GenomeNet

Database: RefSeq
Entry: NC_004605
LinkDB: NC_004605
Original site: NC_004605 
LOCUS       NC_004605            1877212 bp    DNA     circular CON 04-APR-2020
DEFINITION  Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete
            sequence.
ACCESSION   NC_004605 NZ_AP005084-AP005089
VERSION     NC_004605.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMD00058707
            Assembly: GCF_000196095.1
KEYWORDS    RefSeq.
SOURCE      Vibrio parahaemolyticus RIMD 2210633
  ORGANISM  Vibrio parahaemolyticus RIMD 2210633
            Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales;
            Vibrionaceae; Vibrio.
REFERENCE   1
  AUTHORS   Makino,K., Oshima,K., Kurokawa,K., Yokoyama,K., Uda,T.,
            Tagomori,K., Iijima,Y., Najima,M., Nakano,M., Yamashita,A.,
            Kubota,Y., Kimura,S., Yasunaga,T., Honda,T., Shinagawa,H.,
            Hattori,M. and Iida,T.
  TITLE     Genome sequence of Vibrio parahaemolyticus: a pathogenic mechanism
            distinct from that of V cholerae
  JOURNAL   Lancet 361 (9359), 743-749 (2003)
   PUBMED   12620739
REFERENCE   2
  AUTHORS   Nasu,H., Iida,T., Sugahara,T., Yamaichi,Y., Park,K.S., Yokoyama,K.,
            Makino,K., Shinagawa,H. and Honda,T.
  TITLE     A filamentous phage associated with recent pandemic Vibrio
            parahaemolyticus O3:K6 strains
  JOURNAL   J. Clin. Microbiol. 38 (6), 2156-2161 (2000)
   PUBMED   10834969
REFERENCE   3  (bases 1 to 1877212)
  AUTHORS   Hattori,M., Yamashita,A., Oshima,K. and Shiba,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2002) Contact:Masahira Hattori Graduate School of
            Frontier Sciences, University of Tokyo; 5-1-5 Kashiwanoha, Kashiwa,
            Chiba 277-8561, Japan
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            BA000032.
            This work was done in collaboration with Kozo Makino, Ken Kurokawa,
            Katsushi Yokoyama, Takayuki Uda, Kenichi Tagomori, Masatomo Najima,
            Masayuki Nakano, Yoshino Kubota, Shigenobu Kimura, Teruo Yasunaga,
            Takeshi Honda, Hideo Shinagawa, Tetsuya Iida (Osaka University),
            Yoshio Iijima (Kobe Institute of Health), and supported by the
            Research for the Future Program of the Japan Society for the
            Promotion of Science. This clone was isolated from a patient
            presenting with acute gastroenteritis.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 04/04/2020 15:51:16
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 4,732
            CDSs (total)                      :: 4,567
            Genes (coding)                    :: 4,522
            CDSs (with protein)               :: 4,522
            Genes (RNA)                       :: 165
            rRNAs                             :: 12, 11, 11 (5S, 16S, 23S)
            complete rRNAs                    :: 12, 11, 11 (5S, 16S, 23S)
            tRNAs                             :: 127
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 45
            CDSs (without protein)            :: 45
            Pseudo Genes (ambiguous residues) :: 0 of 45
            Pseudo Genes (frameshifted)       :: 28 of 45
            Pseudo Genes (incomplete)         :: 10 of 45
            Pseudo Genes (internal stop)      :: 19 of 45
            Pseudo Genes (multiple problems)  :: 10 of 45
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1877212
                     /organism="Vibrio parahaemolyticus RIMD 2210633"
                     /mol_type="genomic DNA"
                     /strain="RIMD 2210633"
                     /sub_strain="RIMD 2210633"
                     /db_xref="taxon:223926"
                     /chromosome="2"
     gene            1150..3120
                     /locus_tag="VP_RS15280"
                     /old_locus_tag="VPA0001"
     CDS             1150..3120
                     /locus_tag="VP_RS15280"
                     /old_locus_tag="VPA0001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006879970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3346 domain-containing protein"
                     /protein_id="WP_005477480.1"
                     /translation="MTADEKILIKAPRSHKDGHLFEVHESSADWVEQYQHFKGVTKSI
                     LELLNLISLRGFSSKDGLVSTTEIVEATDGQLTRAALQQRLRAAVNIGLFTQTPVRFE
                     EGLAGKTMLHKFVNPNQLISVLGATSLVTDKVRQNEKQKRSKALAQTQVNKRLLNEHG
                     LNTPPMMKDEADQFVVSPTNWAGIIDQALAPPRTRKSYQKSMVSISGTKAVIETRSSK
                     NIMTVDDLMTLFALFTLTVQYHDHHKDQYQMDAAHVPNKTPLYITDILSLRGKKDSGP
                     ARDSIRDSIDRIEFTDFQLHELTGRWLSENMPEGFKSDRFRFLARTITASEEAPVEGS
                     DGEIRIKPNLYILVWEPSFYEELLTRDYFFLFPPEILKQHTLVFQLYSFFRSRMVRRH
                     TDCMLLSELNQKLARNIEWRRFSMDLIRELKRLSDGKGTDDLFVVNLWGYHLTIETMI
                     ENDKVMDYQIDIKCDVEEVLRYSRARTTNAGKRNMAPTLPNPLRNEMVTRQQLEALSG
                     IIDGEFEPIQRKTPSPRGNLGRRVKQRKHLVEINADEITITLSKYTSPEALERSITAL
                     SAMTGHSYASIKEECSEYIEKLDWLRVGDEPIPYETLSKTVELFNTQNEVKHLTIERL
                     IAGLAVRRKVCRQVFDGHMDEMVFRALDEMAI"
     gene            complement(3409..3876)
                     /locus_tag="VP_RS15285"
                     /old_locus_tag="VPA0002"
     CDS             complement(3409..3876)
                     /locus_tag="VP_RS15285"
                     /old_locus_tag="VPA0002"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005448840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_021451231.1"
                     /translation="MELTSWQDQISDWYETRKHDQVDVLEAILYEAPDTVFGPELSDQ
                     QSKAIACWLDGCLRVFQHARYQDHHKAYQTLLYASAKLEQAACHPMSDILLKDWCLKR
                     LQHLTVLALEFCNQQQDQNQWQQQANNLIESHVALMRSLNWNETRKHDQGLRH"
     gene            complement(3876..4808)
                     /locus_tag="VP_RS15290"
                     /old_locus_tag="VPA0003"
     CDS             complement(3876..4808)
                     /locus_tag="VP_RS15290"
                     /old_locus_tag="VPA0003"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008074118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_005464829.1"
                     /translation="MSQPIIQMKNVIKEFTVGGGFAKEETFRALQGVSFDLYAGRTLA
                     LVGESGCGKSTCARLITKVYPASEGEILFNGTNINDITSRHDIQDYRSKVQMVFQDPF
                     GSLNPTHTIRHHLTRPLKIHKQVQHDREIPARLEELLKLVELPEETLNKYPHELSGGQ
                     RQRVNLARALAVGSQIILADEPTSMLDVSIRLGVLNLMQRMKQELGIGFLYITHDLAT
                     AHYIAEETAVMYKGQIVEWGDTHAILKNPQHPYTKLLISAVPDPDLPFGNLVKNEPNY
                     SIDADEIRHRSSVVVDEYDQVGPNHFVKQWIEAA"
     gene            complement(4805..5659)
                     /locus_tag="VP_RS15295"
                     /old_locus_tag="VPA0004"
     CDS             complement(4805..5659)
                     /locus_tag="VP_RS15295"
                     /old_locus_tag="VPA0004"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004746310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_024699219.1"
                     /translation="MSEINLSHAFHSEPVIQIRELCVDYITDNGDFNAVKSVSFDIGK
                     GEVFGLAGESGCGKSTIAFSINRLHKPPAFISGGQILFQGKDILRLSDKELSALRWSE
                     IAMVFQSAMNSLNPVLTIQEQFADVLRHHQGLSNEQAKDRAEKLLDLVNIPRDRLGEY
                     PHQFSGGMRQRLVIAIALSLNPKLIIMDEPTTALDVVVQREILQQIYQLREEFGFSVL
                     FITHDLALMSQLCDRIAIMRHGEIVEVNHAYEIRNHPQHPYTQKLWASFPNIHDVHKQ
                     PEQQGAPA"
     gene            6022..6222
                     /locus_tag="VP_RS15300"
                     /old_locus_tag="VPA0005"
     CDS             6022..6222
                     /locus_tag="VP_RS15300"
                     /old_locus_tag="VPA0005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008074120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005477395.1"
                     /translation="MSINSIDHEEMTNIAHKWELPEEEETVVKPEKTMKSAEARRRIE
                     ALREIRESGLSIEEARELGLIH"
     gene            6467..7528
                     /gene="ribA"
                     /locus_tag="VP_RS15305"
                     /old_locus_tag="VPA0006"
     CDS             6467..7528
                     /gene="ribA"
                     /locus_tag="VP_RS15305"
                     /old_locus_tag="VPA0006"
                     /EC_number="3.5.4.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase II"
                     /protein_id="WP_005477438.1"
                     /translation="MVDQILFYEPDEPHGFLSNFCHAPVEISSQSWPTSEHYYQAQKF
                     VDAQLQTKIQKAQSPDEAFALSRQYEHLVRSDWDNMKLSVMAFIVREKFLQNPKLAQK
                     LMRTGNACLTEHSHKDAFWGDGGDGKGLNHLGEILMNVRAELRHVEPYNLVKFIDKAK
                     LPTQWGTFMMHGFIETATGKEHLALVYGDPTSQPAPLIRLHSECLTGDALFSTRCDCG
                     FQLNRALQNIVEEGCGVLLYLRQEGRGIGLINKIRAYHLQDDGADTVEANERLGFAAD
                     MRDYAFCKGMLEHLGIDEVRLMTNNPRKLAALKNAHINVVERVPLQEGRNPSNQHYLK
                     TKANKLGHMFDPHFVDQTE"
     gene            complement(7634..8389)
                     /locus_tag="VP_RS15310"
                     /old_locus_tag="VPA0008"
     CDS             complement(7634..8389)
                     /locus_tag="VP_RS15310"
                     /old_locus_tag="VPA0008"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005435875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_005477460.1"
                     /translation="MKGLLRVLAFSCMAVSAATAAEEVNYYVIADQARPFQIEQQGQQ
                     HAGIVTDIVNAIFANSDYKVNFHTYPFKRMISVLEAGGEENWLTYGSPDWGRVQSENL
                     SKEPIYTVKHVLVSSSDAPFKFNTMQDIKGRSIVLLLGFDYPNLMPFFEDKTVNEMRV
                     KDYDAAYRVIQRTPGDTAFVEMESRVMYNLKRLELPLEQFEIQSFSAVIPDYSIYLAF
                     SPEMKPEVQNFINQRLSALKASGEIDNIVKHYL"
     gene            8458..10356
                     /locus_tag="VP_RS15315"
                     /old_locus_tag="VPA0009"
     CDS             8458..10356
                     /locus_tag="VP_RS15315"
                     /old_locus_tag="VPA0009"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_005490914.1"
                     /translation="MDVKERTQRRFSIGNQLMLAVLTLSLIFTLVISAISLYRDFQEE
                     LSHLDTDLKQVESSYLSSFSASLWVEDRELLLTQALGAMRLPSVDYLRIATKDEVIIE
                     LGTEITQDVVERRWPMQFSVGEKTFELAELTVQSDLSAVYQDLWQQFFFLLTTEAIKI
                     LLLMVGVLWVAFRLLVNPLQLLSGAVSDFSGGNAPSTVTLPKRWCFDEVSLLAQKYNR
                     SVQKVREHQAELEAERDKAEVANRKKSEFLATMSHEIRTPMNGIIGVASLLSDTKLDP
                     QQKEFVEIIDNSSQSLMTIIDDILDFSKVEAGKVELASETYHFRQLLDDVISLHTVKA
                     QQKNLQLLSDIDPKLPAEVQGDEGRLKQVLNNLLSNAVKFTERGHVKLLVSLHEQNND
                     IAQVRFRVVDSGIGIAKEHQQAVFERFQQADGSTTRKYGGTGLGLAICAQLVHIMGGD
                     IKLTSELGLGSCFDFTIPLTVVSGLPTYTDPLNVLDFPRTEANEATNKNPDKPWVLIV
                     EDTEVNQRVVRIMLEQLGLKVSVASHGEEAFQLCREHAFDLIFMDCQMPVMDGFIATE
                     QIRDMNEWGAHVPIIALTANVVKEDQQRCFEAGMNEFVAKPVTKARLQQIFEQYLPKA
                     LKNIATPK"
     gene            10458..10667
                     /locus_tag="VP_RS15320"
                     /old_locus_tag="VPA0010"
     CDS             10458..10667
                     /locus_tag="VP_RS15320"
                     /old_locus_tag="VPA0010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005374484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3283 family protein"
                     /protein_id="WP_005477463.1"
                     /translation="MSFNLSLLPPDEKNKIELDKQASFLVWKLREAKSGPEAIEEQLS
                     KINDADEKVFFQRAVEKYKRVMGVA"
     gene            10802..11518
                     /locus_tag="VP_RS15325"
                     /old_locus_tag="VPA0011"
     CDS             10802..11518
                     /locus_tag="VP_RS15325"
                     /old_locus_tag="VPA0011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YebC/PmpR family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_005464874.1"
                     /translation="MGRSFEVRKASMAKTAGAKIKVYSKYGKEIYMCAKNGGSDPDMN
                     LSLKHLIAKAKKDQVPAHVIEKALDKANGGGGEDYVPARYEGFGPGGTSVIVDCLTDN
                     GNRTFQDVRQCFVKVGAKIGVEGSVSHMFDHQAVFQFKGEDDEVILETLMMEDVDVTD
                     VELEDGVITVFAPHTEFFKTKTALNAAFPDLTIDVEEITFVPQTQTPVAGEDAEKFQK
                     FLDLLDDCDDVQQVYHNAEL"
     gene            complement(11595..12677)
                     /gene="rodA"
                     /locus_tag="VP_RS15330"
                     /old_locus_tag="VPA0012"
     CDS             complement(11595..12677)
                     /gene="rodA"
                     /locus_tag="VP_RS15330"
                     /old_locus_tag="VPA0012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012130346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein RodA"
                     /protein_id="WP_005481706.1"
                     /translation="MNKRFFPRIDLPLLMAIIPIMLLSSLTLWSASGFDESMLFKHLA
                     RCALTLVCILVMSSIPAASYQRSAPYLYFVAVSLLLAVALFGDSTNGSQRWLDIGFFR
                     FQPSELIKLSIPIMIAWMLHLEGGRPDFRKIALCLMITLVPAGLIALQPDLDGAIFTV
                     IYALFVLFFAGMSWKIIGGFVVSVLTLAPILWFFVMEAYQKSRVTQFLHPESDPLGSG
                     YQIIQSLIAIGSGGMKGKGWMNATQGTLGFIPESHTDFIFSTYAEEWGFIGCVVLLAL
                     YLFITARVMLLACQSEHFFSRLVSGTLAMSFFLYAFINTGMVSGLLPVMGSPLPFFSY
                     GGTAMLTQGICFGVIMSLCYSKYRNT"
     gene            13135..13803
                     /locus_tag="VP_RS15335"
                     /old_locus_tag="VPA0014"
     CDS             13135..13803
                     /locus_tag="VP_RS15335"
                     /old_locus_tag="VPA0014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005481717.1"
                     /translation="MMVFNLHLSRATTLLGAALAAFTLSSSLALANPTEQLLTRFNQA
                     AQGDTGLVDTVHDELSQLVQKQGATPVTLVYLGSSETLQGRDAFMPWNKMKFTERGLA
                     TIQKGLDLMANQPMPIQEQQRLQGLPEYQLATAMAATTYTSLPDMFNHFERGYELYLT
                     LLDEPSFNQQPFAATAWVYLYAIEAALRAEDMEQAQKWLAKMESFDSTHLETQTAKAL
                     LAKH"
     gene            13813..14511
                     /locus_tag="VP_RS15340"
                     /old_locus_tag="VPA0015"
     CDS             13813..14511
                     /locus_tag="VP_RS15340"
                     /old_locus_tag="VPA0015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005392078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_005481731.1"
                     /translation="MIVFSQLSRDYTLGSQTVRALQDVSGEVFAGEMVALCGPSGSGK
                     STLLNVLGMLDSQYQGQVTFAGQPYPSGQMQAAKMRREKLGFIFQKFNLVPVMTALEN
                     VAYPLHLNGFSKTEQTELASQMLEHVGLGEFIHHMPDNLSGGQQQRVAIARALVHKPA
                     LVIADEPTASLDSQTANKVIDIMKGLGHEFGTTFIVATHDPRMASRCDRTIELVDGKI
                     IQTHASVEEVSWAS"
     gene            14499..15767
                     /locus_tag="VP_RS15345"
                     /old_locus_tag="VPA0017"
     CDS             14499..15767
                     /locus_tag="VP_RS15345"
                     /old_locus_tag="VPA0017"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006880952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_005481724.1"
                     /translation="MGKLIPVSVRLAWLNLQRNRRRSLLSMLIIAIAVFALTSAGGFG
                     LYTYDSLKESTARDTGHLTLTTPGYFAKEEEMPLSNGLSHADEITKQLIGLSEVRGVQ
                     PRVEFSGLISNGSKSSIFIGIGVNEREFDMKGPFLDVRDGQTLSNIHASRYDASEPEV
                     MLGVDLASNLSVNVGDWITLLATTTDGALNAYDFKVRGIYSTGVPELDKRQLYVHINS
                     AQSLLGSDKVSALSVFLFDTCLTNKVEQQVATILNKQKPSFGDQEVEITPWQERAFFY
                     LKVKDLYDRIFGIMGAVMALVVFVALFNTMTMSVTERTREIGTLSALGSYPREIIAGF
                     LREAGLLAVIGSLIGALFTALVTIFLMMVDVQMPPPPGRTEGYPLTIYFSWELVAAAG
                     LSVLLICLVAAFFSARKGVNKPITEALIYV"
     gene            15760..16533
                     /locus_tag="VP_RS15350"
                     /old_locus_tag="VPA0018"
     CDS             15760..16533
                     /locus_tag="VP_RS15350"
                     /old_locus_tag="VPA0018"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012130339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein-sorting protein"
                     /protein_id="WP_005481719.1"
                     /translation="MFNSKPLLTITLLAVSSVASAAEQALDAQQVAQLIEKADSYRLQ
                     DDSSKVVSLVRLYQDQELDKTRLYHVYTRPNRESLVVFKSAVEAGQKMLMMGDNYWLQ
                     MPKSRRPIRITPMQKLLGEASIGDISTLTWSQDYQGEWKATETLTINGQSIAAYRLAL
                     TAKTKGASYQKIDLWLSEQDAFPIKADLYLRSGKLAKQAQYGRATNLGKDYVSEMTLL
                     DSIQPSKKTVIEYQEIVPWQLDNKFYNPSYLPKANTSEL"
     gene            16566..17906
                     /locus_tag="VP_RS15355"
                     /old_locus_tag="VPA0019"
     CDS             16566..17906
                     /locus_tag="VP_RS15355"
                     /old_locus_tag="VPA0019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005481704.1"
