GenomeNet

Database: RefSeq
Entry: NC_004565
LinkDB: NC_004565
Original site: NC_004565 
LOCUS       NC_004565              74082 bp    DNA     circular CON 29-MAR-2017
DEFINITION  Clostridium tetani E88 plasmid pE88, complete sequence.
ACCESSION   NC_004565
VERSION     NC_004565.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603289
            Assembly: GCF_000007625.1
KEYWORDS    RefSeq.
SOURCE      Clostridium tetani E88
  ORGANISM  Clostridium tetani E88
            Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
            Clostridium.
REFERENCE   1  (bases 1 to 74082)
  AUTHORS   Brueggemann,H., Baumer,S., Fricke,W.F., Wiezer,A., Liesegang,H.,
            Decker,I., Herzberg,C., Martinez-Arias,R., Merkl,R., Henne,A. and
            Gottschalk,G.
  TITLE     The genome sequence of Clostridium tetani, the causative agent of
            tetanus disease
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 100 (3), 1316-1321 (2003)
   PUBMED   12552129
REFERENCE   2  (bases 1 to 74082)
  AUTHORS   Brueggemann,H. and Gottschalk,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUL-2002) Goettingen Genomics Laboratory, Institute
            for Microbiology and Genetics, Grisebachstrasse 8, Goettingen
            37077, Germany
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            AF528097.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 03/29/2017 15:40:11
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.1
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 2,826
            CDS (total)                       :: 2,750
            Genes (coding)                    :: 2,699
            CDS (coding)                      :: 2,699
            Genes (RNA)                       :: 76
            rRNAs                             :: 6, 6, 6 (5S, 16S, 23S)
            complete rRNAs                    :: 6, 6, 6 (5S, 16S, 23S)
            tRNAs                             :: 54
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 51
            Pseudo Genes (ambiguous residues) :: 0 of 51
            Pseudo Genes (frameshifted)       :: 27 of 51
            Pseudo Genes (incomplete)         :: 22 of 51
            Pseudo Genes (internal stop)      :: 12 of 51
            Pseudo Genes (multiple problems)  :: 8 of 51
            CRISPR Arrays                     :: 6
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..74082
                     /organism="Clostridium tetani E88"
                     /mol_type="genomic DNA"
                     /strain="Massachusetts"
                     /sub_strain="E88"
                     /db_xref="taxon:212717"
                     /plasmid="pE88"
     gene            join(73941..74082,1..140)
                     /locus_tag="CTC_RS14370"
                     /db_xref="GeneID:25393099"
     CDS             join(73941..74082,1..140)
                     /locus_tag="CTC_RS14370"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="TdeIII family type II restriction endonuclease"
                     /protein_id="WP_052042391.1"
                     /db_xref="GeneID:25393099"
                     /translation="MKAWKERSKTYFSLPFNPSGEGSDYRKAHSIPYRIFYIDNDESV
                     LIGAELWNKIGDNKNTYSDLLELFNKVGEKYSDTIKKTIWVYNREFFIY"
     gene            441..1826
                     /locus_tag="CTC_RS13635"
                     /old_locus_tag="pE88_01"
                     /db_xref="GeneID:24252511"
     CDS             441..1826
                     /locus_tag="CTC_RS13635"
                     /old_locus_tag="pE88_01"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_011100780.1"
                     /db_xref="GeneID:24252511"
                     /translation="MLAKQLSLYDYIDNTLKNLVTCEVEIKAEEDNIQKATLHMDTLH
                     KGDDGYITIAIKHNNDWAQHHYKIEELKDNVGKVLSIDGVNIYLSPNSFYKPIRRIEN
                     VRKLNSLYIDLDYYTLDKFKDLTVDQILWNLEADYFKSKVPEANFIVITGRGLAIYWL
                     IEAVPYKALPLWNAVQKNFLNKLKDIGADEKSIDAARVMRLSGSVNQKNGHAVDLLFY
                     NDNKYNLRDIQENYLPDLTPYVKNPYHKAKGRRKRVVNLFNLYSLHYARLRDLVKLME
                     LREGMCRMEDGSLKATGLREFMCFLYRYWSSCYEGDIENALKSTLDFNKQFKEPLSIG
                     EVERATKSATKAYKQWLKDCPTGTYSRGGYNYKNKTLIKLLNITEDEMKVLETIIDNK
                     EVKRRDNEKNKARQKAKRRNELGLTKRQQEKEDKIREVKELYNKGLTQKEIANKLDIT
                     DRYVRKILNKK"
     gene            1944..2228
                     /locus_tag="CTC_RS13640"
                     /db_xref="GeneID:24252510"
     CDS             1944..2228
                     /locus_tag="CTC_RS13640"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035125438.1"
                     /db_xref="GeneID:24252510"
                     /translation="MLFVIMAVINAFQYMDTEKIVPIMDTLHLETALKNMKWEMKQEN
                     NIIIIKPRFLDSLFGEKIFIKTYNDDKVKIIGAKRLVNRLINYVNFNFAL"
     gene            2462..2668
                     /locus_tag="CTC_RS13645"
                     /db_xref="GeneID:24252480"
     CDS             2462..2668
                     /locus_tag="CTC_RS13645"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035125439.1"
                     /db_xref="GeneID:24252480"
                     /translation="MLKKRLILYKIIGSLINTIFIVLIVEEFQFIELKFKYSLALNYS
                     IYFIIICFITYFLLYEQKKISNKR"
     gene            complement(2876..3286)
                     /locus_tag="CTC_RS13650"
                     /old_locus_tag="pE88_02"
                     /db_xref="GeneID:24252479"
     CDS             complement(2876..3286)
                     /locus_tag="CTC_RS13650"
                     /old_locus_tag="pE88_02"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100781.1"
                     /db_xref="GeneID:24252479"
                     /translation="MKVSDIDRSLSEYKVVKGPRFSGQKFDNSDKKQCIKIALMAALG
                     HLNLAMSASLAAGEIANILWRQVNFDKIGGIYTLNYYVKIPYRKEHRGKNINVPVPHE
                     FFFVTFVLDDTPPKNANVVYTEWKSDGIRLANIN"
     gene            complement(3428..3646)
                     /locus_tag="CTC_RS13655"
                     /old_locus_tag="pE88_03"
                     /db_xref="GeneID:24252478"
     CDS             complement(3428..3646)
                     /locus_tag="CTC_RS13655"
                     /old_locus_tag="pE88_03"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysM peptidoglycan-binding domain-containing
                     protein"
                     /protein_id="WP_011100782.1"
                     /db_xref="GeneID:24252478"
                     /translation="MQIIETNLQFKNINYGSLNPLNKTTPSNYIVKSYDALWSISKKF
                     NTSVELLKKINNLNSDTIYPNQILKIHL"
     gene            complement(3671..3886)
                     /locus_tag="CTC_RS13660"
                     /old_locus_tag="pE88_04"
                     /db_xref="GeneID:24252477"
     CDS             complement(3671..3886)
                     /locus_tag="CTC_RS13660"
                     /old_locus_tag="pE88_04"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100783.1"
                     /db_xref="GeneID:24252477"
                     /translation="MENEVLKLASSQGIWAALSVVLIFYILKAQEEREKNYQDIISKL
                     TDKFNIVEDVKKDVKEIKDYVYKKKTS"
     gene            complement(4065..4582)
                     /locus_tag="CTC_RS13665"
                     /old_locus_tag="pE88_05"
                     /pseudo
                     /db_xref="GeneID:24252476"
     CDS             complement(4065..4582)
                     /locus_tag="CTC_RS13665"
                     /old_locus_tag="pE88_05"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015613477.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:24252476"
     gene            4870..5223
                     /locus_tag="CTC_RS13670"
                     /old_locus_tag="CTC_p6"
                     /db_xref="GeneID:24252475"
     CDS             4870..5223
                     /locus_tag="CTC_RS13670"
                     /old_locus_tag="CTC_p6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100784.1"
                     /db_xref="GeneID:24252475"
                     /translation="MNRKQTDKFDLLNQECENTNVNIFNSIKADLLELVDIKPELIKL
                     LEDYKSSGNILDIEELNINNLPEEFKNKIEVRSIKIYNKVYNEFNKLCNQYKGIKKQD
                     LLSLALYEFCKKYRK"
     gene            5316..5738
                     /locus_tag="CTC_RS13675"
                     /old_locus_tag="CTC_p7"
                     /db_xref="GeneID:24252474"
     CDS             5316..5738
                     /locus_tag="CTC_RS13675"
                     /old_locus_tag="CTC_p7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100785.1"
                     /db_xref="GeneID:24252474"
