
                     /codon_start=1
                     /product="putative tRNA methyltransferase Trm12"
                     /protein_id="NP_593066.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC4G8.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC4G8.06c.1"
                     /db_xref="GeneID:2543551"
                     /db_xref="GOA:Q09832"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="InterPro:IPR026274"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PomBase:SPAC4G8.06c"
                     /db_xref="PomBase:SPAC4G8.06c.1"
                     /translation="MISFLVQKSEAKYWKDVVQNKNKFLKNIGIISGPKLVDTYSNQF
                     EADFLKKCVLIPTSYNKEDLPKDILDCPRIYLIEEEVKSVQTDEKLQIKVLRYVSQIL
                     HTTVSEEQYPVPSRFVIYPPLALLSLNSFGTKEWHLFFQSYANVDVKAGLFDIFAREW
                     NVSHIAINEPIPVGDVMRRPLSLKPLYGDFGVLIDGNPSEQDFQKAFWVSCRQNGIYQ
                     TWAPLYTMFSRGNSIEKARVLNFSYIKDEIIADLYAGIGYFTFSYVKAGASTVFCWEI
                     NPWSVEALRRAALKNGWSIYVVRNGENYEFKVGTHRIVVFLESNVYAAERFSKMNISA
                     RHINLGMLPSSEKSWSTATSILKRESHSFIHVHENVKDEDIETYSSEVNSCFSKMLAK
                     NTVCVTNCVKSFSPRVSHIVYDIETV"
     gene            complement(<774000..776062)
                     /locus_tag="SPAC4G8.07c"
                     /db_xref="GeneID:2543535"
     mRNA            complement(join(<774000..774023,774155..774403,
                     774453..775290,775414..775513,775641..776062))
                     /locus_tag="SPAC4G8.07c"
                     /product="tRNA (uracil(54)-C(5))-methyltransferase"
                     /transcript_id="NM_001018465.2"
                     /db_xref="GeneID:2543535"
     CDS             complement(join(774000..774023,774155..774403,
                     774453..775290,775414..775513,775641..776013))
                     /locus_tag="SPAC4G8.07c"
                     /codon_start=1
                     /product="tRNA (uracil(54)-C(5))-methyltransferase"
                     /protein_id="NP_593067.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC4G8.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC4G8.07c.1"
                     /db_xref="GeneID:2543535"
                     /db_xref="GOA:Q09833"
                     /db_xref="InterPro:IPR002792"
                     /db_xref="InterPro:IPR010280"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR025795"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PomBase:SPAC4G8.07c"
                     /db_xref="PomBase:SPAC4G8.07c.1"
                     /translation="MYPYCLKYLTNGLRSKQMINFLCIQNILSARTLKICRFRFLPTP
                     SHPTHKMAQETRAISSISEAANKRARKLSKRRAKKPVEEGSSGHVLLLEIENLIEKPV
                     LANVPFERFQEIEVKISYLSSSGDGIGLVCNDQYAVVVPFTLPGDIVKAKLHFLADTY
                     ALADFLEVISPSEDRDDTLIKCPYFAKCGGCQYQMLSYDKQLLQKKRVVEKAFQYYSK
                     LDSSLLPAIKDTVGSPLQYNYRTKITPHFDVPKGGTKGPLIIGFQEKGRRRVMDIEEC
                     PIATKTINEEYPKIIEDVQSRANTFKRGATILMRDSATEDGKHCVITDHKMIVREQFG
                     DLSFTFPAGAFFQNNNSILEKFTSYVREQLLNPFGRKEHQRPKYFVDAYCGSGLFSVA
                     CSKGFLSVIGVEISADSVRYAEENAKRNNVSNATFIVGQAEKIFSSIETPPNETAMVI
                     DPPRKGCDQSFLNQLLEYSPYRIVYISCNVHTQARDVGFLLSQEKGRSYKIDEIRGFD
                     LFPQSHHVESILTLTKVVS"
     gene            776184..777243
                     /locus_tag="SPNCRNA.681"
                     /db_xref="GeneID:14217977"
     misc_RNA        776184..777243
                     /locus_tag="SPNCRNA.681"
                     /product="intergenic RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_151048.1"
                     /db_xref="GeneID:14217977"
     gene            776272..777066
                     /locus_tag="SPNCRNA.159"
                     /db_xref="GeneID:9407320"
     misc_RNA        join(776272..776539,776589..776758,776829..777066)
                     /locus_tag="SPNCRNA.159"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150482.1"
                     /db_xref="GeneID:9407320"
     gene            777177..778498
                     /locus_tag="SPAC4G8.08"
                     /db_xref="GeneID:2543493"
     mRNA            join(777177..777287,777338..777731,777891..778498)
                     /locus_tag="SPAC4G8.08"
                     /product="putative mitochondrial iron ion transporter"
                     /transcript_id="NM_001018466.2"
                     /db_xref="GeneID:2543493"
     CDS             join(777259..777287,777338..777731,777891..778283)
                     /locus_tag="SPAC4G8.08"
                     /codon_start=1
                     /product="putative mitochondrial iron ion transporter"
                     /protein_id="NP_593068.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC4G8.08"
                     /db_xref="EnsemblGenomes-Tr:SPAC4G8.08.1"
                     /db_xref="GeneID:2543493"
                     /db_xref="GOA:Q09834"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PomBase:SPAC4G8.08"
                     /db_xref="PomBase:SPAC4G8.08.1"
                     /translation="MDVQTLMAASAGAVASRLLCHPIDTITVHKQTIGKFSFKTMPLK
                     AYYRGLPISLTLITPATCLYLSTYVEAKRRFKPSVGEGAILYSICGMTAEVVSSFVWT
                     PLEVIKARTQISQKGSVINTISTLARSEGLKGFYRGYWMGVAIYLPTTVSWWVCYEES
                     KKYLQKQSNWDISVIAPICSALGTVVATTISTPLDIVKTRYQVATSSAMRKAEYGLQA
                     EKELGILEIAKLLFSKHGVKGFTRGLFTRMCYIMPSGMISMSVFESFKSKDID"
     gene            complement(777800..778374)
                     /locus_tag="SPNCRNA.682"
                     /db_xref="GeneID:14217978"
     misc_RNA        complement(777800..778374)
                     /locus_tag="SPNCRNA.682"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151049.1"
                     /db_xref="GeneID:14217978"
     gene            778431..781324
                     /locus_tag="SPAC4G8.09"
                     /db_xref="GeneID:2543476"
     mRNA            778431..781324
                     /locus_tag="SPAC4G8.09"
                     /product="putative leucine--tRNA (Leu) ligase"
                     /transcript_id="NM_001018467.2"
                     /db_xref="GeneID:2543476"
     CDS             778532..781156
                     /locus_tag="SPAC4G8.09"
                     /EC_number="6.1.1.4"
                     /codon_start=1
                     /product="putative leucine--tRNA (Leu) ligase"
                     /protein_id="NP_593069.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC4G8.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC4G8.09.1"
                     /db_xref="GeneID:2543476"
                     /db_xref="GOA:Q09828"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002302"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR025709"
                     /db_xref="PomBase:SPAC4G8.09"
                     /db_xref="PomBase:SPAC4G8.09.1"
                     /translation="MLKSVGTNGRKVPKIASLCNFLKFNKNIHSNPDFLAIAENWKSY
                     WKSHYPFVKNDKGKKKYILSMFPYPSGLLHIGHVRVYTISDILSRYYRMKGYKVIHPM
                     GWDAFGLPAENAAIENGISASSWTYENIKKMKEQTYHMNIYFDWDREISTCNPDYYKW
                     SQYLFLQMFHKGLAYQAEATVNWDPVDCTVLANEQVDSHGRSWRSGAIVEKKNLRQWF
                     LKISDYSDQLLDDLETLPKWPDKVKKMQRNWIGRTTGFEISFPLLNDKETLTVFTTKP
                     ETIIDVSFIALSKNHKLVLLESQKDPSLAEHLRNESLLDKGYQLPCFAKNPVTGKALP
                     IFYAPYVLDCYGTGAVMGAPIHDRRDFEFAKRNNIIFSKESCIGSYFTNEGKELLNHH
                     DSSNLMDIKQKMLQQKIVSYLEEKKLAKRVKNYRLKDWLISRQRFWGTPIPMVHCETC
                     GAVPVPESELPVKLPDLDKIYEKGTSPLSNLETWMKTTCPKCHGPATRETDTMDTFVD
                     SSWYYFRFLDSKNSELPVGLASASSLMPVDIYIGGVEHSILHLLYSRFFSKFMKDIGL
                     WNGDKYLNEPFTQLITQGMVHGLTYTTMSDERILNPKEVQKIGDEYFLISNPKEKVQL
                     SYQKMSKSKHNGVDPIRTIQKYGSDIIRAYIIFSAPVEGVLLWNENAIMGTKRWLTKI
                     WNCVHQLLEREKKMSDAMRQTKLTIVDDHNSRKLESQYNEFISQCSAHYENVFSLNLV
                     ISDAMKLTNNIADALKNNKVNIGTIKASLEVLVKCIAPIIPCFSSECWLLLGHNSSVY
                     SNWPISKNKKENMEEPVTIPVQINGKVRFKIEMPKLNDENEILNFVLETNDGKRWLSN
                     KKVLKSFVKQKIISLVTD"
     gene            complement(778805..781335)
                     /locus_tag="SPNCRNA.683"
                     /db_xref="GeneID:14217979"
     misc_RNA        complement(778805..781335)
                     /locus_tag="SPNCRNA.683"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151050.1"
                     /db_xref="GeneID:14217979"
     gene            complement(781347..783634)
                     /gene="atp10"
                     /locus_tag="SPAC4G8.11c"
                     /db_xref="GeneID:2542816"
     mRNA            complement(join(781347..782336,782438..782704,
                     782803..783634))
                     /gene="atp10"
                     /locus_tag="SPAC4G8.11c"
                     /product="putative F1-F0 ATPase assembly protein"
                     /transcript_id="NM_001018469.2"
                     /db_xref="GeneID:2542816"
     gene            781348..783419
                     /gene="gos1"
                     /locus_tag="SPAC4G8.10"
                     /db_xref="GeneID:2542969"
     mRNA            781348..783419
                     /gene="gos1"
                     /locus_tag="SPAC4G8.10"
                     /product="putative SNARE protein Gos1"
                     /transcript_id="NM_001018468.2"
                     /db_xref="GeneID:2542969"
     CDS             781487..782035
                     /gene="gos1"
                     /locus_tag="SPAC4G8.10"
                     /codon_start=1
                     /product="putative SNARE protein Gos1"
                     /protein_id="NP_593070.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC4G8.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC4G8.10.1"
                     /db_xref="GeneID:2542969"
                     /db_xref="GOA:Q09835"
                     /db_xref="InterPro:IPR023601"
                     /db_xref="PomBase:SPAC4G8.10"
                     /db_xref="PomBase:SPAC4G8.10.1"
                     /translation="MKSMLLRDSVKKASQFQRSLHSDPNQAKILLEERRKLLEEANSS
                     ADENDSHSMATIKSHFERLKRDEQLLNGVLKKYDAKQEVLSPEELRDAQNFLEMQEAN
                     SLDNSIRGTNELLERAYATREDFDYQNSVLGNVTNRINGAAMSIPFINQILRKTSIRR
                     RRDSIILALLISVLMLLFLFFH"
     CDS             complement(join(782142..782336,782438..782704,
                     782803..783144))
                     /gene="atp10"
                     /locus_tag="SPAC4G8.11c"
                     /codon_start=1
                     /product="putative F1-F0 ATPase assembly protein"
                     /protein_id="NP_593071.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC4G8.11c"
                     /db_xref="EnsemblGenomes-Tr:SPAC4G8.11c.1"
                     /db_xref="GeneID:2542816"
                     /db_xref="GOA:Q09836"
                     /db_xref="InterPro:IPR007849"
                     /db_xref="PomBase:SPAC4G8.11c"
                     /db_xref="PomBase:SPAC4G8.11c.1"
                     /translation="MAYNYLKNLVIPRLIVKHQFKLRSFSTKSLNDTKEKAPSALIPV
                     GLLVKPTMLSEVQKPTLWEKLTKPASTSSPEQRQKELLNEMKRSTIQDFNEVRRFNGK
                     LFYSPPRLFKEKSALWMYNFHGKSLRNQYKELYKDWQGSPFFFALFSNAFGENQCRNW
                     IQHLAPFDYLPVRYANVQSNLIKYWLQKIFIGKVKRSIPEKCWNEYITAYDNKFSFPE
                     IGWNNKLVGNVYLIDDSCKIRWLGTGDPTNVEIENLKTAIKFLVNKNVG"
     gene            complement(783822..786724)
                     /locus_tag="SPAC4G8.12c"
                     /db_xref="GeneID:2542832"
     mRNA            complement(join(783822..785632,785698..785855,
                     785896..786062,786161..786229,786274..786399,
                     786440..786724))
                     /locus_tag="SPAC4G8.12c"
                     /product="putative alpha-1,2-mannosyltransferase"
                     /transcript_id="NM_001018470.2"
                     /db_xref="GeneID:2542832"
     CDS             complement(join(784675..785632,785698..785855,
                     785896..786062,786161..786229,786274..786399,
                     786440..786563))
                     /locus_tag="SPAC4G8.12c"
                     /codon_start=1
                     /product="putative alpha-1,2-mannosyltransferase"
                     /protein_id="NP_593072.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC4G8.12c"
                     /db_xref="EnsemblGenomes-Tr:SPAC4G8.12c.1"
                     /db_xref="GeneID:2542832"
                     /db_xref="GOA:Q09837"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="PomBase:SPAC4G8.12c"
                     /db_xref="PomBase:SPAC4G8.12c.1"
                     /translation="MFKNRKYAIIYTFLLILRFWFSQGSSYIHPDEHLQSFQIFANKL
                     FGWKVELPWEFTTKKPIRSVVPLNVMLLPIFLLCRCICKSNCSPYPILLFTRLYMCLI
                     SLLIDLSIWNIVPLNARWSALLLYSSSFMATTFQTHTFTNSIETIFFFLTILFLSKLN
                     SVPLNKKISYLYTFLLAIVSVLGFFTRITFLAFVIAPYIYFSVRCFKKNVNNPKDIFL
                     HLCIFVSVSFATVLACILEDYKFYGVFVITFWNNLKYNSQIENLSQHGLHSRLTHFFT
                     NMPLLCGPLIFVPKLWDVRKPATWLWLLPVFILSLFPHQEPRFLLPAASIFIVNSGCL
                     VRSYWIKFLFVMYAVVLAVFFGIMHQNGVIPAVLEVKNIIEQRNVTTMENCNLYFNPE
                     MPTTIYFWKIYSAPTWMLARPKFSQINTSHLYNYSTKQMISKFWETYYEEVKVVNLPE
                     ENTTEFQASTLLVCPVAMLQTSSYLQNLTMLHYIPYHVDLDDTDELPLAELIMNHGIG
                     IFTAKEICENNTITNELPTVLRSVG"
     gene            complement(786778..790219)
                     /gene="prz1"
                     /locus_tag="SPAC4G8.13c"
                     /db_xref="GeneID:2541806"
     mRNA            complement(786778..790219)
                     /gene="prz1"
                     /locus_tag="SPAC4G8.13c"
                     /product="calcineurin-responsive transcription factor
                     Prz1"
                     /transcript_id="NM_001018471.2"
                     /db_xref="GeneID:2541806"
     CDS             complement(787119..789164)
                     /gene="prz1"
                     /locus_tag="SPAC4G8.13c"
                     /codon_start=1
                     /product="calcineurin-responsive transcription factor
                     Prz1"
                     /protein_id="NP_593073.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC4G8.13c"
                     /db_xref="EnsemblGenomes-Tr:SPAC4G8.13c.1"
                     /db_xref="GeneID:2541806"
                     /db_xref="GOA:Q09838"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="PomBase:SPAC4G8.13c"
                     /db_xref="PomBase:SPAC4G8.13c.1"
                     /translation="MERQRSEEANRRFKDLNPSSLYDNLSKPDLGGSSELHTYMNDTS
                     LADIPLFEDTLASEVSSSLISNPSKNNIQHLHPNTSEPFKTSSKSDEYDSYPRTGNVP
                     TFSFTELNDTSVSGFGSQAVFENSVSPLSNPSNSPQAFDLTQGSSSTHNANDFTVNNV
                     GSRRQSIYEFNIGIPSSNIDSSQFLPVSRAIAASEISPSSSPQLLTSFLPSGSVSNPS
                     SPYLQGSVGALYEADAFNFVDVMSQASGTEVDSERFPSVDFEDPSLLMENQQNITGTG
                     SFADYLQPPSSGSLGAFTNASPGESNTGIDFDTDNTNLNPSVDLLSNHSTPSFIFENS
                     PSAEFSHQSSPYLVPNSGRTLNSENARESTIRSVNSPFSEDHADASLTTHVFDPISPT
                     ALSNSVLNYDSNNFSGTPQINVVPSSPSKSQSGPSLPANPLLQTDISITYSQSASPVS
                     GQPAMNENSYDLQNANLCAPEMSPTYTARHRSNSAGSRFDAYEPIPQLYTHFSHSSEC
                     LSVNQDTELLGKIENDNSKSNDYLSVRNTRPRSRSLNSLVGNKSENSSSSKAKSESKS
                     QGNYVCTFAGCNKRFTRAYNLKSHMNTHTNYRPFQCSICKKSFARQHDKRRHEQLHTG
                     IKAFACVTCNQRFARMDALNRHYKSEVGQNCLRTATERGIQVPPSRKTAVASTSKQK"
     gene            790209..790793
                     /locus_tag="SPNCRNA.684"
                     /db_xref="GeneID:14218294"
     misc_RNA        790209..790793
                     /locus_tag="SPNCRNA.684"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151051.1"
                     /db_xref="GeneID:14218294"
     gene            complement(790245..792274)
                     /locus_tag="SPAC16C9.01c"
                     /db_xref="GeneID:2542315"
     mRNA            complement(join(790245..791851,792014..792091,
                     792129..792274))
                     /locus_tag="SPAC16C9.01c"
                     /product="putative carbohydrate kinase"
                     /transcript_id="NM_001018472.2"
                     /db_xref="GeneID:2542315"
     gene            790798..791645
                     /locus_tag="SPNCRNA.685"
                     /db_xref="GeneID:14217883"
     misc_RNA        790798..791645
                     /locus_tag="SPNCRNA.685"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151052.1"
                     /db_xref="GeneID:14217883"
     CDS             complement(join(790884..791851,792014..792091,
                     792129..792168))
                     /locus_tag="SPAC16C9.01c"
                     /codon_start=1
                     /product="putative carbohydrate kinase"
                     /protein_id="NP_593074.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC16C9.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC16C9.01c.1"
                     /db_xref="GeneID:2542315"
                     /db_xref="GOA:Q09839"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="PomBase:SPAC16C9.01c"
                     /db_xref="PomBase:SPAC16C9.01c.1"
                     /translation="MDYPSKDVEFVTTGMFIIDEIEFDGGKKIKDIIGGAGSFALIGA
                     RLWTSEPESQQLGMIVDKGSDFPQVILDELNDLHTGIVYRETPWRKTTYGYNRLRDNG
                     FRLFEYLTPKKPIRAPDLLETGLIYAKTIHIITNPKTFVSVCEELAKYGNLKNRPKIV
                     WEPTPESCLPENWHILQKALKYCDIFSPNEVDSANLLGIDISESKSRAKEFVSAFQEF
                     QIGHDSQGWVVLRNGSDGCLIGACTSSTNATSDAVVPVREILHLPSVQMKNGSVLDTT
                     GAGNAFCGAAILEYYRTGNIIEACAKATVAASFVIQQHGLPAHTKNSEGIDLWNGESV
                     FQRLKEYYEFLASHEASAIKELTKRGV"
     gene            792378..794001
                     /locus_tag="SPNCRNA.686"
                     /db_xref="GeneID:14218091"
     misc_RNA        792378..794001
                     /locus_tag="SPNCRNA.686"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151053.1"
                     /db_xref="GeneID:14218091"
     gene            complement(792521..793937)
                     /locus_tag="SPAC16C9.02c"
                     /db_xref="GeneID:2542316"
     mRNA            complement(join(792521..792949,793049..793609,
                     793659..793937))
                     /locus_tag="SPAC16C9.02c"
                     /product="putative S-methyl-5-thioadenosine phosphorylase"
                     /transcript_id="NM_001018473.2"
                     /db_xref="GeneID:2542316"
     CDS             complement(join(792689..792949,793049..793609,
                     793659..793760))
                     /locus_tag="SPAC16C9.02c"
                     /EC_number="2.4.2.28"
                     /EC_number="2.4.2.-"
                     /codon_start=1
                     /product="putative S-methyl-5-thioadenosine phosphorylase"
                     /protein_id="NP_593076.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC16C9.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC16C9.02c.1"
                     /db_xref="GeneID:2542316"
                     /db_xref="GOA:Q09816"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR010044"
                     /db_xref="InterPro:IPR018099"
                     /db_xref="PomBase:SPAC16C9.02c"
                     /db_xref="PomBase:SPAC16C9.02c.1"
                     /translation="MNKQAEPILLGVIGGSGFYDLPGFDIVESVNPITPWGYPASPIS
                     IARTTSGFLIAFLARHGVGHIYTPTEVPSRANIAALKSLGVLAIVSFSAVGSLREDIP
                     PEDFVLPTQIIDRTLCARPNTFFESGCVAHVSFGDPFDQDLYEILSSCGSNLKNGSKL
                     HTKRKGDDLTVVCMEGPAFSTRAESNLYRSWGASIINMSVIPEAKLAREAEIAYQMVC
                     MATDYDCWRMNEEPVTVETVMEHISNNKDNAKIFLLEAVKKLEAPLLQGFLGRNLRES
                     VQNGIQTNHKHRNPDAIRRLQFLFPNLTIPH"
     gene            794866..796821
                     /gene="nmd3"
                     /locus_tag="SPAC16C9.03"
                     /db_xref="GeneID:2542319"
     mRNA            794866..796821
                     /gene="nmd3"
                     /locus_tag="SPAC16C9.03"
                     /product="putative export adaptor Nmd3"
                     /transcript_id="NM_001018474.2"
                     /db_xref="GeneID:2542319"
     CDS             795084..796580
                     /gene="nmd3"
                     /locus_tag="SPAC16C9.03"
                     /codon_start=1
                     /product="putative export adaptor Nmd3"
                     /protein_id="NP_593077.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC16C9.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC16C9.03.1"
                     /db_xref="GeneID:2542319"
                     /db_xref="GOA:Q09817"
                     /db_xref="InterPro:IPR007064"
                     /db_xref="PomBase:SPAC16C9.03"
                     /db_xref="PomBase:SPAC16C9.03.1"
                     /translation="MDMDSGSMGVAFQPSEPIASTILCCECGVPTPPNAAAMCMDCIK
                     MTTDITSGIPRESTVNHCRECERYMQPPNNWMIAPLESRELMAICLKKLRGLNQVRLV
                     DANFIWTEPHSRRIKVKLTVQKEAFTNTILQQSFQVEFYVNNTQCPDCARTYTPHIWK
                     AVCQVRQKVLHKRTFLYLEQIILKHKAHMNTVNIKETKDGIDFYFGQRAHAIKMVEFL
                     SAVVPIRYKGSEELISEDFKSNTANYKFTYSIEIVPICKDDLVCLPKTVAKAHGNIAQ
                     LVVCTKVGPTIRFLDPLTLQTCDMLPSIYWRTPFPALADIPELTEFIVADVDLLGPTN
                     GKYALADVELIKSSDGSTHLTRTHLGGILNAGNTVLAYHLAVTNFNNEVYDTLREDSI
                     PEVVIVKKTYPQTKKKNRNWRLKTIGMQKAEDVKKQDIERQERDYELFLQNLEEDPEL
                     RQGVNLYKAPVKAIAVADTDMDEEDEVDEDIPQISVDELLDDVEAMHI"
     gene            complement(796876..798833)
                     /gene="mot2"
                     /locus_tag="SPAC16C9.04c"
                     /db_xref="GeneID:2542325"
     mRNA            complement(join(796876..798229,798318..798497,
                     798548..798833))
                     /gene="mot2"
                     /locus_tag="SPAC16C9.04c"
                     /product="putative CCR4-Not complex subunit Mot2"
                     /transcript_id="NM_001018475.2"
                     /db_xref="GeneID:2542325"
     CDS             complement(join(796993..798229,798318..798497,
                     798548..798600))
                     /gene="mot2"
                     /locus_tag="SPAC16C9.04c"
                     /codon_start=1
                     /product="putative CCR4-Not complex subunit Mot2"
                     /protein_id="NP_593078.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC16C9.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC16C9.04c.1"
                     /db_xref="GeneID:2542325"
                     /db_xref="GOA:Q09818"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003954"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="PomBase:SPAC16C9.04c"
                     /db_xref="PomBase:SPAC16C9.04c.1"
                     /translation="MLKTQEIYSSEDEDDMCCPLCMEEIDISDKNFKPCQCGYRVCRF
                     CWHHIKEDLNGRCPACRRLYTEENVQWRPVTAEEWKMDLHRKNERKKREKERKEVELS
                     NRKHLANIRVVQKNLAYVNGLSPKVANEENINVLKGPEYFGQYGKIIKIAINKKAAAN
                     SANGHVGVYITYQRKEDAARAIAAIDGSVSDGRHLRASYGTTKYCTSYLRNQQCPNPS
                     CMYLHEPGDEVDSYTKEDLASLQHTRPLSTKPNVVNGATHSPSPSLPFKTPLLPVTKT
                     PLEEANSSPAAQNQHITTVDHVHPQVSMTPSLSTNNTATSVPAPYSSAASVNVVPGHA
                     TTILHHEESSALPPTAAWAKLSPSVLQERLRAAVNQQPLDALKSSSTQTSIPKIQKLK
                     AAKLPSEEENTTKWLNKAINDLVSSLSKINFSTEGTEFDKKQIEMIQNLPPLFVFNAR
                     SVIDKEVVPEQEKSAENQPPTSLGINNGNPVMPPPGFQS"
     gene            799341..800981
                     /gene="cph1"
                     /locus_tag="SPAC16C9.05"
                     /db_xref="GeneID:2542318"
     mRNA            799341..800981
                     /gene="cph1"
                     /locus_tag="SPAC16C9.05"
                     /product="Clr6 histone deacetylase-associated PHD
                     protein-1 Cph1"
                     /transcript_id="NM_001018476.2"
                     /db_xref="GeneID:2542318"
     gene            complement(799485..800012)
                     /locus_tag="SPNCRNA.687"
                     /db_xref="GeneID:14218173"
     misc_RNA        complement(799485..800012)
                     /locus_tag="SPNCRNA.687"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151054.1"
                     /db_xref="GeneID:14218173"
     CDS             799550..800764
                     /gene="cph1"
                     /locus_tag="SPAC16C9.05"
                     /codon_start=1
                     /product="Clr6 histone deacetylase-associated PHD
                     protein-1 Cph1"
                     /protein_id="NP_593079.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC16C9.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC16C9.05.1"
                     /db_xref="GeneID:2542318"
                     /db_xref="GOA:Q09819"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="PomBase:SPAC16C9.05"
                     /db_xref="PomBase:SPAC16C9.05.1"
                     /translation="MASSINNSSQPTVPSISNNSHGDSFVNEGPPSNFKNNSLTSSTH
                     SSTDHVNVLPISQDKEMDISSPVKKQKASYSNKSPNKAPIQKSRGSSLKSHLETESQQ
                     TPVKRRRRKATIRNVDYCSACGGRGLFICCEGCPCSFHLSCLEPPLTPENIPEGSWFC
                     VTCSIKSHHPPKHPLSIWSQLYDWIDSQNPSQYRLPDDLVHYFHGISRGDTGAYKETE
                     GEMDTDEFSALPTGSSITNLAYCGYCSKPSMGACWVYGCQLCDTFYHKNCKEHAKKCS
                     HDSIGKKGMRVPKNAVVIRTPLVLDTTSNTLNPKVMISGWQFLMGEFPSDELLYFPRL
                     PVSCLYKVSEDGLIKDFLYAIGIEAKKFNNERKKRELEVIPPDVKSALLPARTHPNLP
                     IALRTLFNKART"
     gene            complement(801141..804123)
                     /gene="upf1"
                     /locus_tag="SPAC16C9.06c"
                     /db_xref="GeneID:2542327"
     mRNA            complement(801141..804123)
                     /gene="upf1"
                     /locus_tag="SPAC16C9.06c"
                     /product="ATP-dependent RNA helicase Upf1"
                     /transcript_id="NM_001018477.2"
                     /db_xref="GeneID:2542327"
     CDS             complement(801310..804087)
                     /gene="upf1"
                     /locus_tag="SPAC16C9.06c"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase Upf1"
                     /protein_id="NP_593080.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC16C9.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC16C9.06c.1"
                     /db_xref="GeneID:2542327"
                     /db_xref="GOA:Q09820"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018999"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC16C9.06c"
                     /db_xref="PomBase:SPAC16C9.06c.1"
                     /translation="MSLGLQPNNDISSLVSSKNMTSENGLEHQFEELLVEKQYSEEHC
                     AYCHIKNPNSILKCLHCNKWFCNVRGKSGASHIISHLVRARHKQVALHSHSSLSDTVL
                     ECYNCGTRNVFLLGFIPAKAKTVVVLLCRQPCARASIAKDMNWDLTQWQPIISDRQFL
                     PWLITPPSEEEQKLAIPITSQQMVRLEELWRKDPNANLEDLDKPIEDDSLPSVELRYK
                     DAHAYQAVLSPLIQAEADYDKRLKESQTQKDVVVRWDQAINKRYTAWFLLPKLESGEI
                     RLAIGDEMKLTYEGELRAPWSSTGYVIKIPNNVSDEVGLELKRSDKVPIECTHNFSVD
                     YVWKSTSFDRMQTALRLFATDGSRLSSFLYHKLLGHDIPPSFLKPKLPSDLSVPNLPK
                     LNASQSEAVRAVLSKPLSLIQGPPGTGKTVTSASVVYHLATMQSRKRKSHSPVLVCAP
                     SNVAVDQLAEKIHRTGLRVVRVAAKSREDIESSVSFLSLHEQIKNYKFNPELQRLLKL
                     RSENNELSIQDEKKLRILVAAAEKELLRAAHVICCTCVGAGDRRISKYKFRSVLIDEA
                     TQASEPECMIPLVLGAKQVVLVGDHQQLGPVVMNKKVALASLSQSLFERLIILGNSPF
                     RLVVQYRMHPCLSEFPSNTFYEGTLQNGVTTSERIARHVDFPWIQPDSPLMFYANFGQ
                     EELSASGTSFLNRTEASTCEKIVTTFLRSNVLPEQIGIVTPYDGQRSYIVQYMQNNGS
                     MQKDLYKAVEVASVDAFQGREKDFIILSCVRSSEHQGIGFVNDPRRLNVALTRAKYGV
                     IVLGNPKVLAKHALWYHFVLHCKEKGYLVEGTLNSLQKFSLTLTPPQKPQKFKRDLNV
                     QRSLSPIQNAGSAMLPSFSNLPNLYSSSYLEEWNVFAQYKRRESNATDFEDFRSQVGD
                     DESKFDEPTRF"
     gene            804574..807722
                     /gene="pom2"
                     /locus_tag="SPAC16C9.07"
                     /gene_synonym="mug189; ppk5; SPAC2G11.01"
                     /db_xref="GeneID:2542326"
     mRNA            804574..807722
                     /gene="pom2"
                     /locus_tag="SPAC16C9.07"
                     /gene_synonym="mug189; ppk5; SPAC2G11.01"
                     /product="serine/threonine protein kinase Pom2"
                     /transcript_id="NM_001018478.2"
                     /db_xref="GeneID:2542326"
     CDS             804996..807506
                     /gene="pom2"
                     /locus_tag="SPAC16C9.07"
                     /gene_synonym="mug189; ppk5; SPAC2G11.01"
                     /codon_start=1
                     /product="serine/threonine protein kinase Pom2"
                     /protein_id="NP_593081.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC16C9.07"
                     /db_xref="EnsemblGenomes-Tr:SPAC16C9.07.1"
                     /db_xref="GeneID:2542326"
                     /db_xref="GOA:Q09815"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PomBase:SPAC16C9.07"
                     /db_xref="PomBase:SPAC16C9.07.1"
                     /translation="MVGLISTSETLPKQESKSSSAPVSNFLSPNNLTEQTCSPLRAHS
                     TFKEPVFLLSQRQYSHNSKILTELINSVKRPNKPDQNEEKSAVGIEEKSFKDEHLAQK
                     KGLHHFADLKEIFLNKNLSTLDGLQDASLHDNIQSGKLDNPVISQNRRIVLEKLANPN
                     SSKEYETIPTVENRHPLNKLSKTKTLAYEETINQLDETPGGTNYPMNKKKTLSSETNK
                     YEYPQQSKFHECSQFASPRSSIVNGPRTLGKNSKRADDTARMASRMKPSNFNNNIQSS
                     SYGHASQSTKLTSQRDNDHQKDLNFSPYKSIPLNNRPYSPMSEIVGFSGSTTPLDTYG
                     NRPSGKKFNKNSKFRPPGSTISSYSSASTLRRLPRAPGSKVHAERQNSTFNSGISLRA
                     LRKEMGNTAPVSSNQLLKDADLVMENLSTRNTEKVLREVNILKRLRESCVAITAKSYD
                     TLDERKIRSLTTFEYLEIKNFQKIYFTGSENCQKLSKQIPLDECNEALFDDDNGDYKA
                     IQGDHLLYRYEIIDTVGKGSFGQVLKCIDHKRGQVVAIKVIKNRQKFHGQTLVEVGIL
                     KRLCEADPADKNNVIRYLSHFDFRGHLCIVTELLGSNLFDVIRENNYKGLPLIVVKSF
                     ALQGLQALRLLQGQNIIHCDLKPENLLLSHPLKARIKLIDFGSSCFYNEKVYTYLQSR
                     FYRAPEIILGLEYGKEIDIWSFGCILAELFTGVPLFPGGNETEQLGYIMEVLGPPPMA
                     LIRNSTRSKAYFDSEGKPHPITDSHNRLLVPSTRTFSQLLNTKQASFLDFLSKCLKWD
                     PKDRITVDSALQHEFILGKTSQKPMVSKGSHPLPDLPV"
     gene            807894..812194
                     /gene="urb2"
                     /locus_tag="SPAC2G11.02"
                     /db_xref="GeneID:2541516"
     mRNA            join(807894..808197,808256..812194)
                     /gene="urb2"
                     /locus_tag="SPAC2G11.02"
                     /product="putative ribosome biogenesis protein Urb2"
                     /transcript_id="NM_001018480.2"
                     /db_xref="GeneID:2541516"
     CDS             join(808028..808197,808256..812042)
                     /gene="urb2"
                     /locus_tag="SPAC2G11.02"
                     /codon_start=1
                     /product="putative ribosome biogenesis protein Urb2"
                     /protein_id="NP_593082.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2G11.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC2G11.02.1"
                     /db_xref="GeneID:2541516"
                     /db_xref="GOA:Q09804"
                     /db_xref="InterPro:IPR018849"
                     /db_xref="PomBase:SPAC2G11.02"
                     /db_xref="PomBase:SPAC2G11.02.1"
                     /translation="MSLQTLTKRIRDKNGSREDQIDLANKLFRGEVDVYFPNKEEFII
                     NFLLDRLKENSNLTCVNIGYWQLFLNIWKSDKLSGSFRVSAIRRQSLYPIILNAFEYL
                     IKEFKKDVFLKISDVFVCVYSNLNILYISRSFPDQISLLFSRYCYLIASKIDDLLDSH
                     PNEVFKETLICVIQSAVHSQASSTKAQTQFLHQTLGSILALLCKTQKGDPYFSFLNAV
                     LMKCVLTQHTLDVLLLTKKDSSMTLCSLLNAISFEPINLKAIPLFFIICADSINFHLS
                     SVEKSISQQKASELMYKLFSEHIAFLLSLKNLPEEATLDCMLSICQVFENDNLHRGHS
                     DEYTFAMLEQLLELSVKTLRQNTCWSTSWEMLSSLLAIDFDVLLPHSKILWECIKSVS
                     HQDDIHALKFLKRWVRASAKARILDSFCIDWHLNVQTMSERSILTNRDFITSFSAVAE
                     VSLSQISIKKLVTWLMSSESIMSENSNRFVVYYSLCKSLKRESYPAHLVPNFELFTRS
                     IFNASLKNFNILDERSQALLCMCQISHVQFFSSDMSISASVGMKTLFEDLMAEKSRGL
                     SSTVWSLQLLLCYLEQCLRLNTLHEDTTFPMRVVNYALEYSSKALDKFAENSHLILLD
                     MVDVGKPDLVLTLLCRWLHMVHLYSSRTSITSWIYSIASKFYFIDSLNLETKDSVLES
                     NWERFISSTETYELDSIRDSLIDCLIRLLCYSSNNAIDPVSAPGNLDFDNSAELCSSL
                     TRFTPKNIDFVLKSLIHIPIHSITKNQRTRLLNLLIIHEKLLSDKDNSAHISLRKIIY
                     TLMKTPCSSGFYRDPKIIIDLMQFGKTDLSFHKVHVLIMRSWIQHLDEGNKSEVILKL
                     LQLILADFRELPLETITLIFNALVDSLPTSKHIKNSNDILSSVFTINDMLIDEMTAYL
                     SKKESLCSGTFSCLLACCNSVLRTQNLTSESLNKLHILKVGIEEKAISLKLNELPFLE
                     NWILFQCLLSFGGDDFLKVVAYMVYYRRTVGEMSFRVSDFELALSRLSTNDADYAILN
                     ILNLLTSNECDEFDYSVLMKVVGVFANYSDCFQRNRHLVHMVLLCCTHVFYNQTLKPA
                     TLIDSALDVFLCFVQKTSKFISLDSFNTILTALSTILNLKELECEPKDHANLILKIIQ
                     ILNGLLFNHRSYMSGRFHVFYSILKSLLYSMVQHDSEMKKIKGIALMNFYKPKKVPIH
                     VVQSFCRLLTTWMNPNLMHDSNKKNSSLTDAERLFVKATTKHFVFLLTDFMSAQTVYQ
                     IDIQVKELLTNCFYNVYENLSNHEKQMALVAMNAPSKSLYQKFVNDYLIFAKWNEA"
     gene            complement(811443..814228)
