GenomeNet

Database: RefSeq
Entry: NC_004448
LinkDB: NC_004448
Original site: NC_004448 
LOCUS       NC_004448              16746 bp    DNA     circular VRT 07-JUL-2016
DEFINITION  Alligator sinensis mitochondrion, complete genome.
ACCESSION   NC_004448
VERSION     NC_004448.1
DBLINK      BioProject: PRJNA12111
KEYWORDS    RefSeq.
SOURCE      mitochondrion Alligator sinensis (Chinese alligator)
  ORGANISM  Alligator sinensis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Crocodylia; Alligatoridae;
            Alligatorinae; Alligator.
REFERENCE   1  (bases 1 to 16746)
  AUTHORS   Wu,X., Wang,Y., Zhou,K., Zhu,W., Nie,J., Wang,C. and Xie,W.
  TITLE     The complete mitochondrial genome sequence of Chinese alligator
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 16746)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (18-DEC-2002) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 16746)
  AUTHORS   Wu,X., Wang,Y., Zhou,K., Zhu,W., Nie,J., Wang,C. and Xie,W.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-MAY-2002) College of Life Science, Nanjing Normal
            University, Institute of Genetic Resources, Linghai Road, Nanjing,
            Jiangsu 210097, China
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF511507.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..16746
                     /organism="Alligator sinensis"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:38654"
     rRNA            1..985
                     /product="12S ribosomal RNA"
     tRNA            986..1051
                     /product="tRNA-Val"
     rRNA            1052..2630
                     /product="16S ribosomal RNA"
     tRNA            2631..2705
                     /product="tRNA-Leu"
                     /codon_recognized="UUR"
     gene            2706..3671
                     /gene="ND1"
                     /db_xref="GeneID:806142"
     CDS             2706..3671
                     /gene="ND1"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 1"
                     /protein_id="NP_758780.1"
                     /db_xref="GeneID:806142"
                     /translation="MDFLIVVPPALLIISILIAVAFLTALERKIIGYMQLRKGPNIVG
                     PLGLLQPLADGFKLVIKELTLPLLATPALFILSPAAALMLALTMWSPLPMPFPLADLN
                     LGLLFLLAMSSLMVYSLLWSGWSSNSKYALMGALRAVAQTISYEVTLAIIVLSIVLLT
                     GGFSLHALTTTQEPLYLHLATWPSMMMWYTSTLAETNRAPFDLTEGESELVSGFNVEY
                     GASPFALFFLAEYANIMLMNTLTVTLFLNPSTPTSIPMLFTIALMSKTLLLTMSFLWI
                     RASYPRFRYDQLMHLLWKSFLPTTLALCLWHSSLPMSTFGLPPTT"
     misc_feature    2706..3668
                     /gene="ND1"
                     /note="NADH dehydrogenase subunit 1; Provisional; Region:
                     ND1; MTH00111"
                     /db_xref="CDD:214422"
     tRNA            3669..3738
                     /product="tRNA-Ile"
     tRNA            complement(3740..3810)
                     /product="tRNA-Gln"
     tRNA            3810..3881
                     /product="tRNA-Met"
     gene            3883..4947
                     /gene="ND2"
                     /db_xref="GeneID:806141"
     CDS             3883..4947
                     /gene="ND2"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 2"
                     /protein_id="NP_758781.1"
                     /db_xref="GeneID:806141"
                     /translation="MPLSQPIILTTLTATTLVFLLSTHLVLMWAALELSTLAILPLIA
                     NKSHPRAIEASTKYFLMQAMASTLIIFSGALNYEMTGSYQIAELTDLTSMIVLTLALF
                     IKVGLVPFHFWVPEVLQGMPTAPAIFLLTWQKLGPLVMLFLISHLISLKLIFMVAVLS
                     SLIAGWMGLNQTQVRKLMAFSSIAQMAWIIVIIKYAPSLTILTFYIYSTTVSATLLTL
                     DKMSTTSTKHLITSFSKSPTAATLLTLSLLSLSGLPPLAGFLPKWLTVNQLVSEKATW
                     IALLMLMASLLSLFFYLRLWYNSSSTLPPNTTNTTRLWRKLTPQSNLTINLLVLAATT
                     LLLSATLMKAITKQETPKAK"
     misc_feature    3883..4854
                     /gene="ND2"
                     /note="NADH dehydrogenase subunit 2; Provisional; Region:
                     ND2; MTH00112"
                     /db_xref="CDD:214423"
     misc_feature    3946..>4461
                     /gene="ND2"
                     /note="Proton-conducting membrane transporter; Region:
                     Proton_antipo_M; pfam00361"
                     /db_xref="CDD:278775"
     tRNA            4944..5018
                     /product="tRNA-Trp"
     tRNA            complement(5023..5088)
                     /product="tRNA-Ala"
     tRNA            complement(5091..5163)
                     /product="tRNA-Asn"
     tRNA            complement(5168..5233)
                     /product="tRNA-Cys"
     tRNA            complement(5234..5310)
                     /product="tRNA-Tyr"
     gene            5307..6884
                     /gene="COX1"
                     /db_xref="GeneID:806140"
     CDS             5307..6884
                     /gene="COX1"
                     /codon_start=1
                     /transl_table=2
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="NP_758782.1"
                     /db_xref="GeneID:806140"
                     /translation="MNAHRWLFSTNHKDIGTLYFVFGTWAGMVGTALSLLIRTELSQP
                     GPLLGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLLPLMIGAPDMAFPRMNNMSF
                     WLLPPSFMLLLSSACVEAGAGTGWTVYPPLAGNLAHAGPSVDLTIFSLHLAGVSSILG
                     AINFITTAINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTT
                     FFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHVVAFYSGKKEPFGYMGMAWA
                     MLSIGFLGFIVWAHHMFTVGMDVDTRAYFTTATMVIAIPTGVKVFSWLATIYGGIVNW
                     QAPMLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMSG
                     FTHLIPSYLRDLPFTQHELKIQFMIMFVGVNFTFFPQHFLGLSGMPRRYSDYPDAYTL
                     WNLLSSIGSLISMTAVVLLMFIVWEAFSSKRKVTALEMTTTNIEWLNNCPPSHHTYEE
                     PVFALVQTSFKTYHPAS"
     misc_feature    5307..6854
                     /gene="COX1"
                     /note="cytochrome c oxidase subunit I; Provisional;
                     Region: COX1; MTH00116"
                     /db_xref="CDD:177177"
     misc_feature    order(5334..5336,5574..5576,5586..5588,5592..5594,
                     5613..5615,5736..5738,5748..5750,5802..5804,5814..5816,
                     5874..5876,5895..5897,5904..5906,5928..5930,5955..5963,