                     /translation="MKVRFFNAIINVNSAAISFIATSLWMVAPVAASDELSFEWDWAV
                     SYETAKLRDSAFMDAQGSARDSLNALLDVQVNYQNISGLFTLYSQGVYLNQQGEHEWW
                     GEADNQLLIRELAWQGEWQVGDTTLDVSAGKLRVDWGVGYGYRPLDLFKPYRQNPVGL
                     VAEEGAGVFSLSYYDMSGVWTVIATDSSWGQQDQSALDQAVEQRGFGIRRYALVGDIE
                     YQLIGYYDDVRLGLLGTSAIAVWDESIAMHSSLLWQKQSVGYQFKNEGQPSDRYQPVT
                     VEEQGNAFQALVGLNWANQAGHNVIAEYWYDSRAWSKSQWEQAIARGEWLSQSSDTTL
                     LATSYVQGFQHANIVQHNLMLHWRWDLEAWTAWRGRSDLELLSNVTPTLDVMYSPQDG
                     GVIVTQWLNYQWIDTGDQSVEVEVAARFLTGDDHSAYAQINDKHMIVFNIKGKF"
     gene            17907..18938
                     /locus_tag="VP_RS15360"
                     /old_locus_tag="VPA0020"
     CDS             17907..18938
                     /locus_tag="VP_RS15360"
                     /old_locus_tag="VPA0020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005497639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_005481721.1"
                     /translation="MCSAKSMVASGWQRSVIVTTLFCLFISGMTLSVWGGPYYVHVLV
                     SFGFGYSALFFSWLIDKLFPTIPRMLEIALSLTACLLFGVINAQFWLGEYFGISGMLP
                     VLLMGLLFSGMCYFYFHSREKEAIAQRELESIKRENAEQERALLLSQLKQMQSQIEPH
                     FLFNTLANISALMSQDVDKAKQMLDQLTALLRATLKNSREEHTTVENEITLIDAYLGI
                     QKIRLGERLSYTIEVQEGLGNTELPPMMLQPLVENAIIHGIEPKREGGEVQLLIKQEK
                     QLLQIEVKDTGVGLSHVSNHSGSGIGLSNLKQRVDALFAGKGQVSISESSEGGVSVRL
                     SWPMISKEQ"
     gene            18940..19731
                     /locus_tag="VP_RS15365"
                     /old_locus_tag="VPA0021"
     CDS             18940..19731
                     /locus_tag="VP_RS15365"
                     /old_locus_tag="VPA0021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_005481713.1"
                     /translation="MNTGFTAIIADDEPLLRHHLDKSLAEVWPELDIVAKVADGEQAL
                     LAIEQSQPDIAFLDIRMPVLDGMSLAQKLNRLANPPLIVFVTAYDDYAIKAFEQNAAD
                     YLLKPISDARLQTTCERVKARLSQRGSDNSHVQMNSLLEQLQQLSAPQTPQYLQWIKA
                     TQGDDIHLIATSDVLYFKAEEKYVSVYAQQGKGEVQEYLIRTSLKELIGQLNPEQFWQ
                     VHRSSVVQVSKISKVNKDFAGRMFVYVGETKLPVSRASQSLFKGM"
     gene            19809..20444
                     /locus_tag="VP_RS15370"
                     /old_locus_tag="VPA0022"
     CDS             19809..20444
                     /locus_tag="VP_RS15370"
                     /old_locus_tag="VPA0022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017189790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2268 domain-containing protein"
                     /protein_id="WP_005481726.1"
                     /translation="MSYRVTLLNATGALSSVADYLYEQLNSLSLQLADHFELNNIDVT
                     ISPFGHGDVPQSGIGGYCLSPYRVEVLLDTQRTDIKTVIENELAAVLAHELHHLFRMR
                     AGENGLTLGEVLIMEGLACHFERQVNGGIIPSLFESIKDRDWRPFYTEMKDKLTSLDY
                     NFDTYFLGSDESRWPKYMGYWVGYNLVAEYLANFHGSELDLVGAKAEIFYQ"
     gene            complement(20547..21041)
                     /locus_tag="VP_RS15375"
                     /old_locus_tag="VPA0023"
     CDS             complement(20547..21041)
                     /locus_tag="VP_RS15375"
                     /old_locus_tag="VPA0023"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009706712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_005481711.1"
                     /translation="MIIMTTNFGDIEIELNLERAPVSSKNFKKYCEEGFYNGTIFHRV
                     IDGFMIQGGGHTEDMTEKPTRAPIANEANRGLKNTVGTIAMARTDAPHSATAQFFINL
                     EDNDFLDHTATTNLGWGYAVFGKVTAGMDVVNRIAKVKTTSKQGHDDVPCEPIIIEKV
                     TISE"
     gene            complement(21160..22821)
                     /locus_tag="VP_RS15380"
                     /old_locus_tag="VPA0024"
     CDS             complement(21160..22821)
                     /locus_tag="VP_RS15380"
                     /old_locus_tag="VPA0024"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004743009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_005464936.1"
                     /translation="MNLTIRKRLYILSIIPVLTIALGMMWFTYLQTNAYNQQQIDQTH
                     TTMMAMKKAELKNYVQMARSAIEPLLKRNATLEEALPVLRELEFGETGYIFGYNSKGV
                     RVVVGKNDKGIGENFYNLQDKKGNYLIQDLLKNAKTGEFTTYYFPKLGQTEALPKLSY
                     SMFIPEWDLMIGTGFYTDDIDAVIAEMEASAHDALNTTLVAIALFCVSIAAVVAIFAV
                     FVNRSIMRPIEQFDASIQSFAQGDADLTARMHESNVPEFKQLAHNFNIFVESLQGIIK
                     SVTQVGEEVVAETNNMSQRASQVDELAGGQREETEQVAAAMTEMTATAHEISNNANQA
                     AESARHADENAQQAKHIVDSAANSVEELASEVSEASTVIARVESDVQNISSSLEVIQD
                     IAEQTNLLALNAAIEAARAGDQGRGFAVVADEVRKLASRTQDSTGDIHKMIEQLKSGS
                     DAAVRAMESSQARGEATVEEARAASVALQDIQAAIANIMDMNTLIATATEEQSQVGQE
                     ISQRVEVISQQSSQSASLANQNRSGSQNLNHKANELYDLVGRFTV"
     gene            complement(23001..23387)
                     /locus_tag="VP_RS15385"
                     /old_locus_tag="VPA0025"
     CDS             complement(23001..23387)
                     /locus_tag="VP_RS15385"
                     /old_locus_tag="VPA0025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020195059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF393 domain-containing protein"
                     /protein_id="WP_005464876.1"
                     /translation="MTKLTIFYDGTCPLCAKEMKALRQHDHKQEINTVDIYSDAFSAY
                     PQINPDRANTILHALDNQGNLLLGLDVTYRAWQLVGRGWLYAPLRWPLIRPVADWLYL
                     RFAQNRYRISYWLTGTSRCNSGRCSR"
     gene            complement(23389..24216)
                     /locus_tag="VP_RS15390"
                     /old_locus_tag="VPA0026"
     CDS             complement(23389..24216)
                     /locus_tag="VP_RS15390"
                     /old_locus_tag="VPA0026"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005464873.1"
                     /translation="MKIQSLLPVLLLCAASANAADNIRIEYMPAETTHDKLAEQSIQS
                     SDVNPIFVRLSQDYFPFRKPLTLIYGGEDGPMYDPDTHTIHIPYTFYLESLNYFSNNQ
                     YEDRYGKSPKTGALDTLLHTLLHEAGHAYIEDQSIPVLGKEEDAVDNFATILLIDYLD
                     DGADMAISAADMFAFESDDRPDYYDFGEYIDEHSFDLQRYFSTLCLVYGSDPEQYKSL
                     LDEVEKDYLRDRKDFCQYNYENIRTNWQHYLQHNEPKEASTRKNSEKPSSSPNPMTN"
     gene            24466..25104
                     /locus_tag="VP_RS15395"
                     /old_locus_tag="VPA0028"
     CDS             24466..25104
                     /locus_tag="VP_RS15395"
                     /old_locus_tag="VPA0028"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005497653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CatB-related O-acetyltransferase"
                     /protein_id="WP_005481729.1"
                     /translation="MTKHWSKVQYLHQVVQNANIHIKGTQSYYSDCWDNGFEESVVRY
                     LLGDEISKQWQPSWEVDQLYIGDYVCIAAEAVILMGGNHNHRTDWFCLYPFLDDVERS
                     YQSRGDTIIGDAVWIGMRAMIMPGVTIGEGAVIAANSVVTKNVPPYTVVAGAPAKPLK
                     TRFDSETIDKLLALKMYSWDEAKFNAIRSFICGNDIEQLIIAESNYKDGECH"
     gene            25649..26884
                     /gene="gltS"
                     /locus_tag="VP_RS15400"
                     /old_locus_tag="VPA0031"
     CDS             25649..26884
                     /gene="gltS"
                     /locus_tag="VP_RS15400"
                     /old_locus_tag="VPA0031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004743913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/glutamate symporter"
                     /protein_id="WP_005464899.1"
                     /translation="MNHLISVGALESFLVAISVLFLGHFINAKLPILKKFNIPEPIVG
                     GLIVACIITALHFNGVDLEFDLPLQNTFMLMFFATVGLAANYTQLMKGGAKVFIFLAV
                     ASFYIIIQNGVGVSLAAALGLDPLMGLIAGSITLSGGHGTGAAWSQTFQDVYGLNNVL
                     EIAMASATFGLIIGGIIGSPVAQRLVEKHGIESEYGRGGRDAKTHEKFPELVTYNEYE
                     EDKVTAKKVVEKLFFLLICVTGAKYVEQWVSTYEISWLMIPDFVYALFIGVIITNFLE
                     VTKIRKLDAETVDMLGTVSLSLFLAMALMSLKLWNIFDLAIPFLVILAIQSVILAIFT
                     YYVTFKVMGSNYDAAVISGGHCGFGLGATPTAVMNMGSIVNRFGPSPQAFMVVPIVGA
                     FFIDIVNLIILQGYISFLG"
     gene            complement(26983..27813)
                     /locus_tag="VP_RS15405"
                     /old_locus_tag="VPA0032"
     CDS             complement(26983..27813)
                     /locus_tag="VP_RS15405"
                     /old_locus_tag="VPA0032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017040968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_021451233.1"
                     /translation="MRSVVAMLRKEWLENPLVLRLPLFMLACGALLFISLMSNTTLQH
                     NMFFEMSLGGDVSDIHKELGDDVNMLITGGAGLLSMLLAIQYFPRTLRKERAEGSIMF
                     WRSMPVSDLKTHLVKLTFGLLVIPLVCSGLVLAADFMLWLLNVSTDQQLALLYRQTSL
                     GYVLLHWVEFLARMALAGVLMLPLALCAMAISQKVNSPLVILFIAIYALRWMPIAMFG
                     YYGLDQFFSAVLYLPLHAIIASNPFSAIPEAGLANVGIYAFIGILAWTASLKFSRTIQ
                     "
     gene            complement(27813..28670)
                     /locus_tag="VP_RS15410"
                     /old_locus_tag="VPA0033"
     CDS             complement(27813..28670)
                     /locus_tag="VP_RS15410"
                     /old_locus_tag="VPA0033"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012130321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_005464877.1"
                     /translation="MSALVSVKNVSKQYRQQGEALHDVSFDLHAGQVLGLLGHNGAGK
                     STLINALLGAHDYEGTIRINGFEPMMQRDKIMQNLSYISDVNVLPDWMTVSQLLSYTE
                     GVHPGFNRSKADALLRQTDIKPRAKIRALSKGMKVQLHLAIVIATNTQILILDEPTLG
                     LDLVYRDTFYRHLLEWFHDGERVLIITSHEVSEIEHLLTDVLILKHGRPVLQTSMESI
                     SEDYFILDANDEHRAQIEAMHPLSSQKGLGTTKWLLSSQYADQAAGLGDVHGVKLADL
                     FLALQKEAA"
     gene            complement(28667..29038)
                     /locus_tag="VP_RS15415"
                     /old_locus_tag="VPA0034"
     CDS             complement(28667..29038)
                     /locus_tag="VP_RS15415"
                     /old_locus_tag="VPA0034"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017003145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_005464887.1"
                     /translation="MTHWHDRQPIFRQLADQITQQILQGVWKEGEALPSVRSISADMK
                     INHLTVMKGYQLLVDEGLVEKKRGQGMFVAQGAIQQLRSAEKARFLEQQIPQIADTLQ
                     RLDMSVDELVQQLNPHMKGDQ"
     gene            29473..30699
                     /gene="gltS"
                     /locus_tag="VP_RS15420"
                     /old_locus_tag="VPA0035"
     CDS             29473..30699
                     /gene="gltS"
                     /locus_tag="VP_RS15420"
                     /old_locus_tag="VPA0035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005428834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/glutamate symporter"
                     /protein_id="WP_005464942.1"
                     /translation="MNHVISIGPQESFLVAICVLFLGQFINTKLPILKKFNIPEPIVG
                     GLVIACVITAMHFNGVDLSFDLPLQNTFMLMFFATVGLAANYTQLIKGGAKVFIFLAV
                     ASAYILIQNAVGVSLATALGLDPLMGLIAGSITLSGGHGTGAAWSQTFQDMYGLHNVL
                     EVAMASATFGLVIGGIIGSPVAQRLIDKNNLESEYGRTNQSHQRFPELVTYNEHEEDR
                     VTAKKVVESLSIILLCVTGAGYLENWVSSFGIKWLMIPDFVYALFIGVVITNIMEVTK
                     VRKVDLETVDILGTVSLSLFLAMALMSLKLWNIFDLAIPFLIILAVQSVILAVFAYYV
                     TFRVMGSNYDAAVISSGHCGFGLGATPTAVMNMGSIVNRFGPSPQAFMVVPIVGAFFI
                     DIVNLVILQGCIAFIK"
     gene            30877..31743
                     /locus_tag="VP_RS15425"
                     /old_locus_tag="VPA0036"
     CDS             30877..31743
                     /locus_tag="VP_RS15425"
                     /old_locus_tag="VPA0036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011082092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005464929.1"
                     /translation="MSEKISTSALAKMRNIDAKLLFSDLKRAGYITRQGEKWILTEEG
                     AKFGGEYVDHPKFGQFIVWPTNLHIELNPTSGKTLSATQLGDKLRLNAKRINQLLSEL
                     GWISKSEDGWQVTEAGIRAGGQQRADKESQNTFVVWHDIVLRNKRLKQSVVEFLGQDV
                     ESHSTDKSYSSFRQKFEAKHRTLDGHYVRSKGELLIDNWLYLAGIVHAYERQLPIEQE
                     VMSDFYLPAGKLYLQFWGSDSGETPEKEREVIRAVYQQHNFNLIEVEPSELDRLDEVL
                     PKRLRQFGIQAY"
     gene            complement(31871..32671)
                     /gene="nagB"
                     /locus_tag="VP_RS15430"
                     /old_locus_tag="VPA0038"
     CDS             complement(31871..32671)
                     /gene="nagB"
                     /locus_tag="VP_RS15430"
                     /old_locus_tag="VPA0038"
                     /EC_number="3.5.99.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009842200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine-6-phosphate deaminase"
                     /protein_id="WP_005464933.1"
                     /translation="MRLIPLTRAAQVGKWAAAHIAKRINDFKPTAERPFVLGLPTGGT
                     PLATYKALIELYQAGEVSFKHVVTFNMDEYIGIPADHPESYRSFMYNNFFNHIDIQEE
                     NINLLNGNTDNHEAECKRYEDKIKSYGKINLFMGGVGNDGHIAFNEPASSLSSRTRIK
                     TLTEDTRIANSRFFDGDINQVPKYALTIGVGTLLDAEEVMILVTGHNKALALEAAVEG
                     CVNHLWTVSALQLHPKAVIVCDEPSQQELKVKTVKYFSELEAENIKGF"
     gene            33057..33308
                     /locus_tag="VP_RS15435"
                     /old_locus_tag="VPA0039"
     CDS             33057..33308
                     /locus_tag="VP_RS15435"
                     /old_locus_tag="VPA0039"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004412449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3081 domain-containing protein"
                     /protein_id="WP_005464900.1"
                     /translation="MKNELDPSKVLQAYENVMNNGSPTEFGKIYEGVEAFSDYDGYNV
                     FLRGNGVELKVGFHNTYHLEYEQEHLKETFLKKIAMLAK"
     gene            complement(33460..33813)
                     /locus_tag="VP_RS15440"
                     /old_locus_tag="VPA0040"
     CDS             complement(33460..33813)
                     /locus_tag="VP_RS15440"
                     /old_locus_tag="VPA0040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005593390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF413 domain-containing protein"
                     /protein_id="WP_005464927.1"
                     /translation="MSDTEFRHGKKRFYDNVKFPRGFAKSGDFTLSEEEILTIYGDTM
                     LGLESGELTPENSEEKHFVKVLENPGKAKTKIERTWLKYTQLARGRKRFHTLNGRNKP
                     DAADDYAEESLAEDD"
     gene            33962..34861
                     /locus_tag="VP_RS15445"
                     /old_locus_tag="VPA0041"
     CDS             33962..34861
                     /locus_tag="VP_RS15445"
                     /old_locus_tag="VPA0041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005497667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005464903.1"
                     /translation="MDVKVFRTFLELAKVRHFGRAAENLYITQAAVSARIKQLESYFD
                     TQLFIRDRNNIKLTSAGERLISYAEVMVTTLQQAKLELSLEDGKALQLTMGGTPNIWD
                     AYLQNCLSIVTDSFGGYGFMAEVMGREMLSRSLLERTLDMAFAFDQIKADELNCKKVA
                     DVVLVLVSTEQDSLDTVFEHKYVYVDWGTRFASEHSERHPKIPAPYLRTSTARIALDF
                     ILEKGGAAYLPVSLVEPFIANGQLYKVSGVEDWYRPIYLSYRKASTSVEAIKQVEEIV
                     KEIDPLTAYSLQQIGSASSDANH"
     gene            complement(34981..35676)
                     /locus_tag="VP_RS15450"
                     /old_locus_tag="VPA0042"
     CDS             complement(34981..35676)
                     /locus_tag="VP_RS15450"
                     /old_locus_tag="VPA0042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004725197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin family protein"
                     /protein_id="WP_005482811.1"
                     /translation="MITVRHAEDRGRANFGWLDSKHTFSFGSYYDPKHMGFSELRVIN
                     DDLVQPNAGFDTHGHRDMEIISYVLEGVIAHKDSEGNVQTLPAGEFQLMSAGKGIYHS
                     EYNASETDPLRFLQIWIQPNTFGNKPGYQQKDFGRNAGLTTIATPTGESGTLHIKQDA
                     YLYQLILEPNRELAFDIHSGRNVYVHQVSGELHVDNTLLTGGDGAKIEAQSKVTFRNL
                     TNQSVTALIFDLP"
     gene            complement(35698..36141)
                     /locus_tag="VP_RS15455"
                     /old_locus_tag="VPA0043"
     CDS             complement(35698..36141)
                     /locus_tag="VP_RS15455"
                     /old_locus_tag="VPA0043"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010319257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DoxX family protein"
                     /protein_id="WP_005482937.1"
                     /translation="MKALLHKITTSQSGYSALALRIPIGIIFMAHGAQKLFGWFGGYG