                     /translation="MRKFNFYIKYIFKILIYSFIVVIIPDIFIFKNFMESKKDLILLV
                     GGVIFISISILFSYRKKTRIITIDNKECFVKKLKGTLDKIKWELIREENNIIFINPEL
                     IAPRVFGREIIVKIYDNKVQFTGAKSLIDGLIWDLDNL"
     gene            5998..6195
                     /locus_tag="CTC_RS13680"
                     /db_xref="GeneID:24252473"
     CDS             5998..6195
                     /locus_tag="CTC_RS13680"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_023439654.1"
                     /db_xref="GeneID:24252473"
                     /translation="MAKAFKKRLIFYKIIGSLINTIFIILIVKRFQFIELSFKYSLAL
                     NYFIYIIIIFSITYFILYEQK"
     gene            6216..6398
                     /locus_tag="CTC_RS13685"
                     /db_xref="GeneID:24252472"
     CDS             6216..6398
                     /locus_tag="CTC_RS13685"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_023439655.1"
                     /db_xref="GeneID:24252472"
                     /translation="MHKINSYFKLFFKFLLLYSIATILTLIIISIILTDNELNYNSLK
                     YFIVSFVIMAVINAFQ"
     gene            6534..6860
                     /locus_tag="CTC_RS13690"
                     /old_locus_tag="CTC_p8"
                     /db_xref="GeneID:24252471"
     CDS             6534..6860
                     /locus_tag="CTC_RS13690"
                     /old_locus_tag="CTC_p8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100786.1"
                     /db_xref="GeneID:24252471"
                     /translation="MKLLSIEYIIVNIILFCSLCEKIYIFFSMGETIIRSKKRGILIM
                     DKYLYHYKWKEIKNYQLIDSNKLIFERFDSYNSSIDKIQIELYEKPIEELISFLEELI
                     PQNNFS"
     gene            6885..7124
                     /locus_tag="CTC_RS13695"
                     /db_xref="GeneID:24252470"
     CDS             6885..7124
                     /locus_tag="CTC_RS13695"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_023439656.1"
                     /db_xref="GeneID:24252470"
                     /translation="MKYIHVILNILLFIYILYALYNRIYTNKSNANEKPKNRFKFYKI
                     MLTLFIFLLFLDIIKGNINLQTLFWVQFCIIKTKF"
     gene            complement(7121..7327)
                     /locus_tag="CTC_RS13700"
                     /db_xref="GeneID:24252469"
     CDS             complement(7121..7327)
                     /locus_tag="CTC_RS13700"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_023439657.1"
                     /db_xref="GeneID:24252469"
                     /translation="MSKVFIRKILYYLVISFIISKLIFGKIEIIKFNSHYSLVINQSM
                     YIIISFVNLYFILLAYNQEKNNKH"
     gene            7442..7624
                     /locus_tag="CTC_RS13705"
                     /db_xref="GeneID:24252468"
     CDS             7442..7624
                     /locus_tag="CTC_RS13705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003489045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_045923736.1"
                     /db_xref="GeneID:24252468"
                     /translation="MNEKEEYINLKSIRVAYFYTVFFLFICVVRGNSDVEFFLFITQN
                     LVLIFSERYFESKDKK"
     gene            7828..8292
                     /locus_tag="CTC_RS13710"
                     /old_locus_tag="pE88_09"
                     /db_xref="GeneID:24252467"
     CDS             7828..8292
                     /locus_tag="CTC_RS13710"
                     /old_locus_tag="pE88_09"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080502853.1"
                     /db_xref="GeneID:24252467"
                     /translation="MNVLFIFFIAVIFIFMVIRNNNHLEVPNPEDLSSITFINVVNEK
                     GIERVIVYEQSDIYKLLEVFKNSKKTNKESISDLPNKTKFNAIFFNFTSGGNNLRSIY
                     EENEVFYIHQPYNGVFKLGSNDLYVLDEIIEKGKKESISMQLEDILKDNFKR"
     gene            complement(8469..9008)
                     /locus_tag="CTC_RS13715"
                     /old_locus_tag="pE88_10"
                     /db_xref="GeneID:24252466"
     CDS             complement(8469..9008)
                     /locus_tag="CTC_RS13715"
                     /old_locus_tag="pE88_10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="WP_011100788.1"
                     /db_xref="GeneID:24252466"
                     /translation="MYKLLCEYKRGNNKALEKIIENFIPLILKEASKYKIKCYDYEDL
                     VQHGYLSVIKACNKYKGNGDNFIPYCINAIKNNYTALLKGEIKHHREIPDEFILNKAK
                     DYMFTLEDEVIAYEKIEELYKALDKLSSSERYIIGSFYIGNKAMGEIACTTNKSYNEV
                     RYAKDKAIKNLQRILKKHI"
     gene            complement(9010..9564)
                     /locus_tag="CTC_RS13720"
                     /old_locus_tag="pE88_11"
                     /db_xref="GeneID:24252465"
     CDS             complement(9010..9564)
                     /locus_tag="CTC_RS13720"
                     /old_locus_tag="pE88_11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="WP_011100789.1"
                     /db_xref="GeneID:24252465"
                     /translation="MDIEHLVSKAKLGDKNSLEMILKEFTPTIIKLSSCVYLSSYNME
                     DLIQEGYLYLFNIIKKYNPKKSKFKTYANISLKNNYNYLIRQNVKYHGELSYNKEINL
                     DKDEMNYFLKDNFNIEDIFIKKALYKSLKSLDKKEFNILIHYYFKDGSLKDFSIKNNM
                     SYYNCIKLKNTALYNLKEKFERVV"
     gene            complement(9833..10255)
                     /locus_tag="CTC_RS13725"
                     /old_locus_tag="pE88_12"
                     /db_xref="GeneID:24252464"
     CDS             complement(9833..10255)
                     /locus_tag="CTC_RS13725"
                     /old_locus_tag="pE88_12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100790.1"
                     /db_xref="GeneID:24252464"
                     /translation="MTKKKRILSIICICVLGVISIAASNYYKAPKNDTEKAQYMKLLK
                     DKNSKILVEVGNEAITENDLKVAKIFNDNNLSDDQLLDKLIRDKIFIIEGKKENNKYK
                     NENTTKNLIDNSKDESYKQTIDRVYDNLKQNYHIQLLK"
     gene            10828..11817
                     /locus_tag="CTC_RS13730"
                     /old_locus_tag="pE88_13"
                     /db_xref="GeneID:24252463"
     CDS             10828..11817
                     /locus_tag="CTC_RS13730"
                     /old_locus_tag="pE88_13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParM/StbA family protein"
                     /protein_id="WP_011100791.1"
                     /db_xref="GeneID:24252463"
                     /translation="MENITNEYVMTLDAGKYETKLIGKNKKGTTEDIKRVIFKTKIYN
                     LEDGYIDIEGNSHKIELDGKEYLIGEQGVEDSSETSKTNLIHKLAAYTAITQVLDSNK
                     NNKVQLVLACPLSVLRNAKAKEEYRDYIKGNGEITVKVDDKEYSFEITDITIKAEGSG
                     VLFLEQENFKNKNVAVIDFGGLNMGFSLYRNCVVNPSERFIEEHGVKDLIIRVGDALT
                     DLNNGNLITNEQAESALNNGYMKKGGEIDTESSTVIKKVKEKFLKDAIKLIEKRGFKL
                     DQLDSLIFIGGTTQKLKEQISKTYPNNSIITNNSQWTTCEGLYKVAVAKYCIQ"
     gene            11832..12173
                     /locus_tag="CTC_RS13735"
                     /old_locus_tag="pE88_14"
                     /db_xref="GeneID:24252462"
     CDS             11832..12173
                     /locus_tag="CTC_RS13735"
                     /old_locus_tag="pE88_14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100792.1"
                     /db_xref="GeneID:24252462"
                     /translation="MPGGRKQNAITVSFSKKNSDIYGLLVNKKENEKGFNQNEYICEC
                     IRFFEKYKDKLNNNLSEHDIMKLIDIKLEEFKNNLNLSEVQVKEVKNELNNEKLESDI
                     EFINSSWLEDD"
     gene            complement(12293..>12577)
                     /locus_tag="CTC_RS13740"
                     /pseudo
                     /db_xref="GeneID:24252461"
     CDS             complement(12293..>12577)
                     /locus_tag="CTC_RS13740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011986597.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:24252461"
     gene            12873..13541
                     /locus_tag="CTC_RS13745"
                     /old_locus_tag="pE88_15"
                     /db_xref="GeneID:24252460"
     CDS             12873..13541
                     /locus_tag="CTC_RS13745"
                     /old_locus_tag="pE88_15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010076221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_035125440.1"
                     /db_xref="GeneID:24252460"
                     /translation="MHMLTIKNIYKTYGSGTGKVQVLNGINLTVNKGEFLSIMGPSGS
                     GKSTLVHIMAGLDKPTKGEIIFKGKNIYDLNENILSDLRRKEFGFIFQSFNLIPVLTA
                     EENIKLPLMVDKGKFDIEYFNYLVEYLNIKDRLQHYPSELSGGQQQRVAIARALVTKP
                     NIVFADEPTGNLDSDSTNEVLDILCNSIKKFNQTLIMITHDLNVASYGDRVLKLKDGS
                     IIKN"
     gene            13558..16011