                     5976..5981,5985..5987,6015..6017,6129..6131,6138..6140,
                     6147..6152,6162..6164)
                     /gene="COX1"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    5346..6689
                     /gene="COX1"
                     /note="Cytochrome C and Quinol oxidase polypeptide I;
                     Region: COX1; pfam00115"
                     /db_xref="CDD:278541"
     misc_feature    order(5361..5363,5544..5546,5577..5579,5598..5600,
                     5607..5609,5772..5777,5793..5795,5805..5807)
                     /gene="COX1"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(5379..5381,5391..5393,5400..5402,5412..5414,
                     5652..5657,6507..6509,6726..6728,6735..6737)
                     /gene="COX1"
                     /note="Subunit I/VIIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(5421..5423,5430..5435,6531..6533,6540..6545,
                     6642..6644,6696..6698)
                     /gene="COX1"
                     /note="Subunit I/IV interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(5469..5471,5985..5987,6099..6101,6108..6113,
                     6186..6194,6201..6203,6210..6212,6234..6236,6258..6260,
                     6267..6269,6288..6296,6330..6332,6384..6389,6393..6395,
                     6399..6413,6606..6611,6621..6629,6654..6659)
                     /gene="COX1"
                     /note="Subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(5487..5489,6438..6440,6450..6452,6579..6581,
                     6690..6692)
                     /gene="COX1"
                     /note="Low-spin heme (heme a) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(5646..5648,5655..5657)
                     /gene="COX1"
                     /note="Subunit I/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(5709..5711,5943..5954)
                     /gene="COX1"
                     /note="Subunit I/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(5874..5876,5895..5897,6015..6017,6129..6131,
                     6138..6140,6147..6152,6162..6164)
                     /gene="COX1"
                     /note="Dimer interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(5985..5987,6000..6005,6396..6398,6408..6413,
                     6621..6623)
                     /gene="COX1"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(6024..6026,6174..6179,6432..6434)
                     /gene="COX1"
                     /note="Binuclear center (heme a3/CuB) [ion binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(6024..6026,6036..6038,6069..6071,6174..6179,
                     6252..6254,6261..6263)
                     /gene="COX1"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(6102..6104,6114..6116,6792..6794)
                     /gene="COX1"
                     /note="Subunit I/Vb interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(6177..6179,6408..6413,6621..6626)
                     /gene="COX1"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    6192..6194
                     /gene="COX1"
                     /note="Subunit I/VIb interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    6291..6293
                     /gene="COX1"
                     /note="Subunit I/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(6435..6437,6621..6626)
                     /gene="COX1"
                     /note="Electron transfer pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(6534..6536,6705..6707)
                     /gene="COX1"
                     /note="Subunit I/VIIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(6642..6644,6654..6656)
                     /gene="COX1"
                     /note="Subunit I/VIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     tRNA            complement(6876..6953)
                     /product="tRNA-Ser"
                     /codon_recognized="UCN"
     tRNA            6956..7031
                     /product="tRNA-Asp"
     gene            7031..7718
                     /gene="COX2"
                     /db_xref="GeneID:806139"
     CDS             7031..7718
                     /gene="COX2"
                     /note="TAA stop codon is completed by the addition of 3' A
                     residues to the mRNA"
                     /codon_start=1
                     /transl_except=(pos:7718,aa:TERM)
                     /transl_table=2
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="NP_758783.1"
                     /db_xref="GeneID:806139"
                     /translation="MANPMHLGFQDAMSPLMEELLYFHDHTLMILFLISSLVFYMISA
                     LLLPKLYHSSASDVQEVEVIWTILPAIVLISVALPSLRTLYLMDETNNPCLTIKATGH
                     QWYWSYEYTDFSALEFDSYMVPTQDLPLGHFRLLEVDHCMITPTNSTIRVLITAEDVL
                     HSWAIPSIGTKMDARPGRLNQVMLTLANSGVFYGQCSEICGANHSFMPIVMETIPLNH
                     FQLWLKDCMSS"
     misc_feature    7031..7702
                     /gene="COX2"
                     /note="cytochrome c oxidase subunit II; Provisional;
                     Region: COX2; MTH00117"
                     /db_xref="CDD:177178"
     misc_feature    7034..7276
                     /gene="COX2"
                     /note="Cytochrome C oxidase subunit II, transmembrane
                     domain; Region: COX2_TM; pfam02790"
                     /db_xref="CDD:280885"
     misc_feature    7307..7696
                     /gene="COX2"
                     /note="C-terminal domain of Cytochrome c Oxidase subunit
                     II; Region: CcO_II_C; cd13912"
                     /db_xref="CDD:259979"
     misc_feature    order(7307..7312,7316..7318,7322..7324,7355..7357,
                     7481..7483,7499..7501,7562..7573)
                     /gene="COX2"
                     /note="subunit II/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259979"
     misc_feature    order(7445..7447,7451..7453,7466..7471,7595..7597)
                     /gene="COX2"
                     /note="subunit II/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259979"
     misc_feature    order(7511..7513,7616..7618,7622..7624,7628..7630,
                     7640..7642,7649..7651)
                     /gene="COX2"
                     /note="CuA binding site [ion binding]; other site"
                     /db_xref="CDD:259979"