                     LEGTGQWMASIGLGPGVLMAFLAGSAEFFGGLFILLGLLTRPAAVALSFTMVVAIISV
                     HFENGLFMANNGYEFGLALLAASVSLAFSGAGKAALDNFLNKKFS"
     gene            complement(36491..36694)
                     /locus_tag="VP_RS15460"
     CDS             complement(36491..36694)
                     /locus_tag="VP_RS15460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005428499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005464930.1"
                     /translation="MDLHTCVIVLRNQKVITSKSVDHSIGIIERDSGNEISEIQINAT
                     DGVNIRTYHYNNVEESLESLMNL"
     gene            36875..38242
                     /locus_tag="VP_RS15465"
                     /old_locus_tag="VPA0045"
     CDS             36875..38242
                     /locus_tag="VP_RS15465"
                     /old_locus_tag="VPA0045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005448912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase 2 family
                     protein"
                     /protein_id="WP_005482874.1"
                     /translation="MFIHPHTSLTFEQCQKARVSRDSRFDGRFYVAVKTTGIFCRPIC
                     PANLPKEENVEYFTDKAQALKAGYRPCLRCRPDSAPGSWAWKGVETTFQRAISLIDRG
                     ELHHHSVSELAERVGISDRYLRMLFEQYLGMSPKQYAQYQQLMFAKQLLHSSSMSVTE
                     VGFAAGFNSTRRFNDAFQKFLKLTPSQVRRREFDGVSTNRIALSYRGELNWQHMLDFY
                     RLRAIEGVERVSGESYQRNVCLDNSKAWFKAIKGEGNLELEFEIEEVAKLQNLVSGIR
                     RMFDLDTDICTVEQHLDYVAPGLVSNRGIRIPGVWNAWEAGVRAVLGQQVSVKAAIGQ
                     LNLLVKTLSGDADKRFFPTPDAIANADVSFLRMPQSRKETLVRFAQFMQSNAETDPQQ
                     WLALKGIGPWTVSYAQLRGQSQPDCFLDKDLVVKKAMQRYPSLNTHTAAPWGSYATFH
                     LWNQS"
     gene            38239..38721
                     /locus_tag="VP_RS15470"
                     /old_locus_tag="VPA0046"
     CDS             38239..38721
                     /locus_tag="VP_RS15470"
                     /old_locus_tag="VPA0046"
                     /EC_number="2.1.1.63"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005428511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylated-DNA--[protein]-cysteine
                     S-methyltransferase"
                     /protein_id="WP_005464913.1"
                     /translation="MNTVYTEMPSPLGAVTIQSNAEGLLGIWFETCTTKPSELGRRDD
                     QHPILRQAVTQLDEYFSGLRNEFDLPLAATGTDFQNQVWHALTTIPYGETWSYQDLAN
                     AIGNPKAVRAVGLANGKNPISIVVPCHRVIGKSGKLTGYAGGVERKQRLLALEQGTPL
                     "
     gene            38821..39639
                     /locus_tag="VP_RS15475"
                     /old_locus_tag="VPA0047"
     CDS             38821..39639
                     /locus_tag="VP_RS15475"
                     /old_locus_tag="VPA0047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017818335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005464915.1"
                     /translation="MFFKMDFDAFMSECWQLHEEKPEQVYAQLETALNEVEALSQVER
                     IVALMLHTAIGHLEHPERFLACLDRLDDRAITESLAFQRSIAVARFFVDDTEDVALLE
                     EQDQRRVFSLIANELSALTQLEPASQWLAKAALGMTPHDAEEVLARSIAITANNLACQ
                     YEELSERTDEQKARMLESARLALDYWKIAGGWMQEERAEYRLAMSLLKADAPKEAKVH
                     AERCEAICLQNGGDAFELFYAHDLLMQVHFQLSQQCKKQLDAQVQQYCTTSELA"
     gene            complement(39723..40331)
                     /locus_tag="VP_RS15480"
                     /old_locus_tag="VPA0049"
     CDS             complement(39723..40331)
                     /locus_tag="VP_RS15480"
                     /old_locus_tag="VPA0049"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005497673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YitT family protein"
                     /protein_id="WP_005464880.1"
                     /translation="MDKDHSLRENLLALTLGSALVSLGVIFFSKVGLLTGGTAGLAIF
                     LTKVSDFSFGQIFFALNLPFYILSVMRMGWRFTVNTFIAVSIVSFAVDHLHHVIEISR
                     IEPFYAALLGGGLIGIGMLVIFRHKMSLGGFNILALYLQERFGIRAGKIQMALDCAIV
                     VMSLFIVDVHLIALSVLGAIATNLILAMNHKPGRYQPKPQTA"
     gene            40533..40928
                     /locus_tag="VP_RS15485"
                     /old_locus_tag="VPA0050"
     CDS             40533..40928
                     /locus_tag="VP_RS15485"
                     /old_locus_tag="VPA0050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016958201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GFA family protein"
                     /protein_id="WP_005464875.1"
                     /translation="MIKQVGNTQINPLHRLTCHCGKVELELTLPNGIEKPRRCDCSMC
                     RRRGAIVASVPLSGIRIVQGDDVLKLYQFNTHTAKHFFCSECGIYTHHQRRSDPSEYG
                     YNVGCLEGVNPYELGDIEVMDGVNHPSDR"
     gene            complement(40956..42386)
                     /locus_tag="VP_RS15490"
                     /old_locus_tag="VPA0051"
     CDS             complement(40956..42386)
                     /locus_tag="VP_RS15490"
                     /old_locus_tag="VPA0051"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020195075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter NhaD"
                     /protein_id="WP_005482814.1"
                     /translation="MPIYPIVAFCCLLFSSSSFAAASGDLNLVNSAVGYIALILFSIA
                     YILVMLEEYLKMRKSKPVLLAAGLIWILIGYTFAQHHQQDVAKAALEHNLLEYAELLL
                     FLLVAMTYINAMEERKLFDALQAWMVGKGFGFKKLFWLTGFLAFVISPIADNLTTALL
                     MCAVVMKVSGDNPRFVNLACINIVIAANAGGAFSPFGDITTLMVWQAGHVRFSEFMPL
                     FVPSLINYVVPAFLMSLFVPNTKPNTIHEHVELKRGARRIVLLFVLTIATAVSFHAVL
                     HFPPVVGMMMGLAYLQFFGYFLRKTLKHSLAKKAAMAIANGDDHALKRLGSVVPFDVF
                     HRVSRAEWDTLLFFYGVVMCVGGLSLLGYLELVSNVMYTQWNPVWANVMVGVLSAIVD
                     NIPVMFAVLTMDPSMSTGNWLLVTLTAGVGGSLLSIGSAAGVALMGAARGQYTFFGHL
                     KWTPVIALGYAASIAAHLWMNGGLFT"
     gene            complement(42797..43822)
                     /locus_tag="VP_RS15495"
                     /old_locus_tag="VPA0052"
     CDS             complement(42797..43822)
                     /locus_tag="VP_RS15495"
                     /old_locus_tag="VPA0052"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005428497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase family protein"
                     /protein_id="WP_005464923.1"
                     /translation="MATNRKIASLEFARIIAMVAIVGLHCQMALTYWQWDGVPWVGYL
                     LNQLARFAVPLFFLISGYLIQPKLSSNPLETLANYAKPLMKIWLVWSVISLLMPFQWQ
                     VVAEAGYLAERQGYWGYLASAPLNSLLEGGLVHLWFIPALVIAVAIIACLVRIGMTQL
                     LLPTAVLLYVYGVLAGSYAPLTDLPAPFFTRNGPFFSTLLVVLGYLIREKQWLWSRNN
                     TIRLILLGMALHFGEAYWLMQYDVAFNSNDFLFGTVIWSLGVFMWLLVHPNFGNMPWV
                     FKWAPSVLGVYVSHLLVIIVMMNIAGFLGLQDLAKDAFLFPATLIVTLLLVRAIEASP
                     LKKALLR"
     gene            44076..44666
                     /locus_tag="VP_RS15500"
                     /old_locus_tag="VPA0053"
     CDS             44076..44666
                     /locus_tag="VP_RS15500"
                     /old_locus_tag="VPA0053"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005468576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_005468576.1"
                     /translation="MKKGKVTKEFILQRAFEIASEDGLESLTIGELAKQCGMSKSGLF
                     AHFNSKLNLQLSVLEYANQVFAERVIEPARGLGDGNIERKIRGLLDSWMTWNHSFQGS
                     CMFLDAWNDAADKNCPLQAALRKAIDTWLSYLEIQIAKGKENQEFISDLDTRQATFDL
                     YGQYLSAHVFYSIKGEEESLRLFWQGIDNLLARWRG"
     gene            44787..45644
                     /locus_tag="VP_RS15505"
                     /old_locus_tag="VPA0054"
     CDS             44787..45644
                     /locus_tag="VP_RS15505"
                     /old_locus_tag="VPA0054"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_005468574.1"
                     /translation="MSEKIYFNTSQRFSVKRSLVNISTRLHHILAPSHAKKTARKLLL
                     TPARTQPKNAEPQGLVKAAIQGHTGAIKTYSLGQGPVWVLTHGWSGTASQFYPLMEHI
                     AACGFTALAYDHPAHGESDGQYGHIPGFVRGLEEVLDSVEEGVAGLVGHSMGTASALE
                     CRHHKLENKPLLLIAPVLNYVENLFGSIARSGYSMKLFKAVVSEVEDQYGYPLQSIDP
                     LKRLSERAAPTIIVHDEQDKFTKHSISAQAADEIENVELVTTQDQGHGRVMKCEQVFS
                     SFDRLIERV"
     gene            complement(45762..48308)
                     /locus_tag="VP_RS15510"
                     /old_locus_tag="VPA0055"
     CDS             complement(45762..48308)
                     /locus_tag="VP_RS15510"
                     /old_locus_tag="VPA0055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017419874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
                     /protein_id="WP_005482861.1"
                     /translation="MIRFNLCAAGVALALSGAAVAAPTAPSVDMYGSNNLQFSKIELA
                     METTSGYYDMVKYHDQAKITVKFNQWSGTPGDTYNIYFDGVKVATGAITGGQTTATFD
                     YGQGGLYQMEIEACDATGCSKSDPAEITIADTDGSHLKPLTMNVDPNNKTYNTDPSVV
                     MGTYFVEWGIYGRNYTVDNMPADNLTHILYGFIPICGPNESVKSVGGNSFNALQTACR
                     GVPDYEVVIHDPWAAYQKSFPQAGHEYSTPIKGNYAMLMALKQRNPDLKIIPSIGGWT
                     LSDPFYDFVNKANRDTFVASVKKFLKTWKFYDGVDIDWEFPGGGGAAADKGDPVNDGP
                     AYVALMRELRAMLDELEAETGRTYELTSAIGVGYDKIEDVNYADAVQYMDYIFAMTYD
                     FYGGWNNVPGHQTALYCGSFMRPGQCDGSGVDENGEAYKGPAYTADNGIQLLLAQGVP
                     ANKLVLGTAMYGRGWEGVTPDTLTDPNDPMTGTATGKLKGSTAQGVWEDGVIDYKGIK
                     SFMLGANNTGINGFEYGYDAQAEAPWVWNRTTGELITFDDHRSVLAKGSYAKSLGLAG
                     LFSWEIDADNGDILNAMHEGMAGGVVPQPNRKPTAAAGADQSVTGPASVVLDGSQSKD
                     SDGTIASYAWEQVSGTAVVLAGANTAKASFDAAEVTVEEQLTFKLTVTDNEGATASDL
                     VVVTVKPAGVVDPVNNAPVAQVVAPATANAGDVVVVDASASSDADNDTLTFNWTLPQG
                     LNATVNGSKVTFTAAEYPQDTSLSFTVSVSDGKASSSASATVVVAQHTTDPNPGTCDN
                     AWDASAVYTGGNQVTHAGKTWEAKWWTQGDDPSKSGEWGVWKEVGVANCN"
     gene            complement(48678..49181)
                     /locus_tag="VP_RS15515"
                     /old_locus_tag="VPA0056"
     CDS             complement(48678..49181)
                     /locus_tag="VP_RS15515"
                     /old_locus_tag="VPA0056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2850 domain-containing protein"
                     /protein_id="WP_005464988.1"
                     /translation="MAIPARRKRKQDKEPQLSFWARHQLKMVKSAFVIFVCSLVAFFA
                     YQLHVSYQDYIDPEHVYGEWIEIGAPPYQTERLIFTSDGVYRNHRLITTEFAFDGKVI
                     TLNTGIGETAYQLSGSHLSPQIRRIEPRIPDQRFIRKGFEHTVQGSEVGAASKRRAAL
                     SEHFSRD"
     gene            49506..49790
                     /locus_tag="VP_RS15520"
                     /old_locus_tag="VPA0057"
     CDS             49506..49790
                     /locus_tag="VP_RS15520"
                     /old_locus_tag="VPA0057"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrimidine/purine nucleoside phosphorylase"
                     /protein_id="WP_005464991.1"
                     /translation="MSIKENSYFAGGVKSLGFNQHGQDVSVGVMLPGEYTFGTQAPER
                     MTVVKGALVVKRVGEADWTTYSSGESFDVEGNSSFELQVKDATAYLCEYL"
     gene            49961..50242
                     /locus_tag="VP_RS15525"
                     /old_locus_tag="VPA0058"
     CDS             49961..50242
                     /locus_tag="VP_RS15525"
                     /old_locus_tag="VPA0058"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020195079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005464981.1"
                     /translation="MAVQRKHSDLPPRYEASDLTNEQRHRFTEVANAAHKRRKFYKQA
                     IEKSLVGKMKERAFKPVIAPQQGKPSRARQAFWLIVFLALGLWAMHFFA"
     gene            complement(50262..51419)
                     /locus_tag="VP_RS15530"
                     /old_locus_tag="VPA0059"
     CDS             complement(50262..51419)
                     /locus_tag="VP_RS15530"
                     /old_locus_tag="VPA0059"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_005482807.1"
                     /translation="MSTLAGARLEEMADIRSTRKKKIVFLCSSIAATLLVYGAIVQSL
                     ENHWGLSVLHAFSAIACLGICYLIKVQRHHKYADLLLSAVIMFEGLLLLLFNDAPSGK
                     LLWLYPIVATIILINEFKVGLLFSATYMILVFFGITFLDGLPATGDMIERRFMFTLIA
                     ISFVCHTFSYYYAKVVSYIQTLYREGIEELAYLDQLTGLANRWSFETWARAKLHDIDH
                     SDERSVTALVFLDIDNFKYINDTYGHDVGDQVLKAFATRLKKSIRNSDRKTDKHDYSI
                     ARFAGDEFVLMLYDVRSKQDLDGILDRIVNLFPKGYQNYDTYNELTMSVGAAIYKQDA
                     DDLSELTRCADKAMYAAKHTGKNQYAFYEHCSHAGELRKQQESMLEMTEAC"
     gene            51995..53335
                     /locus_tag="VP_RS15535"
                     /old_locus_tag="VPA0061"
     CDS             51995..53335
                     /locus_tag="VP_RS15535"
                     /old_locus_tag="VPA0061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011082191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family efflux transporter"
                     /protein_id="WP_005482935.1"
                     /translation="MPKRQNINQRMSIVALAWPILVEILLRTALGTSDVFMLSGYSDK
                     AVSAVGVITQITFFLIIVSTFVSSGTGILIAQYNGAGREQESVNVGVASIALSVIIGV
                     LLSVIAVFGAIFLLPYYGLEAQVEQYAREYLLISGAMTFNVTIGIVFTTILRSHGYSR
                     SPMVVNLISGVFNIIGNYIALYQPFGLPVYGVQGVAIATVVSQVIGTLMLWFILARSS
                     IELPMSTMKQVPAEIYKKILKIGGMNAGEVLSYNVAQICIVYFVVQMGTASLAAFTYA
                     QNIARFSFAFALAIGQAAQIQTGYYIGKGWVSSILKRVQIYFLVGFVASTAATTLIYL
                     FREEILRVFTDQPEILALAGSLVMGSILLEAGRVFNLIFIAGLKGAGDIKFPVQMGIL
                     SMWGLGVLFSYIFGIHLGYGVLGAWMAIALDEWVRGIIMARRWRSQVWTKFKVS"
     gene            complement(53424..55103)
                     /locus_tag="VP_RS15540"
                     /old_locus_tag="VPA0062"
     CDS             complement(53424..55103)
                     /locus_tag="VP_RS15540"
                     /old_locus_tag="VPA0062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009385468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="WP_005482837.1"
                     /translation="MHSPEHCFTRFTADTSDYELPTQFTFPFYYTPHPLCVLAAKQLQ
                     QHLLAQTDFEHDFGLVNEETGRGKMFGVLLVKSPQGELGFLSAFSGKIADQNLIPGFV
                     PPVYDMLTDEGFFRAETDAINAANAEYKTCAANPELADLKAQIQADRAAYQQEEQTQR
                     QVMIDGRAARKRQRQQGEQTLNADDLKILLDELGKQSVAEKNVLKYLKQAWDEKLAIK
                     EARLAELEQQLAHLKEQRKTLSNALQHKLHKQYRFLNSHGEARDLVDIFADTTNPIPP
                     AGAGECAAPKLLQYAFKHGFKPLALAEFWWGVSPKSEVRQHKKFYPSCNSKCQPILGH
                     MMQGLDVEPNPLAENWAEDKELEIIYQDDAMVVVNKPSGLLSVPGKTIKDSAYTRIQA
                     MFPDVEGPFVIHRLDMATSGILVFALTKRANKSLQKQFMARGVQKRYMALLEGVLNEP
                     EGEISLPMRGDPDDRPRQLVCFEHGKHAETYWQLIDVKDGRSKVYMYPKTGRTHQLRV
                     HSAHHMGLNMPMVGDGLYGEKANRLHLHAEMLELDHPYSKERMVFRAECEF"
     gene            complement(55221..55841)
                     /locus_tag="VP_RS15545"
                     /old_locus_tag="VPA0063"
     CDS             complement(55221..55841)
                     /locus_tag="VP_RS15545"
                     /old_locus_tag="VPA0063"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005383260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DsbA family protein"
                     /protein_id="WP_005482835.1"
                     /translation="MVTVHYFFDPMCGWCYGASPLIEALMDTSQFKVELHPGGMIEKR
                     AIESEFRQHIINSDARIATETGATFGEAYLQRVKSEDAFVLDSYLPTQAILSAEKMGL
                     NPWHMLKAIQSAHYQLGLKVNEASTLKAIAESLGLANDVWEQNMTLSEADLDEKIRSS
                     RQLMRQLHVGGYPTLIAEVNGEYLTLPHSTYYDKPAQWKLALQKLQ"
     gene            complement(55835..56701)
                     /locus_tag="VP_RS15550"
                     /old_locus_tag="VPA0064"
     CDS             complement(55835..56701)
                     /locus_tag="VP_RS15550"
                     /old_locus_tag="VPA0064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010320539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_005455527.1"
                     /translation="MKKFTLIAASVLMASPVLAANHSPLTLEVYNADGNSFHVNSTLV
                     YGETDAMVIDTGFTKADAMRIAAKVLDSGKTLKTIFISQADPDYYFGAEALHQQFPDA
                     QIIATPAVQKIIKEKLAGKLAYWGPKLGANAPVKPVIPVAYDKASLELEGHKIEIRGN
                     HGTSAHRPYLWIPDNKAILGNVAVYSNVHLWMADAADQTAINAWEQQLSEMLALKPQV
                     VIPGHMKAGTKLNADTIRYSQQYLQDFQQAKKHSNNSAQLIDTMSAKYPEAQLPIALE
                     IGAKVHTGEMSW"
     gene            56828..57715
                     /locus_tag="VP_RS15555"
                     /old_locus_tag="VPA0065"
     CDS             56828..57715
                     /locus_tag="VP_RS15555"
                     /old_locus_tag="VPA0065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019820922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005464957.1"