                     /locus_tag="CTC_RS13750"
                     /old_locus_tag="pE88_16"
                     /db_xref="GeneID:24252459"
     CDS             13558..16011
                     /locus_tag="CTC_RS13750"
                     /old_locus_tag="pE88_16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011100794.1"
                     /db_xref="GeneID:24252459"
                     /translation="MSNLKLIIKYMKNKPKRTLSIIFSIIITSILLTIVGLVNYNIQI
                     NTIDNGKKLYGDYYADLNTKNKQKTETLKGYKYLKDKTVHIPYGMFTSKDMKTSLNIE
                     ISDETFLKSTGLEMLKGRFPKNKDEICVDESFLENMNITKKLDQYITLDLINSPKNLK
                     SDGYKEYKFTKKFKLVGILKTNPGIKFKGVSCGILSIKNIDDIPKDFIDYHILIKTFP
                     YKSVEEITKSIEHIQNRFNINEDDIFINRGLMQVIKHSNDSKILSIAFEMVVIIASIL
                     TIYNIFNMSILDRTKDYGILRCLGFRKKKIMSIVLKEGLILSIISIPIGILIGCFLSK
                     SIYFSIGKILNNTVKSLTLSIYVILLVFIITLLSVSISAFMPAIYAYNVSPIGAIKNL
                     NVYSKIHKIKHRKGHFIIKKLFKNEGMLAYKNIWRMKKRTYLIVFSLGISITIFTAFM
                     YYFNHIAIEDPSENFKNGQFKLTFDNRLDNTYCYDNNFISKINNMHGIKHITKIQSAT
                     ETAVLNESFIKSNLKDNPSENNLTIDNGEYRVPCNVIGYNEEIVKDLKTKIGKDEVIL
                     INDKYAKNNTNLKAGDIITLRRFYKDNIEQRVKYEDKEFKIKDILNKAPYQSSMIGIS
                     ALIRHDDFKNFTKINGYRTLDISVYENFNMDFINNELENLTKEVKYSKLLSYYKEIKY
                     IKDSIKFIKILTYSFIACIVLIGLLNIINTINTNIVLRMSEFATLKAIGFNKNHIRKV
                     IMFEGLFYGILSSIFGMFTSGVVCILLYNLIPNMKPGFSIIIFCIPELFIIIISLLSS
                     IVPLRKVNKINVINTLNEL"
     gene            16097..16285
                     /locus_tag="CTC_RS13755"
                     /db_xref="GeneID:24252458"
     CDS             16097..16285
                     /locus_tag="CTC_RS13755"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041744725.1"
                     /db_xref="GeneID:24252458"
                     /translation="MNNVPSITFLTDWYTILYFAVLLSQLTSVYSNAKKGKNRFSIAS
                     IVFILTLPIDKSRGFLSD"
     gene            complement(16369..17508)
                     /locus_tag="CTC_RS13760"
                     /old_locus_tag="pE88_18"
                     /db_xref="GeneID:24252457"
     CDS             complement(16369..17508)
                     /locus_tag="CTC_RS13760"
                     /old_locus_tag="pE88_18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011100815.1"
                     /db_xref="GeneID:24252457"
                     /translation="MCQLLVVLHFQQLNNILKIKKHHKGNDTVQLTIKIKLIPMKEQK
                     LHIQDTCLEYIKTVNDIVSLMVAENKSLKLTSKDIIANLPSAVKNQAIRDSKSVYSKY
                     KKTKIQNFLKKPMCIWNNQNYSIGENYIAFPVMINGKSKKIKVKAIIEQYQKDLLTNK
                     LGTLRITKKANKLMAQISIDVVEKENVNNKAMGIDLGLKIPAVAVTEDKKVKFFGNGR
                     QNKYIKRKYRSLRKKLGKAKKINKIKSINDKEQRYMKDQDHKISRGIVNFAIQNNISV
                     IRLEKLTNIRNTAKTNRKNEKNLHTWSFYRLAQYIEYKALLEGIKIEYVNPCNTSKQC
                     PICGKLNTAKDRKYQCSCGYKAHRDLNACINIINATVVDGNSLQA"
     gene            complement(17429..17836)
                     /locus_tag="CTC_RS13765"
                     /old_locus_tag="pE88_19"
                     /db_xref="GeneID:24252456"
     CDS             complement(17429..17836)
                     /locus_tag="CTC_RS13765"
                     /old_locus_tag="pE88_19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605-like element ISClte2 family
                     transposase"
                     /protein_id="WP_011100796.1"
                     /db_xref="GeneID:24252456"
                     /translation="MEQKYKSNNNIVYSCKYHIVWCPKYRRKVLIGNVETRLKELLIE
                     TCADIEVDIIKMELMPDHVHMLIEVDPQFGVHKAIKRMKGRTSKMLRQEFPHLKTKLP
                     TLWTNSYFVSTVGGAPLSAIKQYIENQKTSQRK"
     gene            18195..18539
                     /locus_tag="CTC_RS13770"
                     /db_xref="GeneID:24252455"
     CDS             18195..18539
                     /locus_tag="CTC_RS13770"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035125509.1"
                     /db_xref="GeneID:24252455"
                     /translation="MIKNIFKSNCFSFLIILIFNILLITGKIEFGSESGLVIVIAFMF
                     CFTSGLIIEIKRGNKSTIKLRILTTIIFSIILLSPINIIPNKYSYSSLFIIATELLML
                     EIIIYYFISDKI"
     gene            18829..19047
                     /locus_tag="CTC_RS13775"
                     /db_xref="GeneID:24252454"
     CDS             18829..19047
                     /locus_tag="CTC_RS13775"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035125507.1"
                     /db_xref="GeneID:24252454"
                     /translation="MAAELHMKNQVIPKKISEFLSNAKLSEEEIWERLRENWIRDGCN
                     FKWYHKNKKIVNWNIKRAQKQLVLIKII"
     gene            complement(19636..19851)
                     /locus_tag="CTC_RS13780"
                     /db_xref="GeneID:24252453"
     CDS             complement(19636..19851)
                     /locus_tag="CTC_RS13780"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035125505.1"
                     /db_xref="GeneID:24252453"
                     /translation="MFDNRNLLILIILASILCRIDMWRINKNYNKLLDAKEEDIYEYL
                     YNLSKIQVESNCTYFFLMLIALLLLFK"
     gene            20256..21941
                     /locus_tag="CTC_RS13785"
                     /old_locus_tag="pE88_20"
                     /db_xref="GeneID:24252452"
     CDS             20256..21941
                     /locus_tag="CTC_RS13785"
                     /old_locus_tag="pE88_20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100797.1"
                     /db_xref="GeneID:24252452"
                     /translation="MDKKNKVIKCNTSIVDNNIIESPLFISSIKEIITIGQLEKMDIS
                     SSVKRVLKVLKEDFKKSPLPMDYENFPVVYKRWNDSKGMIRELLITSSIPDMTTMDVW
                     NGLIGLYIQKLTPIYFNNENSSYDINEDEMEYTLYELAKFMNKSTGGKSLDKLMSEII
                     RLNNANYYSFANGVIFDKKNDKYLKSKTKGLSLIVDCEFNSEKRVKDQKVNTKCKVQF
                     NRLIVDNIRYEYIKYINPKEYFALPSRGFTRRLYIYIKGNSYLSNGHRSTYIKRSFQV
                     LRNKLPIHEHQPSKIKERLKKPLENLKKFNIISDYFFGDEVFINGITEKCVYFILEGS
                     REDLIKKLEKSSLLIKSDNEDLEFKMEIPKDLNSFLVEKGFSEVMAKEILYKYDKWTI
                     IKYILWLKEKEFENNQSVKNFPGMLRFALQGDTVNLENTHKHIVAFVDEKRISEKNIK
                     LNKEEFLKKSYEDYIQKETEKFKKEDEIAYKVLQDTILENLNVSYENKLREFALFEKN
                     ITKLEKENWEEQKKKWHEFNELREKSRLFKEQFEKSLIIIRNLKFYEDFKRDI"
     gene            complement(21961..22989)
                     /locus_tag="CTC_RS13790"
                     /old_locus_tag="pE88_21"
                     /db_xref="GeneID:24252451"
     CDS             complement(21961..22989)
                     /locus_tag="CTC_RS13790"
                     /old_locus_tag="pE88_21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M28 family peptidase"
                     /protein_id="WP_011100798.1"
                     /db_xref="GeneID:24252451"
                     /translation="MNFKFIRNITIIVIVLVLGFYGFINGNNTKTSKITNMNNFKMPT
                     TEEIITKLCSNEFSGRVINSKGNELTVEYMENLFNKLKLEPVFKDSYLHEFESAILGN
                     SDENGVPEKQTILKLNNVVGKISGKNNKNAIILGAHFDGYGKVTNPNTKKVEIFRGAL
                     DNASGVATILNIAHNLKTRKDTLDYDVIICGFNGELTGYKMGSEQFVKDIKHLYDKIF
                     YINIDCVGAKKAGPIALKNISRVKDSSQLYDSIKDIFKKHNIHYEDIYSSKKVEDCFE
                     KNFFGVSDYKYFEKNNIPNIHIAQSKISDLILKVEDTPEILDYNLIYALALSLSDFTK
                     NNELKFTN"
     gene            23264..23458
                     /locus_tag="CTC_RS13795"
                     /db_xref="GeneID:24255263"
     CDS             23264..23458
                     /locus_tag="CTC_RS13795"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035125503.1"
                     /db_xref="GeneID:24255263"
                     /translation="MELLYLIEDEDNRFILNLRPQGYIDPAIPARMLRYRVNIYESML
                     STNEDLLPMKQVVIYFSKEQ"
     gene            complement(23519..23704)
                     /locus_tag="CTC_RS13800"
                     /db_xref="GeneID:24255262"
     CDS             complement(23519..23704)
                     /locus_tag="CTC_RS13800"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035111391.1"
                     /db_xref="GeneID:24255262"
                     /translation="MEGLTTNNSKIHIDRLEKDTPSEAIQLSQKLYKMMPRIKLSDLL
                     LQVSKWIGFYRNFIHVF"
     gene            23809..24495
                     /locus_tag="CTC_RS13805"
                     /old_locus_tag="CTC_p21"
                     /db_xref="GeneID:24255261"
     CDS             23809..24495
                     /locus_tag="CTC_RS13805"
                     /old_locus_tag="CTC_p21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_011100799.1"