                     /gene="vps45"
                     /locus_tag="SPAC2G11.03c"
                     /db_xref="GeneID:2541485"
     mRNA            complement(join(811443..812139,812192..813472,
                     813559..813766,813816..814228))
                     /gene="vps45"
                     /locus_tag="SPAC2G11.03c"
                     /product="vacuolar sorting protein Vps45"
                     /transcript_id="NM_001018481.2"
                     /db_xref="GeneID:2541485"
     CDS             complement(join(812107..812139,812192..813472,
                     813559..813766,813816..813970))
                     /gene="vps45"
                     /locus_tag="SPAC2G11.03c"
                     /codon_start=1
                     /product="vacuolar sorting protein Vps45"
                     /protein_id="NP_593083.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2G11.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2G11.03c.1"
                     /db_xref="GeneID:2541485"
                     /db_xref="GOA:Q09805"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="PomBase:SPAC2G11.03c"
                     /db_xref="PomBase:SPAC2G11.03c.1"
                     /translation="MDLVSASQSYFKRIFQEVSDLKILLLEEDTTKIVSSCITQSNLL
                     EQQIYLTVLLGNKREKLRHLKCVAFLRPTPTTLRLLCEELRDPKYAEYHLYFTNVIPK
                     SFLERLAESDDFEAVKSIQEFFLDYLVVNNDLASFNIPHIIEDSPDNWQDGAFHRTHQ
                     GIISLLLSLKKKPVIRYDNNSLLCLKLAEEVSYTIQHESQLFNFRKPDTAPILLLLDR
                     KNDPITPLLTQWTYQAMVHELFGIDNGRVSFSNSTSDNEKSTEIVLNPTLDPFYKETR
                     FDNFGDLGVKIKDYVSHLQTKSTKKASEIESIADMKQFLEAYPEYRRLSGNVSKHVSL
                     VSEISQVVQRENLLEVGEVEQSLVCNEPQSTDFNDIQRLLFSNISENTKLRLAALYSL
                     RFERIDPAKVSALQQMLIAGGVNPLKVSVIPTLLHVAGYSFRQGDVFPPSNLFSRARS
                     GLKGLRGVENVYIQHNPFLKSILLDLIQGRLKETTHPFLNSETRAQTSNEKPQDIIVV
                     IVGGATYEEAHFVSEFNATQPGVRIILAGTTILNSTAYIDDIMYMSTRIK"
     gene            814218..815490
                     /locus_tag="SPAC2G11.04"
                     /db_xref="GeneID:2541946"
     mRNA            814218..815490
                     /locus_tag="SPAC2G11.04"
                     /product="putative G-patch type RNA-binding protein"
                     /transcript_id="NM_001018482.2"
                     /db_xref="GeneID:2541946"
     CDS             814451..815356
                     /locus_tag="SPAC2G11.04"
                     /codon_start=1
                     /product="putative G-patch type RNA-binding protein"
                     /protein_id="NP_593084.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2G11.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC2G11.04.1"
                     /db_xref="GeneID:2541946"
                     /db_xref="GOA:Q09806"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="PomBase:SPAC2G11.04"
                     /db_xref="PomBase:SPAC2G11.04.1"
                     /translation="MGFMLYEGIDSKSIEEITEESEKTKTDLQKANTPNKTEAVHSLN
                     NTCSEQNSGTKDYLNSLQFLPSNFRPKTHKKKKSVSSYLSSTIQKNANENIPHVQCRN
                     DSQSTVTTRNPTPFKIEVGIYPSKPNNLNKEPPASTVHSDNLGDAVEHEWVELYDPLF
                     PTSYSVFKESDYANLCETNWSHYVNQVPSLSIEAKLSNIVNASKSGIGPPPSLLSHAT
                     LARPSESMVLSNNIAAEDLDFFKKSPPVPAISKKENVALKMLQRCGWKEGQGLGQHNQ
                     GIINPLHVEISGFVTETKHSKINDK"
     gene            complement(815388..817984)
                     /locus_tag="SPAC2G11.05c"
                     /db_xref="GeneID:2541947"
     mRNA            complement(815388..817984)
                     /locus_tag="SPAC2G11.05c"
                     /product="putative BRO1 domain-containing protein"
                     /transcript_id="NM_001018483.2"
                     /db_xref="GeneID:2541947"
     CDS             complement(815515..817620)
                     /locus_tag="SPAC2G11.05c"
                     /codon_start=1
                     /product="putative BRO1 domain-containing protein"
                     /protein_id="NP_593085.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2G11.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2G11.05c.1"
                     /db_xref="GeneID:2541947"
                     /db_xref="GOA:Q09807"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="InterPro:IPR025304"
                     /db_xref="PomBase:SPAC2G11.05c"
                     /db_xref="PomBase:SPAC2G11.05c.1"
                     /translation="MEFLNIPTKNTFHWSCDPLFNELKRLSCFKSFTYENDLKTFKAL
                     RSQLCLSHPSINSLSSFQTYHQLLCVLEQKHLSECVAPFVWTLSSSSNERESFENLIF
                     EHACLIYRLACTYHTTAISLCNEKPPNLVQACQYFQLSAGCFRYINDFYIYTKSLDFN
                     ENLLKAWEIYCLAEAQTCIFSKANSNDTTSESIIVKILAKVFLLYEDAYKLFKNATGA
                     PSIFVHWTYIQKLFYQTITYQIISRTSYSLNKYGENISYLRLSLLHCKEALKTRFDFG
                     FNVKVYEKLEKLESSLQFELKRNERDNDFIHLQPEIPVGSFPLLDTVTMVQSITPDVL
                     TDKTAAYPYFSTCLDKEFMDLIEEHEKNILDAAVKSIDCLTKEGTEKLFALMEEIKSV
                     NDNRYITETSNKVMENFTEIKNLGGLEFLRSEASSLDCLIDKVNGTYRHCCQALDEII
                     NSVKSSQNMKEKGFYSDVIKLHEEVSLLKVNVENSQNAKDTIQKDISAFGKDIFELSA
                     QSERILSNLAEKKNPNTDQLLLQANSYLAQWDLLKDERNMLKKLGSNDYFNISMYSNH
                     TDIHSLLKCFREAVDAKWNFRRQRERQEIIIQNVEKLKSYLNSFKVQAECSEISKILS
                     FSQETEKKYKFLLQTVRNETEIARELYNIICRAEERYSQYENRYENENRLNKIKLQHS
                     SSNAFNPEIHKIKFKSSKK"
     gene            817996..819739
                     /gene="vps4"
                     /locus_tag="SPAC2G11.06"
                     /db_xref="GeneID:2542054"
     mRNA            join(817996..818140,818207..818318,818429..818915,
                     818975..819739)
                     /gene="vps4"
                     /locus_tag="SPAC2G11.06"
                     /product="putative AAA family ATPase Vps4"
                     /transcript_id="NM_001018484.2"
                     /db_xref="GeneID:2542054"
     CDS             join(818117..818140,818207..818318,818429..818915,
                     818975..819650)
                     /gene="vps4"
                     /locus_tag="SPAC2G11.06"
                     /codon_start=1
                     /product="putative AAA family ATPase Vps4"
                     /protein_id="NP_593086.1"
                     /db_xref="GeneID:2542054"
                     /db_xref="GOA:Q09803"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSNPDCLSKAISLVKTAIDNDNAEQYPDAYKYYQSALDYFMMAL
                     KYEKNEKSKEIIRSKVIEYLDRAEKLKVYLQEKNNQISSKSRVSNGNVEGSNSPTANE
                     ALDSDAKKLRSALTSAILVEKPNVRWDDIAGLENAKEALKETVLLPIKLPQLFSHGRK
                     PWSGILLYGPPGTGKSYLAKAVATEAGSTFFSISSSDLVSKWMGESERLVRQLFEMAR
                     EQKPSIIFIDEIDSLCGSRSEGESESSRRIKTEFLVQMNGVGKDESGVLVLGATNIPW
                     TLDSAIRRRFEKRIYIPLPNAHARARMFELNVGKIPSELTSQDFKELAKMTDGYSGSD
                     ISIVVRDAIMEPVRRIHTATHFKEVYDNKSNRTLVTPCSPGDPDAFESSWLEVNPEDI
                     MEPKLTVRDFYSAVRKVKPTLNAGDIEKHTQFTKDFGAEG"
     gene            complement(818362..819834)
                     /locus_tag="SPNCRNA.688"
                     /db_xref="GeneID:14218384"
     misc_RNA        complement(818362..819834)
                     /locus_tag="SPNCRNA.688"
                     /product="antisense RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_151055.1"
                     /db_xref="GeneID:14218384"
     gene            complement(819768..821920)
                     /gene="ptc3"
                     /locus_tag="SPAC2G11.07c"
                     /db_xref="GeneID:2542008"
     mRNA            complement(join(819768..821005,821045..821118,
                     821377..821920))
                     /gene="ptc3"
                     /locus_tag="SPAC2G11.07c"
                     /product="protein phosphatase 2C"
                     /transcript_id="NM_001018485.2"
                     /db_xref="GeneID:2542008"
     CDS             complement(join(820163..821005,821045..821118,
                     821377..821704))
                     /gene="ptc3"
                     /locus_tag="SPAC2G11.07c"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="protein phosphatase 2C"
                     /protein_id="NP_593087.1"
                     /db_xref="GeneID:2542008"
                     /db_xref="GOA:Q09173"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /translation="MGQTLSEPVTEKHSVNGSNEFVLYGLSSMQGWRISMEDAHSAIL
                     SMECSAVKDPVDFFAVYDGHGGDKVAKWCGSNLPQILEKNPDFQKGDFVNALKSSFLN
                     ADKAILDDDQFHTDPSGCTATVVLRVGNKLYCANAGDSRTVLGSKGIAKPLSADHKPS
                     NEAEKARICAAGGFVDFGRVNGNLALSRAIGDFEFKNSNLEPEKQIVTALPDVVVHEI
                     TDDDEFVVLACDGIWDCKTSQQVIEFVRRGIVAGTSLEKIAENLMDNCIASDTETTGL
                     GCDNMTVCIVALLQENDKSAWYKKIADRVAANDGPCAPPEYAENHGPGWRSGDNNKKV
                     IVPPNFHQVKLNGSDGYDKDANENSKEDDSTNGSLAAGFRWKEHFFPHKAEEENSSSE
                     TDIVNSNKDVADDHKEAVSAAD"
     gene            complement(822092..823278)
                     /gene="smn1"
                     /locus_tag="SPAC2G11.08c"
                     /gene_synonym="yab8"
                     /db_xref="GeneID:2542002"
     mRNA            complement(join(822092..822429,822489..823278))
                     /gene="smn1"
                     /locus_tag="SPAC2G11.08c"
                     /gene_synonym="yab8"
                     /product="SMN family protein Smn1"
                     /transcript_id="NM_001018486.2"
                     /db_xref="GeneID:2542002"
     CDS             complement(join(822332..822429,822489..822849))
                     /gene="smn1"
                     /locus_tag="SPAC2G11.08c"
                     /gene_synonym="yab8"
                     /codon_start=1
                     /product="SMN family protein Smn1"
                     /protein_id="NP_593088.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2G11.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2G11.08c.1"
                     /db_xref="GeneID:2542002"
                     /db_xref="GOA:Q09808"
                     /db_xref="PomBase:SPAC2G11.08c"
                     /db_xref="PomBase:SPAC2G11.08c.1"
                     /translation="MDQSQKEVWDDSELRNAFETALHEFKKYHSIEAKGGVSDPDSRL
                     DGEKLISAARTEESISKLEEGEQMINQQTETTLEGDTHIQQFADNKGLSDEKPETRAA
                     ETHQEFMEVPPPIRGLTYDETYKKLIMSWYYAGYYTGLAEGLAKSEQRKD"
     gene            823493..826399
                     /locus_tag="SPAC2G11.09"
                     /db_xref="GeneID:2541980"
     mRNA            join(823493..823784,823894..826399)
                     /locus_tag="SPAC2G11.09"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018487.2"
                     /db_xref="GeneID:2541980"
     CDS             join(823739..823784,823894..826229)
                     /locus_tag="SPAC2G11.09"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_593089.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC2G11.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC2G11.09.1"
                     /db_xref="GeneID:2541980"
                     /db_xref="GOA:Q09809"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="PomBase:SPAC2G11.09"
                     /db_xref="PomBase:SPAC2G11.09.1"
                     /translation="MAFNGYGIFDSDPRKNPSSDLRTQFWLAFLLGASACVFFCFFRK
                     RWKVLYAPRTTIEGLNLPTLSSSYYKWLMDLVNIPDDVVQNCAGLDGYVFLLFFKMGI
                     KFLSFASLLGVLIIMPVNKHFRGDAFGNITLSMPAKSEYFFSSPLVKKSIVQSPIIAN
                     GSELNVGVLGPSLFNPIGNLSDIPGLPQPGDGFLYLYVLFTYFISIFLLYVLFSSTKS
                     IADIRQSYLARQNRLTDRTVFISGLPNELCSTENLKAYFDKLDVGSIDSLSICRNYSY
                     MDILLSKKSKYVKKLEKYWSIYLSNCKKLGISTLPPSNYLSPNRAELESTPEQLLEVP
                     WQHHQCHPLIKTHFFGIFGQKIDAIDFYSAKLYKISQQIENARSFDYPTTGQAFITFE
                     SMATAQIVAQTHIDSKSLMGLHIELAPAANDIQWHNTYIGRWHKFFQGWFITLVTFMI
                     ILLWTVPVGAIAVFINLDTIRRLWPELGRMIEDLPFLNSLLRTFLPTLVYSLFISISP
                     FLFRWLSSMQGLSSRAEEEIYAVGKNYAYLFVNFFLVYVIAGSTSIWELAKDTTSFAH
                     FLANRLPHQAQFFIDLIVLQGIGMFPLKLIQLGKLSSYFVRRSFVPYSIASKKFETPD
                     SFSVGIFLPQPMFIMLICLCYSIISPLILVFGLIYFIIGFLVYKYELIYQMEHPQHST
                     GELWSTIFLRMIFGCVIMQLTMMGLMSLRKAYWLSTVIFPLLCFTVISAYNFSTMIRS
                     SMQFVSLYYIRTHQSNTLSSESESRNSESSGSYVHPGFDLSNEELPLIDLNTA"
     gene            complement(826313..828123)
                     /locus_tag="SPAC2G11.10c"
                     /db_xref="GeneID:2541739"
     mRNA            complement(join(826313..827420,827465..827678,
                     827903..828123))
                     /locus_tag="SPAC2G11.10c"
                     /product="putative thiosulfate sulfurtransferase"
                     /transcript_id="NM_001018488.2"
                     /db_xref="GeneID:2541739"
     CDS             complement(join(826538..827420,827465..827678,
                     827903..828011))
                     /locus_tag="SPAC2G11.10c"
                     /codon_start=1
                     /product="putative thiosulfate sulfurtransferase"
                     /protein_id="NP_593090.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2G11.10c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2G11.10c.1"
                     /db_xref="GeneID:2541739"
                     /db_xref="GOA:Q09810"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR007901"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028885"
                     /db_xref="PomBase:SPAC2G11.10c"
                     /db_xref="PomBase:SPAC2G11.10c.1"
                     /translation="MNPQEKIICSSNGLELSLDEYSRYGRQMLLSEIGLPGQLSLKRS
                     SVLVIGAGGLGCPAMQYLVAAGIGTLGIMDGDVVDKSNLHRQIIHSTSKQGMHKAISA
                     KQFLEDLNPNVIINTYLEFASASNLFSIIEQYDVVLDCTDNQYTRYLISDTCVLLGRP
                     LVSASALKLEGQLCIYNYCNGPCYRCMFPNPTPVVASCAKSGILGPVVGTMGTMQALE
                     TVKLILHINGIKKDQFDPYMLLFHAFKVPQWKHIRIRPRQQSCKACGPNKMLSREFME
                     SSPKEYTTICDYVPTLSKQLAPIRRISALDLKNLIETSPHITFLDVREPVQFGICRLP
                     LFKNIPLSEVDSLQNLSGKVCVICRSGNTSQTAVRKLQELNPQADIFDVVAGLKGWST
                     EVDPNFPLY"
     gene            826579..828205
                     /locus_tag="SPNCRNA.689"
                     /db_xref="GeneID:14217950"
     misc_RNA        826579..828205
                     /locus_tag="SPNCRNA.689"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151056.1"
                     /db_xref="GeneID:14217950"
     gene            complement(828321..831629)
                     /gene="prh1"
                     /locus_tag="SPAC2G11.11c"
                     /db_xref="GeneID:2541750"
     mRNA            complement(join(828321..829312,829356..829424,
                     829508..831629))
                     /gene="prh1"
                     /locus_tag="SPAC2G11.11c"
                     /product="putative ATP-dependent RNA helicase Prh1"
                     /transcript_id="NM_001018489.2"
                     /db_xref="GeneID:2541750"
     CDS             complement(join(829214..829312,829356..829424,
                     829508..831499))
                     /gene="prh1"
                     /locus_tag="SPAC2G11.11c"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase Prh1"
                     /protein_id="NP_593091.1"
                     /db_xref="GeneID:2541750"
                     /db_xref="GOA:Q03319"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVKVSGKLRNGGSITKQNLTDGLVGGQRIKAPNKKKNRKASKNT
                     TKKSTVSVVNFLEQDTDFGANEVVGSDNSSPEKRSENSPSKRKDILEQRKNLPIWEAH
                     DTLCQQIQDNRVIVVVGETGSGKSTQIPQFLNECPYAQEGCVAITQPRRVAAVNLAKR
                     VAAEQGCRLGEQVGYSIRFDDTTSKKTRIKYLTDGMLLRELINDPILSQYHTLILDEA
                     HERTLMTDMLLGFVKKIIKKRPALRVIIMSATLNAERFSEFFDGAEICYISGRQYPVQ
                     IHYTYTPEPDYLDACLRTIFQLHTKLPPGDILVFLTGQDEIEALEALIKSYSKQLPSN
                     LPQIQACPLFASLPQEQQLQVFLPALANHRKVVLSTNIAETSVTISGIRYVIDTGLAK
                     IKQFNSKLGLESLTVQPISQSAAMQRSGRAGREAAGQCYRIYTEADFDKLPKETIPEI
                     KRIDLSQAVLTLKARGQNDVINFHYMDPPSKEGLLRALEHLYSIGALDDNGHINDLGY
                     QMSLIPLLPSLARAVLAAREHNCLSEVIDVVSCLSTDSMFLFPQEKRDEAIEARLKFL
                     HSEGDLLTCLNALRQYLESSHDSRKQWCSQNFINRRALKTILDIRKQLREHCLKDGWE
                     LNSSPEVNSENLLLSFLSGYITNTALLHPDGSYRTIIGNQTISIHPSSSLFGKKVEAI
                     MYHELVFTTKSYVRGVSSIRSNWLNAVAPHYLARRST"
     gene            829234..831663
                     /locus_tag="SPNCRNA.690"
                     /db_xref="GeneID:14218289"
     misc_RNA        829234..831663
                     /locus_tag="SPNCRNA.690"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151058.1"
                     /db_xref="GeneID:14218289"
     gene            831918..836094
                     /gene="rqh1"
                     /locus_tag="SPAC2G11.12"
                     /gene_synonym="hus2; rad12; rec9"
                     /db_xref="GeneID:2541620"
     mRNA            831918..836094
                     /gene="rqh1"
                     /locus_tag="SPAC2G11.12"
                     /gene_synonym="hus2; rad12; rec9"
                     /product="RecQ type DNA helicase Rqh1"
                     /transcript_id="NM_001018490.2"
                     /db_xref="GeneID:2541620"
     CDS             832027..836013
                     /gene="rqh1"
                     /locus_tag="SPAC2G11.12"
                     /gene_synonym="hus2; rad12; rec9"
                     /codon_start=1
                     /product="RecQ type DNA helicase Rqh1"
                     /protein_id="NP_593092.1"
                     /db_xref="GeneID:2541620"
                     /db_xref="GOA:Q09811"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR004589"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018982"
                     /db_xref="InterPro:IPR027417"
                     /translation="MTVTKTNLNRHLDWFFRESPQKIENVTSPIKTLDFVKVKVSSSD
                     IVVKDSIPHKSKNVFDDFDDGYAIDLTEEHQSSSLNNLKWKDVEGPNILKPIKKIAVP
                     ASESEEDFDDVDEEMLRAAEMEVFQSCQPLAVNTADTTVSHSTSSSNVPRSLNKIHDP
                     SRFIKDNDVENRIHVSSASKVASISNTSKPNPIVSENPISATSVSIEIPIKPKELSNN
                     LPFPRLNNNNTNNNNDNNAIEKRDSASPTPSSVSSQISIDFSTWPHQNLLQYLDILRD
                     EKSEISDRIIEVMERYPFSSRFKEWIPKRDILSQKISSVLEVLSNNNNSNNNNGNNGT
                     VPNAKTFFTPPSSITQQVPFPSTIIPESTVKENSTRPYVNSHLVANDKITATPFHSEA
                     VVSPLQSNIRNSDIAEFDEFDIDDADFTFNTTDPINDESGASSDVVVIDDEEDDIENR
                     PLNQALKASKAAVSNASLLQSSSLDRPLLGEMKDKNHKVLMPSLDDPMLSYPWSKEVL
                     GCLKHKFHLKGFRKNQLEAINGTLSGKDVFILMPTGGGKSLCYQLPAVIEGGASRGVT
                     LVISPLLSLMQDQLDHLRKLNIPSLPLSGEQPADERRQVISFLMAKNVLVKLLYVTPE
                     GLASNGAITRVLKSLYERKLLARIVIDEAHCVSHWGHDFRPDYKQLGLLRDRYQGIPF
                     MALTATANEIVKKDIINTLRMENCLELKSSFNRPNLFYEIKPKKDLYTELYRFISNGH
                     LHESGIIYCLSRTSCEQVAAKLRNDYGLKAWHYHAGLEKVERQRIQNEWQSGSYKIIV
                     ATIAFGMGVDKGDVRFVIHHSFPKSLEGYYQETGRAGRDGKPAHCIMFYSYKDHVTFQ
                     KLIMSGDGDAETKERQRQMLRQVIQFCENKTDCRRKQVLAYFGENFDKVHCRKGCDIC
                     CEEATYIKQDMTEFSLQAIKLLKSISGKATLLQLMDIFRGSKSAKIVENGWDRLEGAG
                     VGKLLNRGDSERLFHHLVSEGVFVEKVEANRRGFVSAYVVPGRQTIINSVLAGKRRII
                     LDVKESSSKPDTSSRSLSRSKTLPALREYQLKSTTASVDCSIGTREVDEIYDSQMPPV
                     KPSLIHSRNKIDLEELSGQKFMSEYEIDVMTRCLKDLKLLRSNLMAIDDSRVSSYFTD
                     SVLLSMAKKLPRNVKELKEIHGVSNEKAVNLGPKFLQVIQKFIDEKEQNLEGTELDPS
                     LQSLDTDYPIDTNALSLDHEQGFSDDSDSVYEPSSPIEEGDEEVDGQRKDILNFMNSQ
                     SLTQTGSVPKRKSTSYTRPSKSYRHKRGSTSYSRKRKYSTSQKDSRKTSKSANTSFIH
                     PMVKQNYR"
     gene            836206..838256
                     /gene="atg22"
                     /locus_tag="SPAC2G11.13"
                     /db_xref="GeneID:2541826"
     mRNA            836206..838256
                     /gene="atg22"
                     /locus_tag="SPAC2G11.13"
                     /product="vacuolar amino acid efflux transporter Atg22"
                     /transcript_id="NM_001018491.2"
                     /db_xref="GeneID:2541826"
     gene            complement(836307..837262)
                     /locus_tag="SPNCRNA.691"
                     /db_xref="GeneID:14218153"
     misc_RNA        complement(836307..837262)
                     /locus_tag="SPNCRNA.691"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151059.1"
                     /db_xref="GeneID:14218153"
     CDS             836383..837972
                     /gene="atg22"
                     /locus_tag="SPAC2G11.13"
                     /codon_start=1
                     /product="vacuolar amino acid efflux transporter Atg22"
                     /protein_id="NP_593093.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2G11.13"
                     /db_xref="EnsemblGenomes-Tr:SPAC2G11.13.1"
                     /db_xref="GeneID:2541826"
                     /db_xref="GOA:Q09812"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR024671"
                     /db_xref="PomBase:SPAC2G11.13"
                     /db_xref="PomBase:SPAC2G11.13.1"
                     /translation="MNSPIQLHKKFSTTVWHVLSWILYAVGAGPTAIISMGVYVPLIV
                     MKNAHDHGFLRTDHTIPCSLYPEEPCSLNIVGPLWIDVSSIVFAASAISTFLQMAMMV
                     SLGVICDYGNNRRYILFSCVIIGSISGIILSWSPSSFLLGKIVFLILVDLNFIISQSC
                     YDSFLPIFLRFYPITRGPITLESALQDETDDLDSYITNTTIDSSEEEPYLLEHSLILN
                     ESAPPADVEDEHKAKIAARLSSVGFGSFFGAAILFQIIFTPILYKTNNNPIILPITVT
                     VCSCWWLILSTPLCTIVTLPVENHSSDAILTLLYNSVKESYHSFKHAMSISSIRLFLF
                     SRLFINCGIQTSLSSAVIFGKARLNLSNFQLTLLGMGISSFALLGTVIIPYLTEYFQL
                     NSLQVVMIISILLPMAPLYGLLGYIPGFENAGIRTSADVFRATLFFGFFLGGAHSYCR
                     SVYAQLVPSGKETRFFALYALISQTGVLFSHISLTLISNYTSDLRAVYIFVIVVMTLP
                     LSSLWIMYQHSKTPNLHRSSS"
     gene            838228..841562
                     /gene="taf111"
                     /locus_tag="SPAC2G11.14"
                     /gene_synonym="kat4; taf1; taf130"
                     /db_xref="GeneID:2541848"
     mRNA            join(838228..838382,838425..838995,839044..839192,
                     839231..841562)
                     /gene="taf111"
                     /locus_tag="SPAC2G11.14"
                     /gene_synonym="kat4; taf1; taf130"
                     /product="transcription factor TFIID complex subunit
                     Taf111"
                     /transcript_id="NM_001018492.2"
                     /db_xref="GeneID:2541848"
     CDS             join(838320..838382,838425..838995,839044..839192,
                     839231..841387)
                     /gene="taf111"
                     /locus_tag="SPAC2G11.14"
                     /gene_synonym="kat4; taf1; taf130"
                     /codon_start=1
                     /product="transcription factor TFIID complex subunit
                     Taf111"
                     /protein_id="NP_593094.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC2G11.14"
                     /db_xref="EnsemblGenomes-Tr:SPAC2G11.14.1"
                     /db_xref="GeneID:2541848"
                     /db_xref="GOA:Q09813"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR022591"
                     /db_xref="PomBase:SPAC2G11.14"
                     /db_xref="PomBase:SPAC2G11.14.1"
                     /translation="MSFDGLIVENENTKSGYNDGNDLTDLFKQNGTDMSVINSLLGDT
                     NNPGMNESPKILDSSFENSNPQDGPNYEDFDFMGSIHKEFGNNINEMDDMEDVSDDNL
                     PEEEQAVNYTGDKDDEDFGKLLAKEMGEEAAGQVLSGVGFSIPSGLVPPSEPSKTVSS
                     TTEELQNEAQIRESIVKTFFPTFERGVLLNFSELFKPKPVKLAPPKKKTPKVCVPGRL
                     TLEVDTDYAIIFNSKKSLPLKRNVVSPISTHTKKRRRTANTSQRNDGLDLNTVFTTND
                     WEKNIIYDESDVNKTNQSSFFIDKSLVDIDFAFDENIFDGDTGTSKVVLNLNDPKLLL
                     QPQLPKKEDSQRSFADTHQRNSLAWKFNISNDPAYEMLKQNHQSKVRNTLSQLAIEHA
                     AFAEKLTFPYYKTRLSKRAVRSYHRPTMSFKPNAAIVFSPLIVRKRSKDKHKSERELI
                     PTTKEITMGDTTHAILVEFSEEHPAVLSNAGMASRIVNYYRKKNEQDESRPKLEVGES
                     HVLDVQDRSPFWNFGSVEPGEITPTLYNKMIRAPLFKHEVPPTDFILIRNSSSYGSKY
                     YLKNINHMFVSGQTFPVTDVPGPHSRKVTTASKNRLKMLVFRLIRRSPNGGLFIRQLS
                     KHFSDQNEMQIRQRLKEFMEYKKKGDGPGYWKLKSNEVVPDEAGTRSMVSPETVCLLE
                     SMQVGVRQLEDAGYGKTMDEINDDEDEEQPAEQLLAPWITTRNFINATQGKAMLTLFG
                     EGDPTGIGEGYSFIRTSMKGGFKPAGETADDKPEPQTKNAHAYNVAKQQRAYEEEINR
                     IWNAQKRGLSINNLEELAKKYGINSIHDDYVESNEETTREETPSSDKVLRIVRLYRDK
                     NGNLERKQETIHDPIVIHAYLKKRREIDEQSTALDAVVPTGDEAIDRRNRRRLEQELA
                     KSQKNWERRRARHAAKEGINLNGEGRKPTTRKCSNCGQVGHMKTNKICPLFGRPEGGL
                     ATMLDKN"
     gene            complement(841471..842624)
                     /gene="tgs1"
                     /locus_tag="SPAC2G11.15c"
                     /gene_synonym="SPAC521.01c"
                     /db_xref="GeneID:2542015"
     mRNA            complement(join(841471..841859,841908..842053,
                     842126..842241,842321..842624))
                     /gene="tgs1"
                     /locus_tag="SPAC2G11.15c"
                     /gene_synonym="SPAC521.01c"
                     /product="putative RNA methyltransferase Tgs1"
                     /transcript_id="NM_001018493.3"
                     /db_xref="GeneID:2542015"
     CDS             complement(join(841572..841859,841908..842053,
                     842126..842241,842321..842490))
                     /gene="tgs1"
                     /locus_tag="SPAC2G11.15c"
                     /gene_synonym="SPAC521.01c"
                     /codon_start=1
                     /product="putative RNA methyltransferase Tgs1"
                     /protein_id="NP_593095.3"
                     /db_xref="EnsemblGenomes-Gn:SPAC2G11.15c"
                     /db_xref="EnsemblGenomes-Tr:SPAC2G11.15c.1"
                     /db_xref="GeneID:2542015"
                     /db_xref="GOA:Q09814"
                     /db_xref="InterPro:IPR019012"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PomBase:SPAC2G11.15c"
                     /db_xref="PomBase:SPAC2G11.15c.1"
                     /translation="MNKNEELDEDELLKKCIICPPVPKALKKYWNNRYNLFSRFDEGI
                     WLDYQSWYSVTPEKVAVAIAKSVVDFIQPELIIDAFSGCGGNTIQFAKYCPVISIEID
                     PIKIAMAKHNLEIYGIPSSRVTFIQGDVLDTFKSLQFAKDYRSLVFMSPPWGGPSYSG
                     KTVYSLNDLNPYAFDVLFKEATRISPYVAAFLPRNTDVKELAAYGSIHNKPYITNFLF
                     EGYAKAICCYFNMKGAIARKI"
     gene            complement(843102..844243)
                     /locus_tag="SPNCRNA.692"
                     /db_xref="GeneID:14218359"
     misc_RNA        complement(843102..844243)
                     /locus_tag="SPNCRNA.692"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151060.1"
                     /db_xref="GeneID:14218359"
     gene            843197..844165
                     /locus_tag="SPAC521.02"
                     /db_xref="GeneID:2543468"
     mRNA            843197..844165
                     /locus_tag="SPAC521.02"
                     /product="WLM domain protein"
                     /transcript_id="NM_001018494.2"
                     /db_xref="GeneID:2543468"
     CDS             843233..844084
                     /locus_tag="SPAC521.02"
                     /codon_start=1
                     /product="WLM domain protein"
                     /protein_id="NP_593097.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC521.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC521.02.1"
                     /db_xref="GeneID:2543468"
                     /db_xref="GOA:Q9P7B5"
                     /db_xref="InterPro:IPR013536"
                     /db_xref="PomBase:SPAC521.02"
                     /db_xref="PomBase:SPAC521.02.1"
                     /translation="MIAILYLYYILTTSILLSVSFMLRINDDDHPNEKIGFISAIKGD
                     FHDLSSDYLKRIAAMAFPIMKEHGFGVTSLDEVAYNAKFWGRNWNKGECIELVLRDAS
                     NRWLPFEFVMDVFLHELCHIWQGPHDRRFFSHLSTLRAALIALYAKGYKGPGKYMTWD
                     SFVLANVVGNYNTVVFNGITLERSTMHGVETCGGSLQRKKKIRRKPTPSSTKKRKLTR
                     TGQKLGTDMNIRLELLKSPAKPQAQSMRGREARIAAALLRVDNSNEYKPKDHNSSTTL
                     ENYFVVE"
     gene            844948..846142
                     /locus_tag="SPAC521.03"
                     /db_xref="GeneID:2543461"
     mRNA            844948..846142
                     /locus_tag="SPAC521.03"
                     /product="putative dehydrogenase"
                     /transcript_id="NM_001018495.2"
                     /db_xref="GeneID:2543461"
     CDS             845145..845924
                     /locus_tag="SPAC521.03"
                     /codon_start=1
                     /product="putative dehydrogenase"
                     /protein_id="NP_593098.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC521.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC521.03.1"
                     /db_xref="GeneID:2543461"
                     /db_xref="GOA:Q9P7B4"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="PomBase:SPAC521.03"
                     /db_xref="PomBase:SPAC521.03.1"
                     /translation="MSRLDGKTILITGASSGIGKSTAFEIAKVAKVKLILAARRFSTV
                     EEIAKELESKYEVSVLPLKLDVSDLKSIPGVIESLPKEFADIDVLINNAGLALGTDKV
                     IDLNIDDAVTMITTNVLGMMAMTRAVLPIFYSKNKGDILNVGSIAGRESYVGGSVYCS
                     TKSALAQFTSALRKETIDTRIRIMEVDPGLVETEFSVVRFHGDKQKADNVYKNSEPLT
                     PEDIAEVILFALTRRENVVIADTLVFPSHQGGANHVYRKQA"
     gene            complement(846022..849480)
                     /locus_tag="SPAC521.04c"
                     /db_xref="GeneID:2543342"
     mRNA            complement(846022..849480)
                     /locus_tag="SPAC521.04c"
                     /product="putative calcium permease"
                     /transcript_id="NM_001018496.2"
                     /db_xref="GeneID:2543342"
     CDS             complement(846331..848976)
                     /locus_tag="SPAC521.04c"
                     /codon_start=1
                     /product="putative calcium permease"
                     /protein_id="NP_593099.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC521.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC521.04c.1"
                     /db_xref="GeneID:2543342"
                     /db_xref="GOA:Q9P7B3"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="InterPro:IPR005185"
                     /db_xref="PomBase:SPAC521.04c"
                     /db_xref="PomBase:SPAC521.04c.1"
                     /translation="MSQPADINQSESSAETITQGRRADRPEETPSSSVYEQNLRFGDF
                     LMPTVGDADATDSLSQSTNDRDIYSPREIDQYTRKVSSRTDPSTSTISNARQHPRNSV
                     SRLSRSSSNVRQQRDIPKQNFKVRPLSPLRGQSPASLRSEESFTLKERQNAINKTRAF
                     GMRLWKPALYKKFRSINRDADIDIHDEPLKRPNTSISNVIWLICFGAPLFLVIFICYI
                     FFTVLSFFNVPDAIVYSKLCRGLMFYLLYPFGQHVRHKVKRLSVRSPAHPIYQTQHSH
                     YDETPTSHHPDPARLNFLSFSFCVNPMNQSLDCNTTPHRRNASSIIYTLMYYLIIAPT
                     LLITSAICMFTIFFVPCARTLWAICRHLRTCPLSLSFRPNLALPLSMDSSDVVLLCVK
                     KAASWKYYKYTIDGIYIIYFDMLALIIPTIFFGFFGSQGHWFTSSVFLFTASLVSIIP
                     LAYFIGMAVASISAQSSMGMGAFINAFFGSVIEVFLYSVALRKGNAGLVEGSVIGSIL
                     AGLLLMPGLSMCAGAIRKKFQFFNIKSAGATSTMLLFAVLGAFAPTMLFRIYGPFRLD
                     CEPCGANCQKCTKHYVLENDSLYKNRVLPFTYCCSIMLVLAYAIGLWFTLRTHASHIW
                     QNFTADDISFLKAEEEVGEPVNQDTAGNMSDSSEGGEAVVNGNSQHHHNRDDASSGLS
                     SNGSENESLEHEPTNELPQRPLVNQSQNSHGDDAPNWSRSKSAIILLSATFLYSLIAE
                     ILVEHVDTVLDKFAISEKFLGLTLFALVPNTTEFMNAISFALNENIALSMEIGSAYAL
                     QVCLLQIPCLMGYSLFQYYRSGDSISFKHLFTMVFPTWDMICVMICVFLLTYVHSEGK
                     SNYFKGSILVLAYLVSMLGFTFFNY"
     gene            848371..849443
                     /locus_tag="SPNCRNA.693"
                     /db_xref="GeneID:14217984"
     misc_RNA        848371..849443
                     /locus_tag="SPNCRNA.693"
                     /product="antisense RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_151061.1"
                     /db_xref="GeneID:14217984"
     gene            849421..850259
                     /gene="rps802"
                     /locus_tag="SPAC521.05"
                     /gene_synonym="rps8-2"
                     /db_xref="GeneID:2543354"
     mRNA            849421..850259
                     /gene="rps802"
                     /locus_tag="SPAC521.05"
                     /gene_synonym="rps8-2"
                     /product="40S ribosomal protein S8"
                     /transcript_id="NM_001018497.2"
                     /db_xref="GeneID:2543354"
     CDS             849520..850122
                     /gene="rps802"
                     /locus_tag="SPAC521.05"
                     /gene_synonym="rps8-2"
                     /codon_start=1
                     /product="40S ribosomal protein S8"
                     /protein_id="NP_593100.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC521.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC521.05.1"
                     /db_xref="GeneID:2543354"
                     /db_xref="GOA:Q9P7B2"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="InterPro:IPR018283"
                     /db_xref="InterPro:IPR022309"
                     /db_xref="PomBase:SPAC521.05"