                     /translation="MDRVTAAKVFVDVVYSGSFTATAERLDMSRPMVTRYVEAMENWL
                     QTRLLHRTTRKVSLTTAGERSLPQIERWLKQADTLTSNIAVDGELSGKIRLASSTSFG
                     FSQLIPAVNSFMQKHPKVHIDIDLQDSVSDLTEQRIDLAIRIASDPDPSLIGKPIAVC
                     ESVLVASPQYLQTHHAIAHPRDLSSHDCLGYKNFERHVWHLSQGDQFESVGIECRLTS
                     NEATALLHGALQGMGISMLPTYLSNIYLQSGQLESVLPDWKPNDLNIYALYSSRKHLS
                     PAVRAFIDHSEDYFKLHPW"
     gene            57811..58614
                     /locus_tag="VP_RS15560"
                     /old_locus_tag="VPA0066"
     CDS             57811..58614
                     /locus_tag="VP_RS15560"
                     /old_locus_tag="VPA0066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017821029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cof-type HAD-IIB family hydrolase"
                     /protein_id="WP_005464970.1"
                     /translation="MSQVRIKFIASDMDGTLLDQYGRLDPEFFDLFLQLEEQGILFSA
                     ASGRQYYSLRDTFAPIKDRVLYVAENGTLVMYQDKELYSCTIPKAEVAEIVKAAREID
                     GANIVLCGKRSAYIETHDQQSLEEFQKYYHRCETVTDLLEVEDEFIKVAICHFDGSEE
                     LLFPTMNAKFGATHKVVVSAKIWLDVMNAEASKGAAIKHLQETMNFTPAETMTFGDYL
                     NDLEMLQVSEHSYAVANAHEEIKKIARYSAPSNQEAGVLKVIKEKVLAK"
     gene            complement(58723..59127)
                     /locus_tag="VP_RS15565"
                     /old_locus_tag="VPA0067"
     CDS             complement(58723..59127)
                     /locus_tag="VP_RS15565"
                     /old_locus_tag="VPA0067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012130271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011106212.1"
                     /translation="MMRKFMQVLLLLAVIAAGVLAWVFIPSHETIGQKTLEQALNDDY
                     SLVGHRIYSTDPDAGNRFGYFVLATGQSIEEQEPFLVTSDQFIRMEQTGDNTLSVTVN
                     GRIYQYHNDLWVPKSDGKLQHFLVSATANYVR"
     gene            complement(59137..60228)
                     /locus_tag="VP_RS15570"
                     /old_locus_tag="VPA0068"
     CDS             complement(59137..60228)
                     /locus_tag="VP_RS15570"
                     /old_locus_tag="VPA0068"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_005464959.1"
                     /translation="MKLSEAYPIKQKNYSTTSKMLLLVFATSLLLANVILLQQTRVLA
                     QSFTDEQKQATWFLFQLSKELSELVSEARRLDENVLKIEGAELQYELAWSRFDLLINS
                     KDVYTFFSRNHIQQYFLQLFNEFKELEPLLVEAKTGDSQAAAQFYRATQTLYLNLVEF
                     VNQNFRLTSQVYETQKDESQRLMKAQYMLFATFVLSILSLTYFFYRESHFHRKLALSD
                     PLTGLGNRNALFVTLRNNTRNRTAFSLCLLDLNGFKNVNDTYGHQAGDTVLCEIAKRL
                     KDMNIDSFSTYRMGGDEFAVVIESSDVDAEEAKKHIHSVFDTPVLNANNVSSLSTSIG
                     VAHYPSDSDNVDFLISIADKRMYKMKFQR"
     gene            complement(60228..60689)
                     /locus_tag="VP_RS15575"
                     /old_locus_tag="VPA0069"
     CDS             complement(60228..60689)
                     /locus_tag="VP_RS15575"
                     /old_locus_tag="VPA0069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_005482833.1"
                     /translation="MKKIVSLSLLLFAPFLSANSITFSSPQQPSVTLKLEELQSLPTT
                     SYTTDLPWIQQSSEFLGVKLSTLLTHVYGSIPEQVDIGSLNNYHSTLSRKDIVRYQPI
                     LAYQQDHHYIKVRNKGPYWVIYPLSQYPELDHNEYHAQMVWQVNEMKIKQK"
     gene            complement(61135..61974)
                     /gene="fghA"
                     /locus_tag="VP_RS15580"
                     /old_locus_tag="VPA0070"
     CDS             complement(61135..61974)
                     /gene="fghA"
                     /locus_tag="VP_RS15580"
                     /old_locus_tag="VPA0070"
                     /EC_number="3.1.2.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006711029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-formylglutathione hydrolase"
                     /protein_id="WP_005464966.1"
                     /translation="MTIENVSQTKVFGGWHKQYTHDSKALNCTMRFAIFLPPNATKSN
                     PVPALYWLSGLTCTDENFMQKAGAFRMAAELGIAIIAPDTSPRGEGVADDASYDLGQG
                     AGFYLNATQAPWSLHYHMYDYVTQELPAIIEANFPVSDVKSISGHSMGGHGALTIGLK
                     NPTLYRSISAFSPISNPMQCPWGQKAFTAYLGTDIESWKQYDASELLKKEKSPLPILV
                     DQGDADGFLSEQLKPEVLLAAAKQHGSELNLRMQSGYDHSYYFISSFIDNHLNFHAKY
                     LFA"
     gene            complement(62036..63184)
                     /locus_tag="VP_RS15585"
                     /old_locus_tag="VPA0071"
     CDS             complement(62036..63184)
                     /locus_tag="VP_RS15585"
                     /old_locus_tag="VPA0071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-(hydroxymethyl)glutathione dehydrogenase/class
                     III alcohol dehydrogenase"
                     /protein_id="WP_005464962.1"
                     /translation="MTLEIKPGQTHIKSKAMVAWAAGEPLKMEEVDVQLPKAGEVLVR
                     IVATGVCHTDAFTLSGDDPEGIFPSILGHEGGGIVEMVGEGVTSVEVGDHVIPLYTAE
                     CGECKFCKSGKTNLCQAVRETQGKGLMPDGTSRFSINGETIFHYMGCSTFSEYTVLPE
                     ISLAKVNKQAPLEEVCLLGCGVTTGMGAVLNTAKVEKGDTVAIFGLGGIGLSAIIGAR
                     MAGASRIIGIDINESKFDLAKQLGATDVINPQKFDKPIQEVIVEMTDGGVDYSFECIG
                     NVNVMRQALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSEL
                     PEIVNRYMAGEFGLQEFITHTMGLEDVNKAFDLMHEGKSIRTVIHMDK"
     gene            63478..64284
                     /locus_tag="VP_RS15590"
                     /old_locus_tag="VPA0072"
     CDS             63478..64284
                     /locus_tag="VP_RS15590"
                     /old_locus_tag="VPA0072"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005383272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylamine N-acetyltransferase"
                     /protein_id="WP_005482900.1"
                     /translation="MNKTDLNAYLTKLGLPSELPADLESLHKIHVAQHRCLPFENFDI
                     SLQRGISVEIEDIIQKTVYHSRGGYCFELNGLMLDVLKTLGFEARSLLGRVHVMGTPT
                     GRSHQITLVTLDEQAWIVDVGFGSNTPRAPLPFILNQVIQTDLQTFRFVEDAQFGYFL
                     QVLSTDGTDTWNNLYSFDLEFVFAGDIACGNFFTSTSPNSRFTSARVAAKATESGLVT
                     LLNYTLKYTSQGEQTELELEPGQAYLDALKEYFGIELDAQYGELRPLPDA"
     gene            64365..65234
                     /locus_tag="VP_RS15595"
                     /old_locus_tag="VPA0073"
     CDS             64365..65234
                     /locus_tag="VP_RS15595"
                     /old_locus_tag="VPA0073"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005533134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005464972.1"
                     /translation="MANWEGVSEFVAVAETNSFTGAAAKLKTSVAQISRRVSALEERL
                     AVKLLHRTTRKVSLSEAGQLYYQQCKHLVEGLELAELAVTQMQTEPRGLLRVTAPVTY
                     GEMNLAPLLHQFLEKYPRVDLDLVLTNQKLDLIEQGVDVAIRLGRLQDSSMIAKRLSS
                     RQTYVCASPMYLERFGEPHTLSELGRHQCLVGSVDYWHFKENKRDKSLRVSGRIKCNS
                     GFALVDAAKRGLGLVQLPDYYVQEALDSGELVEVLTDYRDDREGIWALYPQSRNLSPK
                     VRLLIDFLAQELA"
     gene            complement(65235..65945)
                     /locus_tag="VP_RS15600"
                     /old_locus_tag="VPA0074"
     CDS             complement(65235..65945)
                     /locus_tag="VP_RS15600"
                     /old_locus_tag="VPA0074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006740951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="WP_005482923.1"
                     /translation="MIKRWFKRWETPLSPEQKRQAIHVVDDWPMVLKDYLQRPLVDDS
                     TTLKDLSFVALDFETTGVDAQGDKILSIGVVDLTLDGIDIASSKEWYICHGQFIKPET
                     AKINGLTPQDLAKGLPLDEGMNRLLKRITGKVVLAHGCCIEKAFIHAYFSSRYQVEDF
                     PAYFIDTLQIEKQFSYAGKSGAHSSYQLDDLRRYYHLPGYLSHSAASDALACAELFLV
                     QSKKLTALPDVTLRQLTR"
     gene            complement(65948..67816)
                     /locus_tag="VP_RS15605"
                     /old_locus_tag="VPA0075"
     CDS             complement(65948..67816)
                     /locus_tag="VP_RS15605"
                     /old_locus_tag="VPA0075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CBS domain-containing protein"
                     /protein_id="WP_005482867.1"
                     /translation="MGTSVTPNIFDFLIKIDPFDKLPEPVVESIANSVKVKYLVRGET
                     IGFSALCDQRYLYIIRTGAIEQRTPNGELRARLGQDDQFGFTFLDPLENAEDGYQAEA
                     IEDSLLYLIPHSELKLVSEEHPEFADYFAAQANVRLSSAVKYVCRKEEKGLFFRTVGE
                     IASENIAIVDVNDSIRSVAQTMCGKQRSSCAVVMKEGEIIGLVTDRDMTKSVVAQDMD
                     TNQPIADVMTPNPVLIEDDAKVIQAISLMLQYNIRCLPVVHGKQVKGLLTTTHLVHNH
                     RTQSLFLIEKIKYASSLNALAALKEERQTIFQALVESGVSAEIQGRVMSMIMDAFTRR
                     IIQLNEELLGPPPCDYAWLVAGSHARNEVHMLSDQDSAIVLSDDATEEHKLYFTHLAM
                     RVCNGLAACGYPLCDGKYMAASPKWCQPIRRWKEYYQKWVASPEYNKLLSISVFLEVR
                     AIHGNREFVDQIQQHLHDCIQKSPSFIPALVRDAIDTQPPLGIFNNLVLEKGGENSNT
                     LNIKKYALNLIIDLARIFSLAAGGSLTGTEERFRYAAQHGTLSKDSVENIIGAYRFIT
                     QVRFRHQLNAILAGTTPDNHIAPDDFSSFERKHLKDAFKIISELQDVAKLKFVKGA"
     gene            complement(67900..68682)
                     /gene="kdgR"
                     /locus_tag="VP_RS15610"
                     /old_locus_tag="VPA0076"
     CDS             complement(67900..68682)
                     /gene="kdgR"
                     /locus_tag="VP_RS15610"
                     /old_locus_tag="VPA0076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020328935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator KdgR"
                     /protein_id="WP_005460804.1"
                     /translation="MEKSTQPEAVSSVLKVFHILQALGEQKAIGVSELSQRLMMSKAT
                     TYRFLQTMKSLGYVSQEGEADKYSLTLKLFELGAKSLEYVDLIELADKEMRHISEQTN
                     EALHLGALDENAIIYIHKIDSGYNLRMQSRIGRRNPLYSTAIGKVLLSERDESFVRDV
                     LSDVEFIKHTEKTLENTDQVLEELAKVRDFHYAEDNEEQEPGLRCIAAPIYDRFGQII
                     AGLSISFPTIRFDEERMEYYVGLLHQAGKNISEQLGYHDYPA"
     gene            68938..69699
                     /gene="kduD"
                     /locus_tag="VP_RS15615"
                     /old_locus_tag="VPA0077"
     CDS             68938..69699
                     /gene="kduD"
                     /locus_tag="VP_RS15615"
                     /old_locus_tag="VPA0077"
                     /EC_number="1.1.1.127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002434532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase
                     KduD"
                     /protein_id="WP_005482916.1"
                     /translation="MILDSFNLEGKVAIVTGCDTGLGQGMALGLAKAGCDIVGVNISE
                     PTETIEKVEAEGRKFVDIRANLMKLDDIPTIVDRAVTELGRIDILVNNAGIIRRNDAI
                     EFSEQDWDDVMNINVKSVFFMSQAVAKQFIAQGEGGKIINIASMLSFQGGIRVPSYTA
                     SKSGVMGVTRLMANEWASHGINVNAIAPGYMATNNTAALRADEQRNKEIVDRIPAARW
                     GTPEDLAGPCVFLASKAADYINGYTIAVDGGWLAR"
     gene            69718..70242
                     /locus_tag="VP_RS15620"
                     /old_locus_tag="VPA0078"
     CDS             69718..70242
                     /locus_tag="VP_RS15620"
                     /old_locus_tag="VPA0078"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005497706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YgjV family protein"
                     /protein_id="WP_005497706.1"
                     /translation="MVDTTILAQALGFISFGLGFSVFYQKNDRHLKILMLIFNLNHLL
                     HFLLLGSMVSALSALLSALRTTTAIFVSSKRVAAVFIVISLVSGFWVAEQWRDLWPII
                     GTVIGTYSVFCLSGIRMRIGFLLGASCWLTNNILVGSIGGTLLEMTVIVMNLLTIYRL
                     HRQQSESMINQSSY"
     gene            70250..70570
                     /locus_tag="VP_RS15625"
                     /old_locus_tag="VPA0079"
     CDS             70250..70570
                     /locus_tag="VP_RS15625"
                     /old_locus_tag="VPA0079"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004396728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="WP_005467181.1"
                     /translation="MFVFNQDIPMEDLGEGISRKVLAHSDNMMSVEVHFEEGAIGAMH
                     SHPHEQLTYVLSGEFEFTIGDEKKIVKTGDTMYKEPNIEHGCVCLKAGVLIDTFTPMR
                     KDFV"
     gene            70611..71246
                     /locus_tag="VP_RS15630"
                     /old_locus_tag="VPA0080"
     CDS             70611..71246
                     /locus_tag="VP_RS15630"
                     /old_locus_tag="VPA0080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017031803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiB/LacA/LacB family sugar-phosphate isomerase"
                     /protein_id="WP_005482830.1"
                     /translation="MKIALMMENSQAAKNAMVAGELNSVAGGLGHDVFNVGMTDENDH
                     HLTYIHLGIMASILLNSKAVDFVVTGCGTGQGALMSCNLHPGVVCGYCLEPSDAFLFN
                     QINNGNAISLAFAKGFGWAGELNVRYIFEKAFTGKRGEGYPIERAAPQQANAAILNNV
                     KAAVAKDVVEGLRAIDQELVKTAVGSTQFQECFFAHCQVPEIAEYVKSLLD"
     gene            71323..72234
                     /locus_tag="VP_RS15635"
                     /old_locus_tag="VPA0081"
     CDS             71323..72234
                     /locus_tag="VP_RS15635"
                     /old_locus_tag="VPA0081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_005482918.1"
                     /translation="MHVAPITSLQTWFPEHLVLPLWSEPQIPSHLVQSYQERNPNELL
                     PDRSVFDITHPEIVVFEPEQSNGIGILLMPGGGYQRVSVDKEGADSARVLNQAGFTVF
                     VMTYRMPNEGHEFGAWTPLADAQRAMRLVRRLPLASHLSSIGVLGFSAGGHVAASLAT
                     SHALDIYPLQDEADRVSAKPDFCALMYPVISMNTDIAHMGSRAELLANLERESDLLRF
                     SLEKQVTSDMPPCFLLHASDDTAVSVENSIVFWQALRQHEIATEMHLFEQGKHGFGIR
                     DAQGLPVAAWPQLLSAWLQNLTEKARR"
     gene            72333..73262
                     /locus_tag="VP_RS15640"
                     /old_locus_tag="VPA0082"
     CDS             72333..73262
                     /locus_tag="VP_RS15640"
                     /old_locus_tag="VPA0082"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015728298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar kinase"
                     /protein_id="WP_005482884.1"
                     /translation="MNPISRVAIIGECMVELKKHDGVLQQGFGGDTLNTAVYLSRLTK
                     QHGVETSYVTGLGHDPFSREMLTAWREEGINTDMVYLSEDKLPGIYAIETAEDGERSF
                     FYWRNDAAAKYWLRERALLSLVKDLCQHQMIYLSGISLAIISDDCRQMLIELLTMCRK
                     EGVKIAFDNNFRPKLWPNIEQARDFYSKILSVTDMAFLTFDDEVMLWGDKHEDEAISR
                     TKNFGVKEIIVKRGADDCFVVTQDQQHTVAALKVDAVVDTTAAGDSFSAGYLAKRILG
                     GDVAESALAGHKVAGTVIQHRGAIIPSQAMPTI"
     gene            73274..73897
                     /locus_tag="VP_RS15645"
                     /old_locus_tag="VPA0083"
     CDS             73274..73897
                     /locus_tag="VP_RS15645"
                     /old_locus_tag="VPA0083"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005460834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 4-hydroxy-2-oxoglutarate
                     aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase"
                     /protein_id="WP_005460834.1"
                     /translation="MKDLNQQLSEIKVVPVIAIKDAGKAVKLAQVLIENGLPCAEVTF
                     RTEDAALAIKNMREAYPEMLIGAGTVLTSAQVDEAIDAGVDFIVSPGFNPTTVKYCQQ
                     RNVTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVAMLKALSAVYPVKFMPTGGVS
                     PSNVKDYLSISSVLACGGTWMVPGDLIDNEQWDELAKLVREVAGIIE"
     gene            complement(74083..75822)
                     /locus_tag="VP_RS15650"
                     /old_locus_tag="VPA0084"
     CDS             complement(74083..75822)
                     /locus_tag="VP_RS15650"
                     /old_locus_tag="VPA0084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+:solute symporter"
                     /protein_id="WP_005492070.1"
                     /translation="MTLLDSMIVMIYLLFIGIAAWLFRRFSTSSNDFLQGGGTMMWWM
                     AGATAFMTQFSAWTFTGAAAKAYEDGISVMFIFWGNALGFFVAAAFFARRYRRLRVET
                     AMEVIRVRFGHTSEQLFTWLSFPLTLIACAIWMNGLASFFSAVFAIEMSTTILAMGVI
                     VTLIAVSGGAWTVSVTNVIQLVLLIAITLVIGYTALQHFDSPSEVFAYTTPIYGEQIR
                     MPSLFVMWAIAMLLQQTMSNNHTLSCYRFLTTANDKDATKAAFVAGVLFVFAPVLWFM
                     PAWFVAAQNIDLLAIYPALEQSANNAAYLYYIQHYMPQGLLGLVMVALVAATIAPLSS
                     AHNRNAGIVVKSLYQVWFNPNATSRQQLMVGKIATIVSGILATVTALLLASVESYSLF
                     DMMIVFAAFIQMPINIPSLLALVSLKTPNWSGWATVMVGCVVSLFMMFIFDVQWISSS
                     PLTPRESKDLSVVATLAVHLLVTGGFFLSTRVFYAKESPSIQQSRTALSIQLATPISD
                     EELSPINHKQGLYVGSITALAGMLLILAGVVLAGSSQSIFVAIGCIVLLFSLFLLQPT
                     LHSKRAWQKQKTK"
     gene            75952..76629