                     /db_xref="GeneID:24255261"
                     /translation="MYKILIVEDDSSIAELLASHIYKYGIECLICNDFDNILDEFIKL
                     DPNLVLMDVNLPKYDGFYWCRKLRQISKCPIIFISARAGDMDQILAMENGADDYVTKP
                     FSFEVVVAKINANLRRVYGDYAKNENDRILKKENIIFYFDSLILQNGDKKVMLTKKEA
                     ALATTLLENSPKVLSRESLLSKLWDDESFVEENTLNVNVTRLRKKFAEIDAKVEIEAI
                     RGMGYRLFQV"
     gene            24529..25473
                     /locus_tag="CTC_RS13810"
                     /old_locus_tag="CTC_p22"
                     /db_xref="GeneID:24255260"
     CDS             24529..25473
                     /locus_tag="CTC_RS13810"
                     /old_locus_tag="CTC_p22"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_011100800.1"
                     /db_xref="GeneID:24255260"
                     /translation="MIILYIINFIVLAFFYNKLGGFKENMSYFIFLSLFFLMCFLVYK
                     YILNKQIYKKLSEKPKSMDDMLTIDPHSPLEEAFFKTIQEYMKLYNKDINFMKNSQKE
                     YKIMLNNWVHQMKTPVSVINLLAQNNYDNEDFQKVALENRRIDYNLSQILTFLRIDDF
                     ANDMKIEKVNLKIVALEVVNELKEFFITQSVFPKLSISQNLSINTDKKWIKYAIYQIV
                     NNAIKYSKKNGTVYINGFVEEDMVVLEIINRGIGIKKSDINRIFDVFFTGDNGRTFGE
                     STGVGLYIVKKVLDILDHKISVKSKPGEETIFYIYFKP"
     gene            25671..26078
                     /locus_tag="CTC_RS13815"
                     /old_locus_tag="CTC_p23"
                     /db_xref="GeneID:24255259"
     CDS             25671..26078
                     /locus_tag="CTC_RS13815"
                     /old_locus_tag="CTC_p23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100801.1"
                     /db_xref="GeneID:24255259"
                     /translation="MKKINKVLINLIICCTIITIITGCNKVNSKNTEIQKLQSDLIIL
                     SEKNSQRYFNKKLNTKDFDISLAKQVKENEYEDIKTLDGVKNIYMIGHFNGKPSDIVE
                     FVLVYNLQSKKVIEFGIKNLKNDNMVYANLKEE"
     gene            26108..26866
                     /locus_tag="CTC_RS13820"
                     /old_locus_tag="CTC_p24"
                     /db_xref="GeneID:24255258"
     CDS             26108..26866
                     /locus_tag="CTC_RS13820"
                     /old_locus_tag="CTC_p24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011100802.1"
                     /db_xref="GeneID:24255258"
                     /translation="MSILEVKDIEKIYSGKVNYTALNGVNFELEKGEFVAIMGPSGSG
                     KTTLLNCVSTIDSPTRGEIIINNKRPHELDDDNLAKFRRQELGFVFQDFNLVNTLTVE
                     ENIILPLTLDSVSRRVMKDRLKISSNLLGIEKLLKKRTFEISGGQAQRVAIARSIIHE
                     PSLLLADEPTGNLDSKAVKDVMELFVSINKKLNTTILMVTHDAYVASFCNRVIFIKDG
                     KLYNEIHSGDSQSEFYEKIIDMLSFLGGGRSDIK"
     gene            26853..28781
                     /locus_tag="CTC_RS13825"
                     /old_locus_tag="pE88_26"
                     /db_xref="GeneID:24255257"
     CDS             26853..28781
                     /locus_tag="CTC_RS13825"
                     /old_locus_tag="pE88_26"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011100803.1"
                     /db_xref="GeneID:24255257"
                     /translation="MTLNRLALNNVLRDKWTYFAYFLSSVFSIFIFFCFSVSMFHPDL
                     TIIQNGSALSMAMMVGSIMVYIFSFMFISYSIRAFMKSREKTLGLFIIMGTSKKQLNS
                     MIFKENMLIGIAAIITAIIFGMVFSPLFLMIGKKIMMLEGFRMYVPIKSILLTFAMFF
                     ILFFIVSFASPLFISKNKIINMLKSDKTDEKKLVFSPLLIIIGLLMIISLVFIFNLYN
                     NIALVTNFVDSTIGSISIFAGILVVLYILYTQLPILIIGIIKKKRLYLRKTNMIIISD
                     IKAKLRSNVKIMYLITILFTVAFYAIVILYSANTDVEKVTKASYPYSYTYVSLSNNDY
                     EKQHVNLIRNSIKDKDGYKEYIFTIRCKGKTYENAVVMSQSEYNNVLKATNSNPISLK
                     NNEIYIVSGSPKTMPSRNINEDVKNILEKQGITPKVVGVNAKNITTEGYFGEINVLND
                     EMMNAFNKKEGFENIKVYGFNIGNWKEEGRITENLRSKIKITDEYKFGFFSAQELFVT
                     EKNSKNLMFYIGFFISIIFVIAASSMIYFKLFTEIEKECIKFKGIVKIGLSKKELSKI
                     ISIEIFILMFTPFLLAIAFLFAGSGSLGNKISSYFTVSVVCSLVFLIIQTLGYIIVNL
                     KYKKVIFKKVTDKVWTAF"
     gene            complement(29178..29375)
                     /locus_tag="CTC_RS13830"
                     /db_xref="GeneID:24255256"
     CDS             complement(29178..29375)
                     /locus_tag="CTC_RS13830"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035111379.1"
                     /db_xref="GeneID:24255256"
                     /translation="MNIEHLVSKAKLGDKTSLEMILKEFTPTIIKYSSCVYLSSYNME
                     DLIQKGYLYLFNIIKNIILKK"
     gene            29542..30111
                     /locus_tag="CTC_RS13835"
                     /old_locus_tag="pE88_27"
                     /db_xref="GeneID:24255255"
     CDS             29542..30111
                     /locus_tag="CTC_RS13835"
                     /old_locus_tag="pE88_27"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100804.1"
                     /db_xref="GeneID:24255255"
                     /translation="MNKQKFNNLDLMDQLEYVNKKLSDGESLREISKCLNMSKTTIRN
                     RFKKIDYVFNKDKKQYIKDSDEYKKNINMLQVKPIENKEIKEDEYIYNTNVLTNVEAK
                     EKLINIIDNYDNIEKMLKWFENQKNIIEVEEINIDTDKLVGNAKTTTVRLYDKVWEDF
                     RKFMKGYPEYKSMDLVSMALVEYMSKYKK"
     gene            30338..31174
                     /locus_tag="CTC_RS13840"
                     /old_locus_tag="pE88_28"
                     /db_xref="GeneID:24255254"
     CDS             30338..31174
                     /locus_tag="CTC_RS13840"
                     /old_locus_tag="pE88_28"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase domain-containing protein"
                     /protein_id="WP_011100805.1"
                     /db_xref="GeneID:24255254"
                     /translation="MKKQKIIRFEDSERIFKCPVCMEALYLKDKSLLCKNKHCFDISK
                     HGYINFILNAKSQKDYNKNSFENRRIILERGIYNHILKEIIDFLNDTSSISRVLDVGC
                     GEGFYANQIYQSTNKEVCAFDISKESIQLAAKRDTSNSVKWFVADLAHLPMKNQSVDC
                     ILDIFSPANYCEFHRILTPDGYLVKIIPGDGHLKELREKAREYLKNKDYSNQQIVNYF
                     ENHFSTICRKKITAQYEISANEREALINMTPLLFNVNKENIDWTEINHITIEAEILIG
                     RP"
     gene            <31235..31890
                     /locus_tag="CTC_RS14620"
                     /pseudo
                     /db_xref="GeneID:31474306"
     CDS             <31235..31890
                     /locus_tag="CTC_RS14620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100821.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing start; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:31474306"
     gene            32303..32668
                     /locus_tag="CTC_RS13850"
                     /old_locus_tag="pE88_30"
                     /db_xref="GeneID:24255252"
     CDS             32303..32668
                     /locus_tag="CTC_RS13850"
                     /old_locus_tag="pE88_30"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100806.1"
                     /db_xref="GeneID:24255252"
                     /translation="MTSGHTYLGCVLGNVEVQKKSNDQILLLGTATTGVAGLLYKIAP
                     IVGAVVGGITAVIAGHQYYLKTLPDNIITYSNQYFRWTNTRNYEYEYKYYSGFKDRAG
                     NVLSSNIYYSYGDFSYLAD"
     gene            32685..32948
                     /locus_tag="CTC_RS13855"
                     /db_xref="GeneID:24255251"
     CDS             32685..32948
                     /locus_tag="CTC_RS13855"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035125499.1"
                     /db_xref="GeneID:24255251"
                     /translation="MIKKLEMIFNIILICISLTLYNYKSIRILNYNYVSLVKICYLLF
                     VFTNLISIFREIRYAYPKVNKINIVNIALKSLVIVLFTLLIVK"
     gene            complement(33162..35102)
                     /locus_tag="CTC_RS13860"
                     /old_locus_tag="pE88_31"
                     /db_xref="GeneID:24255250"
     CDS             complement(33162..35102)
                     /locus_tag="CTC_RS13860"
                     /old_locus_tag="pE88_31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100807.1"
                     /db_xref="GeneID:24255250"
                     /translation="MPFYPQQFILAFLVYLLPSIIFYTALCLFLEILFRHSIISVVLC
                     IFLFIFSDTMPEKFRFILRGSYLKCLTNNFTLSQQFINNIIVNRLLYILLAIILTTNT
                     PTYKLVISRYLISFLLGQVILILLFLLAWLKDIEPNILEKYSIVLLYSLFLSLLGLLI
                     SNITKNTVIGYIVPSIYCLSQIIIGISYLEKYVPLIATGINLQLTEHILMGNIYFTIF
                     SVIILLIINFFYLSKGERIRRNLIFSTIILIICCCTTLGIYSFIKYNNESAFGKFIYN
                     KPVYIIGTKDKEIAKYLDSKNIDFLSKDTITMDDIKQNNTIIISSKNSSFVNSTKKLL
                     DLNLLLKNNGIVSNKSGVYNISSYGILLKNPFNKDVLLSLIECTNTYDLDYIINNPKS