                     /db_xref="PomBase:SPAC521.05.1"
                     /translation="MGITRDSRHKRSATGAKRAQYRKKRKFELGRQPSNTRIGPKRIH
                     EVRVRGGNKKFRALRLDSGNFSWGSEGVSKKTRIIQVAYHPSNNELVRTNTLTKSAIV
                     QIDAAPFRVWYETHYGILMGSKGKKATATPTPKSKHVQRKHSARLGDSKVDSALETQF
                     AAGRLYAVVSSRPGQSGRCDGYILEGEELHFYLRRMAPKK"
     gene            850591..854385
                     /gene="rpb2"
                     /locus_tag="SPAC23G3.01"
                     /gene_synonym="SPAC521.06"
                     /db_xref="GeneID:2541446"
     mRNA            join(850591..850691,850730..854385)
                     /gene="rpb2"
                     /locus_tag="SPAC23G3.01"
                     /gene_synonym="SPAC521.06"
                     /product="RNA polymerase II complex subunit Rpb2"
                     /transcript_id="NM_001018498.2"
                     /db_xref="GeneID:2541446"
     CDS             join(850676..850691,850730..854346)
                     /gene="rpb2"
                     /locus_tag="SPAC23G3.01"
                     /gene_synonym="SPAC521.06"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="RNA polymerase II complex subunit Rpb2"
                     /protein_id="NP_593101.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC23G3.01"
                     /db_xref="EnsemblGenomes-Tr:SPAC23G3.01.1"
                     /db_xref="GeneID:2541446"
                     /db_xref="GOA:Q02061"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="PDB:3H0G"
                     /db_xref="PomBase:SPAC23G3.01"
                     /db_xref="PomBase:SPAC23G3.01.1"
                     /translation="MSYEDYQYNETLTQEDCWTVISSFFEETSLARQQLFSFDEFVQN
                     TMQEIVDDDSTLTLDQYAQHTGAQGDVTRRYEINFGQIYLSRPTMTEADGSTTTMFPQ
                     EARLRNLTYSSPLYVDMRKKVMVAADSNVPIGEEEWLVEEEDEEPSKVFIGKIPIMLR
                     STFCILNGVSDSELYDLNECPYDQGGYFIINGSEKVIIAQERSAANIVQVFKKAAPSP
                     IAYVAEIRSALERGSRLISSMQIKLMARNTENSGQTIRATLPYIRSDIPIVIVFRALG
                     VVPDRDILEHICYDPNDFQMLEMMKPCIEEAFVIQDKDIALDYIGKRGSTTGVTREKR
                     LRYAHDILQKELLPHITTMEGFETRKAFFLGYMIHRMLLCALERREPDDRDHFGKKRL
                     DLAGPLLASLFRMLFRKMTRDVYKYMQKCVETNREFNLTLAVKSNIITNGLRYSLATG
                     NWGDQKRSMVNRVGVSQVLNRYTFASTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGMV
                     CPAETPEGQACGLVKNLSLMSYVSVGSPSAPIIEFLEEWGLETLEDYNPSASPNATKV
                     FVNGVWLGVHRDPAHLTETLRSLRRRLDISAEVSIVRDIREKELRLFTDAGRICRPLF
                     IVDNNPNSERRGELCIRKEHIQQLIEDKDRYDIDPEQRFGWTALVSSGLIEYLDAEEE
                     ETVMIAMSPEDLEASRQMQAGYEVKEELDPAQRVKPAPNPHVHAWTHCEIHPAMILGI
                     LASIIPFPDHNQSPRNTYQSAMGKQAMGVYLTNYQVRMDTMANILYYPQKPLATTRSM
                     EYLKFRELPAGQNAIVAILCYSGYNQEDSIIMNQASIDRGLFRSIFYRTYTDQEKKIG
                     MTVMEEFERPVRSTTLRMKHGTYDKLEDDGLIAPGTRVSGEDIIIGKTAPIPLDHEEL
                     GQRTQLHAKRDVSTPLRSTESGIVDQVMVTTNQEGLKFVKVRMRSTRIPQIGDKFASR
                     HGQKGTIGMTYRHEDMPFSAQGIVPDIIINPHAIPSRMTVAHLVECQLSKVSALSGFE
                     GDATPFTDVTVEAVSKLLRSHGFQSRGFEVMYHGHTGRKLVAQVFLGPTYYQRLKHLV
                     DDKIHARARGPVQILTRQPVEGRSRDGGLRFGEMERDCQISHGCSSVLRERLFDCSDA
                     YRVIVCDICGLIAIASYKKDSYECRSCQNRTRFSQVYLPYAAKLLFQELMSMNIAPRL
                     FTKNHK"
     gene            complement(854453..869704)
                     /gene="sib1"
                     /locus_tag="SPAC23G3.02c"
                     /db_xref="GeneID:2541451"
     mRNA            complement(join(854453..862924,863155..869704))
                     /gene="sib1"
                     /locus_tag="SPAC23G3.02c"
                     /product="ferrichrome synthetase Sib1"
                     /transcript_id="NM_001018499.2"
                     /db_xref="GeneID:2541451"
     CDS             complement(join(854523..862924,863155..869527))
                     /gene="sib1"
                     /locus_tag="SPAC23G3.02c"
                     /codon_start=1
                     /product="ferrichrome synthetase Sib1"
                     /protein_id="NP_593102.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23G3.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23G3.02c.1"
                     /db_xref="GeneID:2541451"
                     /db_xref="GOA:Q9P7T1"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="PomBase:SPAC23G3.02c"
                     /db_xref="PomBase:SPAC23G3.02c.1"
                     /translation="MKNSNEEDAFSTQISQLGPMRPSSDAPYHVLSLPFSHPYSAFLD
                     AWSWLFCGITGGEVSFFFFPVSDDVIPNTNPKNCQCYLYHSTNSQLEPLEVFHLHKLH
                     SAVFTSRRDPSFADDLFESSKPCLNQLLSYFSDITAFRSMDVVADIAFVCSPNFLTLK
                     WNSSLFDDDLARLLFFMINSKITNYDLPFSILNSPCSDLCLNSSSLANYLHGCFYHNT
                     LSHPYQDALKFIYEIGDDLEDTFRSFSFLELHSLAIKLSKLVTCKNEVVPIMVSHSPA
                     LFVGILAILYSGNAYCPIDVETRTERVHFISKDVDASFAIVSEEFVNRFPNNTIILKV
                     PEYNESMEIKVDDEIPPFPFPESLDSVAYVLYTSGSTGNPKGVAISHRAATNSIKSHG
                     YLYPMFGLERGDAWLQFANVTFDVSVFEIFGNWNNGLTLVTSKRQNLIGNLEYLIYDY
                     KIAALELTPTVANVISLDENKELFTSVRMLITIGELLTNRIIDFWGERLVNAYGPTEA
                     AIHVTLNPSKALTTVYLVGVPLQSATICVVSLPTEDSQPHVLHEGFLGEVCIAGPQLS
                     SGYINRPEINAKAFVEVQYNEQTLSIYRTGDLGRIINGKLYIFGRIAGDMQIKIRGRR
                     IEIGEIESKLAPSVDSLAIEKIGDNLVAFYVGDEMKLRKHAESHLASWMCPTKYVGLP
                     GFPRLASGKTDRKALKIQFSASDKHSTDFSSFNQSELLVANVLHEICEKRFNSVVSIS
                     RFSSIFDLGLDSLDIVYFVRKIRSLGFEANPSIVLTSKVVFKIAESLILLKPNEVQSK
                     NNFLNKCTPLQKGMLYESFSNNGNLYFNHTVFKIAASPEKVKLAWEKLLDTHTILSNG
                     FALDENEGFTRFILEKKPPLYSYSKNCLECIQKHFTTKEFDEQFLNSGPLDAAVIYDS
                     SNCYLSIVWHHALYDGWSIDIIMQQLFMLIHDRRLTIVPQFEDYVQELESLRRLNYKN
                     CISFWKKYLKDFKFKSLSYQREKMGVVELSSNISLLSVENICKQLQTTPLSFFLTAWS
                     TVLSSYLKTNDFLVGTVVSGRVNSLLPNVDYVIGPCMQTLPVRIKLDDELSYKNLCQN
                     LFKELSFVLKHSVMAISDFQEELLVSNLFESILIYQQSGIPSVDESFISLIHSTDHVE
                     QPLLIEIEKNKGYKFKLTGYLSSELLNNLLNDFDKILNFILYNIESKIQTHASFNVTI
                     TEHNHVESKARTGFSKREEKLVRSCLSKILGNTVLSADVFENLQNYGFDSLCAMRFFS
                     LLRKSSGIGNLKIPNMKSNPTIASLCELLVLPTETLSADNEITFYEVSDIQHEANLDI
                     ESFQYFPCTPMQQALLASSEKNGVEYYYNKYLFETGKSSQEEIYLLFKTLLNNLPILR
                     TCFFVTRSKKYPYCQVVLNEPNFYFQVLPYKGESLSKYNLAEIPLLDSKKVPIQIFFL
                     QGENKNYVLFCIHHVLYDAWAFQLIMDDINHLLRKENPKGSQSMLKFISYLHRYNKNV
                     DLEIWSKIFLGFKPSKFPELCKDINPEQRTYKCNLSISLSQIDDLCNGFSFTTSTFLQ
                     CCWAKTLSFLLNSRDICFGNIISGRDVPVDEVVSLVAPTFNSFPLRVLLDSKLSFAEV
                     CGQLQRLKETLQEHQMTSVQSICKSLTVKSLFDTVFIIQPQLLSDRTGPWKLLNESSS
                     MDMRFIIELLLGSDDSPLTLVGTGTGKSGKLVCNLYKTILKHYVHYGLSTSVPLYTSL
                     EKHNLISRSPSSPPPIHTNFDTNADIITLFEKEANEHPSSIALHFVYNVDKENIYSYK
                     FFSEYSIKASYWLHSIGIKKNDVVAVFIDKSLDYYSLMLGVLRIGAFFFPLEHCSSLN
                     FAKENLLRTNVKLLIVDKFLPFEDVNQVEIDKFRQVVDKLPTVEIPNESRSSAFIFPS
                     YELAEGLTMMESSSFMDSIISFIDSTCFPSSSRWFQYAPSSTACQMFDCFMCWFFGCT
                     LISGPQLFLKNNLKPLLLATHASHLITTSSIAASLKGEDIPSIQRLYCYEGPINNYMI
                     KSWGSRLSYIYAFKPLICSCVPATEYLESNIMMVGIPLKGLIFAVVNSDTNTLAPIGS
                     SGELCIASVKKSGNTMMDSQRVFTFENRSYYRTGDIVRILAGGEFEYIKKKSFIFIDS
                     MPLDIEGKINVDKLRDLLNDDNYIFKVDNDEFPKNDNILDGFQEKVILTISDFASIPF
                     EKLSLNTKLSTIGIDSISAIQLSKDLREIFHLRISALDILNSSTINSLIRKLKRRRTE
                     SHTRNDKIHESIDQFFKDIRKQILIPQTLCDKIEQILPCLASQCSMLSRFYTNGGKDY
                     LNYSVFHLQKYNDPLLLRSSWENVISNVSILRTKFQTTKHKRSPFCQVTYSKVDIPWS
                     MELHAASVEKVLNEYLELQRRDLLQGKNVLPYSLIFVRTFSQETFLIIIMHHALYDES
                     SLRKILGLVEKSLNSPIGKFNHEPIVRQIELLKANYEEAKAFWIKQLLSFQPTNFPSL
                     TACRIDNEDRMLTKKPCALNYTNLTKWCNAHDVTLQVLGQLVWAKILASYCAENYAVF
                     GTVLSGKSVLTDVDDNIFPTVTTIPCVVKLQGTVEDCLRQLQKFNLDANKFQFTSLLD
                     IKKWLNLGPSEKLFSSLFSIYVDNDIPLKLFNDECKAQGFIEFPVALEMRFSESTSEL
                     TLNSAVNYIPQAHASLILDQFNAILTTIFNNPLQQIEILENSLPTQLLSIKPAIVGDY
                     PTEIKYLHQFVEYFAQKSPNSCALEFALDINQDSVQLIRLTYSELNERANKLAHNLKS
                     YGFRVGSIIAVYFDKCIEAFISMLAILKAGCCFLALDVSAPTERIRYIVTDSTAVLVM
                     STGELYTKLLNASINVTILDASDPGNYSNNIENPYTKDFEDSNLAYVLYTSGSTGKPK
                     GCCLTHHNVVQCMLAFQDQFAGEWDTNSRFLAFASFHFDVSVLEQYFSWSTGITLVAA
                     PQSLILQDLPTAISALKITHVDLTPSLASILTPKTAPLLRVFITGGEQIKQELLNIWG
                     DTRVLYNFWGPTELTIGASAFRKVPKNAKVSNIGPPFPNCSTYILSKETKVPVLLGGL
                     GEICMGGNQVAKGYLNLPEQTDAKFYFDRRFNDRIYHTGDLGRLLKDNNSLEFCGRTD
                     DQIKLRGQRIEIGEINAVIKSSSEKILGVYTLAVVHPVLRKQQLVAFIHVKGISASHL
                     IVHDHKDPSLIGFINSACKASLAKYMVPSFYVFISSVPLTPTNKFDKKKVIEEFSRLS
                     LGQLSSFAPAREENDNEGSNVVEPKLLKIIADFSDVKVTDISPQTSVFELGLDSISAV
                     ALSGLLRKSGYDNANPSLILTSSTISNLGFALNTQTNEELEDSIKVNSIIKLPSCSQF
                     PFHQYIELINPCLPLVEGLLFELERSNNENYYNSFFFLFEKREQADQFINNFKLLRKQ
                     YEVLRSSFLKSDGEYFQVVWKSDFIAEVDVLNNDSLIKTVRYSLKCEKGFFLVTVTLF
                     HGIYDGWSLDLLLNDLARLCSRKTLAPRPRYSKIVRQLLINTSLKKDTKEYWLNLFRS
                     KNIYVPIFQGKLDMAITLGHKLSISSAKLSTICRSVLKASVNSALLTSWICFLNSIGA
                     INCVGIVVSGRSEISMDCLEVMGPLFNTIPFPLFLEKDESFDCLVRRCQLTLASMIPY
                     HQTSLREIKKWLRRSELFNVLFTYNLHPSVIKQCEFPWSFSSESTDTGYPLALEIEED
                     VDGTMNLHLSSNFKYIGQTEIIGLLDSYDCYLSSLLETSNAKISSRPNVLMPNQPEVK
                     QYIPNVWNDVLKKLITILSPKVIITKLDFERDTFVHEFGIDSIDLIWLASKVSEAGIG
                     KLDIGLLMEKPTFYRILQLLCETSANHSTSLKHEFGTLNTLLSKYLTDQDAEDCYPAT
                     PIQSGLLLETMNQKNLYQNDVLFSLDAEISLEKLQNSWKRLCQKNAILRTHFAISEDS
                     SEPMVIQIVDKFEARSCLNQIKILPSRFTNIEDTLRFLRHDEEAKRFLDPFKNPPYYV
                     QFFEIGAKNYMFVQMHHSLYDGWSLSLMYDELMQLYRDEQGNSRKPFKDYIIQLYSLK
                     YDYDFWFKYFENLSIPKPLPFLSNNGKFMSSMMSTVSLPSVRLACQLYGVSIQSLVFF
                     TWGYYIASVLNCPDIVFHTVLSGRTYIEGAETVMGPCMNTIPVRIKFEGALQTLKKTS
                     RMLINLAKQQHTPLSWIYKTYGNVAAIPMESILVYQHLPDSSQSETFLNVVTDNSAVD
                     YPIAIQFEIQGDTLNWLTSLDLARVDGDVANQLLQTIDKIFSNLTKGSFEKLTFNFSN
                     FVKYRQYQINLKDFRENLLLTEEAISDCDLLIIDERVLVVFILFPEPDAKFPYLVLNE
                     EIIRMLKSYIKKFRLTLSSAMVPDILVPVSYLPRSLDHSENEGKLLNIYNSISADNLK
                     ILSAVHEIHLNETEKILLEGFSKIICLPQDSVDISNNFFQLGMDSIRSIHLCSYLRNK
                     GLNVSVSDILQHSSIEKLAHYLQYEKKESSSSFDIASFQLDEYLNTLPSNIPINLVQK
                     ILPCSAGQMYALNAWYNTEKKKYFHTFFYTTEEKIELLKLKLAWAKLVKSSDILRTTF
                     IRSSSPCYPLLQIVLKSFECPWEHYITDNLHDTCLKIQKRELVTNTTLQEVPLRIATI
                     ETSGKFVFCLTIHHALYDGWSLDIMINYLSKMYYDDSLTIVQQNSQLFLSTVLDPAVG
                     LSRKKFWNNYLTNYKPYTFLEKPSASQEITLFFPKLFSLDTVYSSVRSRGLTVQSVSF
                     AVFARLLANEVKQEDVVFGIYVSGRTLDVDNIDELLFPTFNVVPLRVTDTFRPLGEIA
                     LEIQSFLNEISGNLQYISLLDLPVHGMMDIAVNFLSTGDNNEPSKVFSVYPLKLNNAE
                     LKINEVETTIDGCEILFGNKPKLDFELAIRDGYLEIGLFCQSSIFSKREASVFINNFV
                     TIIKEIEL"
     gene            870740..872773
                     /gene="sib2"
                     /locus_tag="SPAC23G3.03"
                     /db_xref="GeneID:2541831"
     mRNA            join(870740..870880,870953..872773)
                     /gene="sib2"
                     /locus_tag="SPAC23G3.03"
                     /product="putative ornithine N5 monooxygenase"
                     /transcript_id="NM_001355990.1"
                     /db_xref="GeneID:2541831"
     CDS             871025..872320
                     /gene="sib2"
                     /locus_tag="SPAC23G3.03"
                     /EC_number="1.14.13.-"
                     /codon_start=1
                     /product="putative ornithine N5 monooxygenase"
                     /protein_id="NP_001342942.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23G3.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC23G3.03.1"
                     /db_xref="GeneID:2541831"
                     /db_xref="GOA:Q9P7T0"
                     /db_xref="InterPro:IPR025700"
                     /db_xref="PomBase:SPAC23G3.03"
                     /db_xref="PomBase:SPAC23G3.03.1"
                     /translation="MTEPLDLAIIGFGPASLSFLIALHDHSEEPLKNKKIRVFEKLPT
                     FSWHEGMLIPGSNMQISFVKDLATPRDPTSYFTFLNYLHSHGQERLSGFLNMSTLEPS
                     RYEYHDYLCWAASHFSKFVEYNANINKLHYDAATDLYIVGHGDTQWQAKNIIITTGCQ
                     PYIPPLYKSVDSPLIVHSSKFMSDHSQKLLRNSKHGILVVGCGQSAAEIWKHCHYSLD
                     PKTPLAMCFRNLAPVPSDSSPFVNSLYFDSHNSHWWYNLPTEARLKGLSVGRTTNYSV
                     VKESLLEEMFKECYLQKLRYGQEFHQIMGDTDIQSIKNEGDHLVVQLTSQMDKSKKPE
                     TRKIDVLYVATGYDHESFDVLMSSLFPNSQGAQISEEYCVLNAPSKQGKVYVAGITSN
                     QHGIGETLLSWAAIRAGGLAKELFGPSKPTARVPASYLN"
     gene            complement(872757..873497)
                     /locus_tag="SPNCRNA.694"
                     /db_xref="GeneID:14218335"
     misc_RNA        complement(872757..873497)
                     /locus_tag="SPNCRNA.694"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151062.1"
                     /db_xref="GeneID:14218335"
     gene            872883..874248
                     /gene="ies4"
                     /locus_tag="SPAC23G3.04"
                     /db_xref="GeneID:2541424"
     mRNA            872883..874248
                     /gene="ies4"
                     /locus_tag="SPAC23G3.04"
                     /product="Ino80 complex subunit Ies4"
                     /transcript_id="NM_001018501.2"
                     /db_xref="GeneID:2541424"
     CDS             873167..873751
                     /gene="ies4"
                     /locus_tag="SPAC23G3.04"
                     /codon_start=1
                     /product="Ino80 complex subunit Ies4"
                     /protein_id="NP_593104.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23G3.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC23G3.04.1"
                     /db_xref="GeneID:2541424"
                     /db_xref="GOA:Q9P7S9"
                     /db_xref="InterPro:IPR013175"
                     /db_xref="PomBase:SPAC23G3.04"
                     /db_xref="PomBase:SPAC23G3.04.1"
                     /translation="MSETLVLHLKVPTERFREVLSSLKEKQNFTASPSSQPKPQERPF
                     QMKKPRAPYGMGPRAMKRREKAEKEKLGVVNDELAESSKPSSGAATPTRSAPKSSAGL
                     INSGLRALDRSGKPCRRWEKKPISIRSISTIVWKLPLWIGTPDSIPNTPELPVKTTLD
                     SVNEIAAALSTHAESSPMDATSPVDSMPESATGI"
     gene            complement(874160..875763)
                     /locus_tag="SPAC23G3.05c"
                     /db_xref="GeneID:2541778"
     mRNA            complement(874160..875763)
                     /locus_tag="SPAC23G3.05c"
                     /product="putative RGS domain-containing family protein"
                     /transcript_id="NM_001018502.2"
                     /db_xref="GeneID:2541778"
     CDS             complement(874532..875563)
                     /locus_tag="SPAC23G3.05c"
                     /codon_start=1
                     /product="putative RGS domain-containing family protein"
                     /protein_id="NP_593105.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23G3.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23G3.05c.1"
                     /db_xref="GeneID:2541778"
                     /db_xref="GOA:Q9P7S8"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="PomBase:SPAC23G3.05c"
                     /db_xref="PomBase:SPAC23G3.05c.1"
                     /translation="MASAPRVSEVLTKKNLPPLSLYNFYIYIRDEENAIEFLDLFLDI
                     MLHKFLFREHIRGLYKAGVTSTSLNTESSSTLGPHHFTRFRSASLSLEDLSTVYWPNF
                     GPLLLEELSNEQTINSSDLLLSKDRAAYLKNLLTSNIQSLTQESTVISKEQVKMFTQI
                     IIEKYFNPASPHEVMLPPQLVQPILDCKEHQRQDELRLFEDVETYLLNFLLKPAYYRF
                     LNHKFKHNLNPLTCTGRFIIGYVSTFAAYWLGFCGIFLDYSRRKRVWTLLPFAFGFYN
                     LICTWSKHDPVLALLGYSEVKPFHYEKVLQPSIRLSLNRRAIFVLSIIVLIVGANTAI
                     FSCVPSIRL"
     gene            876862..878930
                     /locus_tag="SPAC23G3.06"
                     /db_xref="GeneID:2541814"
     mRNA            join(876862..876962,877004..877106,877175..878930)
                     /locus_tag="SPAC23G3.06"
                     /product="putative U3 snoRNP protein Nop58"
                     /transcript_id="NM_001018503.2"
                     /db_xref="GeneID:2541814"
     CDS             join(876947..876962,877004..877106,877175..878582)
                     /locus_tag="SPAC23G3.06"
                     /codon_start=1
                     /product="putative U3 snoRNP protein Nop58"
                     /protein_id="NP_593106.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23G3.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC23G3.06.1"
                     /db_xref="GeneID:2541814"
                     /db_xref="GOA:Q9P7S7"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="PomBase:SPAC23G3.06"
                     /db_xref="PomBase:SPAC23G3.06.1"
                     /translation="MFILTETAAGYAIFKAKDKLLKKRDALIEDLKSPEGASNLLKLQ
                     SFAKFESTVDALDNVSALVEGKVSSKLSSLLEGLSDSKSSTLVVADPKLGNAINKLPG
                     LEFEIISDSSVQDLYRGIREHLSSLISGLAPSDLNAMSLGLSHSLSRHKLKFSPDKVD
                     TMIVQAIALLDDLDKELNTYAMRVREWYGWHFPEMGKIIQDNLAYARVIKAMGMRTKC
                     SETDFSDILPEEIEATLKSAAEISMGTEITEEDLDNIVMLADQVLELASYRAQLSEYL
                     RNRMQAIAPNLTALVGELVGARLIAHAGSLMNLAKQPASTIQILGAEKALFRALKTKH
                     STPKYGLIYHASLVGQANSKNKGKIARVLATKAALSLRVDALSDKDTTNGNIGLENRI
                     RVENRLRSLEGGKLLPLPTAPVQQSKVQINGTSAYSTATDAVTKDAEESQEDVEMDIV
                     IEKKKKKSSKLKEADGESSKKEKKEKKDKKHKKSKRKSEESEDGESPKKKKKSKKSKD
                     "
     gene            complement(879147..880546)
                     /gene="snf30"
                     /locus_tag="SPAC23G3.07c"
                     /db_xref="GeneID:2541781"
     mRNA            complement(join(879147..879835,879987..880546))
                     /gene="snf30"
                     /locus_tag="SPAC23G3.07c"
                     /product="SWI/SNF complex subunit Snf30"
                     /transcript_id="NM_001018504.2"
                     /db_xref="GeneID:2541781"
     CDS             complement(join(879214..879835,879987..880189))
                     /gene="snf30"
                     /locus_tag="SPAC23G3.07c"
                     /codon_start=1
                     /product="SWI/SNF complex subunit Snf30"
                     /protein_id="NP_593107.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23G3.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23G3.07c.1"
                     /db_xref="GeneID:2541781"
                     /db_xref="GOA:Q9P7S6"
                     /db_xref="PomBase:SPAC23G3.07c"
                     /db_xref="PomBase:SPAC23G3.07c.1"
                     /translation="MSFVSKSPPIVNSASPTGQVNPMEVEKANKLLEINRLILWKCLE
                     LQHIKTAQNSTLEQRALSTELFNSYIQRLKANLAFVVSIASPRQMQVLTPPLSCPESL
                     PQLEPLYKELRQYFQIAQTSTLSYPPSNGDSSSYANGTDLHGNTGTMQQEEKANPSLT
                     RSDSVSSGSYITMQGANSLKAQQDLLNSFTGAPSNNSHNIPDPNLSQTFSATSMGPPN
                     NNYSKFRTDNYLARSSNRSGTPNIQNEQSRFFDSQQAQVQARALMQRYQQGMEFNK"
     gene            complement(880660..884231)
                     /gene="ubp7"
                     /locus_tag="SPAC23G3.08c"
                     /db_xref="GeneID:2541845"
     mRNA            complement(880660..884231)
                     /gene="ubp7"
                     /locus_tag="SPAC23G3.08c"
                     /product="ubiquitin hydrolase Ubp7"
                     /transcript_id="NM_001018505.2"
                     /db_xref="GeneID:2541845"
     CDS             complement(881023..883650)
                     /gene="ubp7"
                     /locus_tag="SPAC23G3.08c"
                     /codon_start=1
                     /product="ubiquitin hydrolase Ubp7"
                     /protein_id="NP_593108.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23G3.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23G3.08c.1"
                     /db_xref="GeneID:2541845"
                     /db_xref="GOA:Q9P7S5"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="PomBase:SPAC23G3.08c"
                     /db_xref="PomBase:SPAC23G3.08c.1"
                     /translation="MPHSNTLIVPSTNPFDDPSSIKNGLNNLTSSELVNQMKKESLAA
                     SVKTPSTPPKECSHLKKGVKLSHLKGNARALRDPSKHLCFICTTEKIKREDYELTLCA
                     NCGYLFCCNHESDHSRKHFEKNKKHCVFVNIITLKCHCYSCDADIVIFDKKNLVVRDV
                     QQFICSNLVSSLTKAPNVLKSNSSHFKKEKKSKHSSGKSSKKYKVISPGLKNLGATCF
                     FNSTLQVLCACEALHDVISPFQYSHSSVIVRKLTKSPESSLLSAFIKFLETFYKSDGT
                     ISVYRPTTFFGEFRRLHPQFSESVQQDAHELLRLLLDDLISEEFRVLRFNLNSVSRSL
                     QLSPCLTDDEQLSKSLTSFKQVNVTDASLSPNSHNTSDNEQNNEDYVSVSSLVGSETE
                     DITYSKELSQSSDSSQHQHDSFLPANSSPLAASSTKSLPSSELLDSSSDKGQQVFKGQ
                     HEVAGTNSFEDPNSHFNVSNSSNHEEASPKKEVLKSPQFQRRSLDILRLGELSSDDMM
                     LDKATMDEFSSSLVIKSIFTGRLTSVVMCQSCNEITNTPEPIQDLSIPIHYPSSRVSR
                     RHRFHRALRSRFSRSPKKSSVKIVVDNANDDTDQAPTTNSSSLNENLLGGHASENDKS
                     LKQSPFQKLTRRLSDLSVNSSGQISKQDFDNSNSIFSESSLSSPIIEEPKTLIDCLKN
                     FTHVEELSGENMFACENCCNQPNEVGSPAKGGLTSDNDKYSFNNSVYRNAYKRMLLDD
                     PLPPVFIIHLKRFFQEISHDGYANPKKISDFIEFEQELDLNEFVMPHLRASSSFRYRL
                     FGVIVHSGTLNYGHYVAYVLSHKFLDLSAPSTNSKDFRSEAGIPERRWLYISDNIVRE
                     SSWDEVSKVEAYMLFYERV"
     gene            884365..885989
                     /gene="taf4"
                     /locus_tag="SPAC23G3.09"
                     /db_xref="GeneID:2541721"
     mRNA            884365..885989
                     /gene="taf4"
                     /locus_tag="SPAC23G3.09"
                     /product="putative transcription factor TFIID complex
                     subunit Taf4"
                     /transcript_id="NM_001018506.2"
                     /db_xref="GeneID:2541721"
     CDS             884445..885542
                     /gene="taf4"
                     /locus_tag="SPAC23G3.09"
                     /codon_start=1
                     /product="putative transcription factor TFIID complex
                     subunit Taf4"
                     /protein_id="NP_593109.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23G3.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC23G3.09.1"
                     /db_xref="GeneID:2541721"
                     /db_xref="GOA:Q9P7S4"
                     /db_xref="InterPro:IPR007900"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="PomBase:SPAC23G3.09"
                     /db_xref="PomBase:SPAC23G3.09.1"
                     /translation="MDLNNPPSKRFGDDDDIPANKRPKNEEYPEIPGYLGNRKPSYTQ
                     NPNSGPGKLHYASPRPNNVSSSVGVASGGDRQEADQLQDALISCGIQLKEEELNLSTS
                     FYDPSSLNTFALTTEDRSRKSDFLNSFVLMQTVSNIVNLHRLKSMDSDIHALISMAVR
                     DYLANLLQKMIVESHHRTSQLHTDNYKQVDNVRQTLANFAYKEYESEERRRTVLNIRR
                     AEHEARLAELNSASTNEEGSSRRRKEQSSSAAAKNISEDAQNRMTNATASIMAGSALP
                     SGGKKYSWMATDMTPMTPAVGGGFGIRKKDSNSLKPSSRDGVLPLQQEEKGIITIRDA
                     LAVLEMDREGAGRIFGRGAKAMMRAYIRLKD"
     gene            complement(884513..887531)
                     /gene="ssr3"
                     /locus_tag="SPAC23G3.10c"
                     /db_xref="GeneID:2541438"
     mRNA            complement(884513..887531)
                     /gene="ssr3"
                     /locus_tag="SPAC23G3.10c"
                     /product="SWI/SNF and RSC complex subunit Ssr3"
                     /transcript_id="NM_001018507.2"
                     /db_xref="GeneID:2541438"
     CDS             complement(885895..887172)
                     /gene="ssr3"
                     /locus_tag="SPAC23G3.10c"
                     /codon_start=1
                     /product="SWI/SNF and RSC complex subunit Ssr3"
                     /protein_id="NP_593110.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23G3.10c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23G3.10c.1"
                     /db_xref="GeneID:2541438"
                     /db_xref="GOA:Q9P7S3"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="PomBase:SPAC23G3.10c"
                     /db_xref="PomBase:SPAC23G3.10c.1"
                     /translation="MSNNSRLPENGVQSGNGEDAELKKSMRIIEREIPDSLLEKIPEA
                     EDYIALQDLERKLDSLIVRKRFDLQDSLSRNSHKTRILRMYIHSTVANQSWQQKGENQ
                     ENNSGDINSLPIPEWTLHIEGRLLVNPDDEDDKAFELAPFTNFFRKIAIQILRSDDLY
                     PSGNYVEWNKLPDNSNTSNGITVTRKGDQSVDVKIMLYPEEHPERYKLSKAFANILGI
                     REGTRPDIVSYLWQYIKFHRLQDMEEKRLINCDKALRDLFEADRLYFPRIPELMNRFL
                     EPIDPIVIPYTINVSEHTVEKVTIFDIRINTEDPRHSQIRSFLATMMSQDKIRSIDDK
                     LTELIQAITYSQSKYDFMKKFSESPIEFINEWIESQSRDLEIVLDGTNMNYAEKRSAD
                     YYQQPWVHESAFHYLNLLNSKKQQSVLNASAKK"
     gene            885944..889096
                     /gene="rpn6"
                     /locus_tag="SPAC23G3.11"
                     /db_xref="GeneID:2541807"
     mRNA            join(885944..887836,887899..887981,888027..889096)
                     /gene="rpn6"
                     /locus_tag="SPAC23G3.11"
                     /product="putative proteasome regulatory subunit Rpn6"
                     /transcript_id="NM_001018508.2"
                     /db_xref="GeneID:2541807"
     CDS             join(887661..887836,887899..887981,888027..889033)
                     /gene="rpn6"
                     /locus_tag="SPAC23G3.11"
                     /codon_start=1
                     /product="putative proteasome regulatory subunit Rpn6"
                     /protein_id="NP_593111.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23G3.11"
                     /db_xref="EnsemblGenomes-Tr:SPAC23G3.11.1"
                     /db_xref="GeneID:2541807"
                     /db_xref="GOA:Q9P7S2"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="PomBase:SPAC23G3.11"
                     /db_xref="PomBase:SPAC23G3.11.1"
                     /translation="MSSKSSLELANNAVKSNDIEKAIDLYKEVLNKGVSKDEKVANEQ
                     EQALTNLSDLYVRENRHNDLAQLVQQSRPLMANFSKAKSAKIVRTLIDKFSGEKKSLP
                     LQIEVANDCIKWAIKEKRTFLRQALETKLISLYYDNSSYTDAINLINTLLSELKRMDD
                     KMLLTEVHLLESKVYHAIRNIPKARASLTAAKTSANAVYCPPMLQGNLDLQSGILHAD
                     DMDFKTAYSYFYEAYEGFTSLDDDKKALSSLKYMLLSQIMLNSVSEVKSLLTGKHAIR
                     YAGRDIEAMRAIAQAHENRSLADFEKALQDYKPELASDPIIRSHLSSLYDNLLEQNLL
                     RVVEPFSRVEVSHIAELIGLSTVQVEGKLSQMILDKIFYGILDQGSGCLIVYDEPQQD
                     KTYEAALEVIKNMGTVVDLLIENKASALL"
     gene            complement(889058..892211)
                     /locus_tag="SPAC23G3.12c"
                     /db_xref="GeneID:2541812"
     mRNA            complement(889058..892211)
                     /locus_tag="SPAC23G3.12c"
                     /product="putative serine protease"
                     /transcript_id="NM_001018509.2"
                     /db_xref="GeneID:2541812"
     CDS             complement(889130..892120)
                     /locus_tag="SPAC23G3.12c"
                     /codon_start=1
                     /product="putative serine protease"
                     /protein_id="NP_593112.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23G3.12c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23G3.12c.1"
                     /db_xref="GeneID:2541812"
                     /db_xref="GOA:Q9P7S1"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001940"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR025926"
                     /db_xref="PomBase:SPAC23G3.12c"
                     /db_xref="PomBase:SPAC23G3.12c.1"
                     /translation="MSIKKRARAGSKSDDIGNKTPKKNGIEHEATKSSETVIEMTPSG
                     PIAESKKWKESIARVVKSVVSIRFSQVAAFDTDESGTGEASAFVVDAKNGYMLTNRHV
                     VCAGPFVGHAVFDNHEEVEVFPVYRDPVHDFGFLRFDPKKIRYMNVEQLELRPDLAKV
                     GTEIRVVGNDAAEKLSILAGWISRIDRNVPDYGELTYCDFNTNYIQAAANASGGSSGS
                     PVVERNGNVVALQAGGHMIAATDYFLPLDRPLRALRCLQNNTPITRGTIQAQFLIKTF
                     DECSRLGLDSAMEEKVRTLFPEATSMLVVETVLPEGPSFKKLKEGDILLYVNSMILIN
                     LIELESILDESVGKDVVLTVQRGSELVELTCTAQSTHDIAPDRYVEVCGAKFHNLSYQ
                     LARQYALPVKGVFISEPAGSFRLEGPEYGYILDSIAYKPVPDLDTFIEVMRDIPDRSR
                     VAVGYHFIHDKHSLITDVVEIDRHWLKAFRMVTRNDETGLWDFKNLGDPLPAEPSKPC
                     TTSIPKLNVENFGPTANIINCFVKVLYYMPLHLDGSRKSRKKGTALVLDKDKGLAVTS
                     RSTVPYDLGDLTITVADSIQIPAEVVHLHPTQNLAFIKYDPKLLGDTPIQAAKLKDYY
                     VSQGDPVNFFGFNSKSRVVAAKTSVTDVITMVIPSSPMPRFRAINFESITVESNLSTQ
                     CGSGVLTDDDGLVVALWLTHYGEQTSRGTDVKYHLGLASPVVLSTLRRLQSGVNVNPR
                     ILNVEFRAIQLAQARSLGLPAERIRKIETESGKKHQLFMITHVEAGTPRILTDGDIII
                     SANGKSITRIRDLQVDDVTEVDMEILREGKVQTVKVPTFPSDNCETNRVVICWGATLQ
                     APHRAVRLQIEDLPSNVFVTNRGRGSPADQYDLGAAQFITAVNGVTTLNLEDFVREIR
                     KIDDNSYVRVSTSTFDKVPVVLTIKMNKHYFPTIDLVQDAKAENGWRAVQYDEVGEKK
                     NPSMGFTIDEEVDDNTFDTEGEQQ"
     gene            complement(893278..894532)
                     /gene="mug35"
                     /locus_tag="SPAC22H12.01c"
                     /gene_synonym="SPAC23G3.13c"
                     /db_xref="GeneID:2541723"
     mRNA            complement(893278..894532)
                     /gene="mug35"
                     /locus_tag="SPAC22H12.01c"
                     /gene_synonym="SPAC23G3.13c"
                     /product="protein mug35"
                     /transcript_id="NM_001018510.2"
                     /db_xref="GeneID:2541723"
     CDS             complement(893719..894423)
                     /gene="mug35"
                     /locus_tag="SPAC22H12.01c"
                     /gene_synonym="SPAC23G3.13c"
                     /codon_start=1
                     /product="protein mug35"
                     /protein_id="NP_593113.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC22H12.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22H12.01c.1"
                     /db_xref="GeneID:2541723"
                     /db_xref="GOA:O94435"
                     /db_xref="PomBase:SPAC22H12.01c"
                     /db_xref="PomBase:SPAC22H12.01c.1"
                     /translation="MTNERHDELACLGIFPLKNPKQLDGVVTPILQLRVKFLAPTDRW
                     WEGLVINKDLSKEESEELWKFLQSFDPRSAKFVGRGTPEDHVISYLFEAGKYEFEVFF
                     YQKDHSLKLMGLYDKTQKQLLRRDSSGDLTSTDKERDVSPVSHSEKPYWDRYDLDQPS
                     NQDVEESRNLVQEPKHRSKKYDRLGLDELVMEQTASLWKICSRNGMSVDEFLRFIRMG
                     LESNFQHSNQVIPTHF"
     gene            893996..896547
                     /gene="tfg3"
                     /locus_tag="SPAC22H12.02"
                     /gene_synonym="taf14"
                     /db_xref="GeneID:2541729"
     mRNA            join(893996..895407,895597..895765,895823..895974,
                     896039..896547)
                     /gene="tfg3"
                     /locus_tag="SPAC22H12.02"
                     /gene_synonym="taf14"
                     /product="transcription factor TFIIF complex subunit Tfg3"
                     /transcript_id="NM_001018511.2"
                     /db_xref="GeneID:2541729"
     CDS             join(895366..895407,895597..895765,895823..895974,
                     896039..896401)
                     /gene="tfg3"
                     /locus_tag="SPAC22H12.02"
                     /gene_synonym="taf14"
                     /codon_start=1
                     /product="transcription factor TFIIF complex subunit Tfg3"
                     /protein_id="NP_593114.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22H12.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC22H12.02.1"
                     /db_xref="GeneID:2541729"
                     /db_xref="GOA:O94436"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="PomBase:SPAC22H12.02"
                     /db_xref="PomBase:SPAC22H12.02.1"
                     /translation="MTTVKRTVRLITDQNVLPGGEAAVLNDQSFPVREWSIKLVCLNP
                     QGEETDASFVDRVTYKLHPTFQNPTRTIRKPPFQIKEQGWGEFEMEIIIYYADKGGEH
                     RFLHYLHFQQEHYHEDIELNINATRPGLLKALTATGEVPGYSDEGEEARKDKRKNESE
                     VGAGKKKAKAKPVDMDKLAEGLQKLQEDDLLQVVQMVNENKTPDMYVRNDIEGGEFHI
                     DLYTLPDNLLLLLYSFCAKRVTM"
     gene            896668..897900
                     /locus_tag="SPAC22H12.03"
                     /db_xref="GeneID:2541745"
     mRNA            join(896668..897163,897242..897781,897829..897900)
                     /locus_tag="SPAC22H12.03"
                     /product="putative hydrolase"
                     /transcript_id="NM_001355991.1"
                     /db_xref="GeneID:2541745"
     CDS             join(896877..897163,897242..897767)
                     /locus_tag="SPAC22H12.03"
                     /codon_start=1
                     /product="putative hydrolase"
                     /protein_id="NP_001342787.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22H12.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC22H12.03.1"