     misc_feature    order(7541..7543,7547..7549,7556..7558,7562..7564,
                     7568..7570,7613..7624,7634..7636,7640..7645)
                     /gene="COX2"
                     /note="subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259979"
     misc_feature    order(7601..7603,7607..7609)
                     /gene="COX2"
                     /note="subunit II/IV interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259979"
     tRNA            7719..7796
                     /product="tRNA-Lys"
     gene            7799..7981
                     /gene="ATP8"
                     /db_xref="GeneID:806138"
     CDS             7799..7981
                     /gene="ATP8"
                     /codon_start=1
                     /transl_table=2
                     /product="ATP synthase F0 subunit 8"
                     /protein_id="NP_758784.1"
                     /db_xref="GeneID:806138"
                     /translation="MPQLNPEPWLTTLLITWISFIAFLQPKITSPAPVNDPTTRKPPT
                     IKTWPWPWTQTCLINS"
     misc_feature    7799..7954
                     /gene="ATP8"
                     /note="ATP synthase protein 8; Region: ATP-synt_8;
                     cl03008"
                     /db_xref="CDD:295603"
     gene            7951..8634
                     /gene="ATP6"
                     /db_xref="GeneID:806137"
     CDS             7951..8634
                     /gene="ATP6"
                     /codon_start=1
                     /transl_table=2
                     /product="ATP synthase F0 subunit 6"
                     /protein_id="NP_758785.1"
                     /db_xref="GeneID:806137"
                     /translation="MNTNLFDQFLIPSLLGISLLMPALLMTAILLLNPKNQWLSHPTV
                     TIKSWFINKATKQIMLPISPSGRKQSLILISLLILLLFTNLLGLLPYTFTPTTQLSMN
                     MALGLPLWLATVLIGLRTRPTASLGHLLPGGTPTLLIPGLILIETISLLIRPIALGVR
                     LTANLTAGHLLIQLISIATLNLWSMMPPLSLLTLTVLILLLLLEFAVAMIQAYVFVLL
                     LSLYLQENT"
     misc_feature    7951..8631
                     /gene="ATP6"
                     /note="ATP synthase F0 subunit 6; Provisional; Region:
                     ATP6; MTH00120"
                     /db_xref="CDD:177181"
     gene            8634..9417
                     /gene="COX3"
                     /db_xref="GeneID:806136"
     CDS             8634..9417
                     /gene="COX3"
                     /note="TAA stop codon is completed by the addition of 3' A
                     residues to the mRNA"
                     /codon_start=1
                     /transl_except=(pos:9417,aa:TERM)
                     /transl_table=2
                     /product="cytochrome c oxidase subunit III"
                     /protein_id="NP_758786.1"
                     /db_xref="GeneID:806136"
                     /translation="MSHQTHSFHMVHPSPWPLAGAMAAMLLTTGLTFWFHYDSSLILL
                     LGLITTLLVMLQWWRDIIRESTYLGHHTPAVQKGLRYGMILFITSEVFFFLGFFWAFY
                     HSSLSPTPELGGQWPPVGITTLDPFEVPLLNTAVLLASGVTVTWAHHSLMEANRTQAI
                     QALTLTVLLGLYFTALQAMEYYEAPFTIADSTYGSTFFVATGFHGLHVIIGSTFLMVC
                     LYRQTKYHFTSNHHFGFEAAAWYWHFVDVVWLFLYISIYWWGS"
     misc_feature    8634..9416
                     /gene="COX3"
                     /note="cytochrome c oxidase subunit III; Provisional;
                     Region: COX3; MTH00118"
                     /db_xref="CDD:177179"
     misc_feature    order(8799..8801,8808..8813,8820..8822,8829..8837)
                     /gene="COX3"
                     /note="Subunit III/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(8802..8807,8814..8819,8826..8828,8844..8846,
                     8877..8882,8889..8891,9273..9275,9294..9296,9330..9335)
                     /gene="COX3"
                     /note="Phospholipid binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238834"
     misc_feature    order(8853..8855,8862..8867,8898..8900,8907..8909,
                     8919..8924,8940..8942,9204..9209,9216..9218,9228..9230)
                     /gene="COX3"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    8988..8990
                     /gene="COX3"
                     /note="Subunit III/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(9012..9020,9069..9071,9147..9149,9177..9185,
                     9198..9206)
                     /gene="COX3"
                     /note="Subunit III/VIa interface; other site"
                     /db_xref="CDD:238834"
     misc_feature    9105..9107
                     /gene="COX3"
                     /note="Subunit III/Vb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     tRNA            9418..9489
                     /product="tRNA-Gly"
     gene            9489..9836
                     /gene="ND3"
                     /db_xref="GeneID:806131"
     CDS             9489..9836
                     /gene="ND3"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 3"
                     /protein_id="NP_758787.1"
                     /db_xref="GeneID:806131"
                     /translation="MNLLTMFMVTSITAAAVITMNLLMTEMLPDSEKLSPYECGFDPL
                     GSARLPLSIRFFMIAILFLLFDLEIAILLPLTWATHALNPLKTATWAIIIFLFLFIGL
                     TYEWLQGGLEWAE"
     misc_feature    9489..9830
                     /gene="ND3"
                     /note="NADH dehydrogenase subunit 3; Provisional; Region:
                     ND3; MTH00113"
                     /db_xref="CDD:177175"
     tRNA            9846..9917
                     /product="tRNA-Arg"
     gene            9914..10210
                     /gene="ND4L"
                     /db_xref="GeneID:806130"
     CDS             9914..10210
                     /gene="ND4L"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 4L"
                     /protein_id="NP_758788.2"
                     /db_xref="GeneID:806130"
                     /translation="MITSMSVMFLYSFVICTIGLIMHHTHLLSTLLCLEGMMLSIFMA
                     LTMSALSSNTSSFILPLTILTLSACEAGVGLALLVASARTHNTANLKNLNLLQC"
     misc_feature    9917..10207
                     /gene="ND4L"
                     /note="NADH dehydrogenase subunit 4L; Provisional; Region:
                     ND4L; MTH00125"
                     /db_xref="CDD:177184"
     gene            10204..11577
                     /gene="ND4"
                     /db_xref="GeneID:806135"