                     /locus_tag="VP_RS15655"
                     /old_locus_tag="VPA0085"
     CDS             75952..76629
                     /locus_tag="VP_RS15655"
                     /old_locus_tag="VPA0085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_005482845.1"
                     /translation="MKVRYLTSALLLAMTSGLAAAASVDIRHEYVPDRDGDEHRDRIY
                     VSHRFDNQIGFSVEAKWNYKDGHMGNAGHETGVSYRWKATDNFSLTPGINIDASPSGA
                     SVFKYNLTGAYKINDEWDVAARIRHGYKNTDDSRYNQLNLYANRKFEWGKLGVEAEYK
                     DIHGGEGGWKDKGHDQLIDFKGEYTKLESGVIPFFAIAAITHKGDGSEFKDEYVPRFR
                     VGLKYNF"
     gene            76645..78873
                     /locus_tag="VP_RS15660"
                     /old_locus_tag="VPA0086"
     CDS             76645..78873
                     /locus_tag="VP_RS15660"
                     /old_locus_tag="VPA0086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000753528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exopolygalacturonate lyase"
                     /protein_id="WP_005482823.1"
                     /translation="MKKHTLALCLAAILAPAAHAAEIKVEDLTWKAITFGQSTDMNFG
                     STILPEKVGVNQVTVNGEAVAAGKLASTFTIESRGGKLANSHEGLTFYYTELPTDVNF
                     TLSADVVLEQLGPETGATPNRQEGAGLMVRDILGAERLVPQPEGHEEFPSASNMVMNL
                     MRSHTRANDGMTNINASFREGVYQPWGTPGNRLSRVDYVEGVPYGTAETYRMTLTRTN
                     DGFKVSYRNGEKFVEQAVKGANANIVEMQNSDSQYVGFFASRNAKMTVSNVDLQLAAA
                     DTVDAPKYAAKQGELVFQIASSPRSATKEYPVQARANYSGEFEVLHNDKVVAKQTVTA
                     GELFSQWLTLDSGANQMEVRFTAIDGPNKETQAHRYSVDVVSLPDPMTLYVAPNGSDK
                     GNGSQAQPLDLATAVELLPAGGTIILKDGDYQGMEIPLTASGSADKLKHLRAEGDNVR
                     FVSELRHKANYWHYQGIEVAGAQFIVHGSHNTFEKMVTHGAPDTGFVITSPENIGRAL
                     WASYNQVIESESYNNMDPSQINADGFAAKMRIGDGNTFIRCLSHHNIDDGWDLFNKVE
                     DGANGAVTILDSISFSNGRTLDVANKGGTIGNGFKLGGEGIPVPHVVKNSLSFNNNMD
                     GFTDNFNPGALVLSDNVSIDNKRFNYLFRKSPYSGEIEQGTFTNNRSYRFHVSSKYDD
                     VINSAKSTGNALVENGTTYTSDGKAVDSKMLAPLKQASVIDTQQAIPGKQEAMQLKQL
                     IH"
     gene            79174..80946
                     /locus_tag="VP_RS15665"
                     /old_locus_tag="VPA0087"
     CDS             79174..80946
                     /locus_tag="VP_RS15665"
                     /old_locus_tag="VPA0087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011152606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+:solute symporter"
                     /protein_id="WP_005482859.1"
                     /translation="MEYDYLVIAGYFALMVAISLLFKKMASNSTSDYFRGGGKMLWWM
                     VGATAFMTQFSAWTFTGAAGKAFNDGFAVLAVFVGNMVAYVFAYFYFARRFRQMRVDT
                     PTEGVKRRFGNTNEQFFTWVIIPLSVINAGVWLNGLGVFASAVFNADIVTTIWVTGLA
                     VLAISLLSGAWGVVASDFIQTLVVAVISIACAAVALYVVGGPGEIVENFPGGFIMGPD
                     MNYPLLLVCTFIFFVVKQLQSINNMQESYRFLNAKDSKNASKAALMALVMMLFGAVIW
                     FIPPWASAILYPDAATQYSSLGAKASDAVYLVFARETMPLGTVGLLMAGLFAATMSSM
                     DSALNRNSGIFVRSFYSNIVRKGQASDKELLRAGQIACLVNGILVIMMAQFFNSLKHL
                     SLFDLMMQVATLLQSPILVPLFLGIIIRRTPKWAPWATVVVGMFVSWSVVKIFTPEFV
                     GSWFGMDELTRREAGEMRTMITIAAHLVFTAGFFCLSTLFYKEETDTHKETTAEFFKD
                     VDTECVAEEGQDIVDRMQRAKLGTLVIYMAAGLTLMVLIPNPLWGRLLFLACAASVFA
                     VGYGLKKSAKLDTQLSKVAATTTQ"
     gene            81003..82169
                     /locus_tag="VP_RS15670"
                     /old_locus_tag="VPA0088"
     CDS             81003..82169
                     /locus_tag="VP_RS15670"
                     /old_locus_tag="VPA0088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015728287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligogalacturonate lyase"
                     /protein_id="WP_005482890.1"
                     /translation="MAKGDVITLNFETFVDSDTQVKVTRLTPTDVICHRNYFYQKCFT
                     QDGKKLLFAGDFDGNRNYYLLNLETQQAVQLTEGKGDNTFGGFISTDERAFFYVKNEL
                     NLMKVDLETLEEQVIYTVDEEWKGYGTWVANSDCTKLVGIEILKRDWQPLTSWEKFAE
                     FYHTNPTCRLIKVDIETGELEVIHQDTAWLGHPIYRPFDDSTVGFCHEGPHDLVDARM
                     WLVNEDGSNVRKIKEHAEGESCTHEFWIPDGSAMAYVSYFKGQTDRVIYKANPETLEN
                     EEVMVMPPCSHLMSNFDGSLMVGDGCDAPVDVADADSYNIENDPFLYVLNTKAKSAQK
                     LCKHSTSWDVLDGDRQITHPHPSFTPNDDGVLFTSDFEGVPAIYIADVPESYKH"
     gene            complement(82256..83029)
                     /locus_tag="VP_RS15675"
                     /old_locus_tag="VPA0089"
     CDS             complement(82256..83029)
                     /locus_tag="VP_RS15675"
                     /old_locus_tag="VPA0089"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017818356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="siderophore-interacting protein"
                     /protein_id="WP_005482849.1"
                     /translation="MKKKPQPKTLVVTDTETITPNMQRITLQGEALSHFPRDCEGSYI
                     KLLFNDMGGADLSILSEDDRPIMRTYTIRRFHPETSTIEVDFVRHVTQDLQCGFAARW
                     AMAAQKGDTINIVGPGSISNLNTEADWFFMAADMTALPALSAKIRTLPEEAKGYAVIS
                     VLSPADIQPLHAPAGMELIWLTEGQALADSVRELEWLDGNASIWCACEFDSMRALRQY
                     FRNEKEVDRENIYISSYWKQGVSEDGHKMIKREDAESNQ"
     gene            complement(83209..83793)
                     /locus_tag="VP_RS15680"
                     /old_locus_tag="VPA0090"
     CDS             complement(83209..83793)
                     /locus_tag="VP_RS15680"
                     /old_locus_tag="VPA0090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020195105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysE family translocator"
                     /protein_id="WP_005482872.1"
                     /translation="MEYHQLGALALFAFVSTFTPGPNNIMLMTSGANVGFKRTIPHML
                     GITFGFGAMLILVGIGLMSLFHAYPLTHSILKVLSLSYLLYLTYKIATSDKTEAKHDF
                     RPMSFLGAVAFQWVNPKGWSMALTAITVYTSGGSWLELTFIAGIFCLANLPSVTFWTA
                     AGMQLQRWLTTDKRVKGFNYSMAALLLLSTIPMI"
     gene            83908..84348
                     /locus_tag="VP_RS15685"
                     /old_locus_tag="VPA0091"
     CDS             83908..84348
                     /locus_tag="VP_RS15685"
                     /old_locus_tag="VPA0091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006961293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lrp/AsnC family transcriptional regulator"
                     /protein_id="WP_005482841.1"
                     /translation="MDRFDERILQVLKRDGRISNVELSERVGLSPSATLRRVQDLERK
                     GVIKGYRAVLDNQQLGVGFVAYVSIGLASHSKQAQLGFEEHVRFVNEVVECHNITGAN
                     EYLLRVETQDLAAYKAFHADVLGECEHVKSITTMVVMDTPKDER"
     gene            84564..85742
                     /locus_tag="VP_RS15690"
                     /old_locus_tag="VPA0092"
     CDS             84564..85742
                     /locus_tag="VP_RS15690"
                     /old_locus_tag="VPA0092"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005428273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic polysaccharide monooxygenase"
                     /protein_id="WP_005482868.1"
                     /translation="MKSHVTLPLLSLSAVAALSSFNVNAHGWVEFPSARQNTCYLDGG
                     FWTNEIPNQACKAAFEESGAYPFVQRSEIAANVPNYRDMAHVQAVVRDGELCSAGDAA
                     KKGLNIPSPNWQRTNVTPDANNQIELVFYGKAPHNPSYWEFYLTKPTYDDSKPLTWSD
                     LELIDTAGDVYVDAEKRYRIQVTFPVDRSGDAVLYTRWQRIDVAGEGFYNCSDITLNG
                     TGTTPPTDPVDPTEPGNNLTSLGYFVQQGFGPVESGDTVRFRTFNATGNEIVDILLPI
                     SANNTATWAAEIADQFNAQQIGDWYVGIWHQEMNHYMFDSKNVNANQVLAPSADFSYA
                     LSLIKADVPPPVEPTNLWDKTAVYNQGDVVTHNGKEWTAQWWTSGEEPGTTGQWGVWR
                     "
     gene            complement(85859..86479)
                     /locus_tag="VP_RS15695"
                     /old_locus_tag="VPA0093"
     CDS             complement(85859..86479)
                     /locus_tag="VP_RS15695"
                     /old_locus_tag="VPA0093"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017821021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-IB family hydrolase"
                     /protein_id="WP_005482817.1"
                     /translation="MLDTTKPSLALFDFDGTITREDMFSLFLHYSAYGLRKRVGKLAI
                     MPFYALYKLGVLPARVMRPLSSFIAFSGKETQHIEAIGATFAHEVIPLYLRPEAMERL
                     AWHQHRGDTIVVVSASLNAYLKPWCEANGYHLLCSELISEQPKLSGFYQQGDCSLERK
                     VSRVKAAFSLDEFASVYAYGDTHEDIPMLKLADYAMLNWSEWRASE"
     gene            complement(86518..86829)
                     /locus_tag="VP_RS15700"
                     /old_locus_tag="VPA0094"
     CDS             complement(86518..86829)
                     /locus_tag="VP_RS15700"
                     /old_locus_tag="VPA0094"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005447308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="WP_005482886.1"
                     /translation="MNLFKDLPNNLDEEVFEDLLTHKNLRIERIVSTGQTSPESGWYD
                     QEEHEWVLVLKGAGELTFESGVVQRLDAGEHVTIPAHTKHKVSWTDPTQETIWLAVFY
                     Q"
     gene            complement(86839..87489)
                     /gene="qnr"
                     /locus_tag="VP_RS15705"
                     /old_locus_tag="VPA0095"
     CDS             complement(86839..87489)
                     /gene="qnr"
                     /locus_tag="VP_RS15705"
                     /old_locus_tag="VPA0095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017033301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Qnr family pentapeptide repeat protein"
                     /protein_id="WP_005482928.1"
                     /translation="MLKTDLIFERENFSHHDFQNATFKNCHFYMCSFDHADLRDAKFI
                     DCRFIESKALEGCSFRFANLKDASFTNCMLAMSLFNGANCMGLELRKCDLKGANFQGA
                     NFANRVSNTMFFCSAFITGCNLTYCNFERVLLEKCDLFENRWNGANLAGATLKGSDLS
                     RCEFSPEQWGTFNVEQCDLTHVELDGLDIRRVSLFGVKICDWQQEQLLAPFGLIIL"
     gene            87986..88630
                     /gene="ompW"
                     /locus_tag="VP_RS15710"
                     /old_locus_tag="VPA0096"
     CDS             87986..88630
                     /gene="ompW"
                     /locus_tag="VP_RS15710"
                     /old_locus_tag="VPA0096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014257537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein OmpW"
                     /protein_id="WP_005460838.1"
                     /translation="MKKTICSLAVVAALVSPSVFAHKQGDFVLRVGAASVVPNDSSDK
                     ILGSQEELKVDSNTQLGLTFGYMFTDNISLELLAATPFSHDISTDLLGLGDIADTKHL
                     PPTLMVQYYFGEPQSKFRPYVGAGLNYTIFFDEGFNNKAKNVGLTDLKLDDSFGLAAN
                     VGVDYMINDQWFLNASAWYANIETEATYKFGGAKQKTDVKINPWVFMISGGYKF"
     gene            88863..89888
                     /locus_tag="VP_RS15715"
                     /old_locus_tag="VPA0097"
     CDS             88863..89888
                     /locus_tag="VP_RS15715"
                     /old_locus_tag="VPA0097"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010453427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="WP_005482880.1"
                     /translation="MSGDIAKHSSSRSKLVKTLFFTLCVIAFGAMYWSWQYSDSHPST
                     EDAYVRAKILSVAPQVKGQVVSVDVKDFQSVNKGDLLLKIDSRPYLLAVKQAKAAYQL
                     AVQQHDVADKQVTEAVAGLDAARSNLTEAQVEYKRTDSLVKRKLASDQDLDTAKNKLA
                     NAQASLEQARATVEKAIANRGEEGAEAAVVQQAAAQLAQAELNLSYTDITSPVDGIAG
                     EINTHVGSVVSVGQTLFPVILKDSYWVRANFKETDLTHIKPGMHADVVIDMYPDVVWK
                     ATVEQLSPASGTSFSLMPPENATGNWVKIKQRFPVRLALEVPADAPQLRVGASSEVTI
                     DLQSSVQ"
     gene            89885..91375
                     /locus_tag="VP_RS15720"
                     /old_locus_tag="VPA0098"
     CDS             89885..91375
                     /locus_tag="VP_RS15720"
                     /old_locus_tag="VPA0098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005383288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux MFS transporter"
                     /protein_id="WP_005460814.1"
                     /translation="MSHQITADKRGIATVAVMLSAIMVLIDMTVANVSLSHMMGALGA
                     TADQITWVLTGYSMAEAIFIPMTSFWVSRFGERKVMLVAVIGFVIASALCGQAQSLEE
                     MVLFRIIQGAFGASVIPLAQSTLVQIYPYEQKGKAMAIFSIGILLGPILGPVVGGVIT
                     DNINWRWIFYINLPFGLICTSLIYRYIHIDNKSKPNFDWWIIGYMALGVGALQFVLDK
                     GNEEDWLNSRMIQTAILLAVMGSVMWIYRSWKTKSPIAPLWLLKDRNLMVSSLMIAVV
                     SMAMFGLTTQQPMLLESLLDYPVSTTGLLMAPRGLASAAMLILVIKLNPQFDPRIKIV
                     FGLSCIGIGSYLMTQYSLQIDTFWIVMPSMIQGMGLGLTFSTLSTLAYLTIPKEQSVA
                     AASIYNLFRTIGSSFGISIATTFQYRDSQQQWHALGEGINPYNPNLHDWAANQGLSIT
                     DPVALDQYQQMLQQQSQMVAFVHTFQLVGVMFVIMMPMLVFIRSRE"
     gene            complement(91472..91717)
                     /locus_tag="VP_RS15725"
                     /old_locus_tag="VPA0099"
     CDS             complement(91472..91717)
                     /locus_tag="VP_RS15725"
                     /old_locus_tag="VPA0099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005374351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_005460845.1"
                     /translation="MVTCSQYDFIEIACMFKLPIEITLKNGETHQGNAFDTGYDMQRQ
                     ECLFLDMDGEHTAFPTEQLVAMRALKANPHFDEVTFE"
     gene            91898..93034
                     /locus_tag="VP_RS15730"
                     /old_locus_tag="VPA0100"
     CDS             91898..93034
                     /locus_tag="VP_RS15730"
                     /old_locus_tag="VPA0100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_005482877.1"
                     /translation="MSETILKRTYLTSEQKTQKPDSLIPPQTYHAQLAHRVHHSPQFE
                     NGRVKNEMPNVPSPQSFWQVCWSYLGGRTPLSPNEHLPHSPIQPTQFAQRSESMRLTW
                     LGHSTMLVEVDGIRILTDPVFDYASPFIAKAWFERNIPNTHARDCLPIPEIIVISHDH
                     YDHLEASTIRFYADKPVTFYVPLGVGKHLIKWGVCADNIVEFDWWDSVHYAGIELICT
                     PANHNSGRTYFDKNATLWASWVIKGKEETLYFSGDSAYDSHFSEIAQRCGPIDIACLE
                     VAADVKGQGYPVENWGHMQAHHTVQAFHDLNAKKLLPVHWATYELFTHRWDEPILDLL
                     AHCQKEHITLLTPMPGESFYVHQEHINKQWWREKEICEPARILT"
     gene            93491..94258
                     /locus_tag="VP_RS15735"
                     /old_locus_tag="VPA0101"
     CDS             93491..94258
                     /locus_tag="VP_RS15735"
                     /old_locus_tag="VPA0101"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010453420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482920.1"
                     /translation="MNNSATYLLAALREKIKEKGIGYSELSIGLGIPLSTIKRQLHNT
                     SLGLDKILLYATHLDTDLVELSMRGKQLQQESEQFITDTNSEIFHQYPHLFDFLYLLR
                     RPEWSLEEIARRYQLSDTSVALYLRALEMMDYIELKGDKHYQFKDTGRFIFEEGSNLD
                     TLFAQRFREEVFSHDIRPPICVGRIAITEEQEEKLANEVYNKLIEFDVQNKTSENSQR
                     LKNVLLTFTPGNQIFLADTIPNINGDLLKSITIAKEK"
     gene            94374..97064
                     /gene="ygjK"
                     /locus_tag="VP_RS15740"
                     /old_locus_tag="VPA0102"
     CDS             94374..97064
                     /gene="ygjK"
                     /locus_tag="VP_RS15740"
                     /old_locus_tag="VPA0102"
                     /EC_number="3.2.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005391942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucosidase"
                     /protein_id="WP_005482903.1"
                     /translation="MFKKSTLAILIGATISLVGCGSNDKTEIRLPQAPTSEFTNVIDR
                     TGNPTYLRDYDSYSNLKYNALTDNGAWHGHLLPEDAAGYGAFGGIMQVTQEYAHFMSG
                     QTFDKLTLTDKVSGQTYDLSNAEAKVYSIPGALVQVLDLDDIHVQMVLRFVTDRSSLV
                     ETLITNKTDRDMNLALEWDGELVKYALSTRKDQTVAQYYPDYKRQISTIENGIKINFS
                     EMKDNWAIRNDRDAEFRITRSLPTKTFTNETSFSSTAEMSLPAEQTSAVYTAYSNLHN
                     AKEVQSESLKLQDVLANPTQYMEASKARWDGYLANGLINKEATAEQARVAVKAMETLN
                     GNWRSAAGDIEQATVTPSVTARWFSGNLTWPWDSWKQAYAMAHFNPDVAMDNIRTVFQ
                     EQVQADDKIRPQDKGYLLDVLTYTKPVSRGGAGSENWNERNTKPSLAAWSVMEVYYAL
                     VNQFDRPEDAQKFIDEMYPKLVAYHDWWLSNRDHNQNGVPEYGAAVDPAHNTKEGVMY
                     VWVETRDPNFTTIIPAEDIIEQNGNSYKVKGMASYNKILDEVDYMTIHVGAQEAAGWE
                     SGMDNAARFGFIYNIHNMNSQAEDISNPDRNVDQLGRYAASAYGFDNSIKLEGEEWVY
                     SNTSAENLAKLDLAKKDWEVRFAENRTNNNAADGKLLGFSMLQESVDQASYMYSDNKY
                     LAEMAKLVSDGVEGKDRAQEFLNGAEKIKTYINQCMFDESTGFFYDIHLNVAKDGTTP
                     APLANGCAGLPIVERGKGPEGWSPLFNGAATQEHADKVIAVMRDQDEFNTPDKFQGTG
                     VPLPTASQTNPAYGKDVYWRGRVWLDQVYFGFRAMENYGYKEEAIAMANELFNNAEGM
                     TGDMPIRENYNPETGAVQGASNFSWSAAHLYMMYNGFFKN"