                     /db_xref="GeneID:2541745"
                     /db_xref="GOA:O94437"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PomBase:SPAC22H12.03"
                     /db_xref="PomBase:SPAC22H12.03.1"
                     /translation="MSLKPVKLAFEKYSATVAKHPPVLIFHGLLGSKRNWRSLAKKFS
                     CKLDRDIYAIDQRCHGDSPCVAPLSYSAMALDAFQFMKDHKLDKASIIGHSMGAKTAM
                     VTALKWPDKVEKLVVVDNSPWYQDLPRDYGAYFRKMIQIDEANITKYSEADKMMSTVE
                     KDILVRSFLLSNLKKDSNNSNTFKFRVPIELISKSLKTIEGFPASLNDLVYDSPTLVI
                     RALKAPFIPDSALPVFKKFFPKYELVSLDCGHWVHFEKPKEFSESIINFLNN"
     gene            complement(898045..898994)
                     /gene="rps102"
                     /locus_tag="SPAC22H12.04c"
                     /gene_synonym="rps1-2; rps3a-2"
                     /db_xref="GeneID:2541737"
     mRNA            complement(898045..898994)
                     /gene="rps102"
                     /locus_tag="SPAC22H12.04c"
                     /gene_synonym="rps1-2; rps3a-2"
                     /product="40S ribosomal protein S1"
                     /transcript_id="NM_001018513.2"
                     /db_xref="GeneID:2541737"
     CDS             complement(898191..898949)
                     /gene="rps102"
                     /locus_tag="SPAC22H12.04c"
                     /gene_synonym="rps1-2; rps3a-2"
                     /codon_start=1
                     /product="40S ribosomal protein S1"
                     /protein_id="NP_593116.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22H12.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22H12.04c.1"
                     /db_xref="GeneID:2541737"
                     /db_xref="GOA:O94438"
                     /db_xref="InterPro:IPR001593"
                     /db_xref="InterPro:IPR018281"
                     /db_xref="InterPro:IPR027500"
                     /db_xref="PomBase:SPAC22H12.04c"
                     /db_xref="PomBase:SPAC22H12.04c.1"
                     /translation="MAVGKNKRLSKGKKGIKKRVVDPFSRKEWYDIKAPAFFEVKNVG
                     KTLVNRTAGLKNANDSLKGRILEVSLADLQKDEEHAFRKVKLRVEDIQGKSCLTSFNG
                     LSITSDKLRSLVRKWQTTIEADQTIKTTDGYLCRVFVIGFTRRRANQVKKTTYAQSSQ
                     IRAIRQKMFQVIQNQTSSCSMRELVQKLIPEVIGREIERATGSIFPLQNVLVRKVKIL
                     KAPKHDAQKLLELHGESQDVGTKVVKDVAPLESV"
     gene            complement(899283..902080)
                     /locus_tag="SPAC22H12.05c"
                     /db_xref="GeneID:2541828"
     mRNA            complement(899283..902080)
                     /locus_tag="SPAC22H12.05c"
                     /product="fasciclin domain protein"
                     /transcript_id="NM_001018514.2"
                     /db_xref="GeneID:2541828"
     CDS             complement(899567..901753)
                     /locus_tag="SPAC22H12.05c"
                     /codon_start=1
                     /product="fasciclin domain protein"
                     /protein_id="NP_593117.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC22H12.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC22H12.05c.1"
                     /db_xref="GeneID:2541828"
                     /db_xref="GOA:O94439"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="PomBase:SPAC22H12.05c"
                     /db_xref="PomBase:SPAC22H12.05c.1"
                     /translation="MNLQFRLYLLFILLFISFANGKNEYEDKSTSIIDLLSSKSQFSK
                     LIRRLQRNRLVPYLNRNKGLTLFAPLNEAFPDDSIEPNLLYYIVNTTELDRSVLRTQL
                     KSSDGQQIALKIHYKAETGRAYDKVNNAQIVQSNWRADSGVVQVIDNIIDLPPPALEI
                     LSSEKDFSIFHRLSVAWVGEYSSVTMLVPDSSAFLNVYTNTELAYLYSMYAAEDVKTL
                     IHQHILVNQRVYAEDVIEPKTFHYKNGISISMKFDKDQKKLFINDVSTTKYDLLTFSG
                     AIHTVSSLINPEIISFTPAKYLIGIGAAWFSEKLSRERKSISVDKTSKRAILAPTNWA
                     YREIIDIDYHIIENFDLPAPNKYALYVTNIKSGNSVGEDTNALVRIATGSAGEMYVNV
                     ETRSIQSENIGNVSLYVLDKDIEPPQPLLSQLILVDEISFSVRYLASLGLGDYTKVTW
                     FLVKNSAWTQLGLVHLVLQQNLELLESVMLDYAFEGIAFYGSSDEAWASGNYTTLSNK
                     EFLIEGVYEDSNSRNKRDLLRINNEIYEVQTRDLLVKDGVVHLVDKVKLPFSVSQKDM
                     IIAGGRKEFLELLDKFEMLDMLDSGYPVVVPSLTGSDVNTKDSSFAERHIIDPEKRNF
                     VISGSRLSVDSSPWISIQDYGYSELGNVYFVQNAIPTKRQNRWRITFISISGLLLSVG
                     ICVLCYKIYFKFFRNRFMNQGEREPLLAPADSDTMAGRRNSSSLSV"
     gene            903042..903861
                     /gene="rpc19"
                     /locus_tag="SPAC1687.01"
                     /gene_synonym="rpa17; SPAPYUL23.01"
                     /db_xref="GeneID:2542799"
     mRNA            join(903042..903172,903246..903343,903392..903468,
                     903546..903861)
                     /gene="rpc19"
                     /locus_tag="SPAC1687.01"
                     /gene_synonym="rpa17; SPAPYUL23.01"
                     /product="DNA-directed RNA polymerase I and III subunit
                     Rpc19"
                     /transcript_id="NM_001018515.2"
                     /db_xref="GeneID:2542799"
     CDS             join(903101..903172,903246..903343,903392..903468,
                     903546..903676)
                     /gene="rpc19"
                     /locus_tag="SPAC1687.01"
                     /gene_synonym="rpa17; SPAPYUL23.01"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I and III subunit
                     Rpc19"
                     /protein_id="NP_593118.2"
                     /db_xref="GeneID:2542799"
                     /db_xref="GOA:Q09177"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /translation="MAAMTDVTDPSSVAMESATEKIIILPGHSADLTSVTFQIQKEDH
                     TLGNSLRYVIMKNPEVEFCGYSIPHPSEAKMNFRIQTAPSTTAVDVLRKGLDDLIDLC
                     DAVTEKFTEQLPRDTSTTMEVDG"
     gene            904026..906347
                     /locus_tag="SPAC1687.02"
                     /db_xref="GeneID:2542754"
     mRNA            join(904026..904628,904680..906347)
                     /locus_tag="SPAC1687.02"
                     /product="putative CAAX prenyl protease"
                     /transcript_id="NM_001018516.2"
                     /db_xref="GeneID:2542754"
     CDS             join(904266..904628,904680..905132)
                     /locus_tag="SPAC1687.02"
                     /EC_number="3.4.22.-"
                     /codon_start=1
                     /product="putative CAAX prenyl protease"
                     /protein_id="NP_593120.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.02.1"
                     /db_xref="GeneID:2542754"
                     /db_xref="GOA:O94448"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="PomBase:SPAC1687.02"
                     /db_xref="PomBase:SPAC1687.02.1"
                     /translation="MRVYLISFFFTAIYVVSLYTFPVARPRPSLNRNDPKVITARCIS
                     VLLASSVCCILTRLIIGPSLNVFTFPTDQVLKSLLHAATIFIGPLYEVWIVDKEYRLF
                     FIHLKDCLSNAIAWRNIIIGPLSEELTFRCCIVPICEAAGWSRLKIIFVAPLLFGMAH
                     IHHTYEFLLAYPNAYIAAALQTVVQFSYTTVFGWYTTHLFLSTHSLFPSFLVHAFCNS
                     MGLPTLYGKIGNRNQTRIYYTLLLLGVLIFYMTWGITDFNNHQDFEPRLVPLN"
     gene            complement(905077..906465)
                     /gene="rfc4"
                     /locus_tag="SPAC1687.03c"
                     /db_xref="GeneID:2542790"
     mRNA            complement(join(905077..905977,906033..906144,
                     906288..906465))
                     /gene="rfc4"
                     /locus_tag="SPAC1687.03c"
                     /product="putative DNA replication factor C complex
                     subunit Rfc4"
                     /transcript_id="NM_001018517.2"
                     /db_xref="GeneID:2542790"
     CDS             complement(join(905129..905977,906033..906144,
                     906288..906355))
                     /gene="rfc4"
                     /locus_tag="SPAC1687.03c"
                     /codon_start=1
                     /product="putative DNA replication factor C complex
                     subunit Rfc4"
                     /protein_id="NP_593121.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.03c.1"
                     /db_xref="GeneID:2542790"
                     /db_xref="GOA:O94449"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC1687.03c"
                     /db_xref="PomBase:SPAC1687.03c.1"
                     /translation="MSNAVSSSVFGEKNNSVAYELPWVEKYRPIVLDDIVGNEETIDR
                     LKVIAKEGNMPHLVISGMPGIGKTTSILCLAHALLGPAYKEGVLELNASDERGIDVVR
                     NRIKAFAQKKVILPPGRHKIIILDEADSMTAGAQQALRRTMEIYSNTTRFALACNQSN
                     KIIEPIQSRCAILRYSRLTDQQVLQRLLNICKAEKVNYTDDGLAALIMTAEGDMRQAV
                     NNLQSTVAGFGLVNGENVFRVADQPSPVAIHAMLTACQSGNIDVALEKLQGIWDLGFS
                     AVDIVTNMFRVVKTMDSIPEFSRLEMLKEIGQTHMIILEGVQTLLQLSGLVCRLAKSQ
                     MKPESFII"
     gene            906778..908799
                     /gene="mcb1"
                     /locus_tag="SPAC1687.04"
                     /db_xref="GeneID:2542796"
     mRNA            join(906778..907045,907090..908799)
                     /gene="mcb1"
                     /locus_tag="SPAC1687.04"
                     /product="mini-chromosome maintenance complex-binding
                     protein mcb1"
                     /transcript_id="NM_001018518.2"
                     /db_xref="GeneID:2542796"
     gene            complement(906863..908571)
                     /locus_tag="SPNCRNA.695"
                     /db_xref="GeneID:14218233"
     misc_RNA        complement(906863..908571)
                     /locus_tag="SPNCRNA.695"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151063.1"
                     /db_xref="GeneID:14218233"
     CDS             join(906884..907045,907090..908433)
                     /gene="mcb1"
                     /locus_tag="SPAC1687.04"
                     /codon_start=1
                     /product="mini-chromosome maintenance complex-binding
                     protein mcb1"
                     /protein_id="NP_593122.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.04"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.04.1"
                     /db_xref="GeneID:2542796"
                     /db_xref="GOA:O94450"
                     /db_xref="InterPro:IPR019140"
                     /db_xref="PomBase:SPAC1687.04"
                     /db_xref="PomBase:SPAC1687.04.1"
                     /translation="MVIALSDSFIENPRSFLQRFQDALFAGSKPDLQGTLGIDEEVSN
                     IFATEERIRKIPNYLDCKWSELKTGQLLRLQGMVQDTNFGHEFFAGAVEVNENIWRGC
                     RYILDFSEDEMHLDESKIVLDERYSLFLTNVPGERTLPVIEALGNWGSESLKERSLKY
                     SNRLQASNDTGVCVKCYGGMETKVQVCQAIDVIGIYEEPSEYSDGLPILHMLCFKDYT
                     QSATQAPSPQQAEIIRPKILKYFEKVLGENIAAESLMLALLSNVVHKTTGLVIGGFTL
                     NLTNCTSELVSQLVSVLRPLIKRMVIQKVNVAELNRKPLYPLSDGETLDTSHLQVAPG
                     TLIVLDETELSSGTLNDVGCRNVQFLSSLISQQDLTFFYPFSSFTVHSNVRIIILSHG
                     RSILPADVGCRCRGDSPDTIEFPTDSDELQEFCNFFHMWNMRANIPENMLDYIQSTYV
                     SSRQYNKEINEKTLSLQINCSRLYAKSFGRQLVSRIDFEAARSLINHWTVN"
     gene            908736..911854
                     /gene="pli1"
                     /locus_tag="SPAC1687.05"
                     /db_xref="GeneID:2541580"
     mRNA            join(908736..908871,908924..911854)
                     /gene="pli1"
                     /locus_tag="SPAC1687.05"
                     /product="SUMO E3 ligase Pli1"
                     /transcript_id="NM_001018519.2"
                     /db_xref="GeneID:2541580"
     CDS             join(908839..908871,908924..911074)
                     /gene="pli1"
                     /locus_tag="SPAC1687.05"
                     /codon_start=1
                     /product="SUMO E3 ligase Pli1"
                     /protein_id="NP_593123.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.05.1"
                     /db_xref="GeneID:2541580"
                     /db_xref="GOA:O94451"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR023321"
                     /db_xref="InterPro:IPR027229"
                     /db_xref="PomBase:SPAC1687.05"
                     /db_xref="PomBase:SPAC1687.05.1"
                     /translation="MNQANFLQELPNVLKRLETGLIIPQLKDILRVFGLRLSGTKAEL
                     ITRIKQLIERIAIENNTTSWEALKKAIDGDVTSAVCILKYNTYQIYSAAAPIAPPSSA
                     SGNRSYSRPFAPVVHSRIRFRKSPFYDILEQFNAPFVVPACVGTRNTISFSFHVTPPA
                     LSKLLNDPKQYRVYLFSTPSETIGFGNCLMEFPTPQMELRINNQVAHANYRRLKGKPG
                     TTNPADITDLVSKYAGPPGNNVVIYYMNSTKSYSVVVCFVKVYTIENLVDQIKSRKAE
                     SKEKIIERIKNDNQDADIIATSTDISLKCPLSFSRISLPVRSVFCKHIQCFDASAFLE
                     MNKQTPSWMCPVCASHIQFSDLIIDGFMQHILESTPSNSETITVDPEGNWKLNTFDEP
                     VESSEDEFVPKEKVIELSDGEGISTMANKSNDQPTRRASTHNSGPPAKRKRESLVIDL
                     TISDDDENVATSTTESPSNATKENSLSRNVQSPNIDTAISNRSTNVRHGHPGFKDYTV
                     ENSPASRERSTSESAQSSVHMGYAGEGGLLSGALRAPSQQNNNNSNTQHSINLHTIVP
                     SPYEPPLSVTPSTAITNLSIPESNRTNSSASSKSFTMNDLILPPLHLKNTTQTNNAHE
                     DAQSSNLSQNHSLFYERIPQRPSYRIEKQNKGIYEDENEQSISAMPIPRAHPQLPKNL
                     LSQTAGPLWDEQQDAQVDWNSELQSNNSYHNSGFEGTGNTFQSID"
     gene            complement(911227..911720)
                     /gene="rpl44"
                     /locus_tag="SPAC1687.06c"
                     /gene_synonym="rpl28"
                     /db_xref="GeneID:2542782"
     mRNA            complement(911227..911720)
                     /gene="rpl44"
                     /locus_tag="SPAC1687.06c"
                     /gene_synonym="rpl28"
                     /product="ribosomal L28e protein family domain-containing
                     protein"
                     /transcript_id="NM_001018520.2"
                     /db_xref="GeneID:2542782"
     CDS             complement(911274..911678)
                     /gene="rpl44"
                     /locus_tag="SPAC1687.06c"
                     /gene_synonym="rpl28"
                     /codon_start=1
                     /product="ribosomal L28e protein family domain-containing
                     protein"
                     /protein_id="NP_593124.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.06c.1"
                     /db_xref="GeneID:2542782"
                     /db_xref="GOA:O14069"
                     /db_xref="InterPro:IPR002672"
                     /db_xref="InterPro:IPR029004"
                     /db_xref="PomBase:SPAC1687.06c"
                     /db_xref="PomBase:SPAC1687.06c.1"
                     /translation="MSVSNDLIWQVIRDNNRFLVKRPEFGGIQFNREPVNVSGKNAQR
                     FSGLCNDKAVGVQANSPRGVVLITKTNPKNAQKPAKLFRKDVIANASSRKTYKSIAGR
                     IGRTGYRDDLVKVSVARASAILSSQRPKKTVA"
     gene            complement(912230..912396)
                     /locus_tag="SPRRNA.12"
                     /db_xref="GeneID:5802863"
     rRNA            complement(912230..912396)
                     /locus_tag="SPRRNA.12"
                     /product="5S ribosomal RNA"
                     /transcript_id="NR_151402.1"
                     /db_xref="GeneID:5802863"
     gene            <913657..>914031
                     /locus_tag="SPAC1687.07"
                     /db_xref="GeneID:2542784"
     mRNA            <913657..>914031
                     /locus_tag="SPAC1687.07"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018521.1"
                     /db_xref="GeneID:2542784"
     CDS             913657..914031
                     /locus_tag="SPAC1687.07"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_593125.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.07"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.07.1"
                     /db_xref="GeneID:2542784"
                     /db_xref="GOA:O14068"
                     /db_xref="InterPro:IPR018559"
                     /db_xref="PomBase:SPAC1687.07"
                     /db_xref="PomBase:SPAC1687.07.1"
                     /translation="MASFHIIVSYVTVVLAIIIAITFAARRFWISRYRSIRYSPVENS
                     FEADFNNGLNSSSFDIAQNILAQDTRAGLDEAATSQIRGLMKQLQCSFDQARLIYIRK
                     VMSDNNVDSTGMPLDNKAVTKL"
     gene            <914328..>914618
                     /locus_tag="SPAC1687.08"
                     /db_xref="GeneID:2542803"
     mRNA            <914328..>914618
                     /locus_tag="SPAC1687.08"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018522.1"
                     /db_xref="GeneID:2542803"
     CDS             914328..914618
                     /locus_tag="SPAC1687.08"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_593126.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.08"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.08.1"
                     /db_xref="GeneID:2542803"
                     /db_xref="GOA:O14067"
                     /db_xref="PomBase:SPAC1687.08"
                     /db_xref="PomBase:SPAC1687.08.1"
                     /translation="MFIFNVLTIRCTFHVLFAICYFCDHLLQYISNSRDSKAGLKIFL
                     VFELAVTIFNTVMLQLANRVKNGLTLAILIVSVVMFVYHQQLIVNCKKMLAL"
     gene            914940..919775
                     /locus_tag="SPAC1687.09"
                     /db_xref="GeneID:2542753"
     mRNA            914940..919775
                     /locus_tag="SPAC1687.09"
                     /product="putative ENTH/VHS domain protein"
                     /transcript_id="NM_001018523.2"
                     /db_xref="GeneID:2542753"
     CDS             915092..919231
                     /locus_tag="SPAC1687.09"
                     /codon_start=1
                     /product="putative ENTH/VHS domain protein"
                     /protein_id="NP_593127.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.09.1"
                     /db_xref="GeneID:2542753"
                     /db_xref="GOA:O14066"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="PomBase:SPAC1687.09"
                     /db_xref="PomBase:SPAC1687.09.1"
                     /translation="MDAIHPVSLRNSKRHPLLHSERNLSRRAVSPSISRSFFQHSNGS
                     FPLFQNHRKSLPSAIYKSVDPYVDANPLDPLAAAKASFADFPEQDDSQSSTSPLSSKY
                     HTKKNKQIFVEDSRRGGAASNAAAIAAKKSGYYERTSTRKRSLTVPTPRTSFPHHPRS
                     RRFSLKNAAIATSYHKFKPLSSNSLSSSGMHFSASKQAFNSPLLQTFSPSPSVSPFSN
                     PAVEKLKTSASKQAAEAQSLREFDFFTPTPEPSDKNLEKLKNGASKQASESQSLKNME
                     SLSLARSSPILTSEKLKNGASKQAIESPPFRASEPLPSSNIIPNPAMERLKNGASKLA
                     IESQPFKSAEPLSSAIPLPNPMSEKMRNGASKQAIMAQSSKINPLPPLTASISDPSFE
                     KLKNTASKQAIESQSLMNSGPELLEPSISDPMLEKMKTDAGKQTVESLSLKSSDATIP
                     KPSVSDLGVEKLKNDASKCAVESQSLMINDPSVSSTSFYNPNMEKLKNGAIKQAIEHQ
                     ALNAAILNKTQLPYFHQSSSELPISASKRAALSQQTESASKSSSNISEMCDSHPPSNF
                     SISASQQASKDRFSEATSSIDLDLSPGRSLSLASSKLSVKEAGARVYNRSVATPVMTP
                     SNPFEISKSASQLASIAQVPVSEPAKTSEVNLKKSLSLASSKLSFQEAGTSLKEKTAN
                     VQHSPEVLNDRSLASLSASRHADAISSKSKQHTEIAQPAFNTTGTVLMKTKSNLSDSA
                     LSTPQHSDSVLFDITSKAARLASTCAKTDLHRKPRRKHKSFTLENYFGHNAEDESPQS
                     DEVESQTPPSGYSENDIGGTDIYPFALQGAALAAAKDFSRREASLSDSQSAASMDMLP
                     MKKKLSHSSASSTRSIKSLLTNANQKHIHSSINETDDIPTMAAHIVATGQKNKEKAPS
                     FSNDQALDHLLGSAHKRIPSNKTEWSSSSLHIPSHNSFSDIHHRKIAAHAAAITAASE
                     KLTPSIEETSYSSSKAHDASLSAATLVANKDKLIHAPTPQVLAPVLPKVSLPHRHSVS
                     LGQIRGESEVEGDVFYDAPSDKEDLGSSNAPLDVPHGANRSSMDEVNGSKYDYSDGIL
                     DGSGQYTDSDMSDDENSLKDSQSSVLSFSAVPTKVLKFKLRDVLGSEYSPSPQLLASS
                     SDVSGSSSAVRAAMKADKIFPAVHENPPPLKTKQSIAKPSPHTLRVPQKKHKHFYHRD
                     DGKYKSGTNLRKSETVDLPQFFIDENRRKLYEGLWAANKGYLLSKSEYSKPNDLICNI
                     VVRELWSRSGAPTSVLAKIYDLVDRHHTGVLGRDEFIVGMFLIDQYLKGRKLPLKVPD
                     SVWLSSKRMGDMLWRLEKLQKKTDNKKPFFKKKKKKRKHLKKFFDFNTTAKVNEGAMT
                     D"
     gene            919726..922098
                     /gene="mcp1"
                     /locus_tag="SPAC1687.10"
                     /db_xref="GeneID:2542755"
     mRNA            join(919726..920716,920769..922098)
                     /gene="mcp1"
                     /locus_tag="SPAC1687.10"
                     /product="protein mcp1"
                     /transcript_id="NM_001018524.2"
                     /db_xref="GeneID:2542755"
     gene            complement(919783..920837)
                     /locus_tag="SPNCRNA.696"
                     /db_xref="GeneID:14218234"
     misc_RNA        complement(919783..920837)
                     /locus_tag="SPNCRNA.696"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151064.1"
                     /db_xref="GeneID:14218234"
     CDS             join(919973..920716,920769..922010)
                     /gene="mcp1"
                     /locus_tag="SPAC1687.10"
                     /codon_start=1
                     /product="protein mcp1"
                     /protein_id="NP_593128.1"
                     /db_xref="GeneID:2542755"
                     /db_xref="GOA:O94452"
                     /db_xref="InterPro:IPR007145"
                     /translation="MELAKIGDRLNNYYNNIYTLSEKLGYSFTKISFNNIILDALSGH
                     QRKLEIKIINIESKCNELSSEISLLRKRLGIIEEIEIPRTLIDQYECLVTYHNGIRAI
                     YNTKKNEAKNMYKEIERLSVILGESVDEVNFVNGDFEDISDIKLEQLSAKLNELHQIY
                     RLRKEKNIEIKEELKKLQDSLSIKLSMPADDLSKNGIKHLIIYKEKLRFSLESRKSRV
                     DEIVNEMKNMCGKNPTSELPTNYSDKTLTLWENELSSMRKVYFVKYKTEYEFLQKRYL
                     SLARIMFVSKKEMLFTSQFKEIPNVNRELIQSMKQEIGNLEVDLHLQGELNNMIRRYL
                     LLESRVYKESQRMKVLSGSASQPFTLKRLQKDFQLLKAKLICALREWEEDNEKKIYVF
                     GKPLSSRLLMIHSPPILQNQENISSNDNSKSSPESSPPARKTTGKIENKKLRNIDVQS
                     KKSIRFPLRLASHEEPLIDRMVNQSPDTRSVSKSKRLVRETSSGCLFKNHSKSNTLSP
                     RRKGSRHGPREPCLSPDASSSSIPVTDIKEILPSQHDTPHNSVKLTGSSTTPASVSLR
                     QMIEPLLSRTPPKGEFTNSLDDTPTQSNVEKVDRFLENHDWETCSESSSASEDQSLCK
                     QLSSFSLSSSDISKKLKNNLNGLHFSSDEGSKLPTFL"
     gene            922271..925133
                     /gene="spb1"
                     /locus_tag="SPAC1687.11"
                     /db_xref="GeneID:2542112"
     mRNA            join(922271..922383,922425..922518,922571..922747,
                     922893..925133)
                     /gene="spb1"
                     /locus_tag="SPAC1687.11"
                     /product="putative rRNA methyltransferase Spb1"
                     /transcript_id="NM_001018525.2"
                     /db_xref="GeneID:2542112"
     CDS             join(922314..922383,922425..922518,922571..922747,
                     922893..924960)
                     /gene="spb1"
                     /locus_tag="SPAC1687.11"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /product="putative rRNA methyltransferase Spb1"
                     /protein_id="NP_593129.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.11"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.11.1"
                     /db_xref="GeneID:2542112"
                     /db_xref="GOA:O42832"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR012920"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR024576"
                     /db_xref="InterPro:IPR028589"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PomBase:SPAC1687.11"
                     /db_xref="PomBase:SPAC1687.11.1"
                     /translation="MGKSQKKTAKGRLDKWYKLAKEQGYRSRAAFKLVQLNQKYSFLE
                     KAKVIIDLCAAPGGWLQVASKTCKPGSLIVGVDLAPIKPIPNCHTFVEDITSDKCRSQ
                     LRGYLKTWKADVVLHDGAPNVGSAWLQDAYGQAQLVLMSMKLACEFLVAGGTFVTKVF
                     RSRDYNNLLWVFKQLFNKVEATKPPSSRNVSAEIFVVCRGYKAPKKLDPRFTDPRTVF
                     EEVQEPVTNVDAKVFHPEKRKRSREGYADDDYTLHKTVLASEFVTANDPIQILGTSAE
                     IVFPKDDEECQRLYNLDVTTEEILLCCSDLQVLGKKEFRDILRWRLKIRDEMGIGKKV
                     EDEQKTVVEEIPEMDEEERLDQELQDLSEAERVKLKRERRKANQRKQREIVRMQMGML
                     APMDIGLEHEAMGEDSLFGLATAEKHGLKELENGTLPVTESVDEEVSTDNEVEYDSDD
                     ERDRLEADLDSMYSDYTKRKAESDVKYRVKKARGDLDDEEWNGIDNGTESDDSQIAET
                     NFATPDKDRLTTSLLDKGSTKDGLSRKARMFFDQDIFDGIEDADADVEIMSMNRAAIK
                     KREAELASQNNDDGSKGDQSEDSNDHIEVVPVASAHDEDDDWNSDSDNDENNVEIVTA
                     EAMTLAQDIASRRKSKADLIDEGYNRWSFQSKEGLPDWFLDEETTVNKPNKPITKEAV
                     LALREKMKALNARPIKKVLEAQGRKKMRTIKRLQRVAKKAEGISESGDMTESEKAKEI
                     SRLVSRATKSKPKAKPTLVVAKGPNKGLKSRPKGVKGKYKMVDSRMKKDLRAQKRLAK
                     KGRR"
     gene            complement(925111..926289)
                     /gene="coq4"
                     /locus_tag="SPAC1687.12c"
                     /db_xref="GeneID:2541625"
     mRNA            complement(join(925111..925446,925503..925857,
                     925962..926066,926122..926289))
                     /gene="coq4"
                     /locus_tag="SPAC1687.12c"
                     /product="putative ubiquinone biosynthesis protein Coq4"
                     /transcript_id="NM_001018526.2"
                     /db_xref="GeneID:2541625"
     CDS             complement(join(925212..925446,925503..925857,
                     925962..926066,926122..926245))
                     /gene="coq4"
                     /locus_tag="SPAC1687.12c"
                     /codon_start=1
                     /product="putative ubiquinone biosynthesis protein Coq4"
                     /protein_id="NP_593130.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.12c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.12c.1"
                     /db_xref="GeneID:2541625"
                     /db_xref="GOA:O94453"
                     /db_xref="InterPro:IPR007715"
                     /db_xref="InterPro:IPR027540"
                     /db_xref="PomBase:SPAC1687.12c"
                     /db_xref="PomBase:SPAC1687.12c.1"
                     /translation="MFYLNAHLEINKVVDVVMSLSKKFLKPSVASNQLRLLFTAAERK
                     VNYPGHVPLSPLQRIFLVAGSAIMGLKAPWRGGDMISVLGDASGQPFFLHRLLNKMLV
                     DKTGREILKDKPRMTSKSLNLPFLRTLPPNTLGKIYVDWIDKEHVGPDTRSPTRFVDD
                     PEEAYVMQRYRESHDFYHAICNMPTNIEGELAIKWLEFVNMGLPVGALSALFGPLRLN
                     CEQASRFRRVYIPWSIRNGLNAKTLINVYWEKELTNDIEDVRRRIRIEAAPPLV"
     gene            complement(926394..927671)
                     /gene="csn5"
                     /locus_tag="SPAC1687.13c"
                     /db_xref="GeneID:2541529"
     mRNA            complement(join(926394..926671,926736..927381,
                     927489..927671))
                     /gene="csn5"
                     /locus_tag="SPAC1687.13c"
                     /product="COP9/signalosome complex subunit Csn5"
                     /transcript_id="NM_001018527.2"
                     /db_xref="GeneID:2541529"
     CDS             complement(join(926501..926671,926736..927381,
                     927489..927571))
                     /gene="csn5"
                     /locus_tag="SPAC1687.13c"
                     /codon_start=1
                     /product="COP9/signalosome complex subunit Csn5"
                     /protein_id="NP_593131.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.13c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.13c.1"
                     /db_xref="GeneID:2541529"
                     /db_xref="GOA:O94454"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="PomBase:SPAC1687.13c"
                     /db_xref="PomBase:SPAC1687.13c.1"
                     /translation="MNNQLENVFRFDEEKERAKIRESPWKHDPEFFRSVKISAVALLK
                     MLRHVSQGMPLEVMGYVQGKVEGASLIILDSFALPVEGTETRVNAHEEAQEYSVQYHT
                     LCKSVYRHENVIGWYHSHPNYGCWLSGVDVETQRQNQKYQDPFVAVVLDPKRSLESPY
                     VNIGAFRTYPVGNDGSIRTKSRHHPSVLFKNLPSSKIEDAGAHAEAYYSLPITYFHSK
                     AEKKVTEFLRNRNWSRSITECSILQNNEFLHDSEKLIDHLIHETGNNELPVASAYEQS
                     KACCNELSTFLSQIDVQDKLFKE"
     gene            complement(927801..929011)
                     /locus_tag="SPAC1687.14c"
                     /db_xref="GeneID:2542111"
     mRNA            complement(927801..929011)
                     /locus_tag="SPAC1687.14c"
                     /product="calcium-binding protein"
                     /transcript_id="NM_001018528.2"
                     /db_xref="GeneID:2542111"
     CDS             complement(928213..928443)
                     /locus_tag="SPAC1687.14c"
                     /codon_start=1
                     /product="calcium-binding protein"
                     /protein_id="NP_593132.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.14c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.14c.1"
                     /db_xref="GeneID:2542111"
                     /db_xref="GOA:O94455"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="PomBase:SPAC1687.14c"
                     /db_xref="PomBase:SPAC1687.14c.1"
                     /translation="MSVSTKRLEMDEEAEEAFDLFDVTHKGYIDFEDLRRSCAQLGEN
                     LTKEQLQLMLDLAGTNGKVSREEFAELWIHIS"
     gene            complement(929156..929654)
                     /locus_tag="SPAC1687.23c"
                     /db_xref="GeneID:2542302"
     mRNA            complement(929156..929654)
                     /locus_tag="SPAC1687.23c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018529.2"
                     /db_xref="GeneID:2542302"
     CDS             complement(929159..929473)
                     /locus_tag="SPAC1687.23c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_593133.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.23c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.23c.1"
                     /db_xref="GeneID:2542302"
                     /db_xref="GOA:Q9C118"
                     /db_xref="PomBase:SPAC1687.23c"
                     /db_xref="PomBase:SPAC1687.23c.1"
                     /translation="MWILEKKNIFFKIIHIKSSRKFDFSNAIRIVLLPFSSNCCRNSY
                     TVNNGTFTGRQIYTSICKSRIPPCLKGKNGKTTKSESEPMSQKHLKYVKKYINKVRIL
                     KK"
     gene            929843..932197
                     /gene="gsk3"
                     /locus_tag="SPAC1687.15"
                     /gene_synonym="skp1"
                     /db_xref="GeneID:2542652"
     mRNA            join(929843..929957,930006..930196,930678..932197)
                     /gene="gsk3"
                     /locus_tag="SPAC1687.15"
                     /gene_synonym="skp1"
                     /product="serine/threonine protein kinase Gsk3"
                     /transcript_id="NM_001018530.2"
                     /db_xref="GeneID:2542652"
     CDS             join(929939..929957,930006..930196,930678..931631)
                     /gene="gsk3"
                     /locus_tag="SPAC1687.15"
                     /gene_synonym="skp1"
                     /codon_start=1
                     /product="serine/threonine protein kinase Gsk3"
                     /protein_id="NP_593134.1"
                     /db_xref="GeneID:2542652"
                     /db_xref="GOA:Q10452"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /translation="MNHGTKIPVDPFRIIKETARDGSTGEVKQLSYTSSKVVGSGSFG
                     VVMQVHLIESDSKAAIKRVLQDKRFKNRELQIMRIMKHPNIVDLIAYYYTTGDNSDEV
                     YLNLVLEFMPETIYRASRLYTRQKLSMPMLEVKLYIYQLLRSLAYIHASGICHRDIKP
                     QNLLLDPENGILKLCDFGSAKILVAGEPNVSYICSRYYRAPELIFGATDYTHAIDIWS
                     TGCVMAELMLGHPLFPGESGIDQLVEIIKILGTPSREQIKTMNPNYMEHRFPQIRPQP
                     LSRVFSRSVPLDALDLLSKMLQYTPTDRLTAAEAMCHPFFDELRDPNTKLHNSRNPDA
                     SPRHLPELFNFSPFELSIRPDLNQKLIPSHARDALPVKLDDFVPIPIHRARID"
     gene            complement(932425..934021)
                     /gene="erg31"
                     /locus_tag="SPAC1687.16c"
                     /gene_synonym="erg3"
                     /db_xref="GeneID:2542109"
     mRNA            complement(932425..934021)
                     /gene="erg31"
                     /locus_tag="SPAC1687.16c"
                     /gene_synonym="erg3"
                     /product="C-5 sterol desaturase Erg31"
                     /transcript_id="NM_001018531.2"
                     /db_xref="GeneID:2542109"
     CDS             complement(933052..933954)
                     /gene="erg31"
                     /locus_tag="SPAC1687.16c"
                     /gene_synonym="erg3"
                     /EC_number="1.14.19.20"
                     /codon_start=1
                     /product="C-5 sterol desaturase Erg31"
                     /protein_id="NP_593135.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.16c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.16c.1"
                     /db_xref="GeneID:2542109"
                     /db_xref="GOA:O94457"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="PomBase:SPAC1687.16c"
                     /db_xref="PomBase:SPAC1687.16c.1"
                     /translation="MDYLLNYADQYALDSIYNAVYPLARDNIVRQSISLFFLTWFGGM
                     FLYLTFASLSYQFVFDKSLMDHPKFLKNQVFMEVLTALQNLPGMALLTVPWFLAELHG
                     YSYLYDNISDYGLKYFLCSLPLFVMFSDFGIYWAHRFLHHRYVYPRLHKLHHKWIICT
                     PYASHAFKSADGFLQSLPYHLFPFFFPLHKLTYLALFTFVNFWSIMIHDGKYISNNPI
                     INGAAHHNGHHIYFNYNYGQFTTLFDRLGNSFRAPDEAWFDKDLRQNEDVLRVELMEY
                     EAIRNEVEGDDDREYIANSAKKNH"
     gene            934056..934503
                     /locus_tag="SPNCRNA.160"
                     /db_xref="GeneID:9407135"
     misc_RNA        934056..934503
                     /locus_tag="SPNCRNA.160"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150494.1"