     CDS             10204..11577
                     /gene="ND4"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 4"
                     /protein_id="NP_758789.1"
                     /db_xref="GeneID:806135"
                     /translation="MLKLLLPTTMLIPTINLLPNKITWLPPTAYSIVVMTLALLILNP
                     SDTLMATSRLALGSDQFSTPLMILSCWLLPLMLMASQSSMFKNPAPQNHMFITILAML
                     QLALLMAFMALDLMLFYISFEATLIPTLVIISRWGAQTDRLNAGIYFLFYTIASSIPL
                     MISTLVTYNLKGTLSLPALQLIPMANPLSWTDTLLWLSMLLAFLVKIPLYGLHLWLPK
                     AHVEAPIAGSMILAAVLLKLGGYGLLRVVNLLTEQMNTIYLPFLTLALWGALMTGLIC
                     LRQTDLKSLIAYSSVSHMALVTAAILARNQLAPAASMLLMMAHGLTSSMLFCLANFNY
                     ERTHTRTLLAMQGMQLTTPALTTWWFLASAMNMALPPTINLMGELTIIVSLFSWLDIT
                     LLLTGLSSFITAIYTLHMFSSTQQGTLPAHTTLLPPAQTREHLLMLLHSLPSIILIAN
                     PQLIFPQ"
     misc_feature    10204..11574
                     /gene="ND4"
                     /note="NADH dehydrogenase subunit 4; Provisional; Region:
                     ND4; MTH00124"
                     /db_xref="CDD:214427"
     misc_feature    10204..10497
                     /gene="ND4"
                     /note="NADH-ubiquinone oxidoreductase chain 4, amino
                     terminus; Region: Oxidored_q5_N; pfam01059"
                     /db_xref="CDD:279408"
     misc_feature    10537..11403
                     /gene="ND4"
                     /note="Proton-conducting membrane transporter; Region:
                     Proton_antipo_M; pfam00361"
                     /db_xref="CDD:278775"
     tRNA            11617..11682
                     /product="tRNA-Ser"
                     /codon_recognized="AGY"
     tRNA            11696..11765
                     /product="tRNA-His"
     tRNA            11773..11844
                     /product="tRNA-Leu"
                     /codon_recognized="CUN"
     gene            11846..13657
                     /gene="ND5"
                     /db_xref="GeneID:806134"
     CDS             11846..13657
                     /gene="ND5"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 5"
                     /protein_id="NP_758790.1"
                     /db_xref="GeneID:806134"
                     /translation="MQQSTLFVTLFTLPPFILVLSCSLPAPKTLHPADFKSMMTKLAF
                     LQSLPPLLLLVYNNTTALSFQWHWLNVGTCSVHLGLKVDTFSVFFIPTALFVTWSIME
                     FTKAYMYSDPKITSFFNHLLIFILMMILLISANNLLMLFVGWEGVGILSFKLINWWSF
                     RADSNKAALQAIIYNRLADIGMLASISWMALNSLTLDAQDVPMSPDHSLILAMALVLA
                     AAGKSAQFGFHPWLPAAMEGPTPVSALLHSSTMVVAGIFLLIRTSHIIYSSQTATTAC
                     LLLGAATSLLTAACALTQNDMKKIIAFSTSSQLGLMMSTIGLKQPELAFLHISTHAFF
                     KAMLFLCAGSIIHSLNNEQDIRKMGGLKKAMPITTSCLTIGALALTGMPFLSGFFSKD
                     AIIESLNTSYTSAWALTLVLLATSFTAVYSFRMIYFTLLNTNRLTPMNPINENPETVN
                     PIMRLAVGSIVAGLLISTHMLPSNTPQLTMPGPIKLAALTITMAGLLVAMALTYATNK
                     FPPSTNDTQLPFLTKLAYFNLLFHHLFSTTALYMSQKLSTHLTDQTWYETIGPKTLAY
                     LQTLLAKTITPYHKGKMKQYFKTFLLTIAVIIFFLLF"
     misc_feature    11855..13648
                     /gene="ND5"
                     /note="NADH dehydrogenase subunit 5; Validated; Region:
                     ND5; MTH00004"
                     /db_xref="CDD:214398"
     misc_feature    12041..12199
                     /gene="ND5"
                     /note="NADH-Ubiquinone oxidoreductase (complex I), chain 5
                     N-terminus; Region: Proton_antipo_N; pfam00662"
                     /db_xref="CDD:279055"
     misc_feature    12245..13090
                     /gene="ND5"
                     /note="Proton-conducting membrane transporter; Region:
                     Proton_antipo_M; pfam00361"
                     /db_xref="CDD:278775"
     misc_feature    13106..13648
                     /gene="ND5"
                     /note="NADH dehydrogenase subunit 5 C-terminus; Region:
                     NADH5_C; pfam06455"
                     /db_xref="CDD:283988"
     gene            complement(13653..14168)
                     /gene="ND6"
                     /db_xref="GeneID:806133"
     CDS             complement(13653..14168)
                     /gene="ND6"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 6"
                     /protein_id="NP_758791.1"
                     /db_xref="GeneID:806133"
                     /translation="MEITLFFCCFMLVCAMMVAASSMIHFAVVSLLFVAVFGSGLVVV
                     EGGSFMPLVVLLIYLGGLLVVFAFCVGFTDDPFMGFWGVGVSKGAVFLYWVGLLIGIC
                     CAWGYLWGGMWISVGEPWSEVVVGESLGVSEMYCNGWVFVVVCGWALLIVLFVITGLI
                     RGHRRGAFRSF"
     misc_feature    complement(13656..14168)
                     /gene="ND6"
                     /note="NADH dehydrogenase subunit 6; Provisional; Region:
                     ND6; MTH00115"
                     /db_xref="CDD:214424"
     tRNA            complement(14169..14237)
                     /product="tRNA-Glu"
     gene            14240..15377
                     /gene="CYTB"
                     /db_xref="GeneID:806132"
     CDS             14240..15377
                     /gene="CYTB"
                     /note="TAA stop codon is completed by the addition of 3' A
                     residues to the mRNA"
                     /codon_start=1
                     /transl_except=(pos:15377,aa:TERM)
                     /transl_table=2
                     /product="cytochrome b"
                     /protein_id="NP_758792.2"
                     /db_xref="GeneID:806132"
                     /translation="MTHQLRKSHPLIKLINQTLIDLPTPSNISACWNFGSLLGLTLLI
                     QILTGVFLMMHFSSGDTMAFSSVAYTSREVWFGWLIRGLHMNGASLFFMFIFLHIGRG
                     LYYASYLHESTWNVGVIMLLLLMATAFMGYVLPWGQMSFWGATVITNLLSATPYVGST
                     VVPWIWGGPSVDNATLMRFTALHFILPFALLASLVTHLIFLHERGSFNPLGVNSNTDK
                     IPFHPYYTLKDTLGAALAASALLTLALYLPTLLSDPENFTQANSMITPTHIKPEWYFL
                     FAYAILRSTPNKLGGVLAMFSSILILLLMPFLHTTKQQPMSTRPMSQLLFWALVLDFF
                     VLTWIGGQPVNSTYILMGQTASVLYFAIILILMPTIGLLENKMTS"
     misc_feature    14240..15373
                     /gene="CYTB"
                     /note="cytochrome b; Provisional; Region: CYTB; MTH00119"
                     /db_xref="CDD:214425"
     misc_feature    14267..14857