     gene            complement(97197..97709)
                     /locus_tag="VP_RS15745"
                     /old_locus_tag="VPA0103"
     CDS             complement(97197..97709)
                     /locus_tag="VP_RS15745"
                     /old_locus_tag="VPA0103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="macro domain-containing protein"
                     /protein_id="WP_005482857.1"
                     /translation="MNAISLVQGDITTAHVDAIVNAANPRMLGGGGVDGAIHRAAGPA
                     LINACYAVDDVDGIRCPFGDARITEAGNLNARYVIHAVGPIYDKFADPKTVLESAYQR
                     SLDLALANHCQSVALPAISCGVYGYPPQEAAEVAMAVCQRPEYAALDMRFYLFSEEML
                     SIWQHALTQH"
     gene            complement(97769..98194)
                     /locus_tag="VP_RS15750"
                     /old_locus_tag="VPA0104"
     CDS             complement(97769..98194)
                     /locus_tag="VP_RS15750"
                     /old_locus_tag="VPA0104"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017821017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_005482828.1"
                     /translation="MPTNNPIAIQALDHVVLRTCNLDAMLHFYRDILGCPVEREVMEL
                     GLTQLRAGNALIDVVTVDSELGQLGGKPPVQNGRNIDHFCLQLAPFYENEILEYLRSN
                     GIETEEFAKRYGAQGFGRSLYIHDPEGNVVELKPQVIDE"
     gene            complement(98349..99191)
                     /locus_tag="VP_RS15755"
                     /old_locus_tag="VPA0105"
     CDS             complement(98349..99191)
                     /locus_tag="VP_RS15755"
                     /old_locus_tag="VPA0105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006740976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005482898.1"
                     /translation="MDFNLIQTFLIVAEYQSYSRAAEHLGLTQPAISASMKRLEKETN
                     KSLFVKDGRQIKLTSVAHQLLPKFHQAFAMINDAISDQSTFRLSCNEALIHRITPTNT
                     ISICADTDLPSLLNDLRLKQIDLIISPTTIHNPSFISESVFEEPMVVICRQDHPRIAG
                     KIEQERFYSEKHCRFVGDEDFPVSNTEIHQPGLQERDVEMMTTSLSGMMLYVAKHDCL
                     GVLPLSLAQKWQSALNLQVIQTPMLSEPVSYKLIFHKRDESSTSHQRLRAWARDQFAT
                     GLNA"
     gene            complement(99343..100650)
                     /locus_tag="VP_RS15760"
                     /old_locus_tag="VPA0106"
     CDS             complement(99343..100650)
                     /locus_tag="VP_RS15760"
                     /old_locus_tag="VPA0106"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009706803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1254 domain-containing protein"
                     /protein_id="WP_005482933.1"
                     /translation="MKQKLLVTLLGLSALGASPVFAANTNVDLAEDAYIYGYSIDEAY
                     KFFYHTAVENNYPLNRFQNIRALADDSYTAHPTINNDTLHLMGWLDVAAEPVIVSVPD
                     MDEGRYWILHTMDMGHYTNAAFSSRTRGTKGGQFMFAAQDWQGEVPASVDEVVRVDSN
                     LVKLMGRIMAVNDEDAKVALNYMDQWNIRTLSEYLGKNGPKPVQRTYPDPKKSTWLER
                     VNFVLCDGSMGNADKQWLDKYQSIGVEPCKTDFTPEQLKLAKVGEKKGMEHLVELAPK
                     MTDARTLLGTRDTLGDAPRDIFAEGTYLGQWGLPPIEASYRKSDFDSIGQKLDGSKHD
                     YVMRFKAPNVSEFWSVTIYGNDNRLMAKNDLNRHSRGDRTMKADKDGYYTIYMSANEK
                     GRADDPNFLPVPEKPFYAIMRFYGADDAIQSGEYQMPEIKVVK"
     gene            100789..101706
                     /locus_tag="VP_RS15765"
                     /old_locus_tag="VPA0107"
     CDS             100789..101706
                     /locus_tag="VP_RS15765"
                     /old_locus_tag="VPA0107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009706804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_020838389.1"
                     /translation="MMNFDYNLLKVLAVILETRNTTTAAERLCTSQPAVSRSLRKIRD
                     LFNDDILVRKGTNMELTPKAEEIKAQLSGIINDIDKLVNVSHSFDPATESSVLRVAIN
                     SSIAQWFSAAFTQLLAKEAPFMNLVIEDWTETTPDKIDAGEIAFGINYFPMELPKHLV
                     QKKGGRDDFALACRATHPHGGKRMYLDDISEYAYAVHIIQHWNEKEDHISRLLQPFSV
                     VPRIQLRTTHINTILNLVADSDVLFPCSRHLINQLDKRFSFIEFDDALPKLEGNFGYV
                     YSVKRRNDPLILWVNNTVESLMKSLGIES"
     gene            complement(101779..102264)
                     /locus_tag="VP_RS15770"
                     /old_locus_tag="VPA0108"
     CDS             complement(101779..102264)
                     /locus_tag="VP_RS15770"
                     /old_locus_tag="VPA0108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017054577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_005482882.1"
                     /translation="MKMNHVGIMVGDMDKAVEFYTQALGLKVVMGNTKVVEERETAIG
                     RMCIAVFGEGFKGFNIAHLVTSDGIGLELFEMKERQARHEVDFSRIGIFHFCLQTDDF
                     EGAIKRTEAFGGKVRMDIMRYHPEDDNKPAKMVYLEDPFGNLFELYSHTYEETYASEY
                     E"
     gene            complement(102403..102720)
                     /locus_tag="VP_RS15775"
                     /old_locus_tag="VPA0109"
     CDS             complement(102403..102720)
                     /locus_tag="VP_RS15775"
                     /old_locus_tag="VPA0109"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005428307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4144 domain-containing protein"
                     /protein_id="WP_005482865.1"
                     /translation="MVTWPCLLKLDGDDELIYLRSHADLDSECEALILGPDDYVVDSN
                     GNTFGLQYNDSNTTVLQPEERTLSVEEVTSLILSHEFCLAQRCIIKIHFTSVQQAVEA
                     LAN"
     gene            complement(102817..103527)
                     /locus_tag="VP_RS15780"
                     /old_locus_tag="VPA0110"
     CDS             complement(102817..103527)
                     /locus_tag="VP_RS15780"
                     /old_locus_tag="VPA0110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_005482805.1"
                     /translation="MKLDAILWDYDGTLVNSVPKNIEITKAILAIVAPHLTGDNLPKY
                     LHSEANYHYANHAAKNWQELYVDYYGMSHDEMLQAGGLWAEHQEKNQTPVTLFEGIDG
                     VIKEFAQLPHGICSQNSQSNIRRVLSDNGISAPFKSIVGYDDVSNGHQKPDAYSGIKC
                     VESIFGHAENRQLMYIGDHEADTQFARNIEQQLGGQSKVIAVAAAYSGAMPEHWSVQP
                     DYVARTVDELFSIIAQHT"
     gene            complement(103553..104089)
                     /locus_tag="VP_RS15785"
                     /old_locus_tag="VPA0111"
     CDS             complement(103553..104089)
                     /locus_tag="VP_RS15785"
                     /old_locus_tag="VPA0111"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009843890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF924 domain-containing protein"
                     /protein_id="WP_005460763.1"
                     /translation="MHQQIIKFWFEELTPQNWFENNPELDKHIASRFASVLEQAARCE
                     LFNWRDSAQGRLAEIIVLDQFSRNVYRNTPKAFAQDPLALALAQEAIRLGHDQELAPE
                     QLSFLYMPFMHSESRLIHVEAEKLFRASGLENNYDFELKHKAIIDQFGRYPHRNAILG
                     RESTPEELAFLQQPGSSF"
     gene            complement(104155..106002)
                     /locus_tag="VP_RS15790"
                     /old_locus_tag="VPA0112"
     CDS             complement(104155..106002)
                     /locus_tag="VP_RS15790"
                     /old_locus_tag="VPA0112"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017062727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M3 family oligoendopeptidase"
                     /protein_id="WP_005482888.1"
                     /translation="MTATDYLNDLNQRYLAIHRTKEDFFWETYMGISDDHDGSTQAQT
                     AWTSFLSSAEQITAIKQQLEAADSITNPQEKQQTITGLSGWLAMFESHAIEGEKAQAL
                     KNQLIAFEAELFEKKQNHVQTFTDENGEQVEGSLPVLSSTIRTSNHEEVRQSAHQALL
                     NLEQWLLQNGFIELIKLRNQFARSLGYATFFDYSVQKTEKMSSEQLFEILEDFEQRTR
                     DAHLNSLENLAKEKGASALTGFNFVYSFAGDVMRDLDPYVPFSKSLRRWVESFGRLNI
                     DYSGATLTLDLLDRKGKYPNGFCHGPIPSFYNQGEWVAAQVNFTSNAKPDQVGSGYDG
                     INTLFHEGGHAAHFANVKMNAPCFSQEFAPTSMAYAETQSMFCDSLLTDADWLKQYAL
                     DDEGNSVPDETIQAMINSRQPFKAYEERSILVVPYFERALYQLSDDELTPERITKLAR
                     DCEKQILGLECSPRPLMAIPHLLSDEAACAYQGYLLAHMAVYQTRAYFLEKFGYLTDN
                     PEIGPLLAKHYWHAGNHLSHNETIVSLTGEGFNAKYLADVCNLSPEQAWEVQQKKIDS
                     LATRERAPVASLNATIKVVDGSTELASNAISDEQMCDDFERYIVETYGR"
     gene            106234..106596
                     /locus_tag="VP_RS15795"
                     /old_locus_tag="VPA0113"
     CDS             106234..106596
                     /locus_tag="VP_RS15795"
                     /old_locus_tag="VPA0113"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482939.1"
                     /translation="MINKAKITLLTLGVVLAGCSSVTAPKKDAIESIQQKCAVILSSD
                     VSDDHRWQVYNELMQEYAVHAIKTQAQLDRFEAFVQRVQSDDSGQLITELIEVTDWGC
                     SNGNYLEEMDMFIQEVQK"
     gene            complement(106679..106852)
                     /locus_tag="VP_RS23635"
     CDS             complement(106679..106852)
                     /locus_tag="VP_RS23635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014233493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005460772.1"
                     /translation="MELRNKAGEIAKIADNLTLKEITEMGYTVDLCDEAYDANEHWKA
                     EGKTEGMGEYPEE"
     gene            107093..108235
                     /locus_tag="VP_RS15800"
                     /old_locus_tag="VPA0115"
     CDS             107093..108235
                     /locus_tag="VP_RS15800"
                     /old_locus_tag="VPA0115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_005482892.1"
                     /translation="MVILDHSLAQQIVDRTMSIIGHNVNVMNSAGIIIGSGDPKRVGQ
                     VHDGAVLALNHGDSLELNEQQCLTLQGVKPGINMLLKLHGEVVGIVGVTGEPEKIRDF
                     AKLVKMTAELTIEQAALVEKFQWDRRHREEFILAWINGKLTDEELKDWAMRLSIDVTQ
                     PRVATVIEVSTPSASKSMKSVRNIVELLEYPERNNLVAIVSVNEIVVLKPCHSAKQWD
                     SQIESERIDKLMSRLSDHDSHTFHIALGQLFNEPKDVALSYQSAKQVLAIGKQFYPEK
                     RKYLFDELRLPVLLAPLADIWQGEQIIDGVKRLKEKDKSGQLLKTLDALFECNGNVTE
                     CSKMLFIHRNTLRYRLEKITEITGLPTTNFVGLAELYIATRLSKMA"
     gene            108394..109746
                     /locus_tag="VP_RS15805"
                     /old_locus_tag="VPA0116"
     CDS             108394..109746
                     /locus_tag="VP_RS15805"
                     /old_locus_tag="VPA0116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011866330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntP family permease"
                     /protein_id="WP_005482895.1"
                     /translation="MNLILILLGVIAFIVLTTTKFKLHPFLALIIAAFLAAFAYGLPA
                     DSIAKTIASGFGGILGYIGLVIVLGTIIGVILEKSGAAITMADTVIKVLGERFPTLTM
                     SIIGYIVSVPVFCDSGFVILNSLKESLAKRLKTSSVAMSVALATGLYATHTFVPPTPG
                     PIAAAGNLGLESNLGLVIGVGVFVAAVAALAGMLWANRFQHVEPDGIEAADEIQHDWQ
                     ALKASYGKLPTASQAFAPIFVPILLICFGSIAKFPSLPLGEGFVFDVLTFLGQPLTAL
                     VIGLFLSVRLLKSDNKIEEFGERISQGITAAAPILLITGAGGAFGAVLKATPLGEYLG
                     TTLSALGVGIFMPFIVAAALKSAQGSSTVALVTTSALVAPMLTQLGLDSEMGRVLTVM
                     AIGAGAMTVSHANDSFFWVVSQFSRMSVGLAYRAQTMATLVQGVTAMALVYILSLVLL
                     "
     gene            109763..110899
                     /locus_tag="VP_RS15810"
                     /old_locus_tag="VPA0117"
     CDS             109763..110899
                     /locus_tag="VP_RS15810"
                     /old_locus_tag="VPA0117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005383304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate kinase"
                     /protein_id="WP_005460822.1"
                     /translation="MKVVIAPDSFKESLTAKQVSEAIKTGLARVWQDAEFVTVPVADG
                     GEGTVQSLIDATQGEQVFTTVTAPLGNDVEAFYGILGDGETAVIEMAEASGLHLVPSD
                     ARDPKLTSSIGTGQLIKHALDRGIQRLIIGLGGSATNDGGVGMLTALGVTFLDESGHA
                     ITPNGGGLAALASIDISGLDPRLAACEVLVACDVDNPLCGDKGASAIFGPQKGATASD
                     VTLLDNALRKFGELTEQATGKHVLTREGAGAAGGMGAALLGYTPARLQPGIEIVLETV
                     KLAQHVADADIVFTGEGRIDHQTAHGKTPMGVAKVAKQFDLPVIALAGCVGDNYQAVY
                     ECGIDAVFACVPRAMSLSEAMKEADVNVANLAENVARMWQIKSH"
     gene            complement(110996..112432)
                     /locus_tag="VP_RS15815"
                     /old_locus_tag="VPA0118"
     CDS             complement(110996..112432)
                     /locus_tag="VP_RS15815"
                     /old_locus_tag="VPA0118"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PLP-dependent aminotransferase family protein"
                     /protein_id="WP_005482870.1"
                     /translation="MGTDLLESGEGNKYLVVEKHLKQAINGGVYQADDRLPSIRSLSQ
                     ELNVSKNTVIRAYQELEAQNLVYSVPKSGYRVKVALPTSRSIPDPTRVDLLSICKEIL
                     TYPEYQERLPAGSAHPNIDSPAIKSLYAEIGRHSRQQTHVPSHYQLPPGDHLLIKQLA
                     KITQDLGTPAKLDEIMVTHGAQQAISLALRATTQKGDIVAVESPCYFGNLLMLESLGL
                     KVVEIPSCPRDGMCPEALAKTMATWDIKALIVTPNFTNPTGAMMPLEKRQQLLLASGN
                     IPIIEDDVFGGLSYDKPLPSLSLLDDKQRVIYVNSLSKTLDSRLRIGWMLAGRYRDQI
                     EQYLLCENMGSLNLMQSAVATFLTSGKYRTHTARMGRVYQNNMRRFIQMLHQYLDEYE
                     SLKNRYQINAVQGSFLLWLRLPEDTDSYALYQACNKHRISLLPGTVFGTQEQYRHCVR
                     LSVANFGHETDWSHAMQTLAKLIAKRVC"
     gene            112525..113424
                     /locus_tag="VP_RS15820"
                     /old_locus_tag="VPA0119"
     CDS             112525..113424
                     /locus_tag="VP_RS15820"
                     /old_locus_tag="VPA0119"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005374320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_005460847.1"
                     /translation="MLIRAIPFVFVILWASGFVGARFGLQYAEPATLLSIRMAFNVLL
                     FLVLVAVLRRRLPTGTDFWHSCVVGALIHGFYLGGTYFAIALGMPAGLSSLLVGIQPI
                     LTAALLVAFVREEFKPSQWLGLALGFVGIAMVLMGKMEWQSEQHKVLAIGLCLLALVG
                     ITLGTLYQKKHCQQVDMVGGATVQYLAALIMFLPVAMQFETMQVQWELEFILTVLWLV
                     VVLSCVAILLLLYMVRNGASSSVASVFYLVPPTTAIQAWLAFGESFDWMGISGFVLAA
                     TAVYLVVKKPDLTIKKAIKTEYT"
     gene            113492..113779
                     /locus_tag="VP_RS15825"
                     /old_locus_tag="VPA0120"
     CDS             113492..113779
                     /locus_tag="VP_RS15825"
                     /old_locus_tag="VPA0120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005428383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005459922.1"
                     /translation="MTAKPDRMTAMRNIIDQVKAELPIYEPETFVCGPEGQCIGCPKK
                     LLEMVDSELSYWESAMERGIVPQFDEIRRFGKMCTNVRRGLVRNNVPLLNS"
     gene            113819..114523
                     /locus_tag="VP_RS15830"
                     /old_locus_tag="VPA0121"
     CDS             113819..114523
                     /locus_tag="VP_RS15830"
                     /old_locus_tag="VPA0121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011106217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011106217.1"
                     /translation="MLHCSLAAVLKFEWCLSLLTPWAFNRKKLAIYWLGLTWMWGYCL
                     GLVEIGNVKSKGFTLMEITIVLTTLAFIALAALPVLLDIHRQAYAAMLHSSQSSLGTA
                     LKFFHAQSVIDNAYDQEHVHYIDRQVKTRKGMPEASADSIRALLEIDLPARGYSKIDV
                     PCKGSDFCIIGQQHPNSAHFVAIPDYQFLDKSGFDRVVYIWPQGYTLAEEACYFYYVN
                     QASTDSIVRGHVTQGC"
     gene            complement(114561..115088)
                     /locus_tag="VP_RS15835"
                     /old_locus_tag="VPA0122"
     CDS             complement(114561..115088)
                     /locus_tag="VP_RS15835"
                     /old_locus_tag="VPA0122"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005459926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_005459926.1"
                     /translation="MQIRPIKVSDHERFTALWNRVYSEGEFLISPAPDNATLRSILQR
                     VENESIPQFVAFDRQELIGSVEIFPAEMCGYEGGQLIRVGILGIHIDKSYRGKGLGRK
                     LLSMAIARGWAFGYDQIVLNVYKTNTPAIALYERFGFEHQGELGEVILPNGKVLMSQK
                     MVLNKAQHRSNNPGL"
     gene            complement(115118..115585)
                     /locus_tag="VP_RS15840"
                     /old_locus_tag="VPA0123"
     CDS             complement(115118..115585)
                     /locus_tag="VP_RS15840"
                     /old_locus_tag="VPA0123"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005374312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_005459929.1"
                     /translation="MIYLFDWGNTLMVDFPHAQGKMCDWEHVETVPQATDTLAVLSQN
                     NPIYIATSASDSNMEEVQRAFVRVDLDQFLNGYFCFANLGIAKNQPEFYLAVAKQLGV
                     NVSEITMVGDLPHKDIYPAMQAGVNTIWFNPTGADAPADPIPNQIRCLSELIP"
     gene            complement(115735..116199)
                     /locus_tag="VP_RS15845"