                     /db_xref="GeneID:9407135"
     gene            complement(934665..934738)
                     /locus_tag="SPATRNAALA.01"
                     /db_xref="GeneID:3361376"
     tRNA            complement(934665..934738)
                     /locus_tag="SPATRNAALA.01"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:3361376"
     gene            complement(934941..936081)
                     /locus_tag="SPAC1687.17c"
                     /db_xref="GeneID:2542379"
     mRNA            complement(join(934941..935668,935747..935812,
                     935860..935899,935943..936081))
                     /locus_tag="SPAC1687.17c"
                     /product="putative Der1 family protein"
                     /transcript_id="NM_001018532.2"
                     /db_xref="GeneID:2542379"
     CDS             complement(join(935249..935668,935747..935812,
                     935860..935899,935943..935989))
                     /locus_tag="SPAC1687.17c"
                     /codon_start=1
                     /product="putative Der1 family protein"
                     /protein_id="NP_593136.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.17c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.17c.1"
                     /db_xref="GeneID:2542379"
                     /db_xref="GOA:O94458"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="PomBase:SPAC1687.17c"
                     /db_xref="PomBase:SPAC1687.17c.1"
                     /translation="MAILPEFISQTPPVTRYIVLGTLFTTLAVNFGYVSDLKIFFNWK
                     LFLAKGEYWRAITTFLYVGPFGLELILYLSFLLRFMSMLERSSPPPQTQSFLKTVLIV
                     WFSLLVTSYFSYMPFAASYFSFTMLYIWSWKHPLYRISILGLFDVKAPYVPWVMVLLR
                     WLRTGIFPLLDLISALIGHVYFFVTDFSTV"
     gene            complement(936188..938157)
                     /gene="ssl3"
                     /locus_tag="SPAC1687.18c"
                     /db_xref="GeneID:2542301"
     mRNA            complement(join(936188..936371,936453..937719,
                     937760..937891,937928..938157))
                     /gene="ssl3"
                     /locus_tag="SPAC1687.18c"
                     /product="cohesin loading factor Ssl3"
                     /transcript_id="NM_001018533.2"
                     /db_xref="GeneID:2542301"
     CDS             complement(join(936271..936371,936453..937719,
                     937760..937891,937928..938107))
                     /gene="ssl3"
                     /locus_tag="SPAC1687.18c"
                     /codon_start=1
                     /product="cohesin loading factor Ssl3"
                     /protein_id="NP_593137.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.18c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.18c.1"
                     /db_xref="GeneID:2542301"
                     /db_xref="GOA:O94459"
                     /db_xref="InterPro:IPR019440"
                     /db_xref="PomBase:SPAC1687.18c"
                     /db_xref="PomBase:SPAC1687.18c.1"
                     /translation="MTGLNETDARILVTSRHLFLWPLAETYFKNAEKVLQDCGVCDSF
                     GRLLSTGLQCLYSVLMDTKMEPRVELLTRKRICEVLLSHTVEYADVEAILNRALIIAE
                     QHNLTEYKFSLQLLLSRVFCRTSPKAAKVLLTRCVREAEEYAKVAEIYHSNNQSNPHR
                     WVYEFLLATLEFQNVSQVANSIHNYANHHKHQHLQLLAMILNQSLPMDEISTDSDQIS
                     ILCLVTQIAQCLRKGEILLAREILPKIHSKLESETFVWPSSYIDFFIDDTSKISIKWM
                     SINQLYLLIYLISGFCYISDSTSGRASRFLQEGLRITGDFKHQERCVLEYLESQKWIN
                     NITKDMKYYLIATYLSRSRLSKAERILQSTEDDQTGFLGILKGMYLQKRGDLKKAEVH
                     YRETAKNFSFRTDTFIISTLNLINILEDSAAASRCLESIEPLCNKHEKKIFKLWLLVL
                     KVIREGPQVHQSNVLPRVIQQSSEYANTQLQYISLTELSERFGKLEHAEKMAISALEL
                     AKKSKDELWCLISGRILEDFYRSVQKYDKMRQQALENSAYSKLIEDIYSFV"
     gene            complement(938311..939831)
                     /locus_tag="SPAC1687.19c"
                     /db_xref="GeneID:2542133"
     mRNA            complement(join(938311..938958,939002..939575,
                     939630..939831))
                     /locus_tag="SPAC1687.19c"
                     /product="putative queuine tRNA-ribosyltransferase"
                     /transcript_id="NM_001018534.2"
                     /db_xref="GeneID:2542133"
     gene            938390..939912
                     /locus_tag="SPNCRNA.697"
                     /db_xref="GeneID:14217882"
     misc_RNA        938390..939912
                     /locus_tag="SPNCRNA.697"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151065.1"
                     /db_xref="GeneID:14217882"
     CDS             complement(join(938448..938958,939002..939575,
                     939630..939759))
                     /locus_tag="SPAC1687.19c"
                     /EC_number="2.4.2.29"
                     /codon_start=1
                     /product="putative queuine tRNA-ribosyltransferase"
                     /protein_id="NP_593138.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.19c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.19c.1"
                     /db_xref="GeneID:2542133"
                     /db_xref="GOA:O94460"
                     /db_xref="InterPro:IPR002616"
                     /db_xref="InterPro:IPR004803"
                     /db_xref="PomBase:SPAC1687.19c"
                     /db_xref="PomBase:SPAC1687.19c.1"
                     /translation="MASSFPALQFKVVARCSTTRARVTDIQLPHGLVESPVFMPVGTQ
                     ASLKGVLPEQLDALGCKIMLNNTYHLGLKPGQEVLDTVGGAHRFQSWNKNILTDSGGF
                     QMVSLLKLATITEDGVTFLSPRDGTPMLLTPEHSISLQNSIGSDIMMQLDDVVHTLTE
                     SKRMEEAMYRSIRWLDRCIQAHKRPETQNLFCIIQGGLDKRLREICCREMVKRNTPGI
                     AVGGLSGGEEKHAFCETVYTCTSILPDNKPRYLMGVGYAEDLVVCVALGMDMFDCVYP
                     TRTARFGNALTRKGVINLRNQKFRNDIGPLEEGCSCPCCKTELEGGWGITRAYFNSLV
                     SKETVGANLMTIHNVHFQLQLMRDMRESIIKDEFPSFVKNFFHEWNHGDKSNYPSWAV
                     DALRMVNIDLLA"
     gene            complement(939770..941944)
                     /gene="mis6"
                     /locus_tag="SPAC1687.20c"
                     /db_xref="GeneID:2542304"
     mRNA            complement(939770..941944)
                     /gene="mis6"
                     /locus_tag="SPAC1687.20c"
                     /product="centromere connector protein mis6"
                     /transcript_id="NM_001018535.2"
                     /db_xref="GeneID:2542304"
     CDS             complement(939871..941889)
                     /gene="mis6"
                     /locus_tag="SPAC1687.20c"
                     /codon_start=1
                     /product="centromere connector protein mis6"
                     /protein_id="NP_593139.1"
                     /db_xref="GeneID:2542304"
                     /db_xref="GOA:P87227"
                     /db_xref="InterPro:IPR012485"
                     /translation="MESFENKGFLDIEEGIQWIKKNSENLSSSKKTILARLQQFHKLC
                     SEVGLNQHSISSLLDVILSKKTHFDKNHVQLLIKCLYPNELISQTIAIRIISSLDPHG
                     LRCSYAIQAKLLNWLIHVYEFLDGNNLLCRYYGVLFHFLDFLTLRPYISNLLVLLTKH
                     YHVKSFRIHQLLALYQKPGNTADPYLLALILTYKQHFPDVIVGSYTYRKHGSVRLDSE
                     WIAATKAILNRQSEDVPLETWSSEKRKRQSSLIPDLITMKNTSSSYSLEELTSVQQMG
                     LVYEKIVFPSRIAAVLKSKLFLIFLFLKNKNVYYSRLDEWLHITLNYGLALRSGSNNQ
                     EEEVLHLLYKYLLFSPKFPKSLLQYVITFFSKPNITEENYNLLTLLVTHIPITTDSSY
                     FNSLLKEFEQFILQKNAEFCSKHLNILWLWLFRMLNLRIASMGNNHTLLEKCLLITNH
                     ATFLVSHFSWDVSLAYQLSRLFQLYYKILTKIRKQIEPNIPPKELIYVLFFQPSAFYI
                     NSMVGLLLLTKNYQERLMDSRIDAISKFTHSYLKSLSEIILLKEKRAILSFLQLWEPF
                     KSDYSQFLPIATRIANDHPYAQRVFSLTCAPQFFSYINGYQIYLQQTNPATGSIPLKP
                     IQEETFGAFQSNLHLSDSWEDFQKNFIIYLKKKGYLAISDFLLSTLNR"
     gene            941942..943335
                     /locus_tag="SPAC1687.21"
                     /db_xref="GeneID:2542303"
     mRNA            join(941942..941989,942215..942296,942451..942573,
                     942615..942680,942727..942748,942805..943335)
                     /locus_tag="SPAC1687.21"
                     /product="putative phosphoglycerate mutase family protein"
                     /transcript_id="NM_001355993.1"
                     /db_xref="GeneID:2542303"
     CDS             join(942240..942296,942451..942573,942615..942680,
                     942727..942748,942805..943166)
                     /locus_tag="SPAC1687.21"
                     /EC_number="5.4.2.1"
                     /codon_start=1
                     /product="putative phosphoglycerate mutase family protein"
                     /protein_id="NP_001342788.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.21"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.21.1"
                     /db_xref="GeneID:2542303"
                     /db_xref="GOA:O94461"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="PomBase:SPAC1687.21"
                     /db_xref="PomBase:SPAC1687.21.1"
                     /translation="MKVFLIRHGQTDQNKRGILQGSVDTNLNETGRLQAKLLAQRLLP
                     LDIDQIFCSSMKRCRETIAPYLELKPEVPIVYTDLIRERVYGDLEGMNVVEAKKLLNA
                     NHPDHYGEGLSHLTSRLLKFWDEYVVPLQGKKKCVIVLCHGGVINVLRTHFMEEKGFT
                     FDKSKLESKIITFNTSITEIEVTEHGTGHIHTFGDASHLESEETGKLIA"
     gene            complement(943265..946909)
                     /gene="puf3"
                     /locus_tag="SPAC1687.22c"
                     /gene_synonym="SPAC222.02c"
                     /db_xref="GeneID:2542300"
     mRNA            complement(join(943265..943692,943741..943904,
                     943961..946909))
                     /gene="puf3"
                     /locus_tag="SPAC1687.22c"
                     /gene_synonym="SPAC222.02c"
                     /product="putative RNA-binding protein Puf3"
                     /transcript_id="NM_001018537.3"
                     /db_xref="GeneID:2542300"
     CDS             complement(join(943625..943692,943741..943904,
                     943961..945927))
                     /gene="puf3"
                     /locus_tag="SPAC1687.22c"
                     /gene_synonym="SPAC222.02c"
                     /codon_start=1
                     /product="putative RNA-binding protein Puf3"
                     /protein_id="NP_593141.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC1687.22c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1687.22c.1"
                     /db_xref="GeneID:2542300"
                     /db_xref="GOA:O94462"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PomBase:SPAC1687.22c"
                     /db_xref="PomBase:SPAC1687.22c.1"
                     /translation="MFTAVNSNPNASESISGNSAFNFPSAPVSSLDTNNYGQRRPSLL
                     SGTSPTSSFFNSSMISSNYTFPHGSNKQASLESPVSYSNPIPSLTWLSLDGDSPDSLV
                     STPTAPSANHHGNPFPNGKQSIKAMPSLVNLQEDSVISKFPNSLEVPFRKRSESTSSS
                     LSGLHSDLRPLKTELYGQLNSECGARFPQTLKSPLTPIGGDSARTVSASTARTSDKFF
                     PRHTRAHSDFWIPATSKPSRHASHSSIGDLTTITQSSISSGSGSFKPSWDGSFDSSLM
                     AHQSYGTSPAFANGNSPTLKNDSSFFGSASVRPTVSPIGTSFRQSLPDISAFGIPKTE
                     TNPSEVVAPGTIPISVLPTSNFSAATPANPSLINQNGQEFLQQSRVLYLFHANKQRHF
                     ELSDILGNVVLFSTDQHGSRFIQQKLATATEEEREAVFQEIASTSCLQLMMDIFGNYV
                     VQKYFEFGNEKQKQILLSQIKGHVFSLSLQMYGCRVVQKAIEYISPEHQVQLIQELDG
                     HVLDCVCDQNGNHVIQKAIECIDTGHLQFILRALRPQIHVLSAHPYGCRVIQRAIEHC
                     HSERKLIIEELLPHILKLTQDQYGNYVVQHILRTGSESDKKYIFDLMIDHLLFLSCHK
                     FASNVVERCISYISDVDRRRILNKIISEKAENCSILMLMMKDKYANYVIQKLLDASPE
                     EERDLLISYIYPHISVLKKFTYGKHLIMSVERFRQKSISAVPKLASKECK"
     gene            complement(946892..947942)
                     /locus_tag="SPNCRNA.698"
                     /db_xref="GeneID:14218298"
     misc_RNA        complement(946892..947942)
                     /locus_tag="SPNCRNA.698"
                     /product="intergenic RNA (predicted), possible alternative
                     UTR"
                     /transcript_id="NR_151066.1"
                     /db_xref="GeneID:14218298"
     gene            complement(947876..948800)
                     /gene="tim10"
                     /locus_tag="SPAC222.03c"
                     /db_xref="GeneID:2541950"
     mRNA            complement(join(947876..948132,948481..948800))
                     /gene="tim10"
                     /locus_tag="SPAC222.03c"
                     /product="putative Tim9-Tim10 complex subunit Tim10"
                     /transcript_id="NM_001018539.2"
                     /db_xref="GeneID:2541950"
     CDS             complement(join(947964..948132,948481..948581))
                     /gene="tim10"
                     /locus_tag="SPAC222.03c"
                     /codon_start=1
                     /product="putative Tim9-Tim10 complex subunit Tim10"
                     /protein_id="NP_593142.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.03c.1"
                     /db_xref="GeneID:2541950"
                     /db_xref="GOA:Q9UTE9"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="InterPro:IPR027100"
                     /db_xref="InterPro:IPR027247"
                     /db_xref="PomBase:SPAC222.03c"
                     /db_xref="PomBase:SPAC222.03c.1"
                     /translation="MSMFGIGKNNQTINPQNIAMAEQEVEMMSDIFNRLVMTCHKKCI
                     SPKYYEADLTKGESVCIDRCVSKYFEANQSLSQHMQKRGQENPTP"
     gene            948715..949365
                     /locus_tag="SPNCRNA.699"
                     /db_xref="GeneID:14218363"
     misc_RNA        948715..949365
                     /locus_tag="SPNCRNA.699"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151067.1"
                     /db_xref="GeneID:14218363"
     gene            <949646..>950047
                     /gene="tam1"
                     /locus_tag="SPAC222.19"
                     /db_xref="GeneID:14218092"
     mRNA            join(<949646..949680,949729..>950047)
                     /gene="tam1"
                     /locus_tag="SPAC222.19"
                     /product="protein tam1"
                     /transcript_id="NM_001355994.1"
                     /db_xref="GeneID:14218092"
     CDS             join(949646..949680,949729..950047)
                     /gene="tam1"
                     /locus_tag="SPAC222.19"
                     /codon_start=1
                     /product="protein tam1"
                     /protein_id="NP_001343100.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.19"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.19.1"
                     /db_xref="GeneID:14218092"
                     /db_xref="GOA:G2TRJ4"
                     /db_xref="PomBase:SPAC222.19"
                     /db_xref="PomBase:SPAC222.19.1"
                     /translation="MSVSQQLSELASKEKTVLYVADQNLEEVLCFPESTDRTTLVQLT
                     DACLHANELAKHLEFGKPLSITNQYSRGSCVLQIAKEKKDGSGMVVSTTIAAHNALRG
                     ALKCSNALDQVISQL"
     gene            complement(950120..950813)
                     /gene="ies6"
                     /locus_tag="SPAC222.04c"
                     /db_xref="GeneID:2541949"
     mRNA            complement(950120..950813)
                     /gene="ies6"
                     /locus_tag="SPAC222.04c"
                     /product="Ino80 complex subunit Ies6"
                     /transcript_id="NM_001018540.2"
                     /db_xref="GeneID:2541949"
     CDS             complement(950298..950651)
                     /gene="ies6"
                     /locus_tag="SPAC222.04c"
                     /codon_start=1
                     /product="Ino80 complex subunit Ies6"
                     /protein_id="NP_593143.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.04c.1"
                     /db_xref="GeneID:2541949"
                     /db_xref="GOA:Q9UTE8"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="InterPro:IPR029525"
                     /db_xref="PomBase:SPAC222.04c"
                     /db_xref="PomBase:SPAC222.04c.1"
                     /translation="MEKNSSVDSLDISLLARPFRNPNYKAQPRRNRNLRQIIQNDPVQ
                     NEPSKFSYSSIEAPPSVLPQPKYCDVTGLLAIYTDPKTRLRYHNKEIYGLIRELPSGA
                     DQEYLKLRSSDVVLK"
     gene            complement(950912..953006)
                     /gene="mss1"
                     /locus_tag="SPAC222.05c"
                     /db_xref="GeneID:2541951"
     mRNA            complement(join(950912..952394,952454..953006))
                     /gene="mss1"
                     /locus_tag="SPAC222.05c"
                     /product="putative GTPase mss1"
                     /transcript_id="NM_001018541.2"
                     /db_xref="GeneID:2541951"
     gene            951028..952560
                     /locus_tag="SPNCRNA.700"
                     /db_xref="GeneID:14218253"
     misc_RNA        951028..952560
                     /locus_tag="SPNCRNA.700"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151069.1"
                     /db_xref="GeneID:14218253"
     CDS             complement(join(951054..952394,952454..952603))
                     /gene="mss1"
                     /locus_tag="SPAC222.05c"
                     /codon_start=1
                     /product="putative GTPase mss1"
                     /protein_id="NP_593144.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.05c.1"
                     /db_xref="GeneID:2541951"
                     /db_xref="GOA:Q9UTE7"
                     /db_xref="InterPro:IPR004520"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR018948"
                     /db_xref="InterPro:IPR025867"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR027368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC222.05c"
                     /db_xref="PomBase:SPAC222.05c.1"
                     /translation="MRILNRVFLNTFQACFRRFVHQIPTIYALSTPPGTSAVAIVRIS
                     GPNACKVAKTLAGSVPKPRIASLRTIKHPVRSEVIDKALMLYFKKPSSFTGEDVVELQ
                     LHGGTAVVDVTLEAIKQSGIPNIRYAKPGEFSERAFYNGRADLTQLEGLIDVINAQTA
                     EQLYSANKEAHGSIYDICFRWRKKLIEYRAFLEASIDFSEEHELDDIETIKLFEELNE
                     MKDEIDAHIEGGKCKEVLRKGINVAILGPSNAGKSSLINLLANRRISIVSPQSGTTRD
                     AIEVLVDINGFPVLLSDTAGLRKGEDVQEIEKIGIEIAKARAEESQLTLFVFPINYHS
                     FSESLKQSEILETIKDCLRQRKPIHFLINKVDCVSDYTTMFKPIKAYLQKNFLIPENR
                     IHAVSCKTKEGLIDFLQALSSTFECMVNPLTNNKIQANLGWNERQRQCLSSCSSHLSL
                     ALQKSSDIVVAAEEVKLATEDIGRVTGAVDMENVFSVIFSKFCVGK"
     gene            953095..954325
                     /gene="mak16"
                     /locus_tag="SPAC222.06"
                     /db_xref="GeneID:2541944"
     mRNA            join(953095..953174,953228..954325)
                     /gene="mak16"
                     /locus_tag="SPAC222.06"
                     /product="putative nuclear HMG-like acidic protein Mak16"
                     /transcript_id="NM_001018542.2"
                     /db_xref="GeneID:2541944"
     CDS             join(953113..953174,953228..954074)
                     /gene="mak16"
                     /locus_tag="SPAC222.06"
                     /codon_start=1
                     /product="putative nuclear HMG-like acidic protein Mak16"
                     /protein_id="NP_593145.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.06.1"
                     /db_xref="GeneID:2541944"
                     /db_xref="GOA:Q9UTE6"
                     /db_xref="InterPro:IPR006958"
                     /db_xref="InterPro:IPR029004"
                     /db_xref="PomBase:SPAC222.06"
                     /db_xref="PomBase:SPAC222.06.1"
                     /translation="MQQDEVIWQVVGHEFCSYRIKGEAQNFCRNEYNVTGLCNRQSCP
                     LANSRYATVREDNGKLYLYMKTIERAHFPSKLWQRIKLSKNYAKALEQIDQQLLYWPG
                     RQIHRCKQRLTRLTQYLLKARRLALKHQPALIPIKPKQAHREASRERKALIAAKLEKN
                     IEKELVKRLKSGVYGDQPLNVNEEIWNKVLAAREGLIDEGEEEEEREEAELEFVSDDE
                     DEEEISDLEDWLGSDQSMETSESEEEESSESESDEDEDEDNKGKIRKRKTDDAKKSRK
                     KRAPHIHIEYEQERENEKIPAVQHSW"
     gene            complement(954279..956707)
                     /gene="hri2"
                     /locus_tag="SPAC222.07c"
                     /db_xref="GeneID:2541943"
     mRNA            complement(join(954279..955585,955650..956184,
                     956234..956272,956360..956707))
                     /gene="hri2"
                     /locus_tag="SPAC222.07c"
                     /product="eIF2 alpha kinase Hri2"
                     /transcript_id="NM_001018543.2"
                     /db_xref="GeneID:2541943"
     CDS             complement(join(954355..955585,955650..956184,
                     956234..956272,956360..956474))
                     /gene="hri2"
                     /locus_tag="SPAC222.07c"
                     /codon_start=1
                     /product="eIF2 alpha kinase Hri2"
                     /protein_id="NP_593146.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.07c.1"
                     /db_xref="GeneID:2541943"
                     /db_xref="GOA:Q9UTE5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PomBase:SPAC222.07c"
                     /db_xref="PomBase:SPAC222.07c.1"
                     /translation="MRFFNAHKSAEDGNYSETTNAISLKNERQSRDLSVNKHGRMLLT
                     ALLENFCQLYDNNPAKSKRLFALICHTLQKIGILEEEYIEELAAVRSNYQDALHHLIL
                     QAREAIRLDDAEERLLALPDPTNVFEKFPQETALSKFSVDGLNVRQFRFRDLTLESWL
                     QSRNSRYIEDFEEYSLLGRGGFGSVYHVRNKIDGAEYAMKKINSTFQQMSYSKIFREI
                     KCLAKMDHPNVIRYFSSWVESTTEATQMPIVMSKNSSRVLGTSSYCDVNGMDSIIFEP
                     TESSALTDDILFAEDPGTESIISTSRKSSYSSTTESSNFENLESPRNLHDSNVSTFNN
                     TTILDDDYSSSMHISKTGPTHSFIIYIQMQLCFDDLESYLIRRNHFLSFPLCKEQIQL
                     HTDLFRMIINGVMYVHEGVNLIHRDIKPSNIFLAKSLPEDRGSVPLISYNDKNDLKEY
                     ITPKIGDFGLVVENKKNTETALSFLERNHLPNLQDETQHIGTATYAAPELLDAMSSQH
                     NKFTKKIDTFSLGMVLFELLHPFQTNMERATKLQDLRRGNLPEEFVEQHICESSLILW
                     MTAKDPTKRPSLLEVLNCGLLLPNQVSMPNISNIVSTNHLDVETQMKLIMDENQRLRE
                     QIAVLRSRIQHLETR"
     gene            957183..957254
                     /locus_tag="SPATRNAGLU.02"
                     /db_xref="GeneID:3361501"
     tRNA            957183..957254
                     /locus_tag="SPATRNAGLU.02"
                     /product="tRNA-Glu"
                     /note="tRNA Glutamic acid"
                     /db_xref="GeneID:3361501"
     gene            complement(957367..958774)
                     /locus_tag="SPAC222.08c"
                     /db_xref="GeneID:2541464"
     mRNA            complement(957367..958774)
                     /locus_tag="SPAC222.08c"
                     /product="glutamine aminotransferase subunit"
                     /transcript_id="NM_001018544.2"
                     /db_xref="GeneID:2541464"
     CDS             complement(957646..958350)
                     /locus_tag="SPAC222.08c"
                     /codon_start=1
                     /product="glutamine aminotransferase subunit"
                     /protein_id="NP_593147.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.08c.1"
                     /db_xref="GeneID:2541464"
                     /db_xref="GOA:Q9UTE4"
                     /db_xref="InterPro:IPR002161"
                     /db_xref="InterPro:IPR021196"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="PomBase:SPAC222.08c"
                     /db_xref="PomBase:SPAC222.08c.1"
                     /translation="MSSASMFGSLKTNAVDESQLKARIGVLALQGAFIEHINIMNSID
                     GVISFPVKTAKDCENIDGLIIPGGESTTIGKLINIDEKLRDRLEHLVDQGLPIWGTCA
                     GMILLSKKSRGGKFPDPYLLRAMDIEVTRNYFGPQTMSFTTDITVTESMQFEATEPLH
                     SFSATFIRAPVASTILSDDINVLATIVHEGNKEIVAVEQGPFLGTSFHPELTADNRWH
                     EWWVKERVLPLKEKKD"
     gene            959867..962227
                     /gene="seb1"
                     /locus_tag="SPAC222.09"
                     /db_xref="GeneID:2541942"
     mRNA            join(959867..960417,960608..962227)
                     /gene="seb1"
                     /locus_tag="SPAC222.09"
                     /product="RNA-binding protein Seb1"
                     /transcript_id="NM_001018545.2"
                     /db_xref="GeneID:2541942"
     CDS             join(960061..960417,960608..962113)
                     /gene="seb1"
                     /locus_tag="SPAC222.09"
                     /codon_start=1
                     /product="RNA-binding protein Seb1"
                     /protein_id="NP_593148.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.09.1"
                     /db_xref="GeneID:2541942"
                     /db_xref="GOA:Q9UTE3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="PomBase:SPAC222.09"
                     /db_xref="PomBase:SPAC222.09.1"
                     /translation="MSGIAEFDGILDSLEHSKTGISGSKILKLTNLSMENVSENAQFV
                     ASVYKYAKRAPVTHKLGALYILDSIVRSFQDGAKKNNESFENPVDASFSGGWCKAAEI
                     TDSLVADAIQHAPSAHLPKILKLCDIWEKASTFPPEKLESLRSKLKDAMASTEPVSVD
                     SAAAPSQSTNPEGNGGSVGSQAAAPTSRPVENDAASILEALAAFAQKAPVPSAAEESV
                     STPPQPAVAPSVSAVVPNLPVHPATAINAQSQSGNPLSNPLFQPSNVPQSIPSGPMGM
                     KTGSVNDTQSQQITLMNVLASQNVPPAQIDSIMKAAFPNYNAPFQPAGVGSVPLPAPT
                     SSQSLRLGSLHRSRSPSPRSGRPRRSPSPSHLSIPSTLPPADGVPKPTPDGFPRRFER
                     DPTIPPDSIKVYSRTLFLGGITRSVREPVLRSMFERFGSVQSLILNHNYRHGFLKMFR
                     RDAAEKAQVAMENVPFADTTIRTKWGVGFGPRECSDFSTGISVIPIRLLTDADRTWLV
                     TAEYGGTGGLPITPGIALDEPDIEIGLGISSKAISKRGKDFAMRRDERFRGRKPYRGG
                     PPIHHGERHFDSGNDWHGNPSTVPPPTNPYNPGYPYMDPNYSSGYVSQPPWQPQ"
     gene            complement(962314..964867)
                     /gene="byr4"
                     /locus_tag="SPAC222.10c"
                     /db_xref="GeneID:2541936"
     mRNA            complement(962314..964867)
                     /gene="byr4"
                     /locus_tag="SPAC222.10c"
                     /product="two-component GAP Byr4"
                     /transcript_id="NM_001018546.2"
                     /db_xref="GeneID:2541936"
     CDS             complement(962437..964434)
                     /gene="byr4"
                     /locus_tag="SPAC222.10c"
                     /codon_start=1
                     /product="two-component GAP Byr4"
                     /protein_id="NP_593149.1"
                     /db_xref="GeneID:2541936"
                     /db_xref="GOA:Q10951"
                     /translation="MTEVECWDDDPDFASDVDNASLFTQSIATTSASTSVDDGFSFDD
                     SISRLNSLSISDVPSAHSRVEQWNQQVHNLNHELSSNKNRISSNVEGYEDDFSFDEEG
                     EEGNNEFNTLRPNKYQDADVDEFNTIRASETASQRPPIPFSSDTLKKTYLSSENDARY
                     PSVSDSPYCESEGFSSFEDDFEIDPDTDLNSILHRKQNRMDPKASFSSVEQSSLRTPS
                     SAHNDDGFWDDFDIDFNNETESIFRKKIRSPNTINQKHPYISSTISYQPNVHQDAKYY
                     PLCKDIFPSLANENPHSDNPNLKYSSKTLSKRDTSSHYPETLKASSKHSSPVKGNSSI
                     SSTWTPSNLKIYHSKNSMGLMDLDALKTVASNSKYRTKPKNCKTYGDGTELDTLDELP
                     VDYEFELKLRKKQTTKVSGTPKSKHAGSTQEWHSHTTPRSTSKHENNLNNITNSAKNE
                     HIRSQRQHKTHAAPSKELTKESLSNDQLSVKEKRRHHKKAPTLIQNLNSPRTPKIVGK
                     MRYNPTKHCWEGNDYAIRDFDTPISPSRPALISNISTKKGIQVVGNMVYDPTRLRWID
                     NSISGQEAEDPFSGFDDLEDTDSTSQYLNENSGSFNGSINSIINFPDMSEIYDVGPEF
                     EKKQFSEDIQWRKRIDGWFFSFKNDDRSRLWELYNILNAEQ"
     gene            966164..967591
                     /gene="hem13"
                     /locus_tag="SPAC222.11"
                     /db_xref="GeneID:2541934"
     mRNA            966164..967591
                     /gene="hem13"
                     /locus_tag="SPAC222.11"
                     /product="putative coproporphyrinogen III oxidase"
                     /transcript_id="NM_001018547.2"
                     /db_xref="GeneID:2541934"
     CDS             966430..967368
                     /gene="hem13"
                     /locus_tag="SPAC222.11"
                     /EC_number="1.3.3.3"
                     /codon_start=1
                     /product="putative coproporphyrinogen III oxidase"
                     /protein_id="NP_593150.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.11"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.11.1"
                     /db_xref="GeneID:2541934"
                     /db_xref="GOA:Q9UTE2"
                     /db_xref="InterPro:IPR001260"
                     /db_xref="InterPro:IPR018375"
                     /db_xref="PomBase:SPAC222.11"
                     /db_xref="PomBase:SPAC222.11.1"
                     /translation="MSDITVEPIGKQMEKLILDVQQEIVAGLEAVDGQKFFQDKWTKG
                     EGGYGISCVIQDGNVFEKGGVNTSIVQGKLNQDAVQRMRANHEGIDRTAKELPFFAAG
                     ISMVIHPRNPMAPTTHLNYRYFELVNSDGKKIWWFGGGADLTPSILFEEDGKHFHKLH
                     KEACDRHDPTFYPRFKKWADEYFLIKHRKETRGIGGIFFDDLSEKDPQELFAFVKDCA
                     HTFLPAYVPIMEKRKNMEFTEDDKEFQLIRRGYYAEFNVMYDRGTWFGLQAPEPRVES
                     ILMTLPLHASWRYKYEPKQERHKALLKVTHTPIEWC"
     gene            complement(967583..968302)
                     /locus_tag="SPAC222.17"
                     /db_xref="GeneID:9407196"
     mRNA            complement(join(967583..967958,968030..968302))
                     /locus_tag="SPAC222.17"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001355995.1"
                     /db_xref="GeneID:9407196"
     CDS             complement(join(967865..967958,968030..968205))
                     /locus_tag="SPAC222.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_001343067.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.17"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.17.1"
                     /db_xref="GeneID:9407196"
                     /db_xref="GOA:C6Y4B9"
                     /db_xref="PomBase:SPAC222.17"
                     /db_xref="PomBase:SPAC222.17.1"
                     /translation="MEEKVQEFLKDSTKEQKVFFESLNNQTERVCQQTESGDISCIEL
                     AAAETKLFATMQSLGFICTLSADPNRPTVFECKRELDTNERKERL"
     gene            complement(968507..970412)
                     /gene="atp2"
                     /locus_tag="SPAC222.12c"
                     /db_xref="GeneID:2541927"
     mRNA            complement(968507..970412)
                     /gene="atp2"
                     /locus_tag="SPAC222.12c"
                     /product="F1-ATPase beta subunit Atp2"
                     /transcript_id="NM_001018548.2"
                     /db_xref="GeneID:2541927"
     CDS             complement(968783..970360)
                     /gene="atp2"
                     /locus_tag="SPAC222.12c"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="F1-ATPase beta subunit Atp2"
                     /protein_id="NP_593151.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.12c"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.12c.1"
                     /db_xref="GeneID:2541927"
                     /db_xref="GOA:P22068"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC222.12c"
                     /db_xref="PomBase:SPAC222.12c.1"
                     /translation="MLKKQALSGIRRFSLATKQSFVKTSYKLPRKSWLNTAKFNTIRY
                     ASTEAAKHNKGSIKQVIGAVVDCQFEDADSLPSILNALEVKLPDNKRLVLEVAQHVGE
                     NTVRTIAMDGTEGLVRGTAVIDTGSPISIPVGPGTLGRIMNVIGEPVDERGPIKAVKY
                     SPIHADAPSFEEQSTTPEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELIN
                     NIAKAHGGYSVFTGVGERTREGNDLYREMQETGVIKLEGESKAALVFGQMNEPPGARA
                     RVALTGLTVAEYFRDIEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATD
                     MGAMQERITTTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSISELGIYP
                     AVDPLDSKSRMMDPRILGEEHYNLAGSVQQMLQEYKSLQDIIAILGMDELSEADKLTV
                     ERARKVQRFLSQPFAVAEVFTGIEGRLVSLKDTIRSFKEILEGKHDSLPESAFYMVGS
                     IDDAVKKAEKIAQELAA"
     gene            complement(970875..973548)
                     /locus_tag="SPAC222.13c"
                     /db_xref="GeneID:2541948"
     mRNA            complement(join(970875..971404,971447..972268,
                     972320..972644,972757..973548))
                     /locus_tag="SPAC222.13c"
                     /product="putative 6-phosphofructo-2-kinase"
                     /transcript_id="NM_001018549.2"
                     /db_xref="GeneID:2541948"
     CDS             complement(join(971258..971404,971447..972268,
                     972320..972644,972757..973241))
                     /locus_tag="SPAC222.13c"
                     /EC_number="2.7.1.105"
                     /codon_start=1
                     /product="putative 6-phosphofructo-2-kinase"
                     /protein_id="NP_593152.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.13c"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.13c.1"
                     /db_xref="GeneID:2541948"
                     /db_xref="GOA:Q9UTE1"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="PomBase:SPAC222.13c"
                     /db_xref="PomBase:SPAC222.13c.1"
                     /translation="MSNTGSARTEEFTKGTGYEATKPNNDTDDDAKQNYPSKEPHMKL
                     GDYTEETSFVDDSIFKREELTPDRNSPANDVEKMEVPKPTPQWMKLKDEGKLGKHRKN
                     RLRRPGRFPVRQESTIDIPGLTVSKRTENDSNNASYGIREKLIIILVGIPATGKSYIG
                     SKLSRYYNWLKYNCRFFSVGDKRREEGASTYSMSADFFDIKNEETFKFRENVALETLE