                     /gene="CYTB"
                     /note="Cytochrome b (N-terminus)/b6/petB: Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cd00284"
                     /db_xref="CDD:238176"
     misc_feature    order(14291..14296,14345..14347,14354..14356,14831..14833,
                     14855..14857)
                     /gene="CYTB"
                     /note="Qi binding site; other site"
                     /db_xref="CDD:238176"
     misc_feature    order(14294..14299,14309..14317,14333..14338,14345..14350,
                     14357..14359,14429..14431,14474..14476,14483..14488,
                     14495..14500,14504..14509,14513..14518,14525..14527,
                     14546..14563,14567..14572,14579..14584,14591..14593,
                     14600..14605,14633..14635,14645..14665,14675..14680,
                     14702..14704)
                     /gene="CYTB"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238176"
     misc_feature    order(14297..14302,14306..14308,14315..14317,14378..14380,
                     14390..14392,14399..14404,14429..14434,14441..14446,
                     14453..14467,14471..14479,14486..14488,14564..14566,
                     14843..14848)
                     /gene="CYTB"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238176"
     misc_feature    order(14333..14335,14342..14347,14351..14356,14510..14512,
                     14522..14524,14531..14536,14540..14542,14576..14581,
                     14588..14593,14597..14602,14819..14821,14828..14833,
                     14840..14842,14855..14857)
                     /gene="CYTB"
                     /note="heme bH binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    order(14363..14365,14372..14377,14384..14389,14393..14398,
                     14405..14407,14438..14440,14480..14482,14489..14494,
                     14501..14503,14618..14623,14630..14635,14639..14644,
                     14786..14791,14798..14800)
                     /gene="CYTB"
                     /note="heme bL binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    order(14603..14605,14612..14617,14624..14629,14666..14668,
                     14675..14680,14690..14692,14774..14776,14783..14785)
                     /gene="CYTB"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238176"
     misc_feature    order(14861..14869,14873..14899,14906..14914,14918..14923,
                     14930..14932,14939..14944,14951..14953,14960..14965,
                     14972..14977,14981..14983,14999..15001,15008..15013,
                     15173..15178,15188..15190,15194..15196)
                     /gene="CYTB"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238179"
     misc_feature    order(14861..14866,14879..14881,14888..14896,14900..14902,
                     14912..14914,14921..14926,14933..14938,14945..14947,
                     14957..14962,14966..14974,14981..14983,14996..14998,
                     15002..15007,15011..15025,15029..15037,15044..15046,
                     15050..15061,15104..15106,15134..15136,15143..15148,
                     15152..15160,15164..15166)
                     /gene="CYTB"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238179"
     misc_feature    order(14900..14902,14924..14926)
                     /gene="CYTB"
                     /note="Qi binding site; other site"
                     /db_xref="CDD:238179"
     misc_feature    15014..15319
                     /gene="CYTB"
                     /note="Cytochrome b(C-terminal)/b6/petD; Region:
                     Cytochrom_B_C; pfam00032"
                     /db_xref="CDD:278461"
     misc_feature    order(15044..15046,15050..15055,15062..15064,15071..15076,
                     15122..15124)
                     /gene="CYTB"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238179"
     tRNA            15469..15543
                     /product="tRNA-Thr"
     tRNA            complement(15543..15620)
                     /product="tRNA-Pro"
     tRNA            15633..15701
                     /product="tRNA-Phe"
     misc_feature    15702..16746
                     /note="control region"
ORIGIN      
        1 caataaagac ttagtcccgg tcttcttatt aactaccact taacctatac atgcaagcat
       61 ccacgaacca gtgagaacac cctacaaatc taatagataa atggagccga catcaggcac
      121 atcaaccaca tagcccacga cgtctagccc agccacaccc ccaagggcca cagcagtaac
      181 caactttaaa ccataagcga aagctcgatt tagtcagagt aaaacagggg cggtcaacct
      241 tcgtgccagc aaccgcggct taacaaaggc cccaagttaa caaaccaacg gcgtaaattg
      301 tgactaggat cttatcctat acaattaagg tggatatagc ctcgtagcag tgataagctt
      361 tacagtgcca caaacatcaa cataaaaatg accttaatca ccaagacata tcctacctca
      421 cgaaagttga gaaacaaact gggatcagat accccactat gctcagccct taacaaaggc
      481 tgtgccccaa acatatcacg cccgccagag aattacgagc cacgcttaaa actcaaagga
      541 cttgacggcg cttcgaaccc acctagagga gcctgtccta taatcgacgg tacacgattc
      601 acccgaccac ctctagcccc tcagcctgta taccgccgtc gccaagcccg tccccctgag
      661 ggagacaaaa cgagcacaat agcctcccag gctagcacgt caggtcaagg tgcagccaat
      721 gaggtggaag agatgagcta cattttctaa cacatagaaa tatgcaacgg agagccctgt
      781 gaaaccaggg ctgtcaaagc aggatctagc agtaaactag gaaaagagag cctaattgaa
      841 gtaggccacg aagtgcgtac acaccgcccg tcaccctctt caagcccgat agtagtacac
      901 gcgccccggc aacgagtaca acataggatg agatgaggta aggtcgtaac aaggtaagcg
      961 taccggaagg tgcgctttgg aacatcaaga tgtagcttaa ataaagcttt cagcttacac
     1021 ctgaaaatgt tcaccaccga accattctga cacccacatt agcccacccc ccccccccat
     1081 acctgacaag tttgaactaa aacatttata acaccccagt attggtgaaa gaaaggccta
     1141 gaggcgcgac agagaaagta ccgcaaggga aagatgaaac aaagataaaa cacaagtaaa
     1201 acacagcaaa gaccagccct tttacctttc gcattatggt ttagcaaacc acaagtggca
     1261 aaaagaattt aagtcaccta ccccgaaact gagtgagcta ctaatcagcc gctaaacttg
     1321 agcaaacccc tctctgtggc aaaagagtgg gaagactgct tagtagtggt gaaaagccta
     1381 ccgaacccag taatagctgg ctgcttggga aacgaatttt agttctactg caaactctcc
     1441 tactcccgca acaacgggca aggaaaagtt ttcaagctac ttaatagggg tacagcccta
     1501 ttaacacagg actcaacctc tacctaaggg taatctgtct tattctcaca ccgtgggcct
     1561 taaagcagcc atcacaaaaa agcgtcaaag ctaaacccct aaaaatacca acaacaaact
     1621 gaaccctaca ccacaaccaa gccaccttat aatattaaaa aagactatgc taaaatgagt
     1681 aataagaaaa cgactttctc cttgcgccag cctacattct tcatgacccc ctataaatca