                     NFLGVKNGKPMIKSNCSLNKFNISNVIKNSTILNNDCLLMNENNTTTLLYRNINAKDA
                     TNISNLWEMINTSLETLNTNNKTNNILKVYFKEKQNNNDKVLSICINDTKSLESDSLY
                     NTYNNICYEILSNQILKNIKDPDLKKGWIEYMINVYIPTNILKKYNSKPLCLDSITLE
                     GIKSSYLEEMQLSSNNKENNIHKVILASKMLNFINTKGKIEDFIKDISTKDKTLTNSE
                     LKTIYSNYVDPKTSKNDFNNFK"
     gene            complement(35102..35482)
                     /locus_tag="CTC_RS13865"
                     /db_xref="GeneID:24255249"
     CDS             complement(35102..35482)
                     /locus_tag="CTC_RS13865"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035125495.1"
                     /db_xref="GeneID:24255249"
                     /translation="MRSLIVSKLELRNLFKSYMLPLEIIILIISPFFIEKSNLINHID
                     NARFVAYTLMHALCMLGGFIIPFQIFQIFYQDQTTDISQIIYSNPILAKQYIIGKYLA
                     SVFNFLQFALISTLISIIYPIFLI"
     gene            complement(35521..36213)
                     /locus_tag="CTC_RS13870"
                     /db_xref="GeneID:24255248"
     CDS             complement(35521..36213)
                     /locus_tag="CTC_RS13870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_080502850.1"
                     /db_xref="GeneID:24255248"
                     /translation="MYKDKLNVRKIVGFLPQEFNIYPQLSPREFLDYIAQLNYIKNPL
                     ERKKVINTVMEKVNLVDCMDKKIGSFSGGMKRRLGIAQALIKNPEVLIVDEPTAGLDP
                     EERIRFRTMLVELSQNKIVILSTHIVEDVSASCEKIALLASGEIKYVGSPSSFIKNVD
                     NMVWEKTIYNTRELIKIKNLYNIVSIRQSSNGIIIRFIANVNNISEKQNLISVNPSLE
                     DAYLHYMENIRK"
     gene            36699..37001
                     /locus_tag="CTC_RS13875"
                     /db_xref="GeneID:24255247"
     CDS             36699..37001
                     /locus_tag="CTC_RS13875"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013412308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2442 domain-containing protein"
                     /protein_id="WP_023439689.1"
                     /db_xref="GeneID:24255247"
                     /translation="MEYMPEVIQVVPTEEFKVYVYFDDGSIHLYDASELVTKGIFKPL
                     SDIKIFKDTCTVLNGTLAWSLDGTYDESTCLDVDPFVIYEEYPEVEEPTFLFKNYT"
     gene            complement(37332..37562)
                     /locus_tag="CTC_RS13880"
                     /db_xref="GeneID:24255246"
     CDS             complement(37332..37562)
                     /locus_tag="CTC_RS13880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011988294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035125494.1"
                     /db_xref="GeneID:24255246"
                     /translation="MSLPKITQENVHIFIPLKASKVSQRLAKNYNLSLKDALLEFYNS
                     KTYEDLEQEDTKLWHEGINYLYKELEKEKSLQ"
     gene            complement(37559..37783)
                     /locus_tag="CTC_RS13885"
                     /db_xref="GeneID:24255245"
     CDS             complement(37559..37783)
                     /locus_tag="CTC_RS13885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017352226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3791 domain-containing protein"
                     /protein_id="WP_035125492.1"
                     /db_xref="GeneID:24255245"
                     /translation="MVDLNDNEKLLEFVSFCIENFKIKFNMKGRDVANLFYENGITDF
                     LIDNYDILHTQGKGYILSEIELFLQNRGII"
     gene            complement(37990..38466)
                     /locus_tag="CTC_RS13890"
                     /old_locus_tag="pE88_33"
                     /db_xref="GeneID:24255244"
     CDS             complement(37990..38466)
                     /locus_tag="CTC_RS13890"
                     /old_locus_tag="pE88_33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100809.1"
                     /db_xref="GeneID:24255244"
                     /translation="MKYKNKYYLFIIFGVLIILFIDYKFTFNDIPSSMPSLKVRFDNG
                     TFYATPNGYNWSSSKNSSSNLGYYSIEVAKEIKAIKVPKNSNLKLILSSDKGLKIFNV
                     KQIIGTTIDNHTLKDINLNDNIIITPENNGEYIYYVYADWGDNHFVEYIIKIVVED"
     gene            complement(38919..39206)
                     /locus_tag="CTC_RS13895"
                     /db_xref="GeneID:24255243"
     CDS             complement(38919..39206)
                     /locus_tag="CTC_RS13895"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_023439693.1"
                     /db_xref="GeneID:24255243"
                     /translation="MKTNLDNFIYIILFLLIIINIFIIIRRNSMYKKQHFKNIKNYKN
                     KLCIELAILILYIINVYVSLKICKYNVQVWCILILAATITVKFILINLSKY"
     gene            complement(39438..42413)
                     /locus_tag="CTC_RS13900"
                     /old_locus_tag="pE88_34"
                     /db_xref="GeneID:24255242"
     CDS             complement(39438..42413)
                     /locus_tag="CTC_RS13900"
                     /old_locus_tag="pE88_34"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003362673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M9"
                     /protein_id="WP_011100838.1"
                     /db_xref="GeneID:24255242"
                     /translation="MKKKFIKMLCSIAIGCMISTSYSIKVSAFSNGNTKTNPNGEFKS
                     LSLNSTNPYKTKYSFNDLNKLSNKEILDLTSKIKWSDISDLFQYNKDSYTFYSNKERV
                     QALIDGLYEKGCNYTSTDDKGIDTLVEILRSGFYLGYYNDSLKYLNDKSFKDKCIPAM
                     IAIENNKNFKLGENGQDTVVHALGKLIGNTSCNDEVVNKTIPILEQYYNEIDKYSKDR
                     LKSNAVYNFMKEINYDISQYEYAHNIRDYKNTPWSGKIDSFIDTISKFASISNVTKDN
                     GWIINNSIYYTAKLSKYHSNPSIPHSVIDNCIEIFPDYSEQYFTAIEAIKEDFNSRDS
                     KGNVIDINKLIEEGKKHYLPKTYTFDNGKIIIKAGDKVEESKIQKLYWASKEVKSQFH
                     RIIGNDKPLEVGNADDILTIVIYNNPEEYKLNKTLYGYSVDNGGIYIEGIGTFFTYER
                     TPQESIYSLEELFRHEFTHYLQGRYLIPGLFNKGDFYKGNNGRITWFEEGSAEFFAGS
                     TRTSVLPRKSMVGGLSKNPKERFNADKLLHSKYSDGWDFYKYGYAFSDYMYNNNKKLF
                     SDLVSTMKNNDVKGYEALIEESSKDSKINKDYEYHMENLVNNYDNYTIPLVSDDYMKQ
                     YDNKSLHEIKSDIEKAMDVKNSQITKESSQYFDTYNLKATYTLSSNKGEISNWNYMNN
                     KINEALNKLDNLSWGGYKTVTAYFSNPRLNSNNEVVYDIVFHGLLSHNKNSNEKVEVK
                     EEPEIKDKDSFENVIYEKENNDSFDKANKIHKNQIVMATLDTEDYRDTFYFDALTSGS
                     IDITIENIHGNSDAFNWLVYNDEDLNNYIAYPTKKEDNKLMGSFKVHKPGRYYILVYK
                     TSLNKVNYKLNISDATNMAPVIKKIHEKENNDSFETANKITLDTLVLGNLDYKDVSDI
                     YSFDIENTKDLNIKLTNLNNLGIAWNLYKESDLNNYIAYGAKSDNAIVGKCNLSPGKY
                     YLYVYKYSGDKGNYSVIIN"
     gene            42788..43603
                     /locus_tag="CTC_RS13905"
                     /old_locus_tag="pE88_35"
                     /db_xref="GeneID:24255241"
     CDS             42788..43603
                     /locus_tag="CTC_RS13905"
                     /old_locus_tag="pE88_35"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-spanning permease"
                     /protein_id="WP_011100810.1"
                     /db_xref="GeneID:24255241"
                     /translation="MKILKVDLKRAFFSKTNLITILIGLLVILLGMFMEPIRSAFNLY
                     YSNASDINNSQKMHLIKNSLNKATLWNFGNYYYIMLMPLLSSIPFASAYLEDKKTGFN
                     KFQIIRTNYKKYILSKLITTFISGFSVILIISIIYFLGINLIDSGNEFRSIFYDNTFL
                     GDLGRLNFNLFLVIYTIITSFMGGVYAVFGLAISTFVNSILIGIVSPFILYYFGSYLF
                     LIIGKVEYSPNIVNEFYRYVGISFKNIFIQLIVIFILSTICFFIKTYRSDTFE"
     gene            43596..44405
                     /locus_tag="CTC_RS13910"
                     /old_locus_tag="pE88_36"
                     /db_xref="GeneID:24255240"
     CDS             43596..44405
                     /locus_tag="CTC_RS13910"
                     /old_locus_tag="pE88_36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-spanning permease"
                     /protein_id="WP_011100811.1"
                     /db_xref="GeneID:24255240"
                     /translation="MNNFKYSILYNFKKLNYRFILFFVLSIQVVIYFIMKEYWELNPY
                     INATYNNWDFYSSAYMNSDLLVSTLFFFSLYFIFNCFKDSDNERLIQIRTKSTFKWFS
                     FKIASIFIFNSIISVFCNLYLIIIGIYKMGYGFTWSEKSRAIYVYSDFYSPQRIVFFN
                     IITYSVFVTVLSCVLGILFIKIKNKKIPLIISIIYFILDKYVFRLSDKILKIIKYLSL
                     NSYLIFNNRQFYKYENNYMTVKLGLIVPIILLGVLLILSKILISGKSCENY"
     gene            44392..45192
                     /locus_tag="CTC_RS13915"
                     /old_locus_tag="pE88_37"
                     /db_xref="GeneID:24255239"
     CDS             44392..45192
                     /locus_tag="CTC_RS13915"
                     /old_locus_tag="pE88_37"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100812.1"
                     /db_xref="GeneID:24255239"