                     DLLHWMIHENGVIGILDATNSTHERRKHLYDRISKEADIGIMFLESLCTDDILFEENI
                     KLKIKGPDYEGYDTESALKDLRERVDLYKKYYEPLDERDEQLPFLQYVKVINVGIKVV
                     THNIEGFLAGQAVYFMLNLNIQKRQIWLTRPGESLDTVAGRIGGDASLTPIGKQYAQD
                     LANFMDRQRVLWQLRYTNDLASTNKRFSLSEASSFNVWSSVRKRAIETIEFFNPDSYN
                     VKKIRLLNDLNLGSREGLTLREFSEKYPDEFDVIKRKDYAYRFSGQGGESYLDVIHRL
                     QPLIVEIERSSGNILVVSHRIVSNILMTYFLNYHPEDIIDVGLPLHTLFCIESDRYGT
                     TCMAYRYDAANRQFIKDPMFDLRKRT"
     gene            972677..973994
                     /locus_tag="SPNCRNA.701"
                     /db_xref="GeneID:14217909"
     misc_RNA        972677..973994
                     /locus_tag="SPNCRNA.701"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151070.1"
                     /db_xref="GeneID:14217909"
     gene            complement(973843..976782)
                     /locus_tag="SPAC222.14c"
                     /db_xref="GeneID:2541926"
     mRNA            complement(join(973843..976137,976245..976330,
                     976389..976463,976577..976782))
                     /locus_tag="SPAC222.14c"
                     /product="putative GTP-binding protein Sey1"
                     /transcript_id="NM_001018550.2"
                     /db_xref="GeneID:2541926"
     CDS             complement(join(974167..976137,976245..976330,
                     976389..976463,976577..976733))
                     /locus_tag="SPAC222.14c"
                     /codon_start=1
                     /product="putative GTP-binding protein Sey1"
                     /protein_id="NP_593153.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.14c"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.14c.1"
                     /db_xref="GeneID:2541926"
                     /db_xref="GOA:Q9UTE0"
                     /db_xref="InterPro:IPR008803"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC222.14c"
                     /db_xref="PomBase:SPAC222.14c.1"
                     /translation="MSTASNRVSTQIVDEHKQFNNELPKFMQSVGLLDAGFNYHVVAV
                     LGSQSTGKSTLLNNLFGTSFSVMDASKRQQTTKGIWLSKANNSPILVMDVEGTDGRER
                     GEDQDFERKSALFSISTSEVIIVNMWENQVGLYQGSNMALLKTVLEVNLQLFHNKKER
                     CLLQFVIRDFLGNTSMENLADTIMTDLNNIWASLSKPEGFENSVINDFFDVGFTGLPH
                     KILCSDAFSEAVDSLRERFVDNNNSDYIFNVSYHKKIPADGFSLYTREIWDTIENNKD
                     LDLPTQQQLLAQYRCDEIITEVMEPFSTACTILQKEFLPGNLCKDLPTKLLNMFETVI
                     EAYDRQASRYNVHIYQKKKQELIASVDSHLYVFFQAQLNALHKELIKSFFDASNEFPS
                     DTPFKESSSIKINELVNKMREEGESLSLPHVHWDVDPFILKLSEELTQNSETLCKEKL
                     KEKLEELFTGFEFEVSEAVEVAFQKLSHNVWDTLLNEFLAAQNTTIEKIKNIVPFYVD
                     IDDTKTTEEYIINFKKNSWLFFRKKIDSEMSEVLLQQRLRVYFEELFRYDSDGMPKLW
                     KKSGTIDRDYRESLTKTLDLINVLASIKVSDGNYPDLNVDIKTLEPEYTSPASFFTIL
                     NRRRVSDISVNFKRSADLIFMDCKRSVINTTTRIPPYFWVLLIVLGWNEFMAILRNPF
                     VFMILMFGGTVVYGLYISGLIWPAKMVLERATNNLVDLATDRFSNTYQEQVQQRAMQR
                     TEKSGSPVASADDAEAEKTALS"
     gene            complement(977075..977568)
                     /gene="prl50"
                     /locus_tag="SPNCRNA.50"
                     /db_xref="GeneID:5802864"
     misc_RNA        complement(977075..977568)
                     /gene="prl50"
                     /locus_tag="SPNCRNA.50"
                     /product="non-coding RNA poly(A)-bearing (predicted)"
                     /transcript_id="NR_150877.1"
                     /db_xref="GeneID:5802864"
     gene            <977709..>978637
                     /gene="meu13"
                     /locus_tag="SPAC222.15"
                     /gene_synonym="SPAC821.01"
                     /db_xref="GeneID:3361533"
     mRNA            join(<977709..977757,977804..977857,977905..978006,
                     978049..978189,978333..>978637)
                     /gene="meu13"
                     /locus_tag="SPAC222.15"
                     /gene_synonym="SPAC821.01"
                     /product="homologous-pairing protein 2"
                     /transcript_id="NM_001018551.1"
                     /db_xref="GeneID:3361533"
     CDS             join(977709..977757,977804..977857,977905..978006,
                     978049..978189,978333..978637)
                     /gene="meu13"
                     /locus_tag="SPAC222.15"
                     /gene_synonym="SPAC821.01"
                     /codon_start=1
                     /product="homologous-pairing protein 2"
                     /protein_id="NP_001018191.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.15"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.15.1"
                     /db_xref="GeneID:3361533"
                     /db_xref="GOA:Q9HGK2"
                     /db_xref="InterPro:IPR010776"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="PomBase:SPAC222.15"
                     /db_xref="PomBase:SPAC222.15.1"
                     /translation="MAKAKEVKAKPIKGEEAEKLVYEYLRKTNRPYSATDVSANLKNV
                     VSKQVAQKALEQLRDTGLIHGKLYGKQSVFVCLQDDLAAATPEELAEMEKQIQELKDE
                     VSVVKTLYKEKCIELQALNNSLSPAEIREKIQSIDKEIEETSSKLESLRNGTVKQISK
                     EAMQKTDKNYDFAKKGFSNRKKMFYDLWHLITDSLENPKQLWEKLGFETEGPIDLN"
     gene            978722..979643
                     /locus_tag="SPAC222.18"
                     /db_xref="GeneID:9407033"
     mRNA            join(978722..979021,979120..979176,979215..979643)
                     /locus_tag="SPAC222.18"
                     /product="putative Srp1 family splicing factor"
                     /transcript_id="NM_001355996.1"
                     /db_xref="GeneID:9407033"
     CDS             join(978903..979021,979120..979176,979215..979374)
                     /locus_tag="SPAC222.18"
                     /codon_start=1
                     /product="putative Srp1 family splicing factor"
                     /protein_id="NP_001343068.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.18"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.18.1"
                     /db_xref="GeneID:9407033"
                     /db_xref="GOA:C6Y4C0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="PomBase:SPAC222.18"
                     /db_xref="PomBase:SPAC222.18.1"
                     /translation="MSNAPSNTPTGFNYKPGHTLYIRNFGTDMRARTLGQAFEKWGRI
                     VRCDIPISSNPQAHRYAFVEFEEREKAELAHEKMRNAKIGNDIIFVEWAKSRERYHRD
                     DKRRLSNYA"
     gene            complement(979482..981161)
                     /gene="csn3"
                     /locus_tag="SPAC222.16c"
                     /gene_synonym="SPAC821.02c"
                     /db_xref="GeneID:2541912"
     mRNA            complement(join(979482..980026,980093..980239,
                     980289..980378,980434..980532,980628..980774,
                     980846..980898,980944..981161))
                     /gene="csn3"
                     /locus_tag="SPAC222.16c"
                     /gene_synonym="SPAC821.02c"
                     /product="putative COP9/signalosome complex subunit Csn3"
                     /transcript_id="NM_001018552.3"
                     /db_xref="GeneID:2541912"
     CDS             complement(join(979679..980026,980093..980239,
                     980289..980378,980434..980532,980628..980774,
                     980846..980898,980944..981076))
                     /gene="csn3"
                     /locus_tag="SPAC222.16c"
                     /gene_synonym="SPAC821.02c"
                     /codon_start=1
                     /product="putative COP9/signalosome complex subunit Csn3"
                     /protein_id="NP_593155.3"
                     /db_xref="EnsemblGenomes-Gn:SPAC222.16c"
                     /db_xref="EnsemblGenomes-Tr:SPAC222.16c.1"
                     /db_xref="GeneID:2541912"
                     /db_xref="GOA:Q9UT51"
                     /db_xref="PomBase:SPAC222.16c"
                     /db_xref="PomBase:SPAC222.16c.1"
                     /translation="MVANMEFQGTLPFHPLEDPETLLLKFTDFVHQHSVEQCNQLSMY
                     IIASVNSLAEAFYGSHPEKYNIVFQSVEYAAHSPAISVMHVCYLKELLRQGQYATSLK
                     SFNDLEVSKHIPGSILLQYCMYAAYHCLGNNDLDSAKVWYFSILYIPTTTLTSFHEEA
                     YYSFLLLYIITTGKKFQLDSATSSNVLPLKRHMVPYEEFLDAYLKDVNTLRTVIKEHW
                     SRFLKDNSTAFILFALEVYPMHRLKKWRKTFSSLKLEYIAKQLAISQDVAKEIIQKFD
                     NKTNFTVANGEIFLTFNALDDVSPEMHSDLCQQLIEASKNFEASIRLKSVIYSKIMAK
                     KLNA"
     gene            complement(981473..983481)
                     /locus_tag="SPAC821.03c"
                     /db_xref="GeneID:2543199"
     mRNA            complement(981473..983481)
                     /locus_tag="SPAC821.03c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018554.2"
                     /db_xref="GeneID:2543199"
     CDS             complement(981798..983255)
                     /locus_tag="SPAC821.03c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_593156.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC821.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC821.03c.1"
                     /db_xref="GeneID:2543199"
                     /db_xref="GOA:Q9UT50"
                     /db_xref="PomBase:SPAC821.03c"
                     /db_xref="PomBase:SPAC821.03c.1"
                     /translation="MSSIIQNPIESSYFVEDLSAVGNSQLHSGRSLTYGDRKANIDTR
                     SGGGRRFWSNLNDSGNSFGAVPASSMNLSYGPTKSATISSKDGAMSRSSRYYVSSELK
                     ATLPSLDGRRLSKRNAANHASHHRMPDESASYRTRGEYESSSPRVPQKSLRRYYSTRT
                     AQRLDVRRPASRSSRYSKTSDLPPSDPGRFVDDSDLTPHTDFTNRFVDSDFDPDSGVG
                     RSSSPDQMMSRNNNLNINARMTSTSSKPYAKENQQLISSMAPVEQKNSFSTAREQYVA
                     PALSFAEPVETQHNHMPKTTPLRGTSTVMNGSPIGPYSSSSNATGMYGVSKGHSSSTR
                     RPFFSDVGSSQPAEEFVGSSSSHGRQQDSYIADDSDSERSYRRVRDQYLSKPRLSDKN
                     RYSTFSEFPGQGTPSASQSNLRRSNTVRPTSFYYEKLHIKNDNPSFQALPYETTTQER
                     KPVVKPDSIKTVKPEKKKSKGFFKKLMHKISHIFD"
     gene            complement(983567..987084)
                     /gene="cid13"
                     /locus_tag="SPAC821.04c"
                     /db_xref="GeneID:2543204"
     mRNA            complement(983567..987084)
                     /gene="cid13"
                     /locus_tag="SPAC821.04c"
                     /product="poly(A) polymerase Cid13"
                     /transcript_id="NM_001018555.2"
                     /db_xref="GeneID:2543204"
     CDS             complement(985011..986747)
                     /gene="cid13"
                     /locus_tag="SPAC821.04c"
                     /EC_number="2.7.7.19"
                     /codon_start=1
                     /product="poly(A) polymerase Cid13"
                     /protein_id="NP_593157.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC821.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC821.04c.1"
                     /db_xref="GeneID:2543204"
                     /db_xref="GOA:Q9UT49"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="PomBase:SPAC821.04c"
                     /db_xref="PomBase:SPAC821.04c.1"
                     /translation="MDNANCVGGCKFETRSFQYRRRIPYSLGADPLPPVHPLSLKNLV
                     DIDTDLISSQLYELYDSIILNDSGLERRYAFVQKLEQILKKEFPYKNIKTSLFGSTQS
                     LLASNASDIDLCIITDPPQCAPTTCEVSAAFARNGLKKVVCISTAKVPIVKVWDSELQ
                     LSCDCNINKTISTLNTRLMRSYVLCDPRVRPLIVMIKYWAKRRCLNDAAEGGTLTSYT
                     ISCMVINFLQKRDPPILPSLQMLPHLQDSSTMTDGLDVSFFDDPDLVHGFGDKNEESL
                     GILFVEFFRFFGYLFDYEHFVLSIRHGTFLSKRAKGWQFQLNNFLCVEEPFHTSRNLA
                     NTADEITMKGIQLEFRRVFRLLAYNCNVDDACSQFTFPSLTDTSFMDDYVNELQLEIV
                     PGFSHGRDSSDTSCTESPPEPSHFAWAFDPYNATASPYYNQNINSSIDYSSIYSNDVP
                     AIPPNVPYTFVDPYTYACYINNNSYLPPSYMDFYTWYNSPYPKSSHHFDERHGGDRHE
                     KNLSNSRRYSRNKFHKKKQSSGPFQYYPDAFSFTPTDNNSPPSNSSSSEVVSPVSLHS
                     EPVLSTVQAFKS"
     gene            988076..989866
                     /locus_tag="SPAC821.05"
                     /db_xref="GeneID:2543153"
     mRNA            join(988076..988422,988462..988568,988748..989866)
                     /locus_tag="SPAC821.05"
                     /product="translation initiation factor eIF3h (p40)"
                     /transcript_id="NM_001018556.2"
                     /db_xref="GeneID:2543153"
     CDS             join(988397..988422,988462..988568,988748..989688)
                     /locus_tag="SPAC821.05"
                     /codon_start=1
                     /product="translation initiation factor eIF3h (p40)"
                     /protein_id="NP_593158.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC821.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC821.05.1"
                     /db_xref="GeneID:2543153"
                     /db_xref="GOA:Q9UT48"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR027524"
                     /db_xref="PomBase:SPAC821.05"
                     /db_xref="PomBase:SPAC821.05.1"
                     /translation="MSDTTSLNVPELESPPIERVELESLLVMNIIKHCRDSFPNMGTI
                     GQLVGIDIDGVLQVSSSFESPSVLENEESAVNKSVSGKARQAHTEAMLNRLQYIGAVT
                     GHVGWYLGAYVSSFLSSPFFVETQYAYQKANPNSIAFLYDLSQSSNGTLYMRAYQLTP
                     EFMAAHEEKTWTASSLNSHNLTPSNVIRELPIVIHNSHLATCLLHSLSEPPTPASTLT
                     AEAALEDCESNLPLTETFSNFEVSLGTRYRKNIELLLESTDEFHYEQGNLGFHQRQLA
                     REQAKIQQWIAKRKAENANRAAENLQPLPLDDWKRIFKLPAEPRLLDSLLISSQIMKS
                     TQIDEQSSAFLSKLAGVRNAYAS"
     gene            complement(990025..991617)
                     /locus_tag="SPNCRNA.702"
                     /db_xref="GeneID:14218006"
     misc_RNA        complement(990025..991617)
                     /locus_tag="SPNCRNA.702"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151071.1"
                     /db_xref="GeneID:14218006"
     gene            990192..991889
                     /gene="spn2"
                     /locus_tag="SPAC821.06"
                     /db_xref="GeneID:2543513"
     mRNA            join(990192..990289,990339..990413,990472..990600,
                     990712..990793,990856..991889)
                     /gene="spn2"
                     /locus_tag="SPAC821.06"
                     /product="septin Spn2"
                     /transcript_id="NM_001018557.2"
                     /db_xref="GeneID:2543513"
     CDS             join(990250..990289,990339..990413,990472..990600,
                     990712..990793,990856..991525)
                     /gene="spn2"
                     /locus_tag="SPAC821.06"
                     /codon_start=1
                     /product="septin Spn2"
                     /protein_id="NP_593159.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC821.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC821.06.1"
                     /db_xref="GeneID:2543513"
                     /db_xref="GOA:Q09116"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC821.06"
                     /db_xref="PomBase:SPAC821.06.1"
                     /translation="MEVPSAVTLNNYVGFDSITSQINRKLIRRGFQFNVMVVGPSGSG
                     KSTLINTLFSAHLMDSKGRLDYQAPYRQTTEIHVTSQVVRENRVQLQLNLIDTPGYGD
                     QINNDKCWEPIIKYIRDQHSSYLRRELNSHREKRLQDTRVHCCLFFIRPTGHSLRPID
                     IAVLKRLTEVVNVVPVIAKSDSLTLEERAAFKQQIREEFVKHDINLYPYDSDDADEEE
                     INLNAAVRNLIPFAVVGSEKAIIVDGRPIRGRQNRWGVVNVDDENHCEFVFLRNFLMR
                     THLQDLIETTSYYHYEKFRFKQLSSLKEQSSLATRMGSPAPVYPSEPHLHTATAQ"
     gene            complement(991632..994230)
                     /gene="moc3"
                     /locus_tag="SPAC821.07c"
                     /db_xref="GeneID:2543646"
     mRNA            complement(991632..994230)
                     /gene="moc3"
                     /locus_tag="SPAC821.07c"
                     /product="transcription factor Moc3"
                     /transcript_id="NM_001018558.2"
                     /db_xref="GeneID:2543646"
     CDS             complement(991752..993278)
                     /gene="moc3"
                     /locus_tag="SPAC821.07c"
                     /codon_start=1
                     /product="transcription factor Moc3"
                     /protein_id="NP_593160.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC821.07c"
                     /db_xref="EnsemblGenomes-Tr:SPAC821.07c.1"
                     /db_xref="GeneID:2543646"
                     /db_xref="GOA:Q9UT46"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="PomBase:SPAC821.07c"
                     /db_xref="PomBase:SPAC821.07c.1"
                     /translation="MNPYVSYPEIHMKRNRTGSINSNPLYIPNPNVEPTPKPTKRRTK
                     TGCLTCRRRRIKCDETKPFCLNCTKTNRECEGYPNSAAQMQAMGSVSPPELSVHSAQQ
                     PLIPTSIASSSAQTGDTFSGSSQSNFNTNDLNQMTSSSNLSTVTPIKQDHQKPMNLQG
                     FPSAYQQHQYLQSNHNVPTNNSSSATSSTKPSVQSVGQASYPFLSSVSNFPSNFNSEL
                     FPFYFHDVVPSICAFEFDNNIALHFWSVTVPQFAQSMPCIANSLMAFASIKKLDVFGA
                     YSHLTRALRCPMPGPNSFEYLLVSAFLTLTQLNLPAYDLNFCNNFIRKLSWSSSTKSN
                     YVSLLIAMVVRELVFAILPRGCIWGFNGKPLSEVSVSRSHAPVSDSLFTIGLDILSQP
                     TLSDDLHRERMVAWRDEYHVHLYSASRSPLTKVIDCVGHAVTKNNNDVLSGLQQLMQE
                     ECTDIAVLRTSYLCVLSLQNVFASNSKEFKLRAQIESHFGRLMLEHFMDCNVLNRPVL
                     "
     gene            993887..995063
                     /locus_tag="SPNCRNA.703"
                     /db_xref="GeneID:14218245"
     misc_RNA        993887..995063
                     /locus_tag="SPNCRNA.703"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151072.1"
                     /db_xref="GeneID:14218245"
     gene            complement(994941..997625)
                     /gene="slp1"
                     /locus_tag="SPAC821.08c"
                     /gene_synonym="cdc20"
                     /db_xref="GeneID:2543222"
     mRNA            complement(994941..997625)
                     /gene="slp1"
                     /locus_tag="SPAC821.08c"
                     /gene_synonym="cdc20"
                     /product="WD repeat-containing protein"
                     /transcript_id="NM_001018559.2"
                     /db_xref="GeneID:2543222"
     CDS             complement(995476..996942)
                     /gene="slp1"
                     /locus_tag="SPAC821.08c"
                     /gene_synonym="cdc20"
                     /codon_start=1
                     /product="WD repeat-containing protein"
                     /protein_id="NP_593161.1"
                     /db_xref="GeneID:2543222"
                     /db_xref="GOA:P78972"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="PDB:4AEZ"
                     /translation="MEIAGNSSTISPTFSTPTKKRNLVFPNSPITPLHQQALLGRNGR
                     SSKRCSPKSSFIRNSPKIDVVNTDWSIPLCGSPRNKSRPASRSDRFIPSRPNTANAFV
                     NSISSDVPFDYSESVAEACGFDLNTRVLAFKLDAPEAKKPVDLRTQHNRPQRPVVTPA
                     KRRFNTTPERVLDAPGIIDDYYLNLLDWSNLNVVAVALERNVYVWNADSGSVSALAET
                     DESTYVASVKWSHDGSFLSVGLGNGLVDIYDVESQTKLRTMAGHQARVGCLSWNRHVL
                     SSGSRSGAIHHHDVRIANHQIGTLQGHSSEVCGLAWRSDGLQLASGGNDNVVQIWDAR
                     SSIPKFTKTNHNAAVKAVAWCPWQSNLLATGGGTMDKQIHFWNAATGARVNTVDAGSQ
                     VTSLIWSPHSKEIMSTHGFPDNNLSIWSYSSSGLTKQVDIPAHDTRVLYSALSPDGRI
                     LSTAASDENLKFWRVYDGDHVKRPIPITKTPSSSITIR"
     gene            998045..998413
                     /locus_tag="SPNCRNA.163"
                     /db_xref="GeneID:9407277"
     misc_RNA        998045..998413
                     /locus_tag="SPNCRNA.163"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150524.1"
                     /db_xref="GeneID:9407277"
     gene            998686..1002361
                     /gene="eng1"
                     /locus_tag="SPAC821.09"
                     /db_xref="GeneID:2543379"
     mRNA            998686..1002361
                     /gene="eng1"
                     /locus_tag="SPAC821.09"
                     /product="endo-1,3-beta-glucanase Eng1"
                     /transcript_id="NM_001018560.2"
                     /db_xref="GeneID:2543379"
     CDS             998953..1002003
                     /gene="eng1"
                     /locus_tag="SPAC821.09"
                     /EC_number="3.2.1.39"
                     /codon_start=1
                     /product="endo-1,3-beta-glucanase Eng1"
                     /protein_id="NP_593162.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC821.09"
                     /db_xref="EnsemblGenomes-Tr:SPAC821.09.1"
                     /db_xref="GeneID:2543379"
                     /db_xref="GOA:Q9UT45"
                     /db_xref="InterPro:IPR005200"
                     /db_xref="InterPro:IPR018909"
                     /db_xref="PomBase:SPAC821.09"
                     /db_xref="PomBase:SPAC821.09.1"
                     /translation="MSSYLRSFIFGLLTISLAQCSPILKDTKDTKFSTGSNISLKKRD
                     TNVFDSVVDTINPASYFGTVSHPVTPAGVSTDSLSSPIETNKFFDNNLLGSRTNFMYA
                     DPFRYWWQSSDTMGGICIAHTDDNQRVMDTDDTIPSYYYEPIGICSLGFGASGITSNT
                     DPIVDEIDQMSARFTFSWDSSSMQLTLTEGMAVTTAVYTNAIPQIFSSTLYINDFVEV
                     PGTSAVQKYRVTMSDNHVWLIYIYGDSLTLTESTSQMLVGSNTFNGYIQIAKIPLGDG
                     TAEALYDTYAGVYITGISISGYVEDAVGYYSFDFTTAGDTSVEPLFFLLPHQVDTAVS
                     GTKVTSIVLASLVSGDMNAAAGNSITFAEAIPQDIGFLPWSPTGGQIGYSEEALEIIA
                     EVAGTELGEDFSANSNLNSMYYSGKVLAKYAMLCVTINDILGDETSSEQCIQKLEAAF
                     ARFVDNQQIYPLTYDNTWKGVVSVAGLSGDSLADFGNSYYNDHHFHYGYFVFTAAVIG
                     HIDPDWINTGNNKEWVNFLVRDVANPSSNDPYFPKHRMIDIYHGHGWASGLFESNDGK
                     DEESTSEDYNFFFGMKLWGQVIGDSDMEDRANIILGIERNALNKYMLYADGNVQPTSM
                     QPNYVAGITFMNKITHTTYFGTNIEYIQGIHMLPITPISAFIRGPSFVLAEWNALLAS
                     VIDYVDSGWRSLLYANLAIAEPEESYEYFSSSDFNTDYLDDGASRAWYLAYAAGLWAN
                     DAVYYPVSSSSTTTTSTSTGSVTTTSTTATASCTLPISYTSTPTTTSISGTCNGATFD
                     ASLYVCDGTVLCPIVNGVSYQNCNGACYNPSQYGCDNGALGPVQSSSTTSSITPTPTT
                     TSSITPTPTTTSTTTTAQSTGMQLCGSNYYDASSYYCDNDQLCPIIDGVDYLSCNGAC
                     YNPSQYVCSDGSLSPNTVTTTKATTTFTPTPTTTTTPTPTTTSATSTNVIAQCGSAWY
                     DSQSYICYGNILCPIINGSPLLACGNACYDSSIYGCSNGALVAA"
     gene            complement(1002838..1004804)
                     /gene="sod1"
                     /locus_tag="SPAC821.10c"
                     /db_xref="GeneID:2542128"
     mRNA            complement(1002838..1004804)
                     /gene="sod1"
                     /locus_tag="SPAC821.10c"
                     /product="superoxide dismutase Sod1"
                     /transcript_id="NM_001018561.2"
                     /db_xref="GeneID:2542128"
     CDS             complement(1002999..1003463)
                     /gene="sod1"
                     /locus_tag="SPAC821.10c"
                     /EC_number="1.15.1.1"
                     /codon_start=1
                     /product="superoxide dismutase Sod1"
                     /protein_id="NP_593163.1"
                     /db_xref="GeneID:2542128"
                     /db_xref="GOA:P28758"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR018152"
                     /translation="MVRAVAVLRGDSKVSGVVTFEQVDQNSQVSVIVDLVGNDANAKR
                     GFHIHQFGDNTNGCTSAGPHFNPEGKTHGDRTAAVRHVGDLGNLESDAQGNIKTTFSD
                     SVISLFGANSIIGRTIVIHAGEDDLGKGTSEESLKTGNAGARNACGVIGIAV"
     repeat_region   1004892..1005249
                     /rpt_type=long_terminal_repeat
     gene            1005499..1005710
                     /locus_tag="SPNCRNA.164"
                     /db_xref="GeneID:9407063"
     misc_RNA        1005499..1005710
                     /locus_tag="SPNCRNA.164"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150535.1"
                     /db_xref="GeneID:9407063"
     gene            1006259..1008003
                     /gene="pro1"
                     /locus_tag="SPAC821.11"
                     /db_xref="GeneID:2543410"
     mRNA            1006259..1008003
                     /gene="pro1"
                     /locus_tag="SPAC821.11"
                     /product="putative gamma-glutamyl phosphate reductase
                     Pro1"
                     /transcript_id="NM_001018562.2"
                     /db_xref="GeneID:2543410"
     CDS             1006394..1007749
                     /gene="pro1"
                     /locus_tag="SPAC821.11"
                     /EC_number="1.2.1.41"
                     /codon_start=1
                     /product="putative gamma-glutamyl phosphate reductase
                     Pro1"
                     /protein_id="NP_593164.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC821.11"
                     /db_xref="EnsemblGenomes-Tr:SPAC821.11.1"
                     /db_xref="GeneID:2543410"
                     /db_xref="GOA:Q9UT44"
                     /db_xref="InterPro:IPR000965"
                     /db_xref="InterPro:IPR012134"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR020593"
                     /db_xref="PomBase:SPAC821.11"
                     /db_xref="PomBase:SPAC821.11.1"
                     /translation="MSLEENVKEAKNAFNILQTLSVEDRDDALDKIVEELRIKKSEVL
                     AANAEDMKAAKLLAESGKLSSSMVKRLDLSSSDKYDSMVQGVLDVKSLPDPLGRVTYA
                     RSLDDGLDLYKVSCPVGLLLVIFEARPEVIINITSLAIKSGNAVVLKGGTESAKSFAA
                     LSNVVRSALGKSKVPQAAVQLVQSREEVSQLLKLDEYIDLVIPRGSTNLVRHIKDNTK
                     IPVLGHAAGLCSMYVHEDADMELASKLVLDGKTDYPAACNAIETLLINEAVLSSHLPK
                     IAETLTEAKVTLKCDPASLKVLKDMPKVSALVEPSVDQDYNTEFSDLILAIKTVPSLQ
                     SAMQHINTHGSKHTDCIITSSEAAANRFMAGIDASGVYWNASTRFADGFRYGYGTEVG
                     ISTNKIHARGPMGLDGLTIYKYQLRGNGQVASSYGVGPGKRAFKHTPINIDNISQVSK
                     K"
     gene            1008215..1010318
                     /gene="orb6"
                     /locus_tag="SPAC821.12"
                     /db_xref="GeneID:2543441"
     mRNA            join(1008215..1008581,1008849..1009023,1009069..1010318)
                     /gene="orb6"
                     /locus_tag="SPAC821.12"
                     /product="serine/threonine protein kinase Orb6"
                     /transcript_id="NM_001018563.2"
                     /db_xref="GeneID:2543441"
     CDS             join(1008439..1008581,1008849..1009023,1009069..1010160)
                     /gene="orb6"
                     /locus_tag="SPAC821.12"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="serine/threonine protein kinase Orb6"
                     /protein_id="NP_593165.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC821.12"
                     /db_xref="EnsemblGenomes-Tr:SPAC821.12.1"
                     /db_xref="GeneID:2543441"
                     /db_xref="GOA:O13310"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PomBase:SPAC821.12"
                     /db_xref="PomBase:SPAC821.12.1"
                     /translation="MDKNDYLHFERNPSLFPKSTLDKVQKTKKYIEHYYKVAVDHAVE
                     RNQRRINLEQRLATERGSEERKNRQLRASGEKESQFLRFRRTRLSLEDFSTIKVIGKG
                     AFGEVRLVQKLDTGKIYAMKSLLKTEMFKRDQLAHVKAERDLLVESDSPWVVSLYYAF
                     QDSLYLYLIMEFLPGGDLMTMLINYDTFSEDVTRFYMAECVLAIADVHRMGYIHRDIK
                     PDNILIDRDGHIKLSDFGLSTGFYKQDQSASYMKPRTGNTVKRGQMVDAIWLTMSSKD
                     KMATWKKNRRVMAYSTVGTPDYIAPEIFLQQGYGQDCDWWSLGAIMFECLIGWPPFCS
                     ENSHETYRKIINWRETLTFPNDIHLSIEARDLMDRLMTDSEHRLGRGGAIEIMQHPFF
                     TGIDWDHIRETAAPFIPNLKSITDTHYFPVDELEQVPEQPVTQQPASVDPQTLEQTNL
                     AFLGYTYKKFNYLTMKGAL"
     gene            complement(1010343..1015415)
                     /locus_tag="SPAC821.13c"
                     /db_xref="GeneID:3361515"
     mRNA            complement(1010343..1015415)
                     /locus_tag="SPAC821.13c"
                     /product="putative P-type ATPase"
                     /transcript_id="NM_001355997.1"
                     /db_xref="GeneID:3361515"
     CDS             complement(1010640..1015328)
                     /locus_tag="SPAC821.13c"
                     /EC_number="3.6.3.1"
                     /codon_start=1
                     /product="putative P-type ATPase"
                     /protein_id="NP_001342913.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC821.13c"
                     /db_xref="EnsemblGenomes-Tr:SPAC821.13c.1"
                     /db_xref="GeneID:3361515"
                     /db_xref="GOA:Q9UT43"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="PomBase:SPAC821.13c"
                     /db_xref="PomBase:SPAC821.13c.1"
                     /translation="MKSSGIAGDSNGFETNFLNETTNREEDGAFNWNAADDGTNERRE
                     DIHVRFQDSALPLGIDENELDEIDINGDSKKLDSVEVDESHDVNSPSDSRLKSSFKSV
                     LELTANSMVSVLTPSTKTEQTSKGKGKKKKAHVSFLEGPVEEIPLDDIEPTSPREASP
                     VFNGRPPIPPEFLKSRHKEFTIPNPLQFISNFLSNLFSRDTRYLKSSHGRIIIINPYD
                     DSSQIDERTGKPYMQNSIVSSRYNKYNFVPLQIIAQFSKTANCYFLLIAIMQMIPGWS
                     TTGTYTTIIPLLIFISIAILREGFDNYRRYRQDRVENRIQTQVLRHVDVDPPIVEEHS
                     SFFRRRRWRRSRSQESASRSTIRSTDEREPERTSEDPPQLPPSPSSPSSPALSVKPNI
                     DPQPPLYNSTLTTTRSIPANKPTFFWASCDRKDVRVGDIIRLTSDQTLPADVIALSSP
                     NPNGAIYIETAALDGETSLKTRLVNSTLRSLCKDINDLIRLSGTCTVEDPNGDLYNFN
                     GSMKLDSIQGEIPLSNNDVLYRGSNLRNTSELFALVIFTGEESKIRMNAVRNVSVKAP
                     SMQKVTNRIVIFIFALVVSMAIYCTAAYFVWQKKVERKLWYLTNSKLSFVPILVSFII
                     LYNTMVPISLYVSMEIIRVFQTFLVQSDIDLYYPENDTRCEVRSSSILEELGQVTHVF
                     SDKTGTLTDNIMLFRNLSVGGFAWQHVGAENPKLVSTSQKSDDLDGEAKPPQLENIQG
                     TTIQLLQYVHDNPHTTFSKRVRIFLLNLAICHTCLPSFDEENQIYKYQSISPDELALV
                     HAAQQLGYIVIDRDIDSLTIRLHYPLDPHSHPIAKTYRILNIIEFTSKRKCMSVIVRM
                     PNGRICLFCKGADSAIIKRLRLSNLAKRKDKSVTKAEQARKSIEIDKAIIRNSQSTSR
                     PSLTASRPSLSRRRNDYINNVTSWLDERREKMGVVRPRASTSILETRRRPAVGRHSLA
                     GGERLMEDKKYLSKQEEAEGSIYESLNHNDAKLFENTFEHVHAFATDGLRTLMYAHRF
                     IDESEYQSWKLVNDAALNSLSNRQQLLDEAADLIEKDLEFAGATAIEDKLQVGVPESI
                     NSLFRAGIKFWMLTGDKKETAINIGHSCGVIKEYSTVVVMGSLDGVEGSDETVSGGQR
                     LSLDRPPTNDPASLMIHQLISCMNAIHSNSLAHLVIVIDGSTLADIENDPELFLLFIN
                     TAVEADSVICCRSSPMQKALMVQKVRNTLEKAVTLAIGDGANDIAMIQEAHVGIGIAG
                     REGLQAARSSDFSIGRFKFLIKLLFCHGRWSYVRLSKYILGTFYKEQFFFLMQAIMQP
                     FVGYTGQSLYESWGLTCFNTLFSSLCVIGLGIFEKDLSASTVIAVPELYQKGINNEAF
                     NWRVYFGWCSIAFIQAFLVFYVTYSLFGMKELNDNNIFAYGQLIFTAAIFIMNFKLVF
                     IEMQYINIISIIVLVLTSLAWFLFNIFISEHYPDKNLYLARSQFLHHFGKNPSWWLTM
                     LFVMVCALTIDIVAQMLRRTLRPTDTDIFVEMENDAFVRSRFEQESGEFLQANAPSVD
                     EIEQYLKSRD"
     gene            1015475..1015830
                     /locus_tag="SPNCRNA.220"
                     /db_xref="GeneID:9406977"
     misc_RNA        1015475..1015830
                     /locus_tag="SPNCRNA.220"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150640.1"
                     /db_xref="GeneID:9406977"
     gene            complement(1016103..1019031)
                     /locus_tag="SPAC139.01c"
                     /db_xref="GeneID:2541762"
     mRNA            complement(join(1016103..1016669,1016730..1018827,
                     1018869..1019031))
                     /locus_tag="SPAC139.01c"
                     /product="putative XP-G family nuclease"
                     /transcript_id="NM_001355998.1"
                     /db_xref="GeneID:2541762"
     CDS             complement(join(1016366..1016669,1016730..1018827,
                     1018869..1018875))
                     /locus_tag="SPAC139.01c"
                     /codon_start=1
                     /product="putative XP-G family nuclease"
                     /protein_id="NP_001342957.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC139.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC139.01c.1"
                     /db_xref="GeneID:2541762"
                     /db_xref="GOA:Q9UTN2"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR022039"
                     /db_xref="InterPro:IPR022040"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="PomBase:SPAC139.01c"
                     /db_xref="PomBase:SPAC139.01c.1"
                     /translation="MTIRSLNLFIIDKKHQHKSSLSSFQNCKLGIDASFYLTQIIHSF
                     TPQELQSLAVNGESEYLQHRISEFLEQLRTENITPIFVFNGIPLTFEASSQLEVPGKQ
                     KSHSALTDFEAFDPYDANIQRNMYRMDASGPANYGESKPTLLYTNQRDHLDRLCDQVK
                     FYLDQCNVEYFVAPYLAMAQLAYFLNGTSSPYIDAIYGSTDLLLFGVKKFITSMNTSS
                     NVKISSDPSSPSTQTTINSAAKSSFTWLDGNALLQDTNGLSWQQFIDSCLLCGTAISP
                     TFPQIEGTFLIKSAMELVRMFGSAYRAVLHFAEIFPQPIFQDYLQQYKRAVCFSKFGI
                     VMDTKGLTLPPVPTESVPNDINIYFGTRLPNEIYFYISRGLIPCKMIGALVSGCFSDP
                     VSILEQHIGDKASQGTFSGANSGLNPGRDNAAAVAAVDQRRFVDDLEEIWSQGLNLLT
                     QPLNRFYQARDIVSLHGHNQQASLKVMHSYDPPLYNDTRAWMIYEENLPSYLSSNFLK
                     EEPVVLFDLLRALNDPVFVKKSFCTEGNIGIKNPPKHPLSSTAEIVLSSCYRFLQIRS
                     FVLTSHQLTSWGCPLLKALENCHLQNQTSVVVLFELLRLRQLKEPSLLSSSSASIADL
                     SITSATEFLAKVATFLPIKQRPEVSKISIVDENLLQFYQLQTSFGSNLKELMAMILAS
                     VILNRNVDKSKIDPKLIRKTLPFQNINGSLVSGFVVKRFFEIISKEQEASSQQENIQK
                     AYEIIEKEFPTIGSAENHIAQFLEFWKTFMEGVKEAENTSAIGKLVLSKLFLTNQWIF