                     /old_locus_tag="VPA0124"
     CDS             complement(115735..116199)
                     /locus_tag="VP_RS15845"
                     /old_locus_tag="VPA0124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009700604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_031778755.1"
                     /translation="MHIRQATPNDLDGIFQLNLQINSLHFANAPEAFVAPSEADREFL
                     AQALENKERLFLVAEREQQILGFLTAVITQNDTVSFLIKDPICRVGTIVVDQEQKQQG
                     IGRQLLQACEQWARDANATQVRLEVMEFNQPAQRFYDNQGFKTNSRIMLKHL"
     gene            complement(116207..116938)
                     /locus_tag="VP_RS15850"
                     /old_locus_tag="VPA0125"
     CDS             complement(116207..116938)
                     /locus_tag="VP_RS15850"
                     /old_locus_tag="VPA0125"
                     /EC_number="1.1.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014257203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose 1-dehydrogenase"
                     /protein_id="WP_005459933.1"
                     /translation="MNKVVIVTGASRGIGAATAKKLAEQGYRVCVNYRTQQEAADQVV
                     AEIQANGGKAIAIAADVADEQQVLSLFNETEREFGAVTHLVNNVGVLFTQSPLADISL
                     ERFQTVMNTNVVSCFLCCREAAKRFSAGGAIVNVSSGASRSGAPFEYVDYATSKGAMD
                     TLTKGLSLELAERNIRVNGVRPGFIYTDMHADGGEPNRVDRLSPQIPLKRGGTVEEVA
                     NAIAWLLSDEASYVTGSFIDIAGGR"
     gene            complement(116948..117463)
                     /locus_tag="VP_RS15855"
                     /old_locus_tag="VPA0126"
     CDS             complement(116948..117463)
                     /locus_tag="VP_RS15855"
                     /old_locus_tag="VPA0126"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011106219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_011106219.1"
                     /translation="MSTLISTPRTKMSPIRAEDWALFQRLHIEPSVISLCFDKPDERV
                     LRDKFESRLASWTPECDHWLCLTIFDANTQQPIGITGFVLEEDKAEVGYLLLPEFHGQ
                     QFGTETLNALLHWAETTHDILRFSATVTEGNVASERVLTKCGFELSQVIPDAYQIGGK
                     HYADKIYSRQK"
     gene            117734..118828
                     /locus_tag="VP_RS15860"
                     /old_locus_tag="VPA0127"
     CDS             117734..118828
                     /locus_tag="VP_RS15860"
                     /old_locus_tag="VPA0127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017634357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NapC/NirT family cytochrome c"
                     /protein_id="WP_005459939.1"
                     /translation="MSIKKRYIALLVAAGVGVGWLTLGGSAAVMHYTSDTEFCVSCHS
                     MEIPYKEYQGSVHFSNAKGIRAECSDCHIPQEPMDYLITKIRASKDIYHEFVTGKIDT
                     PEKYEAHRKDMAETVWAQFRENDSATCRSCHDFDAMEEFEQSRDAAKMHEYAKANDQT
                     CIDCHKGVAHFAPEAELDSKAFETLMSFTTKTAANAKVVYPVTTINMGEMGTINPTTK
                     LEVMSAEGDNRTVKLNAFQMKGAEQVLYMGEGQRAIVATLTEQGQQALEAGEFEADVY
                     GNEWRAVSLTGAIDSPVVDTLDPVWSYAEELDNVYCATCHAKIPSNHFTVNAWGPVAK
                     SMGDRTDISAENLEILTKFFQHHAKDVVGH"
     gene            118851..121298
                     /locus_tag="VP_RS15865"
                     /old_locus_tag="VPA0128"
     CDS             118851..121298
                     /locus_tag="VP_RS15865"
                     /old_locus_tag="VPA0128"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000161724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin guanine dinucleotide-containing
                     S/N-oxide reductase"
                     /protein_id="WP_005459941.1"
                     /translation="MTNMTRRGFLKGTGMAAGAMAFTSFAPMSVASSNARGKGILTAG
                     RMGPMLCEVQDGKLVSTTNALPQTVPNSLQSTGPDQVHTKARVKYPMVRKGYLANPSA
                     PEGVRGSDEFVRVSWDEAYKLIHEQHMRIRKEYGPASVFAGSYGWRSSGVLHKAQTLL
                     QRYMSMAGGYSGHLGDYSTGAAQIIMPHVVGSIEVYEQQTTYPVVLEHSDVVVLWGLN
                     PINTLKIAWSSTDCAGLEFFHQLKKSGKTVIAIDPIRSETIEFFGENAEWIAPHPMTD
                     VAMMMGIAHTLVKQGKHDKAFLDKYTAGYDKFEAYLMGEEDGVEKSAEWASQICGVPA
                     KQLELLADIFSKNRTMLMAGWGMQRQQYGEQRHWMLVTLATMLGQIGLPGGGFGFSYH
                     YSNGGNPARDAGVLPAISASLGGGSSAGNDWAVSGAVQSFPVARIVEALENPGQSYHH
                     NGHELTFPNIKMIWWAGGANFTHHQDTNRLIKAWQKPELIVISEPYWTAAAKHADIVL
                     PITTSFERNDLTMTGDYSNQHLVPMKQVVEPQGEARNDFDVFADMAEMLAPGGRDVYT
                     EGKTEMEWLYGFYKAAQQGGRGSRIAMPNFSKFWEDNQLIEMKWNEKNAQFVRYADFR
                     EDPIMNPLGTPSGKIEIFSKTIEGYQLEDCPPHPTWMAPTEYTGNAKDGELQLMTAHA
                     AHRLHSQFNYAKIREEYAIANREPIWIHPEDAKARGIKTGDLVRAFNNRGQVLVGAEV
                     TDRIKQGSVCIHEGGWPDLDPKTGICKNGGCNVLTLDIPTSRLANGCAANSALVRIEK
                     YTGPELELTAFEPPKNG"
     gene            complement(121369..122094)
                     /locus_tag="VP_RS15870"
                     /old_locus_tag="VPA0129"
     CDS             complement(121369..122094)
                     /locus_tag="VP_RS15870"
                     /old_locus_tag="VPA0129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012130200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase PAP2 family protein"
                     /protein_id="WP_005459943.1"
                     /translation="MKTKKYGLMMLALFVLGIIPMSLFGSYHNLTSQVPESLGITFTL
                     LTDSAGSKGFLITLTLLLLSLFRFKPSRTEWMQKLSMLGLLLVIGFASKTGLKLMTES
                     PRPYTELLAAEQLIETPETFYQLDTKQQANVINQISEHVSDWRTRHWQGEKDYSFPSG
                     HTIFVSICLAFFGGLFLQNKCYISALSLWMWGMSVAYSRLWLGMHRPEDLIGSVLFVA
                     IVFTLLPTFQIKKQMPFVSLASR"
     gene            complement(122277..122891)
                     /gene="thiE"
                     /locus_tag="VP_RS15875"
                     /old_locus_tag="VPA0130"
     CDS             complement(122277..122891)
                     /gene="thiE"
                     /locus_tag="VP_RS15875"
                     /old_locus_tag="VPA0130"
                     /EC_number="2.5.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine phosphate synthase"
                     /protein_id="WP_005482839.1"
                     /translation="MNAYRLYLVTDDQQDLPTLKHVVRKAVEGGVTMVQVREKHGDVR
                     EFIERAQAVKTILEGTGVPLIINDRVDVALAVDADGVHLGQSDMPAEIARQLIGPNKI
                     LGLSIETEDQLAEADSLPIDYIGLSAIFATPTKTNTKKHWGIGGLKMALNTTSLPIVA
                     IGGINETNIPALSATGVHGLALVSAICHAENPTKAAEYLLSLMD"
     gene            complement(122955..123746)
                     /gene="thiM"
                     /locus_tag="VP_RS15880"
                     /old_locus_tag="VPA0131"
     CDS             complement(122955..123746)
                     /gene="thiM"
                     /locus_tag="VP_RS15880"
                     /old_locus_tag="VPA0131"
                     /EC_number="2.7.1.50"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017818226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyethylthiazole kinase"
                     /protein_id="WP_005482855.1"
                     /translation="MLIEQITQALTAVRQQKPLVVNITNYVVMNNTANALLAIGASPI
                     MAHSKQEMAEMMSFAGALVINIGTLDSVWTPRMSYAVEQANSNGKIVVLDPVGCGASS
                     LRTETSREIARLANKLIIRGNASEIIALAGEQAQSKGVDALDSSDAALGAAHFLVKEY
                     GASVVISGETDYIVTKEQTVQLNNGHEMMPYVTGMGCTLTALTGAFAAIGDETGLAAA
                     AVLGVVGEIAAEQARGPGSLQMHLLDELYQLDEETLATRLKLQVR"
     gene            complement(123765..124427)
                     /gene="tenA"
                     /locus_tag="VP_RS15885"
                     /old_locus_tag="VPA0132"
     CDS             complement(123765..124427)
                     /gene="tenA"
                     /locus_tag="VP_RS15885"
                     /old_locus_tag="VPA0132"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009706841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiaminase II"
                     /protein_id="WP_005391859.1"
                     /translation="MKYQDLIDACCQDWQEYTEHAFVQQLAKGTLAQPCFLHYLKQDF
                     LFLKQYARAYALAIYKARTLDDMRRALPSVHALLDSEIAHHVTYCGQWGLTESDLENE
                     PEDFGTVAYTRYVLDAGMTGDLVDLYAALAPCSIGYAVIGKMLIEDENTVFEGNPYAS
                     WINLYGGEEFQSGVASGAEHFNQLLAEIDIHSQRGQNLIQVFKTATRMEVAFWQQGLN
                     AQ"
     gene            complement(124446..125396)
                     /locus_tag="VP_RS15890"
                     /old_locus_tag="VPA0133"
     CDS             complement(124446..125396)
                     /locus_tag="VP_RS15890"
                     /old_locus_tag="VPA0133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004726984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_005482863.1"
                     /translation="MNKNKLMSAAALLASMVSTNVLAAEKELTLMLDWFVNPNHGPIV
                     IAQERGYFKQQGLKINIQEPADPSTPPKLVAAGKVDMAISYQPSLTIDVAAGLPLIRS
                     ATLIATPLNTLMVLDNGKNDNLGDLKGKKIGIAIAGNEEATIGTMLAQENVKFSDVQI
                     INVGWALSSSLASGKVDAIWGGLRNFETNQLALEGYKAKAFFPEEHGVPAYDELVFVA
                     NAKTYDKAAIKAFNKALEQATTYIVNHPKESWKEFVAYSPDTLNNELNQRAWNDTLTR
                     FALRPSAVDLKRYDEYAEFMYSQKIIETLPKAKDYVPSFD"
     gene            complement(125419..126219)
                     /locus_tag="VP_RS15895"
                     /old_locus_tag="VPA0134"
     CDS             complement(125419..126219)
                     /locus_tag="VP_RS15895"
                     /old_locus_tag="VPA0134"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009697279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_005482930.1"
                     /translation="MSDMTQYNSVSARISKKERVTHPVLRLLISAAVILGLWQLIVVV
                     FDMPNFILPSPIEVLDRLITRYDVLLKHTWVTAQEILLGLALGLSMGLLFALQMLMFE
                     PLKRWLLPILIASQAIPVFAIAPVLMLWLGYGIASKVVMAAIIIFFPVTTCCYDGLRN
                     TPTGYLDLAKTMGASKWQLLRHIQLPAALPTLASGIRVAVVIAPIGAVVGEWVGSSEG
                     LGYLMLQANARMIIDEMFAALFILAALSIALYFTTDKLLKKAIPWENK"
     gene            complement(126212..126970)
                     /locus_tag="VP_RS15900"
                     /old_locus_tag="VPA0135"
     CDS             complement(126212..126970)
                     /locus_tag="VP_RS15900"
                     /old_locus_tag="VPA0135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005435315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_005482853.1"
                     /translation="MFANAIGIQLADASLQYKDSQTPTLAGVNMVIPVGQWTVLLGRS
                     GCGKTTILRYLAGLLDDQVDWHGELITTDGAALHDRIAYMAQQDLLLPWLNVLDNVCL
                     SSRFSYANSNPVDEKQRALNLLEHVGLADYAYAKPAQLSGGMRQRVALARTLMQDKPL
                     VLMDEPFSALDAVTRHRLQTLSAELLKDKTVVLITHDPQEAVRLAHQLYVLQGTPAQA
                     QHLDVPDSPPPRLLDGECAALQQAILDQLEKDYE"
     gene            complement(126960..127817)
                     /gene="thiD"
                     /locus_tag="VP_RS15905"
                     /old_locus_tag="VPA0136"
     CDS             complement(126960..127817)
                     /gene="thiD"
                     /locus_tag="VP_RS15905"
                     /old_locus_tag="VPA0136"
                     /EC_number="2.7.1.49"
                     /EC_number="2.7.4.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004726981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional hydroxymethylpyrimidine
                     kinase/phosphomethylpyrimidine kinase"
                     /protein_id="WP_005459962.1"
                     /translation="MTQQSQPYSHQTPALPTPIVLTIAGSDSGGGAGIQADIKAMSAT
                     GSFACSVITAITSQNTQGVSAIFPIPLDHVESQLDAVFTDLNIVAVKVGMLADSNIIK
                     VVASKIRQYQPKHLVIDPVMVATSGDLLLEQSAISTLREELIPLADIITPNLPEGAAL
                     TGKPVPHSESEMNDMIDDLRALGAKAILLKGGHLEEDENSNDLLIMQNSAELISAKRF
                     PTKNTHGTGCTLSSAIASYLGQGNNLHKAVHLGKQYISQAIAHADELEVGKGHGPVHH
                     FFAGHTYVR"
     regulatory      complement(127914..128021)
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00059"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="TPP riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="thiamine pyrophosphate"
                     /db_xref="RFAM:RF00059"
     gene            128334..129719
                     /locus_tag="VP_RS15910"
                     /old_locus_tag="VPA0138"
     CDS             128334..129719
                     /locus_tag="VP_RS15910"
                     /old_locus_tag="VPA0138"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006643771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TldD/PmbA family protein"
                     /protein_id="WP_005459963.1"
                     /translation="MLNSVTAKSVIDHALFLGADFAELFVEHHQTNTVQIASGEVDNV
                     NSGIDFGIGIRLFFGHKVLYGYTNSTDETELKRVTSLLAAKDKREQIASAGSMNLNRY
                     PIQHGCRMPLSKDANLDSKIAFLLKVDQAARAESEYISQFIGSVLQREQQVSIFNSEG
                     LHVDDTRHYIRVAGNTVAQKGNEQSSGMEGPGALAGWEFSEQIDAKELGQTIAQQALV
                     KLGADACPSGEMPVVIGNGFGGVIFHEACGHLLETTSVAKKASVFHDKMGEMIAHTAV
                     NAVDDGTMTNEWGSIHVDDEGLPTQRTQLIKDGKLTSFMVDKMGGMKTGYEPTGSGRR
                     QNYKFAPTSRMRNTFIEEGEHSLDDMLAGIERGIYAKKMGGGSVQPGTGEFNFAVREA
                     YLIENGKITKPLKAATLISTGPKVLKEISMVGKDMALAPGMCGSVSGSVPTTVGQPTL
                     KVDNILVGGGN"
     gene            129719..131062
                     /locus_tag="VP_RS15915"
                     /old_locus_tag="VPA0139"
     CDS             129719..131062
                     /locus_tag="VP_RS15915"
                     /old_locus_tag="VPA0139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014233510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TldD/PmbA family protein"
                     /protein_id="WP_005459964.1"
                     /translation="MSQEQQLLNAVDYVLSEAKRQGAEADVIVNRNSSFSLKANQGKL
                     DEYKVSSSQVLGVRVIKDARVATSYSESLEQPSLDLMLTNALQSARFSKQDEHQTISC
                     VNSKITTDIAEIAQDDTTSVDEKIELSLALEQGVVALPHASSSPYNGYSDGETQLIIA
                     NTQGTLCQHFERSFTCYAYTLFEKDGKQSMAGRMSLGRRFDELNPTYCIEGGYNLARD
                     LLDGVPVATGNYPAIFHINALASLFGAFGSAFSGVSAMKGISPLGDKLGQSVASELLT
                     FTDAAYMPNGMAIAGFDSEGFATQDNVLIANGQLNTLLHNSQTASYLGAVSTASASRS
                     AKSSLDVSANHKVIATGNSSASEVKAGEYLELVELQGVHSGADAVSGDFSFGASGFLC
                     RDGQRVQPVRGITVAGNFYKMLQEVEAVGDTQLINDSRTFFAPDVRFARLSIGGK"
     gene            complement(131143..131742)
                     /gene="trmY"
                     /locus_tag="VP_RS15920"
                     /old_locus_tag="VPA0140"
     CDS             complement(131143..131742)
                     /gene="trmY"
                     /locus_tag="VP_RS15920"
                     /old_locus_tag="VPA0140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017054822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (pseudouridine(54)-N(1))-methyltransferase
                     TrmY"
                     /protein_id="WP_005459965.1"
                     /translation="MRSFVLRARAAPTTSKALLEGVGNEAHTEILAHTMMNTMFVAQS
                     HREDVVVHLVLESTKDYSRTITIRSNDITNIGGFHESTLIAAVARALDASVGMGKEQL
                     REVEPGITVRTVSFERLVQELAEDHQLYMLDKKGEFVRDAEIGENPCFLLTDHIPMPK
                     KSFNSLKRLGTEKISLGPKMLFASQCVVLIHNELDIREF"
     gene            131903..132427
                     /locus_tag="VP_RS15925"
                     /old_locus_tag="VPA0141"
     CDS             131903..132427
                     /locus_tag="VP_RS15925"
                     /old_locus_tag="VPA0141"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020195167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3087 domain-containing protein"
                     /protein_id="WP_005459966.1"
                     /translation="MEIKQINKDIYKKKVNLVIGGFVALLAISSLAFSTLLIVLFGNT
                     EVVPEQSTGNFHWNLIGVVLAVATSLSLLNQIKTRPYMEEVLYVWKLKQLHNKIFRKL
                     KSIKAAASNDDVKALTTLKFYYTTQRQVFELDNNTLTMSSVNKELEAIDQIEVDKSLH
                     LDIASFEEGWIDTY"
     gene            132913..134474
                     /locus_tag="VP_RS15930"
                     /old_locus_tag="VPAr01"
     rRNA            132913..134474
                     /locus_tag="VP_RS15930"
                     /old_locus_tag="VPAr01"
                     /product="16S ribosomal RNA"
     gene            134557..134632
                     /locus_tag="VP_RS15935"
                     /old_locus_tag="VPAt01"
     tRNA            134557..134632
                     /locus_tag="VP_RS15935"
                     /old_locus_tag="VPAt01"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:134591..134593,aa:Glu,seq:ttc)
     gene            134635..134710
                     /locus_tag="VP_RS15940"
                     /old_locus_tag="VPAt02"
     tRNA            134635..134710
                     /locus_tag="VP_RS15940"