     1741 tcacactttc ccccacactc ctgctgctca aataaaaggg gaaccccttc ccgtctggtt
     1801 gaccccgaca caggcgcgca caggaaaggc ttaacctttg caaaaggaac tcggcaacaa
     1861 agactccgac tggtttacca aaaacagccc cagccctctt agtatttggg gtgatgcctg
     1921 cccaatgact actagttaaa tggccgcggt atctacaacc gtgcaaagag tagcgtaatc
     1981 acttgttctt taaataagga ccagtatgaa cggctaaacg agagtctaac tgtctcctgc
     2041 aagcagccaa tgaaattgat cttcctgtgc aaaagcagga atagccccac cagacgagaa
     2101 gaccctgtga aactttaatc ggctaagtca tacacacaac taataatcac ccataattac
     2161 ctggaccgtg acttagcgtt tttggttggg gtgaccttga aacaaagaaa aacttttaag
     2221 aaagctataa caaagtagcc agtatccact gagaccccca cacctcaaag tacttaaatg
     2281 taattagatc cgacaacgtc gatccatgaa ccaagctact ccagggataa cagcgcaatc
     2341 cccttcaaga gcccctatcg acaggggggt ttacgacctc gatgttggat caggacaccc
     2401 cattggtgta accgctaata atggttcgtt tgttcaacgt ttaaagtcct acgtgatact
     2461 gagttcagac cggagcaatc caggtcggtt tctatctatg accccgcctt ttcctagtac
     2521 gaaaggaccg gaaaaacaag gcccatgcca ctaaagtacg ccttacccat agctaatgta
     2581 gacaactaaa ctagcaaccg ggatgaacct gcccctcgaa acaagagcat gctgggttgg
     2641 cagagcctgg ctcaatgcaa aaggcctaag ccctttactc agagattcaa attctctacc
     2701 cagtaataga ctttctcatc gtcgtgcccc ccgctctact tatcatctcc atcctgatcg
     2761 cggttgcatt tttaacggcc ctagaacgaa aaattattgg ctacatgcaa ctacgaaaag
     2821 gaccaaacat cgttggccca cttggcctac ttcaacccct cgccgacgga tttaaacttg
     2881 ttattaaaga actaaccctc ccgctacttg caaccccagc cctcttcatc ctatccccag
     2941 cagcagccct aatgctagcc cttacgatat gatcccccct ccccatgcca tttcccctgg
     3001 cagaccttaa cctaggacta ctattcctac tggccatatc aagcctcatg gtctactcat
     3061 tattatgatc cgggtgatcc tcaaactcaa aatatgcctt aataggtgcc cttcgggcag
     3121 ttgctcaaac tatctcctac gaagtaacac tggccatcat tgtattatct attgtcttac
     3181 tgactggggg attttcgcta catgccctca ccaccacaca agaaccccta tacctgcact
     3241 tagccacctg accatcgata ataatatggt atacctctac actagcagaa acaaaccggg
     3301 ccccattcga cctaacagag ggagagtcag agctagtatc cggatttaac gttgaatacg
     3361 gcgcaagccc cttcgcactc tttttcctgg ccgagtacgc caacattata ttaataaaca
     3421 ccctgactgt caccctattc ttaaacccat ctacccccac ttccatccca atactcttca
     3481 ccatcgccct aataagcaaa acccttctac taactataag ctttctatga atccgagcat
     3541 cctacccccg atttcgctat gaccagctta tgcacctttt atgaaaaagc ttcctaccca
     3601 caacattagc cctctgccta tgacactcat cacttccaat atcaacattt gggctgcccc
     3661 caacaacata ggaccgtgcc tgaatcgcaa tagggctctt tgatagagta gacaacaggg
     3721 gttagaaccc cctcgcatcc tagaggagta gggttcgaac ctactcaaaa ggaatcaaaa
     3781 tccttcctac ttcctttata gtacccccta gaagtgtaag ctaattaaag ctattgggcc
     3841 cataccccaa aaataagggc taaccccctt cactcctacc acatgcccct ctcccagcca
     3901 attatcttaa cgaccctgac cgccacaaca ctcgtctttc tactatcaac ccaccttgta
     3961 ctaatatgag ccgcactaga acttagcaca ctagcaatcc tccccctaat cgctaataaa
     4021 tcccaccccc gagctatcga agcttctaca aaatactttt taatacaagc gatagcctcc
     4081 acactaatca tcttctcagg agcgctcaac tatgaaataa caggaagtta ccaaatcgca
     4141 gagttaacgg acttaacctc aataattgtg ctaaccctcg ccctgtttat taaagtggga
     4201 ctagtgccat tccacttctg agtaccagaa gtcctacaag gaatacccac agctcctgca
     4261 atctttctac tgacatggca gaagctaggc ccactagtta tactcttctt aattagccac
     4321 ctcatcagcc ttaaactaat ctttatagtg gccgtcttat cctctcttat tgcaggttgg
     4381 ataggactaa atcaaactca agtacgaaaa ctaatagcat tctcatccat cgcccaaatg
     4441 gcatgaatta ttgtaatcat taaatacgcc ccatccctga caatcctgac tttttatatc
     4501 tattccacta ccgtctccgc cacactactc acactagata aaatatcaac aacctccacc
     4561 aaacacctca ttacctcctt ctcaaaatcc ccgactgcag ccaccctcct aactctctcc
     4621 cttctctcgc tatccggcct tccacccctg gccggctttc tgccaaaatg gctaaccgtt
     4681 aatcaacttg tctcagaaaa agcaacttga atcgctctcc tcatactcat ggcctccctc
     4741 ttaagccttt tcttctatct tcggctatgg tacaactcct catcgaccct accgccaaat
     4801 accacaaaca caacccgcct ctgacgaaaa ctaacccctc aaagcaacct aaccattaac
     4861 ctccttgtcc tggctgccac cacccttctg ctatccgcca cattaatgaa agcaattacc
     4921 aaacaagaaa cccccaaagc taaaagaaat taggttcaaa cttcaagccg agggccttca
     4981 aagccctaaa tgggagtaaa caaaccccca tttcttgatt taaggtttgc gggactctat
     5041 cccacatttt cagaatgcaa atcaaaagct ttaattaagc taaaacctca ataaacagga
     5101 gggctttgat cccacaaata tttaattaac agctaaacgc tccaactaac gagcttctgt
     5161 ttattccaag cctcagtact acctaaagta catctacgaa tttgcaattc gccatgaatt
     5221 tcaccatgag gcctagtaaa gaggggaatt aaacccctgt aaatagattt acagcctacc
     5281 gccatcaaca ctcggccact ttacctgtga acgcccaccg ttgattattc tctactaacc
     5341 acaaagacat tggcaccctt tacttcgtct ttggaacatg agccggaata gtgggaacag
     5401 cactaagcct ccttattcga acagaattaa gccagccagg gcccctccta ggagacgacc
     5461 aaatctacaa cgtaattgtc accgcccatg cctttattat aatctttttc atagtaatac
     5521 ccatcatgat cggcggattt ggaaactgac tactacccct gataatcgga gccccagata
     5581 tagcattccc ccgaataaac aacataagct tttgattgct ccccccatcc ttcatacttc
     5641 tactctcctc cgcctgcgtc gaggcggggg ccggaacagg gtgaactgtc tacccgcccc
     5701 tcgccggaaa tttagcccac gccggaccgt ccgtagattt gacaatcttc tctcttcatc
     5761 tcgccggagt atcctctatc cttggtgcta ttaatttcat tacaacagca attaacataa
     5821 aacccccagc aatatcccaa taccaaacac ccttatttgt atggtccgtc ctaattacag
     5881 ccgtgctcct tctactatcc ctaccagtac tagctgctgg aatcaccata ctccttacag
     5941 atcgcaactt aaatacaacc ttcttcgacc ccgcgggcgg aggagacccc atcctatacc
     6001 aacacctttt ctgattcttt ggccaccccg aagtatacat cctcatcctc cctggattcg
     6061 gaataatttc ccacgtggtc gccttttact caggcaaaaa ggaaccattc ggctatatag
     6121 gaatggcatg agccatactc tctatcggat tcctaggatt cattgtctgg gcccaccaca
     6181 tatttacagt cggaatagac gtcgacaccc gagcatactt caccaccgcc acaatagtta
     6241 tcgctatccc caccggagta aaagtattta gctgacttgc caccatctac ggcggcattg
     6301 tcaactgaca agccccgata ctctgagcac ttggtttcat cttcttgttc acagtagggg
     6361 gcctcactgg catcgtccta gctaactcct cactagatat tgttctccat gacacctatt
     6421 atgtagtcgc ccacttccac tacgtactgt caatgggggc agtcttcgcc attataagtg
     6481 gattcaccca cttgattccc tcttatttac gggatttacc cttcacccaa catgaactaa
     6541 aaatccaatt tataattata tttgtggggg taaattttac cttcttccca caacacttcc
     6601 taggcctctc cgggataccc cgacgctatt cggactaccc agacgcatac accctctgaa
     6661 acctattatc atctattggg tccctaatct caataaccgc agtcgtcctg ctcatattta