                     SLGL"
     gene            1018733..1021093
                     /locus_tag="SPNCRNA.704"
                     /db_xref="GeneID:14217865"
     misc_RNA        1018733..1021093
                     /locus_tag="SPNCRNA.704"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151073.1"
                     /db_xref="GeneID:14217865"
     gene            complement(1019248..1020838)
                     /gene="oac1"
                     /locus_tag="SPAC139.02c"
                     /db_xref="GeneID:2541790"
     mRNA            complement(1019248..1020838)
                     /gene="oac1"
                     /locus_tag="SPAC139.02c"
                     /product="putative anion transporter"
                     /transcript_id="NM_001018566.2"
                     /db_xref="GeneID:2541790"
     CDS             complement(1019612..1020574)
                     /gene="oac1"
                     /locus_tag="SPAC139.02c"
                     /codon_start=1
                     /product="putative anion transporter"
                     /protein_id="NP_593169.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC139.02c"
                     /db_xref="EnsemblGenomes-Tr:SPAC139.02c.1"
                     /db_xref="GeneID:2541790"
                     /db_xref="GOA:Q9UTN1"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PomBase:SPAC139.02c"
                     /db_xref="PomBase:SPAC139.02c.1"
                     /translation="MSEKQTIKALPAHNPTQVKKLGPVSGFLSGGLAACGAVTLTNPF
                     EVIKTRFQLQGQLTKLDPSKRIYKSVGQAFSLIARHEGIRGLQRGLGTAYVYQICLNG
                     CRLGFYEPIRRTLNTWFLDDPKGNKLAINVASGAGSGLCGALFGSPFFLVKTRMQSYS
                     PKFPVGQQYGYKHIFNAFSRIIKENGVKGLFVGADAAILRTVSGSSVQLPIYNWAKRM
                     IEHYNLLEEGMIKHLTASAVSGFGVCCTMQIFDTVMTRMYNQKNKELYKNPIDCILKT
                     IRSEGFFALYKGFGAHLARIAPHTIFCLTFVEQTNKLFLKFQKD"
     gene            1021695..1024135
                     /locus_tag="SPAC139.03"
                     /db_xref="GeneID:2541956"
     mRNA            join(1021695..1022807,1022847..1023794,1023836..1024135)
                     /locus_tag="SPAC139.03"
                     /product="putative transcription factor"
                     /transcript_id="NM_001018567.2"
                     /db_xref="GeneID:2541956"
     CDS             join(1021917..1022807,1022847..1023794,1023836..1023874)
                     /locus_tag="SPAC139.03"
                     /codon_start=1
                     /product="putative transcription factor"
                     /protein_id="NP_593170.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC139.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC139.03.1"
                     /db_xref="GeneID:2541956"
                     /db_xref="GOA:Q9UTN0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="PomBase:SPAC139.03"
                     /db_xref="PomBase:SPAC139.03.1"
                     /translation="MSETTKSGSKKSGQTSRRAIHSCLACRRKKLKCDHGRPCSNCLK
                     RSTIQSCIYIDPGKTNYDKRFERGSEADELIDQLLSRVSMLEKRLNEVGTKSQSDYEN
                     QQSHNLPSTPSADAETQRNIGSLSVLDDTKSQYANYSSSSHVLWHLRNYHYLNLDQDI
                     QEENDSLISPFFFRISPNESAYDYLPPKKVSDILIEQFFFRCHMLINVLHRPTFYVRY
                     NDFWEKPHLRKPAFTSLLYAIYASALLATPVEVQKTWALGEDERYLQVDYHQAFRYAL
                     ASSNFLFEPDLNALQALVLCQVVFDSDRIRAPPSLVGLILHVALCMGLHRDGSLYGLN
                     PVISEIRRRVWANIVLSDLRTSETIGYPPQIVEGNYDTRLPSALPDEIHNVDSSVIIS
                     EATFVNIITKVSRAYSKCLKVLLGIIAPNYTRLLELDRELSNFFKELIEVNIPTSNTM
                     HERHIRLLVSYLSNRFPILLHFPFLLKKNSAQFAYSHSRALESATLALNQLYELGSNP
                     EYSKYSWYLWRYPPFHPCIVLLLDLLNSQKIIYLDDERVVLLNKIFSLFPRSSGKEHY
                     QKAWALLQTSRAKVWEKLGLSTVDVSTTDVRLTNFEFFDANNLDINWDDWDAIFQHCP
                     F"
     gene            complement(1024002..1025903)
                     /gene="fap2"
                     /locus_tag="SPAC139.04c"
                     /db_xref="GeneID:2541766"
     mRNA            complement(1024002..1025903)
                     /gene="fap2"
                     /locus_tag="SPAC139.04c"
                     /product="L-saccharopine oxidase"
                     /transcript_id="NM_001018568.2"
                     /db_xref="GeneID:2541766"
     CDS             complement(1024176..1025477)
                     /gene="fap2"
                     /locus_tag="SPAC139.04c"
                     /codon_start=1
                     /product="L-saccharopine oxidase"
                     /protein_id="NP_593171.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC139.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC139.04c.1"
                     /db_xref="GeneID:2541766"
                     /db_xref="GOA:Q9UTM9"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="PomBase:SPAC139.04c"
                     /db_xref="PomBase:SPAC139.04c.1"
                     /translation="MSRTIVIVGCGVFGLSTAVELAKNHSFDNIIAIDAEPVPSSMSA
                     ANDINKIVRPEYADLKYMKLALEAMEKWRNDPELSSVYFECGRLSTISKDPYRARFDE
                     VAQRNLRKLLGDSALINLSSSEEIRKKYPSLFSNSPLRSDMQAVVNEHAGYANSAASL
                     KLLELKARELGVEFVFGKAGKFKKFVVNHSETDIDKNDNHVSVQTEDGTIYHADTILL
                     AVGAYLNAYLNTSHRVCAKGLPVAHIQLTDEEFKTYKNMPIIFDPDCAYAFPPYPVTK
                     LIKLASTGYEYVCNVETDYDENSKVVSIPHSGPSKSSLPKYAIIQMRRFLDTFLPDLA
                     DRSLINTKMCWISDTEDANFLIDKVPQFDNVFVANGDSGHAFKFLPNIGRYIAQRILG
                     DLSEEWKDAWRWREDDKASELKWRCVRSLIDYKDAEFTYDK"
     gene            1025199..1025635
                     /locus_tag="SPNCRNA.705"
                     /db_xref="GeneID:14218192"
     misc_RNA        1025199..1025635
                     /locus_tag="SPNCRNA.705"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151074.1"
                     /db_xref="GeneID:14218192"
     gene            1027811..1029993
                     /locus_tag="SPAC139.05"
                     /db_xref="GeneID:2541647"
     mRNA            1027811..1029993
                     /locus_tag="SPAC139.05"
                     /product="putative succinate-semialdehyde dehydrogenase"
                     /transcript_id="NM_001018569.2"
                     /db_xref="GeneID:2541647"
     gene            complement(1028239..1030659)
                     /locus_tag="SPNCRNA.706"
                     /db_xref="GeneID:14217866"
     misc_RNA        complement(1028239..1030659)
                     /locus_tag="SPNCRNA.706"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151075.1"
                     /db_xref="GeneID:14217866"
     CDS             1028316..1029797
                     /locus_tag="SPAC139.05"
                     /EC_number="1.2.1.16"
                     /codon_start=1
                     /product="putative succinate-semialdehyde dehydrogenase"
                     /protein_id="NP_593172.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC139.05"
                     /db_xref="EnsemblGenomes-Tr:SPAC139.05.1"
                     /db_xref="GeneID:2541647"
                     /db_xref="GOA:Q9UTM8"
                     /db_xref="InterPro:IPR010102"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="PomBase:SPAC139.05"
                     /db_xref="PomBase:SPAC139.05.1"
                     /translation="MAPQFKRPELFGFDKSHAQSFVQGKWISSPNNKTFEVDNPATGE
                     IIGKVADVSVEETKKAISAANEAFKTYKNFTHVQRSQLLERWAELIMENKDDLVKMLT
                     LENGKPLSQAEMEVTTCSGYLKWYAAEAVRTFGDVAPSSLQSQNFLISIKQPVGVSAL
                     ITPWNFPAAMIARKGGAALAAGCTAIFLPAFRTPYVCLGLVRLAQEAGFPDGVLNVIT
                     SSDASAHGKELTTNPIVRKVSFTGSTNVGKILMGQSASTIKKVSMELGGNAPFIVFPD
                     FPIDQAVESFCTIKFNSCGQVCVCPNRVYVHKNVYDEFVSKLTEKVKTIKVGDGFDSS
                     SAVGPLISQDGCKKVSKHIEDAVSKGAKITVGGKEISSSKGYFFEPTVLSGVTQDMLV
                     ASEETFGPLASVFKFDDTEEVIEWANDSDVGLAGYVFTNNLSTMIHVAKELEVGLVGA
                     NIEMVDEPFISFGGIKQSGFGKEAGRLGVQEFMVVKEINLKTL"
     gene            1030125..1031941
                     /gene="hat1"
                     /locus_tag="SPAC139.06"
                     /gene_synonym="kat1; SPAC23C4.01"
                     /db_xref="GeneID:2542502"
     mRNA            join(1030125..1030287,1030338..1030441,1030503..1030721,
                     1030811..1030926,1030998..1031361,1031418..1031941)
                     /gene="hat1"
                     /locus_tag="SPAC139.06"
                     /gene_synonym="kat1; SPAC23C4.01"
                     /product="histone acetyltransferase Hat1"
                     /transcript_id="NM_001018570.2"
                     /db_xref="GeneID:2542502"
     CDS             join(1030230..1030287,1030338..1030441,1030503..1030721,
                     1030811..1030926,1030998..1031361,1031418..1031693)
                     /gene="hat1"
                     /locus_tag="SPAC139.06"
                     /gene_synonym="kat1; SPAC23C4.01"
                     /EC_number="2.3.1.48"
                     /codon_start=1
                     /product="histone acetyltransferase Hat1"
                     /protein_id="NP_593173.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC139.06"
                     /db_xref="EnsemblGenomes-Tr:SPAC139.06.1"
                     /db_xref="GeneID:2542502"
                     /db_xref="GOA:Q9UTM7"
                     /db_xref="InterPro:IPR013523"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017380"
                     /db_xref="InterPro:IPR019467"
                     /db_xref="PomBase:SPAC139.06"
                     /db_xref="PomBase:SPAC139.06.1"
                     /translation="MSAVDEWVHNANECIEIVQVNEKHEKDCQYHPSNTYAIFGDAEV
                     IYGYKDLNVTITYECPLMVPKLEISYSERLAPDSGVEPTDIEGTLNTYLKDRSIKVEG
                     NSFDVHSANSIHNYSFNGKTFKILQATVLEASEIMQHLQIFSLFFIEGGSFIDLNDPR
                     WMVYLLYETTEDDYCLRGYCTVYKYYKWDKLIHDGIRARISQFVILPPFQHQGHGSQL
                     YNAIVSTFLKNPKILDFTVEDASEAFDSLRDHCDYKRLLSMGIFSEPDFHPSLSRQWI
                     NSKIAETKLTQRQFSRCCELAFTTKLKKLSLLERKSVRLGIKERIFRQNLDVLLQLDK
                     SERIEKIHNAYENQFDEYKQIVKKLPKLKEDSPRKRQKLAQSSS"
     gene            complement(1031904..1033018)
                     /locus_tag="SPNCRNA.707"
                     /db_xref="GeneID:14218208"
     misc_RNA        complement(1031904..1033018)
                     /locus_tag="SPNCRNA.707"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151076.1"
                     /db_xref="GeneID:14218208"
     gene            1032085..>1034167
                     /gene="crn1"
                     /locus_tag="SPAC23C4.02"
                     /db_xref="GeneID:2541961"
     mRNA            join(1032085..1032215,1032258..1032310,1032359..1032586,
                     1032628..1032716,1032766..>1034167)
                     /gene="crn1"
                     /locus_tag="SPAC23C4.02"
                     /product="coronin Crn1"
                     /transcript_id="NM_001018571.2"
                     /db_xref="GeneID:2541961"
     CDS             join(1032182..1032215,1032258..1032310,1032359..1032586,
                     1032628..1032716,1032766..1034167)
                     /gene="crn1"
                     /locus_tag="SPAC23C4.02"
                     /codon_start=1
                     /product="coronin Crn1"
                     /protein_id="NP_593175.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.02.1"
                     /db_xref="GeneID:2541961"
                     /db_xref="GOA:O13923"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015048"
                     /db_xref="InterPro:IPR015049"
                     /db_xref="InterPro:IPR015505"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="PomBase:SPAC23C4.02"
                     /db_xref="PomBase:SPAC23C4.02.1"
                     /translation="MSGRFVRASKYRHIFGQTCKKELCYDNIKLSNNAWDSNLLSVNP
                     FYLSVNWNAGAGGALAVIPLNERGKLPDQVNLFRGHTAAVLDTDWNPFHDQVLASGGD
                     DSKIMIWKVPEDYTVMEPYEDVHPIAELKGHSRKVGLVQYHPTAANVLASSSADNTIK
                     LWDCEKGVAHVSLKMDVMCQSMSFNADGTRLVTTSRDKKVRVWDPRTDKPVSVGNGHA
                     GAKNPRVVWLGSLDRFATTGFSKMSDRQIALWDPTNLSEPIGGFTTLDTGSGILMPFW
                     DDGTKVIYLAGKGDGNIRYYEYENDVFHYLSEFKSVDPQRGIAFLPKRGVNVSENEVM
                     RAYKSVNDSIIEPISFIVPRRSESFQSDIYPPAPSGKPSLTAEEWASGKDAQPDLLDM
                     STLYESKGTVEKAVSATVPSAGAQVQKHNEEKVETPKPEAQPVSKPKESAEEQKPSKE
                     PEVKPTTPSASKVEEPSKKRDEDNHQKEETVTQPKREKTPVEKSFPKPASSPVTFSED
                     VKKEPSEEKKLEVSDEAPKAAPLAESKKVEEKEPFYVSKDKKDISAVNLADLNKRFEG
                     FEKRYEEELAIRDWKIAQLEDKLAKLTEAIKEKCN"
     gene            <1034296..1035992
                     /gene="hrk1"
                     /locus_tag="SPAC23C4.03"
                     /db_xref="GeneID:2541959"
     mRNA            <1034296..1035992
                     /gene="hrk1"
                     /locus_tag="SPAC23C4.03"
                     /product="haspin-like kinase Hrk1"
                     /transcript_id="NM_001018572.2"
                     /db_xref="GeneID:2541959"
     CDS             1034296..1035762
                     /gene="hrk1"
                     /locus_tag="SPAC23C4.03"
                     /codon_start=1
                     /product="haspin-like kinase Hrk1"
                     /protein_id="NP_593176.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.03"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.03.1"
                     /db_xref="GeneID:2541959"
                     /db_xref="GOA:O13924"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR024604"
                     /db_xref="PomBase:SPAC23C4.03"
                     /db_xref="PomBase:SPAC23C4.03.1"
                     /translation="MESRSKVKTYGKNRRYINKDIEIWASLDERPCALKPRNIENFNN
                     QERSDLEHIHSKPKKDSLLSWNILLKKGSYKENELLAKRNQNLVPTVIIPASPRDNAS
                     KSVVSKKEVVNLSSSVALSGKPANNSKLDPLHRLLQIVAQEDALPFSQFVKSQTFEIQ
                     KIGEASYSEVYQASNADDVPVVWKVIPFGEDGQAQYADVLNEVQISQWIKVDGFANLH
                     QVVVVKGTYPSLLLEEWDRYLMQNGSENDRPDSYSSTQLYCVLCLDHSGTDLEHFELR
                     SWRECWSVFYETLKILSLVETRYEFEHRDLHWGNILIRKADRSEEEVSFLLNEISLDD
                     IESVDFPGSQDKADDFDNILQVTLIDFTLARASYSQGIISYNEFNDPDLFNGVDDYQF
                     DIYRLMSRVTKGRWAQFFPITNVLWLHYLIHQLLHKKNLSSPLTETETLMRSRLKQIF
                     RLIDPVKTMQFQQAEDSIRSKSTVTSATSLLNWVRQKY"
     gene            <1036033..>1036508
                     /locus_tag="SPAC23C4.04c"
                     /db_xref="GeneID:5802865"
     mRNA            join(<1036033..1036343,1036397..>1036508)
                     /locus_tag="SPAC23C4.04c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001355999.1"
                     /db_xref="GeneID:5802865"
     CDS             join(1036033..1036343,1036397..1036508)
                     /locus_tag="SPAC23C4.04c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_001343030.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.04c.1"
                     /db_xref="GeneID:5802865"
                     /db_xref="GOA:A6X970"
                     /db_xref="PomBase:SPAC23C4.04c"
                     /db_xref="PomBase:SPAC23C4.04c.1"
                     /translation="MFCYFLSKSYDDCSRYYIISNMAFYFPVYDSDSPTTVHHDERKE
                     SWRSHGFIVCLHIRCCICCKYNSKIKKPSLNIALRIQSLKIIKILIFQFYSTKPLWDK
                     NSPEYKQLRSEIEATKRDEEVKNGELIDPNVTTEDEKL"
     gene            complement(1036639..1038267)
                     /locus_tag="SPAC23C4.05c"
                     /db_xref="GeneID:2541954"
     mRNA            complement(join(1036639..1038061,1038116..1038267))
                     /locus_tag="SPAC23C4.05c"
                     /product="LEA domain protein"
                     /transcript_id="NM_001018573.2"
                     /db_xref="GeneID:2541954"
     CDS             complement(join(1036833..1038061,1038116..1038182))
                     /locus_tag="SPAC23C4.05c"
                     /codon_start=1
                     /product="LEA domain protein"
                     /protein_id="NP_593177.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.05c.1"
                     /db_xref="GeneID:2541954"
                     /db_xref="GOA:O94559"
                     /db_xref="InterPro:IPR018803"
                     /db_xref="PomBase:SPAC23C4.05c"
                     /db_xref="PomBase:SPAC23C4.05c.1"
                     /translation="MQPRFLLHGALLALGIQLCLSIGKITGHISSIEATAADIHDAPS
                     TTTKYVQRTVYAGREKGKIGGPADSWPQRKLDDFLQNHGVKSLDVPPIETPSQFWRKP
                     LQYVSKVTDKCKSFYEKEKNHASHNAQKLDVWIFNSWTNSELSRWLIKNKYEVPEPGT
                     REQLLETVFQASMGDAISTNDELESWSNNLLLSMLDQKNITVPIGASHDDLIVLARRY
                     YDIEERKSQDKVTNITDSQPAPYMKEIIHLWSDGRLIDFLRERNIPISVLSPRETLLK
                     EAYANRFTPRVMIASNVLDGWSSEDLLDWIWKYNKRGSIFSHVAYNSRHELIHAAKLF
                     YMDVASEWSSSDMASLNDSLYSHPSVSKQSTWTEEELKEELESFGELVPVPFSSTKAF
                     ERLLPHLYYYLRGPAFLNRIHYWQTFLGNSLKRAFVLSQ"
     gene            1038379..1041195
                     /gene="tht2"
                     /locus_tag="SPAC23C4.07"
                     /gene_synonym="mug22"
                     /db_xref="GeneID:2541939"
     mRNA            1038379..1041195
                     /gene="tht2"
                     /locus_tag="SPAC23C4.07"
                     /gene_synonym="mug22"
                     /product="protein mug22"
                     /transcript_id="NM_001018575.2"
                     /db_xref="GeneID:2541939"
     gene            complement(1038515..1042027)
                     /locus_tag="SPAC23C4.06c"
                     /db_xref="GeneID:2541945"
     mRNA            complement(1038515..1042027)
                     /locus_tag="SPAC23C4.06c"
                     /product="putative methyltransferase"
                     /transcript_id="NM_001018574.2"
                     /db_xref="GeneID:2541945"
     CDS             complement(1038666..1039649)
                     /locus_tag="SPAC23C4.06c"
                     /codon_start=1
                     /product="putative methyltransferase"
                     /protein_id="NP_593178.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.06c.1"
                     /db_xref="GeneID:2541945"
                     /db_xref="GOA:O13926"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PomBase:SPAC23C4.06c"
                     /db_xref="PomBase:SPAC23C4.06c.1"
                     /translation="MTFYYIRILRLQEKLEESFKYALRVVFTITSDLGEVSYPQDATV
                     RVEALDRQQSHSRITISKQCVSWIGNGHAAETTLYFPASHQQIQLTLHLENQNSIVDS
                     IHINADTVLPVWSEAFSPKSTLPNMVWRYIQGPEKKSPNDGLWFLEQMGNSIAKHLWD
                     AGVVFSKKILSDDWHYSFSNRKDINVLELGSGCGIVGISIASKYPRALVSMTDTEDAI
                     EFMEKNVEKNKSAMSNNITSDILVWGHDIPRKFRRHWDYIVMSDVMYNESSFSDLEAS
                     LQELMDKNTKLYIAYKKRHDNEKTFMSNILGWLDLVYEERGPITIYILQKK"
     CDS             1040241..1040846
                     /gene="tht2"
                     /locus_tag="SPAC23C4.07"
                     /gene_synonym="mug22"
                     /codon_start=1
                     /product="protein mug22"
                     /protein_id="NP_593179.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.07"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.07.1"
                     /db_xref="GeneID:2541939"
                     /db_xref="GOA:O13927"
                     /db_xref="PomBase:SPAC23C4.07"
                     /db_xref="PomBase:SPAC23C4.07.1"
                     /translation="MENQVSSFLIDSPMEWKTYMKSLSDDNPSFGDVTVNLTKISVSS
                     KNAKSYAEEMYNYVTQEMVFISERSRLLLRAKRRLYKNQSLMKKTSVSTSNTVKMVFM
                     SLAKQIEQMLKFCMMVYSKLCEAFETTLKVAKEFQICDSSQEWFFQFQLGYHRKQMEL
                     QMLSFVAEWLVLTQHYTDALNDSAKTLYDIMESSHKAAQKV"
     gene            1041414..1043083
                     /gene="rho3"
                     /locus_tag="SPAC23C4.08"
                     /db_xref="GeneID:3361511"
     mRNA            join(1041414..1041598,1041673..1041745,1042070..1043083)
                     /gene="rho3"
                     /locus_tag="SPAC23C4.08"
                     /product="Rho family GTPase Rho3"
                     /transcript_id="NM_001018576.2"
                     /db_xref="GeneID:3361511"
     CDS             join(1041535..1041598,1041673..1041745,1042070..1042550)
                     /gene="rho3"
                     /locus_tag="SPAC23C4.08"
                     /codon_start=1
                     /product="Rho family GTPase Rho3"
                     /protein_id="NP_001018193.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.08"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.08.1"
                     /db_xref="GeneID:3361511"
                     /db_xref="GOA:O13928"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PomBase:SPAC23C4.08"
                     /db_xref="PomBase:SPAC23C4.08.1"
                     /translation="MSSCFGSKKKPIYRKIVILGDGAAGKTSLLNVFTKGYFPQVYEP
                     TIFENYIHDIFVDGNSIELSLWDTAGQEEYDQLRSLSYSDTHVIMICFAVDSRDSLEN
                     VITKWLPEVSSNCPGVKLVLVALKCDLRGADEEQVDHSKIIDYEEGLAAAKKINAVRY
                     LECSAKLNRGVNEAFTEAARVALAAQPRGTKDGADESHGTGCIIA"
     gene            complement(1041980..1044240)
                     /locus_tag="SPAC23C4.09c"
                     /db_xref="GeneID:2541923"
     mRNA            complement(join(1041980..1043264,1043382..1043512,
                     1043596..1043671,1043720..1043789,1044001..1044240))
                     /locus_tag="SPAC23C4.09c"
                     /product="putative DNA-binding TFAR19-related protein"
                     /transcript_id="NM_001018577.2"
                     /db_xref="GeneID:2541923"
     CDS             complement(join(1043220..1043264,1043382..1043512,
                     1043596..1043671,1043720..1043789,1044001..1044074))
                     /locus_tag="SPAC23C4.09c"
                     /codon_start=1
                     /product="putative DNA-binding TFAR19-related protein"
                     /protein_id="NP_593181.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.09c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.09c.1"
                     /db_xref="GeneID:2541923"
                     /db_xref="GOA:O13929"
                     /db_xref="InterPro:IPR002836"
                     /db_xref="PomBase:SPAC23C4.09c"
                     /db_xref="PomBase:SPAC23C4.09c.1"
                     /translation="MDEELQAIRQARLAQLQAEHGSAPSNIASGPSSNQQQQEVQDEM
                     RQNLLSQILEHPARDRLRRIALVRKDRAEAVEELLLRMAKTGQISHKISEPELIELLE
                     KISGEVSKRNETKIVINRRVQDDEDDWDL"
     repeat_region   1044522..1044860
                     /rpt_type=long_terminal_repeat
     gene            1044844..1046788
                     /gene="sec2"
                     /locus_tag="SPAC23C4.10"
                     /db_xref="GeneID:2541930"
     mRNA            1044844..1046788
                     /gene="sec2"
                     /locus_tag="SPAC23C4.10"
                     /product="putative guanyl-nucleotide exchange factor Sec2"
                     /transcript_id="NM_001018578.2"
                     /db_xref="GeneID:2541930"
     CDS             1044995..1046578
                     /gene="sec2"
                     /locus_tag="SPAC23C4.10"
                     /codon_start=1
                     /product="putative guanyl-nucleotide exchange factor Sec2"
                     /protein_id="NP_593182.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.10.1"
                     /db_xref="GeneID:2541930"
                     /db_xref="GOA:O13930"
                     /db_xref="InterPro:IPR009449"
                     /db_xref="PomBase:SPAC23C4.10"
                     /db_xref="PomBase:SPAC23C4.10.1"
                     /translation="MPDVSNVRVKPNQHPYEKEVNGKLMSQEEILSQKLVAAIERQAA
                     LDDKYATEVHRNEALSERIRELEAKLSAKKSFDEELVKFHNLEEKLQLTETKCRNAES
                     EKSRVENELEDLTSSLFEEANRMVANARKETVASEKRVNQLKKQLVDAETLLSSTQHQ
                     LTELKDVMHSMSDSHEQNNALHPPLSRTTSFVADNVSVGSFASSTSGLDILTGTSARE
                     SLDAKEISSDKHLNISGERPATFPNPTFIEGSDERRSASSLGHRTNNNQNQLIRFSTQ
                     IRSSSTSPPRSPLIISDSPSSSIIHNPHPTHPSASAMNYMNPCFLEFHAFFNYPMKFA
                     RSRSAYSTSANYSNTPPRNTVTPSTARSSTLSQNPSSSSNSIPLISRNLRDFSFFKRC
                     LEEDIEPTLRLDHASGLSWLTRRSVFTAILESSLIINPLHSTSLLSSQPCSLCGFNRT
                     QPLRQFEFRSRPDSTSHASCTYCVARLRSVCNFVAFLHQICKGVWSSCSLEKAWDECL
                     KKREAMFLSRVGLAKELEG"
     gene            complement(1046859..1048934)
                     /locus_tag="SPNCRNA.708"
                     /db_xref="GeneID:14218331"
     misc_RNA        complement(1046859..1048934)
                     /locus_tag="SPNCRNA.708"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151077.1"
                     /db_xref="GeneID:14218331"
     gene            1047065..1047741
                     /gene="atp18"
                     /locus_tag="SPAC23C4.11"
                     /db_xref="GeneID:2541918"
     mRNA            join(1047065..1047385,1047435..1047485,1047530..1047741)
                     /gene="atp18"
                     /locus_tag="SPAC23C4.11"
                     /product="putative F0-ATPase subunit J"
                     /transcript_id="NM_001018579.2"
                     /db_xref="GeneID:2541918"
     CDS             join(1047316..1047385,1047435..1047485,1047530..1047591)
                     /gene="atp18"
                     /locus_tag="SPAC23C4.11"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative F0-ATPase subunit J"
                     /protein_id="NP_593183.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.11"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.11.1"
                     /db_xref="GeneID:2541918"
                     /db_xref="GOA:O13931"
                     /db_xref="InterPro:IPR006995"
                     /db_xref="PomBase:SPAC23C4.11"
                     /db_xref="PomBase:SPAC23C4.11.1"
                     /translation="MSFFGLKRYSTPILKPMLPFFLGGAIVFYGTVKLRDAMMDSAEY
                     RNDPRNPKAGKYGSDH"
     gene            1048957..1051136
                     /gene="hhp2"
                     /locus_tag="SPAC23C4.12"
                     /db_xref="GeneID:2541929"
     mRNA            join(1048957..1049198,1049365..1050088,1050175..1051136)
                     /gene="hhp2"
                     /locus_tag="SPAC23C4.12"
                     /product="serine/threonine protein kinase Hhp2"
                     /transcript_id="NM_001018580.2"
                     /db_xref="GeneID:2541929"
     CDS             join(1049035..1049198,1049365..1050088,1050175..1050489)
                     /gene="hhp2"
                     /locus_tag="SPAC23C4.12"
                     /codon_start=1
                     /product="serine/threonine protein kinase Hhp2"
                     /protein_id="NP_593184.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.12"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.12.1"
                     /db_xref="GeneID:2541929"
                     /db_xref="GOA:P40236"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PomBase:SPAC23C4.12"
                     /db_xref="PomBase:SPAC23C4.12.1"
                     /translation="MTVVDIKIGNKYRIGRKIGSGSFGQIYLGLNTVNGEQVAVKLEP
                     LKARHHQLEYEFRVYNILKGNIGIPTIRWFGVTNSYNAMVMDLLGPSLEDLFCYCGRK
                     FTLKTVLLLADQLISRIEYVHSKSFLHRDIKPDNFLMKKHSNVVTMIDFGLAKKYRDF
                     KTHVHIPYRDNKNLTGTARYASINTHIGIEQSRRDDLESLGYVLLYFCRGSLPWQGLQ
                     ADTKEQKYQRIRDTKIGTPLEVLCKGLPEEFITYMCYTRQLSFTEKPNYAYLRKLFRD
                     LLIRKGYQYDYVFDWMILKYQKRAAAAAAASATAPPQVTSPMVSQTQPVNPITPNYSS
                     IPLPAERNPKTPQSFSTNIVQCASPSPLPLSFRSPVPNKDYEYIPSSLQPQYSAQLRR
                     VLDEEPAP"
     gene            1051665..1052724
                     /gene="bet1"
                     /locus_tag="SPAC23C4.13"
                     /db_xref="GeneID:2542068"
     mRNA            join(1051665..1051739,1051783..1051921,1051971..1052724)
                     /gene="bet1"
                     /locus_tag="SPAC23C4.13"
                     /product="putative SNARE protein Bet1"
                     /transcript_id="NM_001018581.2"
                     /db_xref="GeneID:2542068"
     CDS             join(1051729..1051739,1051783..1051921,1051971..1052174)
                     /gene="bet1"
                     /locus_tag="SPAC23C4.13"
                     /codon_start=1
                     /product="putative SNARE protein Bet1"
                     /protein_id="NP_593185.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.13"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.13.1"
                     /db_xref="GeneID:2542068"
                     /db_xref="GOA:O13932"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="PomBase:SPAC23C4.13"
                     /db_xref="PomBase:SPAC23C4.13.1"
                     /translation="MGSRFGRRKERNGDMLPLYESQSPQHLDSLENENDERISKLTGK
                     VKSLKELTMNIGTEITSSTKLMESMNDSFDSTKSLLSGTMTRLKNVSKNGGISIWMWL
                     AFFCLVALILVLVRF"
     gene            1052875..>1054468
                     /gene="alg1"
                     /locus_tag="SPAC23C4.14"
                     /db_xref="GeneID:2541937"
     mRNA            join(1052875..1053167,1053244..1053676,1053720..1054254,
                     1054346..>1054468)
                     /gene="alg1"
                     /locus_tag="SPAC23C4.14"
                     /product="putative mannosyltransferase complex subunit
                     Alg1"
                     /transcript_id="NM_001018582.2"
                     /db_xref="GeneID:2541937"
     CDS             join(1052984..1053167,1053244..1053676,1053720..1054254,
                     1054346..1054468)
                     /gene="alg1"
                     /locus_tag="SPAC23C4.14"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /product="putative mannosyltransferase complex subunit
                     Alg1"
                     /protein_id="NP_593186.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.14"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.14.1"
                     /db_xref="GeneID:2541937"
                     /db_xref="GOA:O13933"
                     /db_xref="InterPro:IPR026051"
                     /db_xref="InterPro:IPR028098"
                     /db_xref="PomBase:SPAC23C4.14"
                     /db_xref="PomBase:SPAC23C4.14.1"
                     /translation="MLVLKIVLFLSLVIWFNLKKRTDKKRIIVLVLGDIARSPRMQYH
                     AVSFAKLGWKVDLLGYQHPGSSVGLFESHENIRFYPIPSLPAYLQPKNRLQFLFLGPL
                     KVLHQFLALNWALFVRKPASFLFIQNPPCIPVFFIAQCLHILRGTKFIIDWHNFGYSI
                     LALKLGKQHTFVKLLKIYEKYMARGAYAHLTVSKRMKDVLQTWGMNPCYVCYDRPPNH
                     FTPIKNEQKKQMSIKKIPCEYNPSSTKLLITSTSWTPDEDIYILWEALNEYDKTLDTP
                     KLLVLITGKGPMKEEFSQYIKKHPLHKVRFCMPWLSIEDYPQVMACADLGVCLHTSSS
                     GLDLPMKVVDLFGCGVPVIALSYPTISELVHDGENGLIVNDSKALSKKMQYLLTHANE
                     LNSLKLGALKESEYRWDDEWNKVIPPIVQGSN"
     gene            1054665..1055906
                     /gene="rpb5"
                     /locus_tag="SPAC23C4.15"
                     /db_xref="GeneID:2541910"
     mRNA            join(1054665..1054809,1054874..1054956,1055168..1055906)
                     /gene="rpb5"
                     /locus_tag="SPAC23C4.15"
                     /product="DNA-directed RNA polymerase subunit Rpb5"
                     /transcript_id="NM_001018583.2"
                     /db_xref="GeneID:2541910"
     CDS             join(1054735..1054809,1054874..1054956,1055168..1055642)
                     /gene="rpb5"
                     /locus_tag="SPAC23C4.15"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase subunit Rpb5"
                     /protein_id="NP_593187.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.15"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.15.1"
                     /db_xref="GeneID:2541910"
                     /db_xref="GOA:Q09191"
                     /db_xref="InterPro:IPR000783"
                     /db_xref="InterPro:IPR005571"
                     /db_xref="InterPro:IPR014381"
                     /db_xref="InterPro:IPR020608"
                     /db_xref="InterPro:IPR020609"
                     /db_xref="PDB:3H0G"
                     /db_xref="PomBase:SPAC23C4.15"
                     /db_xref="PomBase:SPAC23C4.15.1"
                     /translation="MSAEEKNIVRVFRAWKTAHQLVHDRGYGVSQAELDLTLDQFKAM
                     HCGMGRNLDRTTLSFYAKPSNDSNKGTIYIEFAKEPSVGIKEMRTFVHTLGDHNHKTG
                     ILIYANSMTPSAAKIIATVTGQFTIETFQESDLIVNITHHELVPKHILLSPDEKKELL
                     DRYKLRETQLPRIQLADPVARYLGLKRGEVVKIVRRSETSGRYNSYRICA"
     gene            complement(1055849..1057578)
                     /gene="atg15"
                     /locus_tag="SPAC23C4.16c"
                     /db_xref="GeneID:2541924"
     mRNA            complement(1055849..1057578)
                     /gene="atg15"
                     /locus_tag="SPAC23C4.16c"
                     /product="autophagy-associated lipase Atg15"
                     /transcript_id="NM_001018584.2"
                     /db_xref="GeneID:2541924"
     CDS             complement(1056141..1057415)
                     /gene="atg15"
                     /locus_tag="SPAC23C4.16c"
                     /codon_start=1
                     /product="autophagy-associated lipase Atg15"