                     /translation="MKTINMNKKNLNYILIGMIIFLIAILNIFNAYNFLSNCSGKNIS
                     LQDIIIYIIYGFGENSKTTFIDILRFAIPYLLTIFLCGIYIENMLETGRKYIQIIRYK
                     GYKYWLRSNIKILFLYIIFIFIIYYFLLVIICLLFVKNTTGITDFFYKFNLYENFNIS
                     FYKIVIYQYFINVFLTLNIILIEIFLSLLLKDTIKSYIFVNLLIFIFSTLGTYRIYNP
                     FMISRHKFICHIYKISPVTTIFFSFITCILLYVSIIKLIKSIIRRDEI"
     gene            45189..45830
                     /locus_tag="CTC_RS13920"
                     /old_locus_tag="pE88_38"
                     /db_xref="GeneID:24255238"
     CDS             45189..45830
                     /locus_tag="CTC_RS13920"
                     /old_locus_tag="pE88_38"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011100813.1"
                     /db_xref="GeneID:24255238"
                     /translation="MILINNVTKKFGTNIILENINLKLQEGNIYGFVGKNGSGKTILF
                     KMIAGFMAPTNGEIKVYNKIIGKDVDFPTSCGIIIESPGFINNLSGYKNLKLLSDINK
                     TISEDEIRKYMNFFGLDPYDKKKVKNYSLGMKQKLGLIQALMEDPKILILDEPMNALE
                     EETVIKVRELLKKIKKEKIILLSSHNKEDIDLLCDRIYHVKDRHINICNESAE"
     gene            complement(46073..46369)
                     /locus_tag="CTC_RS13925"
                     /db_xref="GeneID:24255237"
     CDS             complement(46073..46369)
                     /locus_tag="CTC_RS13925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005356709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_080502851.1"
                     /db_xref="GeneID:24255237"
                     /translation="MTLVGLDYNEKKAVKKYSLGMKQRLGIAQAIMEKPKLIILDEPM
                     NGLDKSGVDDIRNLLKLLKDKGVTILLASHNSDDINILCEDVYEMDNGYLNKLD"
     gene            complement(46386..46895)
                     /locus_tag="CTC_RS13930"
                     /old_locus_tag="pE88_39"
                     /db_xref="GeneID:24255236"
     CDS             complement(46386..46895)
                     /locus_tag="CTC_RS13930"
                     /old_locus_tag="pE88_39"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100814.1"
                     /db_xref="GeneID:24255236"
                     /translation="MSKICRIIKNDIYSLFSINKLIFTIIIFTIISITTMQNISDIWR
                     NDLGIYDICFLAFLGPQTLNFKIIEVLKWIIPHIFLYYFISDFIDLELRERNIYLIYR
                     IKSLNTWLKSKIISLLIITFFYFFIGFIIVLALAMFKFNVKNNLSYNLLLTLNSIKLN
                     NFNKKYNIP"
     gene            complement(47307..48446)
                     /locus_tag="CTC_RS13935"
                     /db_xref="GeneID:24255235"
     CDS             complement(47307..48446)
                     /locus_tag="CTC_RS13935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_080502852.1"
                     /db_xref="GeneID:24255235"
                     /translation="MCQLLVVLHFQQLNNILKIKKHHKGNDTVQLTIKIKLIPMKEQK
                     LHIQDTCLEYIKTVNDTVSLMVAENKSLKLTSKDIIANLPSAVKNQAIRDSKSVYSKY
                     KKTKIQSFLKKPMCIWNNQNYSIGENYIAFPVMINGKSKKIKVKAIIEQYQKDLLTNK
                     LGTLRITKKANKLMAQISIDVVEKENVNNKAMGIDLGLKIPAVAVTEDKKVKFFGNGR
                     QNKYIKRKYRSLRKKLGKAKKINKIKSINDKEQRYMKDQDHKISRGIVNFAIQNNISV
                     IRLEKLTNVRNTAKTSRKNEKNLHTWSFYRLAQYIEYKALLEGIKIEYVNPCNTSKQC
                     PICGKLNTAKDRKYQCLCGYKAHRDLNACINIINATVVDGNSLQA"
     gene            complement(48367..48801)
                     /locus_tag="CTC_RS13940"
                     /old_locus_tag="CTC_p40"
                     /db_xref="GeneID:24255234"
     CDS             complement(48367..48801)
                     /locus_tag="CTC_RS13940"
                     /old_locus_tag="CTC_p40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015757473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605-like element ISClte2 family
                     transposase"
                     /protein_id="WP_035111493.1"
                     /db_xref="GeneID:24255234"
                     /translation="MTLSNIIQTWNKKYKSNNNIVYSCKYHIVWCPKYRRKVLIGNVE
                     TRLKELLIETCADIEVDIIKMELMPDHVHMLIEVDPQFGVHKAIKRMKGRTSKMLRQE
                     FPHLKTKLPTLWTNSYFVSTVGGAPLSAIKQYIENQKTSQRK"
     gene            complement(48826..49347)
                     /locus_tag="CTC_RS13945"
                     /old_locus_tag="CTC_p41"
                     /db_xref="GeneID:24255233"
     CDS             complement(48826..49347)
                     /locus_tag="CTC_RS13945"
                     /old_locus_tag="CTC_p41"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100817.1"
                     /db_xref="GeneID:24255233"
                     /translation="MPKSFSPKLFVNNIYETLSKTKMFIVLIILCFNCISRLRNLIQC
                     SLHLDINLSIYDLIMYIFNSFPTVLFTLNFLFLFLIPDILLEKSSYLLSIIRYKNRSQ
                     WYKNKLLSILFISICYVTLIIIICCIIGIGNLNFDNVWNNGSIIINDKLNNGFMNNFT
                     RFAVKPLSSNMGI"
     gene            complement(49310..50104)
                     /locus_tag="CTC_RS13950"
                     /old_locus_tag="CTC_p42"
                     /db_xref="GeneID:24255232"
     CDS             complement(49310..50104)
                     /locus_tag="CTC_RS13950"
                     /old_locus_tag="CTC_p42"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-spanning protein"
                     /protein_id="WP_011100818.1"
                     /db_xref="GeneID:24255232"
                     /translation="MTNLLKQDFKRAFINIYFLLAILICLLACSLGIYPYIDFFENGA
                     IYFFLRAHSMGSSSVLALMVPLIPAIPFAFSYVNDKESGFINYIYLRNSKKEYIISRL
                     ISNSLAGGLSLALPLLFVFGLLSSIFPVKYVDMGSVKGAFSSIYNTSQVNYVFLLIGL
                     AFIFGAVYSTLGLAITAFVENKYLAIVFPFFVYSIPGILFPILGLDCFEPSTTFIPSA
                     NIYTKWYMIFIQQSILFILSASLFYIKVIREGDTNAQKFFSKVVCK"
     gene            50368..50796
                     /locus_tag="CTC_RS13955"
                     /old_locus_tag="pE88_43"
                     /db_xref="GeneID:24255231"
     CDS             50368..50796
                     /locus_tag="CTC_RS13955"
                     /old_locus_tag="pE88_43"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100819.1"
                     /db_xref="GeneID:24255231"
                     /translation="MKKKSFLLVTILIFTFFIVFHSINKYFIIPFYLKDMGLIYTNFR
                     YFYYISYGVLIFTIIYFALTDFIKNKFKISKINIVIINIQVGIYLILSNIIRMKIASK
                     FLINRLNLNPWQYPLLIIMFLFSSLYGLVWIYISNKFMGR"
     gene            50975..51895
                     /locus_tag="CTC_RS13960"
                     /old_locus_tag="pE88_44"
                     /db_xref="GeneID:24255230"
     CDS             50975..51895
                     /locus_tag="CTC_RS13960"
                     /old_locus_tag="pE88_44"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015394148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4351 domain-containing protein"
                     /protein_id="WP_011100820.1"
                     /db_xref="GeneID:24255230"
                     /translation="MDFNKIEDSIMKNAMDIFKQSAVDFFKLDTKIIAPANTELKTID
                     IKTNFTDYTFYTENDDYLHFEFQTTNKEEDINRFLFYDASLFYKYGKKVNTLVVYSSD
                     IKKSKTKVDAGSLKYEIKAFYMSSLNGDEEYNNLKTKIDKGEDLTKEEILSLTFIPLM
                     DSKEDKSTRTIKSIELAEKMEENNTKLQCITLLYAFLEKFGDAKSKKKFKEVFSMTEI
                     GRMIVEESIEKGRAEGIKKGIEEGIKKGRTEGKTEGKSEILIKQLIKKFKKVPEEYIQ
                     KIKTLSIDTIDIIALEIFDMEDIKDLEKYF"
     gene            52344..53732
                     /locus_tag="CTC_RS13965"
                     /old_locus_tag="pE88_45"
                     /db_xref="GeneID:24255229"
     CDS             52344..53732
                     /locus_tag="CTC_RS13965"
                     /old_locus_tag="pE88_45"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100821.1"
                     /db_xref="GeneID:24255229"
                     /translation="MLAKQLSLYDYIDNTLKNLVTCEVEIKAEEDNIQKATFHMDTLH
                     KGDDGYITIAIKHNNDWSQYHYKIEELKENVGKVLSIDGVNIYLSPNSFYKPIRRIEN
                     VRKLNSLYIDLDYYTLDKFKDLTVDQILWNLEADYFKSKVPEANFIVITGRGLAIYWL
                     IEAVPYKALPLWNAVQKNFLNKLKEIGADEKSIDAARVMRLSGSVNQKNGHAVDLLFY
                     NDNKYNLRDIQENYLPDLTPYVKNPYHKAKGRRKKVVNLFNLYSLHYARLRDLVKLME
                     LREGMCRMEDGSLKATGLRELMCFLYRYWSSCYERDTENALQSTLDFNKQFREPLNIS
                     EVEKATNSAQKAYKAWLKDCPTGTYSRGGYNYKNKTLIKLLNITEDEMKVLETIIDNK
                     EVKRRTNIRTNKHHKAKRRNEKGLTKRQQEKENTIMLVKKLLKKGLGVKAIARELNIN
                     ISAVSRIKNNKY"
     gene            complement(54773..55213)
                     /locus_tag="CTC_RS14380"
                     /old_locus_tag="CTC_p46"
                     /db_xref="GeneID:25393101"