     6721 ttgtatgaga agcattctca tccaaacgaa aagtaacagc actcgaaatg acaacgacca
     6781 acatcgaatg gctcaacaac tgccccccat cccatcacac ctatgaagag cccgtatttg
     6841 ccctagtgca aacctccttt aaaacatacc acccagcctc aagaacggag ggaatcgaac
     6901 ccccacctct ggtttctaag ccagccgcta caccgccatg ctccattctc ctcaaagaag
     6961 gattagtata cttcgtatta cctgttcttg tcaagagcaa aaaataggac actaaatcct
     7021 atacccttct atagctaacc cgatacactt aggattccaa gatgcaatat cccctctgat
     7081 agaagaatta ctgtatttcc acgaccacac gctgataatc ctatttctaa tcagctccct
     7141 cgtattctac ataatttccg ccctcctcct ccccaaactc taccactcga gcgcctcaga
     7201 cgtccaagaa gtagaagtaa tctgaactat cctgcccgct attgtcctca tctcagtcgc
     7261 ccttccatca cttcgtaccc tttacctcat ggacgaaacc aacaacccct gccttactat
     7321 taaagcaacc ggacaccaat gatattgatc ctatgaatac accgatttct ctgcactaga
     7381 attcgactcc tacatagtac ccacacaaga cctgcctcta ggccacttcc gtcttctaga
     7441 agttgaccac tgcatgatta ctccaacaaa ctcaaccatc cgagtactaa ttacagccga
     7501 agatgtgttg cactcatggg ccatcccgtc catcggaaca aaaatagacg cacgtccagg
     7561 gcgcctaaac caggtcatac tcacactggc caattccggt gtattttacg gccaatgctc
     7621 cgaaatctgc ggggcaaacc acagcttcat acccattgtc atagaaacta tcccattaaa
     7681 ccacttccaa ctctgactaa aagactgcat gtcctcctca ctaagaagct aaatggttag
     7741 cactagcctt ttaagttaga attaggggat taacaccgac ctctccccct tagtgaccat
     7801 gccccaacta aacccagagc cttgactaac aacccttcta atcacatgaa tttccttcat
     7861 cgccttcctt caacccaaga ttacctcccc cgcacctgta aacgacccaa ctacccgcaa
     7921 acccccaacc attaaaacat gaccctgacc gtgaacacaa acctgtttga tcaattccta
     7981 atcccaagcc tcctaggcat ctccctatta atgccggccc tactaataac tgccattctc
     8041 cttttaaacc ctaaaaatca atgactatca cacccaacag taacaatcaa atcttgattt
     8101 attaataaag ctacaaaaca aatcatgctt cctatcagcc cctcagggcg gaaacaatcc
     8161 ttaatcctca tctccttatt aatcctcctt ctctttacta acctgcttgg cctacttcca
     8221 tacaccttca ccccaacaac acaactatct ataaacatag ccctcggcct tcctctatgg
     8281 ctggcaacag tattaatcgg gcttcggacc cgcccaacgg cctccctggg ccaccttctt
     8341 ccaggaggga cccccaccct ccttatcccg ggcctaatct tgatcgagac aattagccta
     8401 ctaattcgac caatcgccct aggtgtccga ctaacagcaa acctaactgc gggccaccta
     8461 ctaattcaat taatctcaat cgccacatta aacctctgat ccataatacc cccacttagc
     8521 ctattgacct tgacagtcct gattctcctc ttattactag aatttgctgt ggccataatc
     8581 caagcctacg tcttcgtcct cctattatcc ctataccttc aagaaaacac gtaatgtcac
     8641 accaaacaca ctcctttcac atagtccacc ccagcccctg acccctcgcc ggggccatag
     8701 ccgccatatt attaacaaca ggcctgacct tctgattcca ctatgactct agccttattc
     8761 tattgctcgg cctaatcacc actctattag taatactcca atgatgacga gacattatcc
     8821 gagaaagcac ctacctagga caccacacac ctgcagtaca aaaaggacta cgctacggca
     8881 taatcctttt tatcacatca gaggtcttct tcttcctggg cttcttctga gcattttatc
     8941 actcaagcct ttcccccacc cctgagctag ggggacagtg acccccagtc ggaattacca
     9001 cccttgaccc atttgaagtt cccctcctaa acacagctgt cctccttgcc tctggggtaa
     9061 cagtaacctg ggcccaccac agcttgatgg aagccaaccg aacacaagca attcaggccc
     9121 taacactcac cgtactcctt ggcctatact tcaccgccct tcaagccata gagtactacg
     9181 aagccccctt tacaatcgca gacagcacct acggatcaac attcttcgtt gcaaccggct
     9241 tccacggcct ccatgttatt attggctcaa catttctcat agtctgccta tatcgacaga
     9301 caaaatatca cttcacatcc aaccaccact tcgggttcga agccgctgcc tgatattgac
     9361 attttgtaga tgtcgtctga ctcttccttt acatctcaat ctactgatga ggttcatgct
     9421 cttctagtat aaataataca agtgacttcc aatcactaaa cccctaacac acaacaaggg
     9481 gaaaagcaat caaccttctt accatattca tagtaacctc catcaccgcc gcagccgtaa
     9541 tcactataaa cctgctaata actgaaatac tacctgactc agaaaaacta tccccctacg
     9601 agtgcggatt tgaccccctc ggctctgctc gcctacccct atcaattcga tttttcatga
     9661 tcgccatctt attcctactt ttcgatcttg aaatcgctat cctgctccca ctcacatgag
     9721 ccacccacgc cctaaacccc ctaaaaaccg ccacatgggc catcattatc ttcctattct
     9781 tattcatcgg attaacatac gaatgactcc agggcggcct agaatgagca gaatagccaa
     9841 cccccaaaga actagtctaa cataagacct ctaacttcga cttagaagat cacgattaac
     9901 cccgcggttc tatataatca catccataag cgtcatattt ttatactcct tcgtcatctg
     9961 caccatcggc ctaatcatac accacacaca cctactctca acactactat gtcttgaggg
    10021 tatgatactg tcaattttca tggccttgac aatatcagcg ctcagttcaa acacctcctc
    10081 attcatcctg ccactaacaa ttctaaccct ttctgcctgt gaagcaggcg tcggcctggc
    10141 cctactggtt gcctctgctc gaacacataa cacagcaaac cttaaaaacc taaacctcct
    10201 ccaatgctaa aacttcttct tcccacaacc atgctgatcc caacaatcaa cctcctccca
    10261 aacaaaatta cctggttgcc gccaacagcc tactcgattg tcgtaatgac cctagccctc
    10321 ctaatcctca acccatctga cactcttata gccactagcc gcctggccct aggtagcgat
    10381 caattctcaa cccctttaat aattctgtcc tgctgacttc tccccttaat acttatagcc
    10441 agccaaagtt ctatattcaa aaaccccgcc ccccaaaatc acatatttat cacaatcctt
    10501 gcaatacttc aacttgctct acttatggca tttatggccc tagacttaat actattctac
    10561 atctccttcg aagccaccct aatccccacc cttgtaatca tctcccgctg aggggctcaa
    10621 acagaccgcc taaacgcagg tatttatttt ttgttttaca ctatcgccag ctcaatcccg
    10681 ctgataatta gcaccttggt aacctacaac ctaaaaggga ctttatctct ccccgcccta
    10741 caactaattc caatagcaaa ccccctctcc tgaacagaca cacttctatg actatccata
    10801 ctcctagcct tcctagtaaa aatccccctt tacggcctcc acctgtgact ccccaaagct
    10861 cacgtcgaag cccccattgc gggctccata atcctagctg cagtactcct aaaacttggc
    10921 ggctacggcc tgttacgagt agtaaactta ctcaccgaac aaataaacac tatctacctc
    10981 ccctttttaa ccttggcgct ctgaggggcc cttatgactg gccttatctg tttgcgacaa
    11041 actgacctaa aatccttaat tgcctactca tcagtaagtc acatagccct agtaacggct
    11101 gcaattcttg cgcggaatca attagcccca gcagcctcaa tacttctaat aatagcccac
    11161 ggactgacat cctccatgct attctgcttg gcaaatttca actatgaacg tactcacact
    11221 cggacactcc tggcaataca aggtatacaa ctcactacac ctgcccttac aacttgatga
    11281 tttttagcta gcgcaatgaa catagctctc cccccaacaa ttaacctcat aggagaacta
    11341 actattattg tctcactttt tagctggcta gacatcacac tattgttaac tggactaagc
    11401 tcattcatta cagcaatcta caccctccac atattctcat ccacccaaca aggaacacta
    11461 cccgcccaca ccaccctcct cccacctgcc caaacccgag aacacctcct aatactactt
    11521 cactcactac catcgattat tctcatcgcc aacccccaac tcatcttccc ccaatagccc
    11581 caacaaccca ccccatgatc tattgaaccc cactacgaga aggatcacgc aggaactcta
    11641 actcccgctc ccagaattaa tcacctggcc ctctcattat agaccccata tctgggtaag
    11701 tatagtttaa acaaaacatt agaatgtgaa cctaaaaaca ggatactaac caatccttcc