                     /protein_id="NP_593188.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.16c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.16c.1"
                     /db_xref="GeneID:2541924"
                     /db_xref="GOA:O13934"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PomBase:SPAC23C4.16c"
                     /db_xref="PomBase:SPAC23C4.16c.1"
                     /translation="MSQLLFLRRFFFLFCFIIRISCTGVFESVIKSSENVPDKVNVKL
                     QHVFHYGLNEDSISYYRLDVAKKSVYAESESKLPLKMKKGYSVHLKDQSRDALTDYRY
                     KSMKGIYSEANSPADLWEQEAIVIPDITDKETIYSLGKMSYNAYQKIPFDGDWLDLGP
                     DWNITPPEGFGWEEDGLRGHVFSNDDNSTIIIAMKGTSIFGIGRGTSQKDRVNDNLLF
                     SCCCARVSWAWSTVCGCYKNTYTCSQTCLEDEVQDDSRYYSASLDIFYSVKELYPDAQ
                     IWLTGHSLGGATAALMGLSFGIPTVTFEAPGDRMAARRLHLPMPPGLPDEESLVWHFG
                     HNADPIYLGKCTGPTSLCWAGGYAMESTCHTGQECLYDVVKDKGWHLSITHHRMQTVL
                     NDVIDAYEKLPDCSHTPNCVDCYLWEFPDDDS"
     gene            complement(1057647..1058238)
                     /locus_tag="SPNCRNA.709"
                     /db_xref="GeneID:14218152"
     misc_RNA        complement(1057647..1058238)
                     /locus_tag="SPNCRNA.709"
                     /product="intergenic RNA (predicted)"
                     /transcript_id="NR_151078.1"
                     /db_xref="GeneID:14218152"
     gene            1057701..1061166
                     /locus_tag="SPAC23C4.17"
                     /db_xref="GeneID:2541917"
     mRNA            join(1057701..1058415,1058465..1058514,1058623..1059777,
                     1059838..1060104,1060143..1060670,1060709..1061166)
                     /locus_tag="SPAC23C4.17"
                     /product="tRNA (cytosine-5-)-methyltransferase"
                     /transcript_id="NM_001018585.2"
                     /db_xref="GeneID:2541917"
     CDS             join(1058395..1058415,1058465..1058514,1058623..1059777,
                     1059838..1060104,1060143..1060670,1060709..1060745)
                     /locus_tag="SPAC23C4.17"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /product="tRNA (cytosine-5-)-methyltransferase"
                     /protein_id="NP_593189.2"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.17"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.17.1"
                     /db_xref="GeneID:2541917"
                     /db_xref="GOA:O13935"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023270"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PomBase:SPAC23C4.17"
                     /db_xref="PomBase:SPAC23C4.17.1"
                     /translation="MGKRNKKVTQGKRAYNDKSEIVLENKQFEGYYKKQNLFRGKPND
                     EFDSFMEYMRKPLPTTFRICGYRHHAFELKNHFEKYYVPSLKNVVHEGQTIPPPTVLP
                     WYPDGLAYIVDAQKDVIRKSPPLKRLQRFLVSENEAGNINRQEAVSMLPPLFLDVEPH
                     HVILDMCAAPGSKTAQLIEAVYKKANIKDAAHDSKNLKSVEGLVIANDADPKRAQMLV
                     HQINRLNSPNILVVNHDASTMPNIYVKGSSPSDGLNVIEEKKILKFDRILADVPCSGD
                     GTFRKNLSLWREWSANSAFSLHPLQLRILIRGLQLLKVGGCLVYSTCSINPIENEAVV
                     TAALKATGGAVSLVDVSKKLPLLKRDPGLLSWKVLDDSLNEFQSPAENTNDKIELTES
                     MWPLPEEEMSKLHIERCARLYPHMQNTGGFFVAVLQKTDPINSRSFDPKKYTASMEIL
                     PPENKRQRTEKGVDEASNSTLTKSGNSYFDEEPFVYINPDDTSIKTIVDFYGIDPSFP
                     RDQFFVRNQSGIPVRSIYFACSLFKEIIEANTNRVKFVHGGVRFFVKQEISQLLKDFS
                     LKANKDICNFRIHSNGVNIISPFLNEKHFYDAGLKDLKILVKNEYPHVEQFSESGMLK
                     KEFEKMPLGCNILRVDAQTKDGALMDMLILQPIWRSPTSCNLMLARKEKQNLSLELFG
                     MDV"
     gene            complement(1058646..1063306)
                     /gene="rad4"
                     /locus_tag="SPAC23C4.18c"
                     /gene_synonym="cut5; dpb11; dre3"
                     /db_xref="GeneID:2543281"
     mRNA            complement(join(1058646..1062564,1062631..1062738,
                     1062796..1063306))
                     /gene="rad4"
                     /locus_tag="SPAC23C4.18c"
                     /gene_synonym="cut5; dpb11; dre3"
                     /product="BRCT domain protein Rad4"
                     /transcript_id="NM_001018586.2"
                     /db_xref="GeneID:2543281"
     CDS             complement(join(1060792..1062564,1062631..1062738,
                     1062796..1062861))
                     /gene="rad4"
                     /locus_tag="SPAC23C4.18c"
                     /gene_synonym="cut5; dpb11; dre3"
                     /codon_start=1
                     /product="BRCT domain protein Rad4"
                     /protein_id="NP_593190.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.18c"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.18c.1"
                     /db_xref="GeneID:2543281"
                     /db_xref="GOA:P32372"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="PDB:4BMC"
                     /db_xref="PDB:4BMD"
                     /db_xref="PDB:4BU0"
                     /db_xref="PDB:4BU1"
                     /db_xref="PomBase:SPAC23C4.18c"
                     /db_xref="PomBase:SPAC23C4.18c.1"
                     /translation="MGSSKPLKGFVICCTSIDLKQRTEISTKATKLGAAYRSDFTKDV
                     THLIAGDFDTPKYKFAAKSRPDIKIMSSEWIPVLYESWVQGEDLDDGLLVDKHFLPTL
                     FKCRVCLTNIGQPERSRIENYVLKHGGTFCPDLTRDVTHLIAGTSSGRKYEYALKWKI
                     NVVCVEWLWQSIQRNAVLEPQYFQLDMPAEKIGLGAYVRLDPNTTEAKSYSENQKISK
                     NKEKSGQSLAALAEEADLEPVIMKRGKKRDRSILWEELNNGKFEFSSRSEENSVLLDD
                     FTPETVQPLEENELDTELNIENEAKLFKNLTFYLYEFPNTKVSRLHKCLSDNGGQISE
                     FLSSTIDFVVIPHYFPVDELPIFSFPTVNEWWIERCLYYKKIFGIDEHALAKPFFRPS
                     LVPYFNGLSIHLTGFKGEELSHLKKALTILGAVVHEFLGVQRSILLVNTNEPFSMKTR
                     FKIQHATEWNVRVVGVAWLWNIIQSGKFIDQVSPWAIDKKENQEIKKFTNQNNMVFPT
                     SDRDTRLQNSLAQQPIGHSTPHNSPSLLSVKKRQNNHIRSNTLIQLNSNSKDSTIFPR
                     RSVTVPGDKIDTVWKSSVTKPETPTSPQEHVSYIDPDAQREKHKLYAQLTSNVDAIPP
                     ANDLQNQENGLLLITESHRKLRRR"
     gene            1063021..1063448
                     /locus_tag="SPNCRNA.166"
                     /db_xref="GeneID:9407228"
     misc_RNA        1063021..1063448
                     /locus_tag="SPNCRNA.166"
                     /product="non-coding RNA (predicted)"
                     /transcript_id="NR_150555.1"
                     /db_xref="GeneID:9407228"
     gene            1063729..1066954
                     /gene="spt5"
                     /locus_tag="SPAC23C4.19"
                     /db_xref="GeneID:2541916"
     mRNA            1063729..1066954
                     /gene="spt5"
                     /locus_tag="SPAC23C4.19"
                     /product="transcription elongation factor Spt5"
                     /transcript_id="NM_001018587.2"
                     /db_xref="GeneID:2541916"
     CDS             1063867..1066839
                     /gene="spt5"
                     /locus_tag="SPAC23C4.19"
                     /codon_start=1
                     /product="transcription elongation factor Spt5"
                     /protein_id="NP_593191.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC23C4.19"
                     /db_xref="EnsemblGenomes-Tr:SPAC23C4.19.1"
                     /db_xref="GeneID:2541916"
                     /db_xref="GOA:O13936"
                     /db_xref="InterPro:IPR005100"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR006645"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR017071"
                     /db_xref="InterPro:IPR022581"
                     /db_xref="InterPro:IPR024945"
                     /db_xref="PDB:4PZ8"
                     /db_xref="PomBase:SPAC23C4.19"
                     /db_xref="PomBase:SPAC23C4.19.1"
                     /translation="MDTNSPKSIDKDANSTEVDAAEQDAASVKINSTRASPNGSDLLN
                     DDSEAAKITTNEKQSSPVDSHNESPNDTTINKGEDGNENEVDNVNNNDKKEDEDNVEE
                     NEEEADANEEEEEDEEDDEEDEEDEDESGGGRRKRARHDRRNQFLDIEAEVDEDEEEL
                     EDEEDEIGREDGFIEEEVGADYVGDDRRHRELDRQRQELQSVDAERLAEEYREKYGRS
                     QTVVGDTSNVPQRLLLPSVNDPNIWAVRCKIGKEKDIVFTIMRKAMDLQYTSSPLEII
                     SAFQRDSLVGYIYVEARKQSHVLDALNGVLNVYTNNMILVPIKEMPDLLKVQKQVVEL
                     LPGAYVRIRRGKYAGDLAQVDNLSENGLTARVRIVPRIDYSDGLKRKNSATRPQARLF
                     NESEAFKSNPSKFSKRGPRLFLFNNEEFEDGFLVKDIRISSLITEGVNPTLDEVSKFN
                     PNNEDLDLSSLALSVKGGHAEFQPGDHVEVYVGEQTGVSGVVENVRGSVITMVSSDGL
                     RLDVPSRGLRKRFRHGDYVKVIAGKYKDDTGMVVRISKDEVTFLSDTLMTELTVFSRD
                     LGEASSAQAVNSAYELHDLVQLDVNTVACIFSVDRDTYKVIDQNGGVRTVLASQITMR
                     HSNRRGVATDRNGAEIRIGDKVKEVGGEGKQGTILHIYRAFVFLHNRDIAENNGVFSA
                     RSRNVATIAAKGARISADLTKMNPALSNGPALPPVANLKRTIGRDKAIGATVRIRRGP
                     MKGLLGVIKDTTDANARVELHTGNKMVTIPKENLLYTTKTGELISYTEFIERSRGIRP
                     GSISTADGPNVPNWAQGARTPAVANGSRTPAWNTGSRTPAWNSGSKTPAWNSGSRTPA
                     WNSGNKTPAWNAGSRTPAWNSGNKTPAWNVGNKTPAWNSGAKTPAWNAGNKTPSWNNG
                     TKTPAWNANQTPMVANGTNTSWGQTPAYGGFSETNWDTEDNSKPYTAPTPGAWAAPTP
                     GGWDDEEGDSPKYVPPSP"
     gene            complement(1066192..1070006)
                     /locus_tag="SPAC1A6.01c"
                     /db_xref="GeneID:2542431"
     mRNA            complement(join(1066192..1067718,1067773..1070006))
                     /locus_tag="SPAC1A6.01c"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018588.2"
                     /db_xref="GeneID:2542431"
     CDS             complement(join(1067031..1067718,1067773..1068452))
                     /locus_tag="SPAC1A6.01c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_593192.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1A6.01c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1A6.01c.1"
                     /db_xref="GeneID:2542431"
                     /db_xref="GOA:O13855"
                     /db_xref="InterPro:IPR009349"
                     /db_xref="PomBase:SPAC1A6.01c"
                     /db_xref="PomBase:SPAC1A6.01c.1"
                     /translation="MEKWTKENVLKILPVDDESAAMITSTALAVDSSEAAKDYWISLL
                     GDSAETIEFISDFNQKRFHSTHSGNSPSIMKNKKNVTPNNNIRQKNTATSSHPSFYIA
                     NNKQKGYDEEMYKVNPASRNKSQSNNISSHEKSSKTTKNVSPGVMTSDLIPEKKSVKH
                     NNSSSNRIEGLADIEKAIRQIEISQNINKAERRVCNCQGRKHPLNEAAPNCLNCGKII
                     CIVEGIGPCTFCDNPVISKAQQLELIQELKHEGSRLKQAANQKRKSKTVSSKNNFQRL
                     QNSSLHSIFLDPKQLEQKAQEAEERKNVLLNFDRTSAQRTRIIDEAADFDPTSLASDT
                     WASPAEKALNLVRMQKAMAKKEKKKKKVLSISLSGKKVVVDQKEASSESSDEDQDELD
                     NLTKVEGQSHSHNPKAPVIRNLPRPIYHQDLHSSHVAVPESILNKINQKWSKVQDDDG
                     MPSML"
     gene            1068668..1070235
                     /locus_tag="SPAC1A6.02"
                     /db_xref="GeneID:3361484"
     mRNA            1068668..1070235
                     /locus_tag="SPAC1A6.02"
                     /product="WD repeat-containing protein"
                     /transcript_id="NM_001356000.1"
                     /db_xref="GeneID:3361484"
     CDS             1068731..1069816
                     /locus_tag="SPAC1A6.02"
                     /codon_start=1
                     /product="WD repeat-containing protein"
                     /protein_id="NP_001342873.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1A6.02"
                     /db_xref="EnsemblGenomes-Tr:SPAC1A6.02.1"
                     /db_xref="GeneID:3361484"
                     /db_xref="GOA:O13856"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017422"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="PomBase:SPAC1A6.02"
                     /db_xref="PomBase:SPAC1A6.02.1"
                     /translation="MGGTINAAIKQKFENEIFDLACFGENQVLLGFSNGRVSSYQYDV
                     AQISLVEQWSTKRHKKSCRNISVNESGTEFISVGSDGVLKIADTSTGRVSSKWIVDKN
                     KEISPYSVVQWIENDMVFATGDDNGCVSVWDKRTEGGIIHTHNDHIDYISSISPFEER
                     YFVATSGDGVLSVIDARNFKKPILSEEQDEEMTCGAFTRDQHSKKKFAVGTASGVITL
                     FTKGDWGDHTDRILSPIRSHDFSIETITRADSDSLYVGGSDGCIRLLHILPNKYERII
                     GQHSSRSTVDAVDVTTEGNFLVSCSGTELAFWPVDQKEGDESSSSDNLDSDEDSSSDS
                     EFSSPKKKKKVGNQGKKPLGTDFFDGL"
     gene            complement(1069923..1072343)
                     /locus_tag="SPAC1A6.03c"
                     /db_xref="GeneID:2542220"
     mRNA            complement(join(1069923..1070138,1070205..1072343))
                     /locus_tag="SPAC1A6.03c"
                     /product="putative phospholipase"
                     /transcript_id="NM_001018590.3"
                     /db_xref="GeneID:2542220"
     CDS             complement(join(1070061..1070138,1070205..1072127))
                     /locus_tag="SPAC1A6.03c"
                     /EC_number="3.1.1.5"
                     /codon_start=1
                     /product="putative phospholipase"
                     /protein_id="NP_593194.3"
                     /db_xref="EnsemblGenomes-Gn:SPAC1A6.03c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1A6.03c.1"
                     /db_xref="GeneID:2542220"
                     /db_xref="GOA:O13857"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="PomBase:SPAC1A6.03c"
                     /db_xref="PomBase:SPAC1A6.03c.1"
                     /translation="MLFNCFGILALLQILPALAYPPCREQMSDPYEFGESDLMRPGMH
                     DTPLSLMQKREALAISLSKRDSVGSYAPYNVTCPSDYMLRPASDGISSGEQSFIDKRI
                     PKINTQMRSFISNTGLDVDVNSVINDSDGPRLGLAFSGGGLRAMVHGGGVLNAFDSRN
                     GNGSSLAGILQSAMYIAGLSGGSWLVGSVAVNNFANITYLRDNVWNLEHSVFAPHGDN
                     VVENLAYYDDLDDEIDQKKDAGFDTSLTDLWGRALSRKLVDATQGGPNITFSSIRNQT
                     WFQNADYPYPIIISDSRLEEEKAIPANTSIFEFTPYEFGTWDNGIKAFLPMEYVGTHL
                     KNGVPPDHKCIRNYDNAGFVMGTSATLFNTFLLEWSQEVTSNSTLYDIIHKVFEKLSE
                     DQNDIAPYPNPYQNFTTTNTTVKNPFERFDTIDLVDGGEDDENIPIWPLLHPQRFVDV
                     IFAVDATYDDSNGWPDGSSIVTTYERIITYNANKSVDVRGFPYIPDEDTIISLGLNTH
                     PTFFGCDGRNTTAGNHTVDNNTPPLLVYFPNYPWVYYSNISTFTMSMNDTLSSGILEN
                     AALSATQNNSDSFAVCLACAMIQRSLERKNMSTPSQCSSCFEQYCWNGTTVNNPSAVS
                     NYAPTVLSASTTSGTSSTTKASPTHTPWYESLFDLKELKSID"
     gene            1073171..1074075
                     /locus_tag="SPAC1A6.11"
                     /db_xref="GeneID:2542238"
     mRNA            1073171..1074075
                     /locus_tag="SPAC1A6.11"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018591.2"
                     /db_xref="GeneID:2542238"
     CDS             1073534..1073854
                     /locus_tag="SPAC1A6.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_593195.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1A6.11"
                     /db_xref="EnsemblGenomes-Tr:SPAC1A6.11.1"
                     /db_xref="GeneID:2542238"
                     /db_xref="PomBase:SPAC1A6.11"
                     /db_xref="PomBase:SPAC1A6.11.1"
                     /translation="MNHNVYLLTSFNLWSHGVYKISSISLSNSFFPHSFMFVKSLHLM
                     TSQHIFKCLSSCNYALSILHNICLASFLYLSKCYYHTHILTSVRLDFCKSHAHTYIKS
                     KAST"
     gene            complement(1074331..1077514)
                     /gene="plb1"
                     /locus_tag="SPAC1A6.04c"
                     /db_xref="GeneID:2542497"
     mRNA            complement(1074331..1077514)
                     /gene="plb1"
                     /locus_tag="SPAC1A6.04c"
                     /product="lysophospholipase 1"
                     /transcript_id="NM_001018592.2"
                     /db_xref="GeneID:2542497"
     CDS             complement(1074777..1076618)
                     /gene="plb1"
                     /locus_tag="SPAC1A6.04c"
                     /EC_number="3.1.1.5"
                     /codon_start=1
                     /product="lysophospholipase 1"
                     /protein_id="NP_593196.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1A6.04c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1A6.04c.1"
                     /db_xref="GeneID:2542497"
                     /db_xref="GOA:P78854"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="PomBase:SPAC1A6.04c"
                     /db_xref="PomBase:SPAC1A6.04c.1"
                     /translation="MLFRGLSLWMLFLASCLSALALPAAEDDGSVKVFKRAKKHSTKQ
                     EGPSYAPYYVDCPSDNIVESLSSNEIPSAESEYLSTRSTITNTAMKDFLRNANLPGLN
                     ADTLSGSEGPSIGIALSGGGLRAMILGSGALSAMDARHDNHTVLTGLLQASDYLVGTD
                     GSAWTVGGIALNNFSTINDFSKLWAFNHPLMYPKSAIVFNAHFYSSIMNEVAEKANAG
                     FNISLSDYWGRVISRTLGDTTYGFPNVSLSSITSQEWYRNANFPYPIITFATQNYGED
                     ISNVNTTFFEASPNVFGTFDHGINSFIPTEYLGTTLNNGASSNGSCVINYDNFGFMMG
                     ASSTYFNKIMRNFNDSSTKNGRIIQQYLKGNFSENGQQIISIPNPFQGVESANSDAAN
                     NLGSSSSLNLVDTFLTGEKIPLWPLLQKGRDVDVIVAVDNGDDSEWLWPNGNSLVQTY
                     ERVVAAQAAGNTNVKGFPYVPSQQSFVSLHFNDRPVFFGCDGRNTTAGNHTVTRDTPP
                     LVIYLPNVPYNYFTNISTDRTYYTEDMIQQLLTNGLISSTVDNDTYFGQCFACAVVKR
                     TLERNNITASPECQQCYYNYCWSGLYDDSAANDDIVYNPTCRLGEGI"
     gene            complement(1079635..1081713)
                     /locus_tag="SPAC1A6.05c"
                     /db_xref="GeneID:2542205"
     mRNA            complement(join(1079635..1080606,1080659..1081433,
                     1081471..1081713))
                     /locus_tag="SPAC1A6.05c"
                     /product="putative triacylglycerol lipase"
                     /transcript_id="NM_001018593.2"
                     /db_xref="GeneID:2542205"
     CDS             complement(join(1080021..1080606,1080659..1081433,
                     1081471..1081561))
                     /locus_tag="SPAC1A6.05c"
                     /EC_number="3.1.1.3"
                     /codon_start=1
                     /product="putative triacylglycerol lipase"
                     /protein_id="NP_593197.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1A6.05c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1A6.05c.1"
                     /db_xref="GeneID:2542205"
                     /db_xref="GOA:Q9Y827"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="PomBase:SPAC1A6.05c"
                     /db_xref="PomBase:SPAC1A6.05c.1"
                     /translation="MSKNEIKLQMEYASSYETWLEAAEKLDVIEGKYQWREQKESDEY
                     DYVLVESRLHELRRHRLSKNTRLLLGLLRNSVARDFANMDNSRLYNYAHSGTKKLIDE
                     FIQEVLMCLTYLEETPDLSLDEKITEFSRLKLTTGNTALILSGGGTFGMTHIGVLQSL
                     HEQGLVPKIICGSSAGAIVACAAAVRNKEEQEILLRQFHTGDLSVFTDPNAAPPSVIQ
                     SVKQYFTRGCVLDISHLERVMKLLIGDFTFQEAYDRSGYILNVTVSCGSLFEMPSLLN
                     YITAPNVLVWSAVVATCSVPFLFKRATLWERDPLTREVSAFCVTDAPLWMDGSVDNDI
                     PHAKLTELFHVNHFIVSQVNFHIVPFIMDPTSHNWVERCCKKAIDLAAQEVSLTFRLF
                     AELGIFSVLFTKLQSVITQKYSGDITIIPRLNYREVNKVIKNPTPSFLLDAATRGKRG
                     TWTKVPVTRNHCAIEILIAAAYTRLIKRSKSLK"
     gene            1081802..1083525
                     /locus_tag="SPNCRNA.710"
                     /db_xref="GeneID:14217898"
     misc_RNA        1081802..1083525
                     /locus_tag="SPNCRNA.710"
                     /product="antisense RNA (predicted)"
                     /transcript_id="NR_151080.1"
                     /db_xref="GeneID:14217898"
     gene            complement(1081916..1083616)
                     /gene="meu31"
                     /locus_tag="SPAC1A6.06c"
                     /db_xref="GeneID:2542280"
     mRNA            complement(join(1081916..1083142,1083194..1083616))
                     /gene="meu31"
                     /locus_tag="SPAC1A6.06c"
                     /product="protein meu31"
                     /transcript_id="NM_001018594.2"
                     /db_xref="GeneID:2542280"
     CDS             complement(join(1082783..1083142,1083194..1083391))
                     /gene="meu31"
                     /locus_tag="SPAC1A6.06c"
                     /codon_start=1
                     /product="protein meu31"
                     /protein_id="NP_593198.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1A6.06c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1A6.06c.1"
                     /db_xref="GeneID:2542280"
                     /db_xref="GOA:Q9Y826"
                     /db_xref="PomBase:SPAC1A6.06c"
                     /db_xref="PomBase:SPAC1A6.06c.1"
                     /translation="MSCISEIGKFVKSIEYIKLPCLFIFAAIVGMNLSLLYCLLKGWK
                     NVMIWGIETMLFGAIGIFFAWKKKLSWEHLVLLWSTIDAFFSMCLRSCTIIYFSMNPY
                     MLCEILNARNVISCSLNTQKFFFIIVAASNVYSIFQLCGCLLMFNNIISIRPSERTEP
                     EFNFDLEKGVAFASDSEFPEKSICI"
     gene            1084068..1086426
                     /locus_tag="SPAC1A6.07"
                     /db_xref="GeneID:2542484"
     mRNA            1084068..1086426
                     /locus_tag="SPAC1A6.07"
                     /product="uncharacterized protein"
                     /transcript_id="NM_001018595.2"
                     /db_xref="GeneID:2542484"
     CDS             1084175..1086085
                     /locus_tag="SPAC1A6.07"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_593199.1"
                     /db_xref="GeneID:2542484"
                     /db_xref="GOA:O13858"
                     /translation="MSHASKNYNAQLTAAAASTALHGTKKIYNSNENDRAVNSFLGNR
                     TSYGEAVNGSPQYDYMRSRMSTLGSANQPMAPPSLRNRSSVYLPTPAGPPQIPVNTGK
                     RYTLTSSSANYMTKSERQMRPPKSYDFPPSQQVRPSTSRSPSYASYNSEEVNFQSYQD
                     PRLLPRTSQMYMPDNNYSPAVKSPAAQRRSSSYMVPANSRGSPANYNTPYYPTAIPPP
                     IEEYSPSVSLPTSPVAEESYNNVQRSSTVRNNTTQKSVLKKPSRKMSPAYTSSYRQNS
                     PSSQVPPVSKKHVIIYENKEGSSSSESVYEDVFEDFDPSGSNQASLRSTSTIHYTPSS
                     KRISVIPPNTSNIGSRVVSRSGQNNNQPAQPGQYNQQSQPVQSYQSGQSTQHFQPVQP
                     IQPVQSTQYYQPSSPVQPVQNGVPAPPMQPVQSTQYYQPSSPVQPVQNVKPAQPAQPS
                     LEDAAKRRVEEMLRQMDITPTASSTTANNAYASAEPHPSAFPDDMNSVFSDSSFERER
                     DSGRGRSTNLFSKFKSGRSRSKASGEAPYSYPAPPVPSVNNAGARLTLRDSGAAPEAT
                     YSLRQPSNHAYSEGRSYTFTGGQPPSVPTMPYGSRFANDSDSMMGSTADFSSKKKGGK
                     FKAFKKFFKMRF"
     gene            complement(1086242..1087505)
                     /gene="mug125"
                     /locus_tag="SPAC1A6.08c"
                     /db_xref="GeneID:2542601"
     mRNA            complement(1086242..1087505)
                     /gene="mug125"
                     /locus_tag="SPAC1A6.08c"
                     /product="protein mug125"
                     /transcript_id="NM_001018596.2"
                     /db_xref="GeneID:2542601"
     CDS             complement(1086376..1087233)
                     /gene="mug125"
                     /locus_tag="SPAC1A6.08c"
                     /codon_start=1
                     /product="protein mug125"
                     /protein_id="NP_593200.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1A6.08c"
                     /db_xref="EnsemblGenomes-Tr:SPAC1A6.08c.1"
                     /db_xref="GeneID:2542601"
                     /db_xref="GOA:O13859"
                     /db_xref="PomBase:SPAC1A6.08c"
                     /db_xref="PomBase:SPAC1A6.08c.1"
                     /translation="MILKDSLEAKSCFKSSQTSHLAARVAMENPQKGNVINAQSSRQP
                     SSENEFRENLFFKEMRTNGKNEHETSCRSVVLYRNSKSAKRYPLSTKCARISYMQGNK
                     DTKTALTKKYKSNEDVSRMRKKGNKYPQCKSKNLYDSLKLEECIESWSLNQKQNENFY
                     EHTHLNSRDDSNPSSCDRETFFLSDEDSEISLMEGLSSIENGYPDEKETLAALDNVKL
                     SDENAAHLGYLVKYFQNYTDKIILKETLMDWEDKEPSLQELTESTKYLENLADTDHRT
                     SNKPFLFLR"
     gene            complement(1087443..1089673)
                     /gene="lag1"
                     /locus_tag="SPAC1A6.09c"
                     /db_xref="GeneID:2542464"
     mRNA            complement(join(1087443..1089044,1089307..1089673))
                     /gene="lag1"
                     /locus_tag="SPAC1A6.09c"
                     /product="sphingosine N-acyltransferase Lag1"
                     /transcript_id="NM_001356001.1"
                     /db_xref="GeneID:2542464"
     CDS             complement(1087819..1088991)
                     /gene="lag1"
                     /locus_tag="SPAC1A6.09c"
                     /codon_start=1
                     /product="sphingosine N-acyltransferase Lag1"
                     /protein_id="NP_001342862.1"
                     /db_xref="GeneID:2542464"
                     /db_xref="GOA:P78970"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="InterPro:IPR016439"
                     /translation="MSNRKADEKHHMSSSSLTNDRSYIRNLSNRKTSISRKVPITRTL
                     EDPSNFVAKDGTKLVQAPLFLLVWQKEICLSIIAICFACLLSPSLRPYAEPFIFLSYK
                     QPDGSYGKGPKDACFPIFWVIVFTAFRVIVMDYVFRPFVLNWGVRNRKVIIRFCEQGY
                     SFFYYLCFWFLGLYIYRSSNYWSNEEKLFEDYPQYYMSPLFKAYYLIQLGFWLQQILV
                     LHLEQRRADHWQMFAHHIVTCALIILSYGFNFLRVGNAILYIFDLSDYILSGGKMLKY
                     LGFGKICDYLFGIFVASWVYSRHYLFSKILRVVVTNAPEIIGGFHLDVPNGYIFNKPI
                     YIAFIILLFTLQLLIYIWFGMIVKVAYRVFSGEEATDSRSDDEGEDEEASSTNEDK"
     gene            <1090678..1092303
                     /locus_tag="SPAC1A6.10"
                     /db_xref="GeneID:2542532"
     mRNA            <1090678..1092303
                     /locus_tag="SPAC1A6.10"
                     /product="Moeb/ThiF domain-containing protein"
                     /transcript_id="NM_001018598.2"
                     /db_xref="GeneID:2542532"
     CDS             1090678..1092135
                     /locus_tag="SPAC1A6.10"
                     /codon_start=1
                     /product="Moeb/ThiF domain-containing protein"
                     /protein_id="NP_593202.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC1A6.10"
                     /db_xref="EnsemblGenomes-Tr:SPAC1A6.10.1"
                     /db_xref="GeneID:2542532"
                     /db_xref="GOA:O13861"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="PomBase:SPAC1A6.10"
                     /db_xref="PomBase:SPAC1A6.10.1"
                     /translation="METLQVEVFFLFDFTSIMAGFKVPSWITYKSFWIAVSSSVTTAC
                     VILGTLEFRKHRSIRRLQSMIVPEAGKSIQLSSSGVPIEIYDAGEEDEGISKGVPYDE
                     NLIREQLARNYAFFGEDGMERLRNSFVIVVGCGGVGSWVINMLARSGVQKIRIVDFDQ
                     VSLSSLNRHSIATLQDVGTPKTLAIKKAIKKFAPWIEVDARNALFNPDSADDLLSGNP
                     DFVIDAIDNIQTKVDLLSYCYNHKLPVIASTGSACKSDPTRVNIADISATSEDPLSRA
                     TRRRLRLLGIMEGIPVVFSTEKPDPRKASLLPLSEEEFEKGDVDELSALPEFRARILP
                     VIGPMPGIFGLTIATYVLTSIAKYPMDPISTMTRPRLYEEAVKRLHAEARKAGVNLDK
                     TFNASEMSYIIEEVYVGRSALPPHESQKVTVVRWNPQLPFDHTNLVAMTRNEARYHED
                     NVLAKNVDPSTVYGKDVIEVVHSFLRRLRMWEMLY"
     gene            1092387..1094379
                     /locus_tag="SPAC30D11.14c"
                     /db_xref="GeneID:2542249"
     mRNA            1092387..1094379
                     /locus_tag="SPAC30D11.14c"
                     /product="putative RNA-binding protein"
                     /transcript_id="NM_001018599.2"
                     /db_xref="GeneID:2542249"
     CDS             1092441..1094045
                     /locus_tag="SPAC30D11.14c"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="NP_593203.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC30D11.14c"
                     /db_xref="EnsemblGenomes-Tr:SPAC30D11.14c.1"
                     /db_xref="GeneID:2542249"
                     /db_xref="GOA:Q09911"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="PomBase:SPAC30D11.14c"
                     /db_xref="PomBase:SPAC30D11.14c.1"
                     /translation="MSDSRQNSQREDNYSRDRRSRFTEDSYSRRDSQRSGNEAPRESR
                     YYRKEEHLQERSRSRSPARDSRWKSSSSGFAPAHPPIEEPTNNGAEAAAAAARRIAES
                     LQSTKATSSRTSYDHSEGITSTTSASPPSAPAPPLPPSSEGPAVDIPPSMADITSKVI
                     EGDGVFMQDVEINNVRNRYILVRASTLSEIENKSGVQLFSKGRYYPNKALATDKDPPL
                     YLHIVSHNRKDLTVALQEIESWINKDMGPLIDERRFRRREDNERNNSNSPRNFSTHGN
                     GNGENGQPRRKWLEEKVYINLTPSRGFHLRQAIVGPQGAYVKHIQQETRTRVQIKGQG
                     SAFIEPSTNRESDEPIHLCIMSHDPNAIQRAKVLCEDLIASVHQQYKAWKSQPKDRDQ
                     NQGNRAYNPPNRNQAFSARDSRQEKTQPTNASPAPLVTPSLPVPSIPAVPGMEAMAMP
                     PGVTSSIAVPTTSSMPLQGMPTMFGAPGVSAPGTEAPGTGTPGLTTPGVDPYAAYGGY
                     NAYVQYYQQQIYAQMHGVSGDQSHPQ"
     gene            complement(1094262..1095547)
                     /gene="hus5"
                     /locus_tag="SPAC30D11.13"
                     /gene_synonym="ubc9"
                     /db_xref="GeneID:2542196"
     mRNA            complement(join(1094262..1094560,1094616..1094695,
                     1094745..1094854,1094897..1094920,1095142..1095274,
                     1095328..1095547))
                     /gene="hus5"
                     /locus_tag="SPAC30D11.13"
                     /gene_synonym="ubc9"
                     /product="small ubiquitin-like modifier-conjugating enzyme
                     Hus5"
                     /transcript_id="NM_001018600.2"
                     /db_xref="GeneID:2542196"
     CDS             complement(join(1094500..1094560,1094616..1094695,
                     1094745..1094854,1094897..1094920,1095142..1095274,
                     1095328..1095393))
                     /gene="hus5"
                     /locus_tag="SPAC30D11.13"
                     /gene_synonym="ubc9"
                     /codon_start=1
                     /product="small ubiquitin-like modifier-conjugating enzyme
                     Hus5"
                     /protein_id="NP_593204.1"
                     /db_xref="GeneID:2542196"
                     /db_xref="GOA:P40984"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="InterPro:IPR027230"
                     /db_xref="PDB:3RCZ"
                     /translation="MSSLCKTRLQEERKQWRRDHPFGFYAKPCKSSDGGLDLMNWKVG
                     IPGKPKTSWEGGLYKLTMAFPEEYPTRPPKCRFTPPLFHPNVYPSGTVCLSILNEEEG
                     WKPAITIKQILLGIQDLLDDPNIASPAQTEAYTMFKKDKVEYEKRVRAQARENAP"
     rep_origin      1095554..1096335
     rep_origin      1095554..1095603
     rep_origin      1095568..1095608
     rep_origin      1095736..1095739
     rep_origin      1095858..1095884
     rep_origin      1095921..1095936
     rep_origin      1095954..1096003
     rep_origin      1096013..1096030
     rep_origin      1096094..1096131
     rep_origin      1096206..1096230
     gene            1096369..1096466
                     /locus_tag="SPATRNASER.01"
                     /db_xref="GeneID:3361488"
     tRNA            1096369..1096466
                     /locus_tag="SPATRNASER.01"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:3361488"
     gene            1096474..1096545
                     /locus_tag="SPATRNAMET.01"
                     /db_xref="GeneID:3361489"
     tRNA            1096474..1096545
                     /locus_tag="SPATRNAMET.01"
                     /product="tRNA-Met"
                     /db_xref="GeneID:3361489"
     gene            complement(1096764..1097387)
                     /gene="rpl3802"
                     /locus_tag="SPAC30D11.12"
                     /gene_synonym="rpl38-2; rps38"
                     /db_xref="GeneID:2541705"
     mRNA            complement(join(1096764..1096924,1097012..1097198,
                     1097248..1097387))
                     /gene="rpl3802"
                     /locus_tag="SPAC30D11.12"
                     /gene_synonym="rpl38-2; rps38"
                     /product="60S ribosomal protein L38"
                     /transcript_id="NM_001018601.2"
                     /db_xref="GeneID:2541705"
     CDS             complement(join(1096890..1096924,1097012..1097198,
                     1097248..1097250))
                     /gene="rpl3802"
                     /locus_tag="SPAC30D11.12"
                     /gene_synonym="rpl38-2; rps38"
                     /codon_start=1
                     /product="60S ribosomal protein L38"
                     /protein_id="NP_593205.1"
                     /db_xref="EnsemblGenomes-Gn:SPAC30D11.12"
                     /db_xref="EnsemblGenomes-Tr:SPAC30D11.12.1"
                     /db_xref="GeneID:2541705"
                     /db_xref="GOA:Q09900"
                     /db_xref="InterPro:IPR002675"
                     /db_xref="PomBase:SPAC30D11.12"
                     /db_xref="PomBase:SPAC30D11.12.1"
                     /translation="MPRQVTDIKLFLQLAHRGDATSARVKKNQNKAVKFKLRCSRYLY
                     TLVVADAKKAEKLRQSLPPALTVTEVGKKA"
     regulatory      complement(1097318..1097326)
                     /regulatory_class="promoter"
                     /gene="rpl3802"
                     /locus_tag="SPAC30D11.12"
                     /gene_synonym="rpl38-2; rps38"
     gene            complement(1097449..1099554)
                     /locus_tag="SPAC30D11.11"
                     /db_xref="GeneID:2542543"
     mRNA            complement(1097449..1099554)
                     /locus_tag="SPAC30D11.11"
                     /product="hemolysin-III family protein"
                     /transcript_id="NM_001018602.2"
                     /db_xref="GeneID:2542543"
     CDS             complement(1098036..1099364)
                     /locus_tag="SPAC30D11.11"
                     /codon_start=1
                     /produ