     CDS             complement(54773..55213)
                     /locus_tag="CTC_RS14380"
                     /old_locus_tag="CTC_p46"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100822.1"
                     /db_xref="GeneID:25393101"
                     /translation="MIIIKKKIIIAIFIALIALISLFIYHGKNNEKIDIYDTVKETFL
                     TDKGYYNELSKYVSENVFKHTNIYTVYELNNPKYNKPFKINFNLKEKSQNKKNKLIFV
                     KMIYTVEINDSQNKTIGGSYDVPITFTVKNENGNWYIISKEEEA"
     gene            56391..56750
                     /locus_tag="CTC_RS13975"
                     /old_locus_tag="pE88_47"
                     /db_xref="GeneID:24255227"
     CDS             56391..56750
                     /locus_tag="CTC_RS13975"
                     /old_locus_tag="pE88_47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase domain-containing
                     protein"
                     /protein_id="WP_011100823.1"
                     /db_xref="GeneID:24255227"
                     /translation="MKDKIKNILNVHGIDVCFLFGSYGTSRFNEDSDIDIAILGDIDF
                     LDTLPLLEKLEDELKREVDLIKADEVYPIIQLAIAHRCDIVFCKDNKKLQSFLLKSKK
                     WYEEEYRFWKKCYAAEY"
     gene            56701..57186
                     /locus_tag="CTC_RS13980"
                     /old_locus_tag="pE88_48"
                     /db_xref="GeneID:24255226"
     CDS             56701..57186
                     /locus_tag="CTC_RS13980"
                     /old_locus_tag="pE88_48"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100824.1"
                     /db_xref="GeneID:24255226"
                     /translation="MKKNIDFGKNAMQQNTRREVMVRLNNRKLKVILENTEQVINHLD
                     FDLEQYEELDGRKKEMCARTIRNDIADIFKNLEDYLALVLKKIGVFVNDKSFKDCINL
                     ALDKQLLHDEFGKYIIDKIKIRNFFSYRYNYPKTEELIKVYKGHEDLFKGHISFKMTL
                     F"
     gene            complement(57241..57954)
                     /locus_tag="CTC_RS13985"
                     /old_locus_tag="pE88_49"
                     /db_xref="GeneID:24255225"
     CDS             complement(57241..57954)
                     /locus_tag="CTC_RS13985"
                     /old_locus_tag="pE88_49"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4184 family protein"
                     /protein_id="WP_011100825.1"
                     /db_xref="GeneID:24255225"
                     /translation="MPFTLAHPAAVIFSKNKHFNLMGLILGSMAPDFIYFILFNPSSN
                     LGHTFLGFLFLNLPLCYLLNYLIIKFIRIPFILNLPFGLSRYYTYLLNYRVNIKSIKD
                     IIVFGYSSILGMVTHVFWDAFTHSNGFFVLNINFLKININFFNFQIPLFKIIQHGSTL
                     IGIILILIYLNKIKKESNKDIISSKLKYHFIAIFIQIIVIIFSYIFFNTFGIGRFVVT
                     FINGLFVGYLISSILFSRK"
     gene            complement(58025..58633)
                     /locus_tag="CTC_RS13990"
                     /old_locus_tag="pE88_50"
                     /db_xref="GeneID:24255224"
     CDS             complement(58025..58633)
                     /locus_tag="CTC_RS13990"
                     /old_locus_tag="pE88_50"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013720987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011100826.1"
                     /db_xref="GeneID:24255224"
                     /translation="MKSVEPLRDIKTIKSMRAILKSQNTRNELLFILGINAGLRISDI
                     LKLKFEDVINFKNMKVLDYVIIKEKKTGKTKKFYLSSIVQKLIEKYIKEFDSISREMY
                     VFKSNKGENKPISRQHAWYILNTAAEMIGLVKRDDSGKIIQGEIGTHTMRKTFGYHAY
                     QNGTSLELLMDIFNHSCKSETLRYIGITEEEKRDVYLHSNLG"
     gene            58890..59366
                     /locus_tag="CTC_RS13995"
                     /old_locus_tag="pE88_51"
                     /db_xref="GeneID:24255223"
     CDS             58890..59366
                     /locus_tag="CTC_RS13995"
                     /old_locus_tag="pE88_51"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100827.1"
                     /db_xref="GeneID:24255223"
                     /translation="MTNIKQDKWSLITLTSIIIFNCFFMTILFYYNNIIIIVNRFFKK
                     TTEEYYFWWFNRPITNNNESALMELTYIIKIVFLLIFLLEFFYLISNNEYINLIKKKN
                     IIIYLAIGFGIYCVSFLFIKYKAEHYRLFMTLISTEIFSLILLKLVLKVKTEINKL"
     gene            complement(59451..60158)
                     /locus_tag="CTC_RS14000"
                     /old_locus_tag="pE88_52"
                     /db_xref="GeneID:24255222"
     CDS             complement(59451..60158)
                     /locus_tag="CTC_RS14000"
                     /old_locus_tag="pE88_52"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011100828.1"
                     /db_xref="GeneID:24255222"
                     /translation="MSYIQLIDIVKEYGDKQEIVHALNKININIEKGEMIAILGTSGS
                     GKSTLLNLIGCLDKSTSGKYIFDSKDITKCNDKDLSIIRNTKIGFIFQTFSLITEYNV
                     IENVELPLLYRNLLLGNTKKLDNHEIKNLALKYLKKVGMDKYINKKVTKLSGGQQQRV
                     AIARALVNEPDIILADEPTGSLDKKNSFNIINILKDINNTNNTTVIIVTHDEEIAKLC
                     KKIIRIEDGIIIESISL"
     gene            complement(60161..61354)
                     /locus_tag="CTC_RS14005"
                     /old_locus_tag="pE88_53"
                     /db_xref="GeneID:24255221"
     CDS             complement(60161..61354)
                     /locus_tag="CTC_RS14005"
                     /old_locus_tag="pE88_53"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003374834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011100829.1"
                     /db_xref="GeneID:24255221"
                     /translation="MCRLEMLIKSISKQGLKFKLVFFQLVIVFISLNFAFTLINKNLE
                     IKNNINKLVSKDNSVMFRLSVSSQNQDPLNSINKIYEEISNNKMVDKIGSYFISKIKV
                     NDSEINAIFFNKGAFDLYNMNICKGSNKIFNYQKSQNEIPIFISNNLSNKLNVGNVIT
                     AKMLQDNQLKDFKLKVIGVLNSDTIFWNSKLGGNSSIVSLKDSIIIPFDKQYFYDEIV
                     DSTMKSKHTVVSTKKAHDLNEFTTYFSKINYNNTTLDYIKVNDLITQIYNINKPWIMM
                     TLTFSLLLSILSTIGFIGILTSYITFRKREYGIRFALGSSNKELTRLICGEIYLSLIT
                     TNFISILILIIINYILKMNLTPLLIIKSIIPSFIISVTMFFITFLTFKSYILKKNIVD
                     LIRGN"
     gene            complement(61356..62486)
                     /locus_tag="CTC_RS14010"
                     /old_locus_tag="pE88_54"
                     /db_xref="GeneID:24255220"
     CDS             complement(61356..62486)
                     /locus_tag="CTC_RS14010"
                     /old_locus_tag="pE88_54"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003374914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011100830.1"
                     /db_xref="GeneID:24255220"
                     /translation="MFKLVLRKIRSNFTHYFLIFIGYFSALLVILFGFIFLKCSKDMT
                     IDYTNGKIEHQRLISVNVNDSNNMDYNNLINVLKKHSKTTSIRIDGLIEEVPINEKIF
                     EVPIQPVIFSETPEWIPQITNGRYLNPRESSSKAKIAVIGKGVELNKLSKNNYINLCG
                     EKFKIIGIAGKKSNFSNYLGSVFIPLESLPDKMKNNIKTIQIYLLKNNNSPEKEMNKI
                     LNDLNKLSNIKATQVEIMDNLSEFYSTLSITVFVSCLIILVSVSNISILIFYLMLKNK
                     KNILISIALGANRKMIWKQIFIELMLVSLCAIISALIVVHLLIPFVKDNFTHILNVEN
                     IQFSYFNIIATSLAPIIMSFLISIISVKKFFNLDLTMELKGE"
     gene            complement(62491..62748)
                     /locus_tag="CTC_RS14015"
                     /db_xref="GeneID:24255219"
     CDS             complement(62491..62748)
                     /locus_tag="CTC_RS14015"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035125435.1"
                     /db_xref="GeneID:24255219"
                     /translation="MNNNLRLKELDILRALSFIFVVEQHSMGGHYNIKGISNLYYGIF
                     KFFSIETPKQKGNYKIKVAMSCKNKKKQTYFISNTVNLIVE"
     gene            complement(62882..63565)
                     /locus_tag="CTC_RS14020"
                     /old_locus_tag="CTC_p55"
                     /db_xref="GeneID:24255218"
     CDS             complement(62882..63565)
                     /locus_tag="CTC_RS14020"
                     /old_locus_tag="CTC_p55"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_011100831.1"
                     /db_xref="GeneID:24255218"
                     /translation="MNIINSNLKFRGLTYGNNPRKIILHHAEATSCSIEDVHTWHLHN
                     GWSGCGYHYFIRKNGSIYKGRPESSLGAHCINYNSVSIGICVEGNYMVEHMPLSQKSS
                     LIELIKYLCGKYGIKEIYGHGELNSTNCPGRNYPLAQIRGEILKDIKCPYKNYPGYLI
                     KVNANLKDNNVRIIQEKLMEKGYNVGSYGADGYLGGTTLNAIKSFQRDNGILVDGIVG
                     RDTWGRLFN"
     gene            63985..65337
                     /locus_tag="CTC_RS14025"
                     /old_locus_tag="CTC_p56"
                     /db_xref="GeneID:24255217"
     CDS             63985..65337
                     /locus_tag="CTC_RS14025"