    11761 ttaccccccc ccgttttcat aggtaaccag tacatcctct ggccttaggg gccggcaatc
    11821 tcggtgcaac ccaaagtgaa aacacatgca acaatcaacc ctatttgtta cactattcac
    11881 cctacccccc ttcatcctcg tactatcctg ctccctccca gcccccaaaa ccctccaccc
    11941 ggctgacttt aaaagtataa taactaaact ggcattcttg caaagcctcc ctcccctcct
    12001 cttattagtc tataacaaca caaccgctct ctcattccaa tgacactgac tcaacgtagg
    12061 aacttgctct gttcacctgg gccttaaagt tgacaccttc tcagtcttct ttatcccaac
    12121 agccttattc gtcacatgat caatcataga gttcaccaaa gcatacatat actcagaccc
    12181 caaaatcacc agcttcttta accacctcct aatttttatt ctaatgatga tccttctaat
    12241 ctccgctaac aacttactca tattattcgt gggctgagag ggagtaggca tcttgtcgtt
    12301 caagctcatc aactgatgat ccttccgagc ggactctaac aaggcagccc tacaggccat
    12361 catttacaac cgcctagcag atatcggaat actcgctagc atttcatgaa tggccctaaa
    12421 tagcctcacc ctcgacgccc aagacgtccc catatccccc gaccactcac tcatcctagc
    12481 catagccctt gtcctagcag cagctggaaa atcagcccaa tttggcttcc atccctggct
    12541 cccagcagcc atagagggcc ccacaccagt ctcagcccta ctccactcaa gcaccatagt
    12601 agtagcaggc attttcttat taatccgaac ctcccacatc atctacagca gccaaacagc
    12661 aaccacagcc tgcctgctcc taggagcagc aacctccctg ctcacagctg cctgcgccct
    12721 cacccaaaat gatatgaaga agattattgc attctcaacc tcaagccaac ttggactaat
    12781 aatgagcaca attggactta aacagcccga acttgcattt ctacacatct caacacatgc
    12841 cttttttaaa gcaatactat tcctgtgcgc agggtcaatt atccatagcc ttaacaacga
    12901 gcaagatatt cgaaagatgg gcggccttaa aaaagcaata cccatcacca cctcttgctt
    12961 gactattgga gcattagctc tcaccggcat acccttcctc tcaggatttt tttccaaaga
    13021 cgccattatt gaatcgctaa atacctcata cactagcgcc tgggccctta ccctcgtcct
    13081 actcgccacc tccttcactg cagtttatag cttccgcatg atttatttta ccctactaaa
    13141 caccaaccgc ctaacaccca tgaaccccat taatgaaaac ccagaaactg taaaccccat
    13201 catacgtcta gctgtcggaa gcattgtagc cgggctatta atttcaaccc acatactacc
    13261 ctctaatacc ccccaactaa ccatgcctgg cccaatcaaa cttgcagccc tcaccatcac
    13321 aatagctggc ctactagtcg caatagccct gacctacgcc accaacaaat tccccccatc
    13381 caccaacgac actcaactgc ccttcctaac taaactggcc tacttcaacc tcctattcca
    13441 ccatctcttc tccaccactg ccctttacat aagccagaaa ctatctaccc atctgaccga
    13501 ccaaacatga tacgaaacta tcggaccaaa aacattagcc tatcttcaaa ccctgttagc
    13561 caaaactatt accccctatc acaaaggaaa aatgaaacag tacttcaaaa cctttttact
    13621 aaccattgcc gtaattatct tcttccttct gttctaaaag aacgaaatgc ccctcgccga
    13681 tggccacgaa tgagccccgt gattacgaat aatacaatta gcagggctca tccacacacc
    13741 acaacaaata ctcacccatt acaatacatc tcactgaccc ctaatgactc accgaccaca
    13801 acctcactcc aaggctctcc cacactaatc cacatccccc ctcacaaata cccccacgca
    13861 caacagatcc cgatcaacaa ccccactcaa taaagaaaca cagccccctt ggataccccc
    13921 acccctcaaa accctataaa aggatcatca gtgaacccca cacaaaaagc aaataccacc
    13981 agtaagcccc ccagataaat taataatacc accaggggca taaaacttcc accctcaact
    14041 actaccaaac cactaccgaa cacagccaca aaaagcaagc tcactacagc aaagtggatc
    14101 attgaacttg ccgctaccat tatcgcacat actagtataa aacaacaaaa aaacaacgta
    14161 atctccatca tttttatttg gatttcaacc aaaacctgag gcctgaaaag cccccgttgt
    14221 ccttcaacta taaaaaccca tgacccacca gctacgaaaa tcccacccac ttattaaact
    14281 tattaaccaa acccttattg acctcccaac accctcaaac atctcagctt gttgaaactt
    14341 tggatcacta ctaggcctaa cccttctaat ccagatccta acaggagtct tcttaataat
    14401 gcacttctca tcgggtgaca ccatagcatt ttcatctgtc gcctacacct cccgtgaagt
    14461 ttggttcggg tggcttattc gcggcctcca cataaacggg gcctctctct tcttcatatt
    14521 catcttcctc cacatcggac gaggcctata ctacgcatcc taccttcacg agagcacgtg
    14581 aaatgtcgga gtaattatac tcctactcct gatagccact gcattcatag gctacgtcct
    14641 cccgtgagga caaatatcgt tctggggagc aaccgtaatt acaaatctac tatccgccac
    14701 accctacgtt ggaagcactg ttgtaccctg aatctgaggc ggcccctctg tagacaacgc
    14761 aacactcata cgcttcaccg ccctacactt cattctccct tttgccctat tagcctcact
    14821 agttacccac ctaatcttcc tacacgaacg aggatccttc aaccccctag gagtcaactc
    14881 gaatactgac aaaatcccat tccaccccta ctatacccta aaagacaccc ttggagcagc
    14941 actagccgcc tcagcactac tcaccctcgc cctctattta ccaaccttat taagcgaccc
    15001 tgaaaacttt acccaagcaa actccataat tacccccaca cacattaaac cagaatggta
    15061 cttcttattc gcctacgcta ttctacgatc cacccctaac aaactaggag gagtactagc
    15121 catgttttca tctattctaa tcctacttct aatgcccttc ttacacacaa ctaaacagca
    15181 accgatatca acacgcccca tgtctcagct cctattctgg gccctcgtcc tagacttctt
    15241 cgtactcaca tgaatcggag gtcaaccagt aaactccaca tacatcttaa tgggccaaac
    15301 cgcctccgtg ctctacttcg ccatcatcct catcctcata cccacaatcg gactcctgga
    15361 aaacaaaata actagcttca tctacaccat cagcccccga atcaccccca taaaaccaag
    15421 cccccatcct agtcgcccca ccgcacttct ccaacaaaga aaaactccac cactctcgta
    15481 gctaaaaaga aaagcgctgg ccttgtaaga cagaagtgga cgacaaacac cctcccgaga
    15541 gtacacccac ttaagtcaag gaggcaaata aaactttaca cttcggcccc caaagccgaa
    15601 attctaatta aactactcct tgccacacat ctacgttgtc gtagcttaaa tactaaagca
    15661 taacactgaa aatgttaata tggacagcca gtcccgaata acgcaccccg gccaaccaca
    15721 ggcgccatgt catcaaccca tatttagctc acttcctccc tatgtatatc gcgcattcat
    15781 ctatttgccc catacacaca tccccccact cagattggtc cactgtacag gggttctcgc
    15841 tatccgcgtc atctttcgtt cagtactaac tattactagc ttcaagctca tacctggaca
    15901 cggcttccat gtattgcttt ttaagaggcc tctggttatc actctcacgt ccatatcttg
    15961 cgattgcctg gacattcgtc cctcttctta gaggcctcaa cccgcaccgt cttggtctcc
    16021 actcattttt gtccgtgatc gcggcatctc cagcttgagc acatttagtg gatttttatt
    16081 ttttggggga gagttcaggt tccacttggg cgactatttc tttaaattcc cggtcagtaa
    16141 gaaaacactc tagacttata aaactataat actttcgccc cgctctcacg cgcatactct
    16201 aaatgctcta ttgtacatcc cccccccccc ccccatgtat ctgcggcggt tggggttcag
    16261 gtgcacatat agctgcacca ttatagggcc ataaatttat attatagggc cataaattta
    16321 tattataggg ccataaattt acatttatag agccataaat ttatattata gggccataaa
    16381 tttatattat agggccataa atttacattt atagggccat aaatttacat ttatagagcc
    16441 ataaatttat attatagggc cataaattta catttataga gccataaatt tatattatag
    16501 ggccataaat ttatattata gggccataaa tttacattta tagggccata aatttacatt
    16561 tataagagcc ataaacttat attatagaac cataaactta tattatagaa ccataaactt
    16621 atattataga accataaatt tacacaccac accataaacc cgaatcacaa acaccaaaca
    16681 aaaatcaacc atccaactaa aacaccacat cgttattacc ccgagaacta accaaaactc
    16741 taataa
//
DBGET integrated database retrieval system