                     /old_locus_tag="CTC_p56"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent exopeptidase M28"
                     /protein_id="WP_011100832.1"
                     /db_xref="GeneID:24255217"
                     /translation="MKKIISLIMCLTISVVFISCSKDTTPNEDSNNKNTSIESKYKKH
                     IEISIDENLILENLKKLCENVRNYGSVGEKVSADYLKGKLEEYGYIVEFQEFPVYKQT
                     IDSTMAVKNNKDYFKLNPYNSEKKGTGKNVIGKRDNHSNEKKTIYLTAHYDTTDFTKG
                     VIDNGTGTAVILEVARQLRNYHSPFNIEIVFFSGEEYCRSGSRYFVSKLTEEEKKNTL
                     GCINVDMVGEKGAGDIVMGLVNQENNVMTVMLNEGLENKLKISRGGSSDDLSFYHGEI
                     PAITLLNKKPNFKIDKKEDQFPYVDLQQLKNTAYLISNFLTNFNMDTYNKIVNKDKTY
                     SSNKKVDKLGEVNGFKLNKISAYPIKNGYDSITEYEYINKNGKRYIFTEQIKTFINLD
                     DYGEFKSLDKDNNWLYSISKDSKYNTKVFYCFGIHFGEIKSDISMDEAMKILKIYSEK
                     "
     gene            complement(65527..65829)
                     /locus_tag="CTC_RS14030"
                     /old_locus_tag="CTC_p57"
                     /db_xref="GeneID:24255216"
     CDS             complement(65527..65829)
                     /locus_tag="CTC_RS14030"
                     /old_locus_tag="CTC_p57"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100833.1"
                     /db_xref="GeneID:24255216"
                     /translation="MNNKFLDNLQRDILDKKGYYTLYAFIFILSFVITIEDIKLYLNI
                     FRIILSGGALFFLGLIYFKCKDLRDDKDNKVIIQNIFFFIILTFTCIYIFIKNLIL"
     gene            complement(66192..66410)
                     /locus_tag="CTC_RS14035"
                     /db_xref="GeneID:24255215"
     CDS             complement(66192..66410)
                     /locus_tag="CTC_RS14035"
                     /inference="COORDINATES: protein motif:HMM:PF11148.6"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2922 domain-containing protein"
                     /protein_id="WP_035125436.1"
                     /db_xref="GeneID:24255215"
                     /translation="MQKTLVMKFVDEKGKKVNMSLTEIKDDLESEEIEALMDVILAKK
                     SAFKLNNPLVSKDSAQIVERTVDEVYKA"
     gene            complement(66434..66655)
                     /locus_tag="CTC_RS14040"
                     /db_xref="GeneID:24255214"
     CDS             complement(66434..66655)
                     /locus_tag="CTC_RS14040"
                     /inference="COORDINATES: protein motif:HMM:PF07872.9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1659 domain-containing protein"
                     /protein_id="WP_035125437.1"
                     /db_xref="GeneID:24255214"
                     /translation="MAITKDTYSTNLVLELDLGVDENGKQKRKNKSLFKLDVLATDED
                     VYAIGEAASKLLEHSMISISRINKNLLLG"
     gene            complement(66743..66922)
                     /locus_tag="CTC_RS14045"
                     /db_xref="GeneID:24255213"
     CDS             complement(66743..66922)
                     /locus_tag="CTC_RS14045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011987687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YvrJ family protein"
                     /protein_id="WP_035111455.1"
                     /db_xref="GeneID:24255213"
                     /translation="MFDEIIMLISNVGFPVAVTTYLLVRLDQRLEELTKAFMNLTKVI
                     ETAIEHQKSEDYFKK"
     gene            67415..68161
                     /locus_tag="CTC_RS14050"
                     /old_locus_tag="CTC_p58"
                     /db_xref="GeneID:24255212"
     CDS             67415..68161
                     /locus_tag="CTC_RS14050"
                     /old_locus_tag="CTC_p58"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100834.1"
                     /db_xref="GeneID:24255212"
                     /translation="MKLIKKFSKVLSIFLLLLFPLQTLSTTNVHAQEKNFNIIQNGND
                     FIIEENGSKHIMKIKEEPGKITSYMLDENDNVEYYFINDYENKTFYSSITNKYISLND
                     DFYDTDETFDISNSKFMAYAKPGSKENPYRYCTPGARRTESSKLSYAEILGMVGAGAS
                     AATITTALMSRFILGVKATTQVVSNMKVIGAEVFAILSSVGDHTWLANHGIAMNFNYV
                     CSLQHYVDNAWGDNEWFYGEQVSTVSYSKY"
     gene            68165..68461
                     /locus_tag="CTC_RS14055"
                     /old_locus_tag="CTC_p59"
                     /db_xref="GeneID:24255211"
     CDS             68165..68461
                     /locus_tag="CTC_RS14055"
                     /old_locus_tag="CTC_p59"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011100835.1"
                     /db_xref="GeneID:24255211"
                     /translation="MKNKDYSIVRLLNFILLIAFLFLFRNDKIMSNYHIRIIFNLTLI
                     VAGSYAVKDILLKIKGIVKNEEKFKFIKIILYTVLTLLMIYLLISTILNLIHAI"
     gene            complement(68640..72587)
                     /locus_tag="CTC_RS14060"
                     /old_locus_tag="pE88_60"
                     /db_xref="GeneID:24255210"
     CDS             complement(68640..72587)
                     /locus_tag="CTC_RS14060"
                     /old_locus_tag="pE88_60"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011100836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetanus neurotoxin"
                     /protein_id="WP_011100836.1"
                     /db_xref="GeneID:24255210"
                     /translation="MPITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIW
                     IVPERYEFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNV
                     AGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIF
                     GPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTI
                     GKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFG
                     GQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDK
                     DSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDT
                     IYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRE
                     NLYNRTASLTDLGGELCIKIKNEDLTFIAEKNSFSEEPFQDEIVSYNTKNKPLNFNYS
                     LDKIIVDYNLQSKITLPNDRTTPVTKGIPYAPEYKSNAASTIEIHNIDDNTIYQYLYA
                     QKSPTTLQRITMTNSVDDALINSTKIYSYFPSVISKVNQGAQGILFLQWVRDIIDDFT
                     NESSQKTTIDKISDVSTIVPYIGPALNIVKQGYEGNFIGALETTGVVLLLEYIPEITL
                     PVIAALSIAESSTQKEKIIKTIDNFLEKRYEKWIEVYKLVKAKWLGTVNTQFQKRSYQ
                     MYRSLEYQVDAIKKIIDYEYKIYSGPDKEQIADEINNLKNKLEEKANKAMININIFMR
                     ESSRSFLVNQMINEAKKQLLEFDTQSKNILMQYIKANSKFIGITELKKLESKINKVFS
                     TPIPFSYSKNLDCWVDNEEDIDVILKKSTILNLDINNDIISDISGFNSSVITYPDAQL
                     VPGINGKAIHLVNNESSEVIVHKAMDIEYNDMFNNFTVSFWLRVPKVSASHLEQYGTN
                     EYSIISSMKKHSLSIGSGWSVSLKGNNLIWTLKDSAGEVRQITFRDLPDKFNAYLANK
                     WVFITITNDRLSSANLYINGVLMGSAEITGLGAIREDNNITLKLDRCNNNNQYVSIDK
                     FRIFCKALNPKEIEKLYTSYLSITFLRDFWGNPLRYDTEYYLIPVASSSKDVQLKNIT
                     DYMYLTNAPSYTNGKLNIYYRRLYNGLKFIIKRYTPNNEIDSFVKSGDFIKLYVSYNN
                     NEHIVGYPKDGNAFNNLDRILRVGYNAPGIPLYKKMEAVKLRDLKTYSVQLKLYDDKN
                     ASLGLVGTHNGQIGNDPNRDILIASNWYFNHLKDKILGCDWYFVPTDEGWTND"
     gene            complement(72818..73354)
                     /locus_tag="CTC_RS14065"
                     /old_locus_tag="pE88_61"
                     /db_xref="GeneID:24255209"
     CDS             complement(72818..73354)
                     /locus_tag="CTC_RS14065"
                     /old_locus_tag="pE88_61"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014520037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="botulinum neurotoxin transcription-activating
                     sigma factor BotR"
                     /protein_id="WP_011100837.1"
                     /db_xref="GeneID:24255209"
                     /translation="MENLFVKIKTLKNNNKEFEVIIIHFKNTVNILIRKYNLESHYND
                     ILYHLWNILKKIDLNKFNTENDLHKYISRSLKRYCLDICNKKNRDKKIIYNSEITNIK
                     LNLMENSCSNYLNFEFNDLISILPENQRKILYMKFFEDMKECDIAKKLHMSRQAVYKN
                     KVLALKKLEPIVNKLINI"
     gene            73590..73802
                     /locus_tag="CTC_RS14625"
                     /db_xref="GeneID:31474307"
     CDS             73590..73802
                     /locus_tag="CTC_RS14625"
                     /inference="COORDINATES: protein motif:HMM:PF09520.8"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TdeIII family type II restriction endonuclease"
                     /protein_id="WP_080502854.1"
                     /db_xref="GeneID:31474307"
                     /translation="MKLSTLLGQAILEQIAKVIAEDTGALAINQYDIKLIINTWRLEK
                     IDEILRAQRQSKIEPNWKKKLKIYYL"
CONTIG      join(AF528097.1:1..74082)
//
DBGET integrated database retrieval system