                     /old_locus_tag="VPAt02"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:134668..134670,aa:Lys,seq:ttt)
     gene            134725..134800
                     /locus_tag="VP_RS15945"
                     /old_locus_tag="VPAt03"
     tRNA            134725..134800
                     /locus_tag="VP_RS15945"
                     /old_locus_tag="VPAt03"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:134758..134760,aa:Ala,seq:tgc)
     gene            134814..134889
                     /locus_tag="VP_RS15950"
                     /old_locus_tag="VPAt04"
     tRNA            134814..134889
                     /locus_tag="VP_RS15950"
                     /old_locus_tag="VPAt04"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:134847..134849,aa:Val,seq:tac)
     gene            135159..138074
                     /locus_tag="VP_RS15955"
                     /old_locus_tag="VPAr02"
     rRNA            135159..138074
                     /locus_tag="VP_RS15955"
                     /old_locus_tag="VPAr02"
                     /product="23S ribosomal RNA"
     gene            138148..138263
                     /gene="rrf"
                     /locus_tag="VP_RS15960"
                     /old_locus_tag="VPAr03"
     rRNA            138148..138263
                     /gene="rrf"
                     /locus_tag="VP_RS15960"
                     /old_locus_tag="VPAr03"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
     gene            138333..138423
                     /locus_tag="VP_RS15965"
                     /old_locus_tag="VPAt05"
     tRNA            138333..138423
                     /locus_tag="VP_RS15965"
                     /old_locus_tag="VPAt05"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:138367..138369,aa:Ser,seq:tga)
     gene            complement(138925..139281)
                     /locus_tag="VP_RS15970"
                     /old_locus_tag="VPA0143"
     CDS             complement(138925..139281)
                     /locus_tag="VP_RS15970"
                     /old_locus_tag="VPA0143"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006880368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YibL family ribosome-associated protein"
                     /protein_id="WP_005467110.1"
                     /translation="MSIKTDIQKLHNRVDTCQRKLDAARSRGDHEMISKFTDEVEDLT
                     KKLNQLKHKQTYELNKERKSLLDMPFSREITKAEQADIGKLKKRVRGLVIVHPMTKMG
                     KELRLDVMTGFAPKEF"
     gene            complement(139365..140360)
                     /locus_tag="VP_RS15975"
                     /old_locus_tag="VPA0144"
     CDS             complement(139365..140360)
                     /locus_tag="VP_RS15975"
                     /old_locus_tag="VPA0144"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010453311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyacid dehydrogenase"
                     /protein_id="WP_005479619.1"
                     /translation="MINIAFFSAKSYDEASFNKIKNNRDFEFHYHDFRLTEKTAKMAH
                     GCDVVCAFVNDDLSAPVLKQLSLGGTKLIAMRCAGFDKVDQQAAKELGLQVVRVPAYS
                     PEAVAEHTVGLMMCLNRRLHKAYQRTRDANFSLEGLVGFNFFGKTVGVIGTGKIGIAT
                     MRIFKGLGMELLCYDPYENPLALEMGARYCSLEEIYANADVISLHCPMSEENYHLLNE
                     NAFAQMKDGVMIINTSRGELLDSVAAIEALKQGKIGALGLDVYDNEKDLFFQDKSNDV
                     IVDDVFRRLSACHNVLFTGHQAFLTHEALNNIASVTLNSVETFFSGQVSGNELIN"
     gene            140590..141072
                     /locus_tag="VP_RS15980"
                     /old_locus_tag="VPA0145"
     CDS             140590..141072
                     /locus_tag="VP_RS15980"
                     /old_locus_tag="VPA0145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005453241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L,D-transpeptidase family protein"
                     /protein_id="WP_005479613.1"
                     /translation="MSIKWCALILCGLVTFSTHAAVDLVKVDKSKRRMYLIEDGIILK
                     EYRIALGASPKGHKQEEGDNRTPEGSYTLDYVIEDSAFYRSVHISYPDAIDTLEAHRR
                     GVSPGGNIKIHGLKNGETQDPSFIQSFDWTNGCIALTNEEMDEFIQLVTMGTPITIEW
                     "
     gene            complement(141103..141813)
                     /locus_tag="VP_RS15985"
                     /old_locus_tag="VPA0146"
     CDS             complement(141103..141813)
                     /locus_tag="VP_RS15985"
                     /old_locus_tag="VPA0146"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005459332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="WP_005459332.1"
                     /translation="METLLIGHRGVAGSFPENTKVSVQAAIDLGLKWVEVDVQPTKDN
                     VLVVCHDHTLSRCSNGKGRVDAHTLEELRQLDFGGWFSEDFAGETIMTLEELLSLATE
                     RGLNLNIEVKVDRHPADEVAQTLAKVLTESSMPRENLLLSSFSHDVIRALYQHCEGYR
                     LGVLSEFFTKKDGLLLDEVKAYSCNLNINWVRSRQIIKLQEAGYKVMCYTVNNPNKLK
                     HLPQLDGIFSDHPKRFMQ"
     gene            142071..143024
                     /locus_tag="VP_RS15990"
                     /old_locus_tag="VPA0147"
     CDS             142071..143024
                     /locus_tag="VP_RS15990"
                     /old_locus_tag="VPA0147"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005453245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="WP_005479617.1"
                     /translation="MKIGVIGAGAVGVGVCNYLLTLGSVSELVLLDQNLERAEGEVFD
                     FRHTAALTFSKNTRIIPSDDYLDLLGADIVVITAGAQIQQGQTRLDIAEINAKIGVEI
                     ARKIERVAPKAVLIVVSNPCDIVAHFITTNTGFEPNKVISSGCVIDTARLMSIVANRV
                     DLDPKNIFGYVLGEHGSHCFTPKSLISIAGQPADYYCDTHNIERIDADELLEAVKQAG
                     YEIFRRKHNTVHGIAASVFRIIQAIKINERSVLPVGTMMSGQYGVSGVVLSLPTVVGK
                     KGAESVLTHPFTEEELETLHSISMNLRSIVENVAQSTGLKC"
     gene            143183..143848
                     /locus_tag="VP_RS15995"
                     /old_locus_tag="VPA0148"
     CDS             143183..143848
                     /locus_tag="VP_RS15995"
                     /old_locus_tag="VPA0148"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005432642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_005459337.1"
                     /translation="MSRVLIVDDDVPLCELLEVVLQDEGYTVSSVHCGESALQYMEKT
                     PVDLVLLDVMLPNLNGMQVARRICQRFATPILMLTALNDENSMLDGYQAGADQYIGKP
                     FNVAELLMRIKAILRRVGLERQRQTICNTAQSISDQLTSLPLTSTEAELLSHLVKNQG
                     VVISKAELQTEVLKKELSPFDRNLDMHISNIRRKLVEAGLSKQHIKTFRGKGYSYLES
                     VGA"
     gene            143848..145221
                     /locus_tag="VP_RS16000"
                     /old_locus_tag="VPA0149"
     CDS             143848..145221
                     /locus_tag="VP_RS16000"
                     /old_locus_tag="VPA0149"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017188518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_005459362.1"
                     /translation="MKLVCPSYIAKRKDSLAFKLFSYMTAIVISILLVQALAEQALVK
                     AMLKVPNSVKMEMLDLAHQANVLIEHGDMDELADWANAQQFYLFVLNEQLQPVTHRLM
                     HPHFEFKLQFKRSIDDQLEDKVNRPIISIPLVQQHNLVIQLPHRLHPANDFILYFSII
                     KVVIAAVILALFSLLMARNLQQPLDRLREASKKLSNGDFNVSVVQELKSNTREFNELA
                     QDFDHMTKEIHSLAEKQRLLIRDVSHELRTPLARQNLVLHLLRKRVGESEQELVTRLE
                     DEAKELNHLISDILEFSRLENARYDKETKRSDLEVLLAPQVERCKIDLRESQSIVFIS
                     RVTEPRAYCEDTLVVRCLNNLVGNAIKYAGEDARIEVTLTNQEINGQAYLVMSVSDDG
                     PGIPENKLSDIFNPFTRLDASRDKKLGGYGLGLAIVKESMRMMGGSVNAENRSQGGLT
                     VSLVFRQ"
     gene            145430..147523
                     /gene="peuA"
                     /locus_tag="VP_RS16005"
                     /old_locus_tag="VPA0150"
     CDS             145430..147523
                     /gene="peuA"
                     /locus_tag="VP_RS16005"
                     /old_locus_tag="VPA0150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore enterobactin receptor
                     PeuA"
                     /protein_id="WP_005479624.1"
                     /translation="MFTKSHLALVIGAVLAAPAVANVQTDEHLVVEGREFGYKADTNS
                     TAMRMEMTQLETPGQVAVIDETVIDEQRASTLGEVLRNDASVSAGGTSRNRERFSLRG
                     FELSSSDGFLRDGRQHWSHYRQPIELLERVEVLKGPSGLLYGKSEPGGLVNMVSKKPT
                     TQTQVSLSQDIGSNEHSRTVLDVSGSLNDAETLRARAIFAKENYSSWRTYGDGTKPQT
                     DRVVGGLVVEYDITENIMVSAHYDRTKDEGSVDSGAYIVDGKPVRGDKYIWDAQWSKI
                     DNDVENYGIDINAQVTDNVNVKAGYNRQDFKRFDVESYPKFDNYDKDGVIRHKGNERT
                     DNWVFDTAYLDVTTNFSLLGTENTFLVGANYLDYKYDRFMASHAGEDVAAGTTVTRPG
                     TVRSKKYPRREHDTWGIYAQNMMTINDYWQVLAGARYDEKREDSLTENQVSPKLGVIF
                     HPTSNGSIYVQYSESFMPQGEVSNGSRIYINDGEKLDAERGISYEIGTKWELFDQRLF
                     VSGAVFDITLENISLDVESGKDASNQLLHKKTQGGEQVHKGAELMAQGFVTPELSLTA
                     SAMYLDAELKKAERFEGNRPADVPEFSASLWSSYRVQDNTNLNLGLIYEGDRYGDAAN
                     TFKKDGYARIDMGVSYKHKYDENLDIIARFNVENLFDTDYLAGGGSTNGNQEGASGVV
                     VGEGRNYMATIQFKY"
     gene            147598..148365
                     /locus_tag="VP_RS16010"
                     /old_locus_tag="VPA0151"
     CDS             147598..148365
                     /locus_tag="VP_RS16010"
                     /old_locus_tag="VPA0151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009843857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3450 domain-containing protein"
                     /protein_id="WP_029797603.1"
                     /translation="MNLMKSSIALLISSVLIPAHAANLNDAQAVQSKTNQASAVSQKR
                     IDASAEKSLTLEAEIEQLQEEVSNLKIYRDHLSSLVESQHQEVNSLNEQIEQIAQTRQ
                     GVVPLMYHMLEGLKRIVASDKPIRKAQREERIAKLDDLMTRADVADAEKFRRILEAYQ
                     IEMDYGTKLGIYQGKINLDANEKVEADVLYLGRVSLVARSLSGDKFWSWSQQQQAWQP
                     VGSEQKTELDKAFAMANKQIAPSMLTLPVSLTVAEGK"
     gene            148366..149733
                     /locus_tag="VP_RS16015"
                     /old_locus_tag="VPA0152"
     CDS             148366..149733
                     /locus_tag="VP_RS16015"
                     /old_locus_tag="VPA0152"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012130142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MotA/TolQ/ExbB proton channel family protein"
                     /protein_id="WP_005459330.1"
                     /translation="MIKKWLSVALISTAAMMPHTTFASDTLLQKAQQENRQQQTHNAS
                     RESGFKKTEQELQAIKNKLVAERAALQAEADTLSVTFSENEAELAQLEEKLRLETGSL
                     GELFGVVRQNAKELESELKHAVTGVDANSYQKDIEAIVAAKSLPTLKQLQAMWRSMEE
                     QVTASGELAKVSFTLLDGEGKEQTVNGVRLGAMALLDDNGYVKWNGQRGDAVNYLRQP
                     ENGPTASAFTNGELDSLVIDPSRGILLEQLANSPTLKDRLNAGGVVGQIILVLLAIGL
                     IIALVRGVSLFIARQKIAKQLKNPTKAEDNPLGRVLSVYQNDKHRSVEALELRLLEAV
                     VDEQTHLEKGLSMLKLLAALAPMLGLLGTVTGMIETFQVITQFGNGDPKVMAGGISMA
                     LVTTVLGLVAAMPLLLAHNVLSSQAESIRNILEKQGIGLVAEQAERDMSNNKGNRNTI
                     AENAA"
     gene            149733..150287
                     /locus_tag="VP_RS16020"
                     /old_locus_tag="VPA0153"
     CDS             149733..150287
                     /locus_tag="VP_RS16020"
                     /old_locus_tag="VPA0153"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006741219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MotA/TolQ/ExbB proton channel family protein"
                     /protein_id="WP_005479627.1"
                     /translation="MEQILLNTLGLISEDWANTLMSFMQQGGQILWWLAAVVAVCWLL
                     VMERVVYLTTVFPKVNKELREQWLARSEHHSWYAHQIRDGWIAKAQIELRQNLSTIKL
                     LVAICPMLGLLGTVTGMITVFDVMASQGSSDPKLMASGISLATLPTMAGMVAALAGMF
                     VHARLSKVCERKAIQLEQSLRSQK"
     gene            150284..150688
                     /locus_tag="VP_RS16025"
                     /old_locus_tag="VPA0154"
     CDS             150284..150688
                     /locus_tag="VP_RS16025"
                     /old_locus_tag="VPA0154"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010453291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="WP_005459364.1"
                     /translation="MRLGRRPNQQDEAQVDLTSMLDIVFIMLIFFIVTSSFVRESGVE
                     VNRPQASNVVSQKDAGIFIAITAANDVYIDKRLVDLERVEASIEHLLLDQPDASLVIQ
                     ADEHAYNGTVVKVMDAAKGAGVKNIALAAEKP"
     gene            150688..151308
                     /locus_tag="VP_RS16030"
                     /old_locus_tag="VPA0155"
     CDS             150688..151308
                     /locus_tag="VP_RS16030"
                     /old_locus_tag="VPA0155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005453264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy transducer TonB"
                     /protein_id="WP_005484262.1"
                     /translation="MGRLLIALPASLLIAVSLFSFMAWMVDNGNQRAPKPSEAVRFDM
                     VMVENDADVQRRQRSVPEQPEPPQAPEPMELSQANTQVEPMSQVTPISALGLNTALDG
                     IAINAPNLKGTMGNQQALPLYKVEPRYPSKALKRKVEGYVIMRFTIDTTGRPKDIEVI
                     DAEPKRMFEKEAISALKKWKYQPKVENGVSIEQFGQTAKVEFKLGK"
     gene            151305..152477
                     /locus_tag="VP_RS16035"
                     /old_locus_tag="VPA0156"
     CDS             151305..152477
                     /locus_tag="VP_RS16035"
                     /old_locus_tag="VPA0156"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005438295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="WP_005479628.1"
                     /translation="MMKKFLITTLLSLTAASAIAQELSQYTASRVQRAHSLAQEEKLK
                     EAISTLESLDLSRGYDQAFVARMLGIFYWQNEQVKPAIKQLDFAVSSGLLQDEQAWQT
                     RKMLADILLNEQQFAKALPHYYELSKAVPKNQKAHEVWLRIAQSHYQLSQWNKVLSAM
                     GRYEKFGQPDELGPLSIKLSSELELKKWQPAIVTIKRLIAIEPERVEWWRQLVALHLR
                     VDDSKRALDAMALAKLQGVALSQDDFKLLAQLYAKRGIPERAALIMEQLEDLNVDSQL
                     KAQQATYWQMAKEWDKSIDSWRIAAKLDSKYYWNYSQLLVQQGHYQQALAALDKVKGR
                     NADVALIKTRAYYKLNRLDDALANAKRANEIKPSNQAKSWVKYLTQRRKAEATQSS"
     gene            152664..153293
                     /locus_tag="VP_RS16040"
                     /old_locus_tag="VPA0157"
     CDS             152664..153293
                     /locus_tag="VP_RS16040"
                     /old_locus_tag="VPA0157"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017079282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PepSY domain-containing protein"
                     /protein_id="WP_005479632.1"
                     /translation="MLLKSKGVQTWARRLHIYISMALLLVTLFFALTGITLNRPELFE
                     RKEPIIQQHTIIIPPQTLFLNGESFQPNRVALIDFLTQEVALRGTPSALDVYTEVEQG
                     ELVLGELSLDFKGPGYNATVFVDMTTGDADIETTNYGAIALLNDLHKGRNSGDVWKWF
                     IDITALLMVFFVLTGVCLLLPKKKTFRTSLQWMSFGSLLSLVIYFVAVP"
     gene            153317..153856
                     /locus_tag="VP_RS16045"
                     /old_locus_tag="VPA0158"
     CDS             153317..153856
                     /locus_tag="VP_RS16045"
                     /old_locus_tag="VPA0158"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2271 domain-containing protein"
                     /protein_id="WP_005479631.1"
                     /translation="MLNTGKLLRQNLFCKAALVAALAPWPVLAAPLPDAAKIDFEFEL
                     PKIDTSMYARPYVAVWVEDEQRQSVKTIQLWVGKDEWLKDMRSWWRKVGRYDRDLIDA
                     VTSATRPAGQYRFVWDGTNDAGERLEQGDYTLHVEVVREHGGRNYLRQKMTLADSEVR
                     YQLKPTQETGVITVNYQVK"
     gene            153872..154702
                     /locus_tag="VP_RS16050"
                     /old_locus_tag="VPA0159"
     CDS             153872..154702
                     /locus_tag="VP_RS16050"
                     /old_locus_tag="VPA0159"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005393550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4198 domain-containing protein"
                     /protein_id="WP_005479623.1"
                     /translation="MKTKMKAVALASVMAIGLAAATTAQAHPRWVLPSHFTVSKEGGD
                     WLTFDVTASHGTFVFDKPAGSEQAFVIMPDGRSERPNFVIRGKRRSMFDFFFVEEGTH
                     KVAINNEPSYYTQYKAGRRDTVKWVRANKAERADVLPEKTRDVVTQLSYTRAESYITV
                     GKPTEKALEIESKLLELKPLTHPSDIIEGEAVTFQFFFDGKPQQGVTAEITREGTLYR
                     NHQEQIDVVSDKDGKITFTPDVAGRYLMKANYKGELNNHPLADKASANVHLTFETLLN
                     "
     gene            154745..155065
                     /locus_tag="VP_RS16055"
                     /old_locus_tag="VPA0160"
     CDS             154745..155065
                     /locus_tag="VP_RS16055"
                     /old_locus_tag="VPA0160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005453276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479615.1"
                     /translation="MNNTSILKAALLLAGFSSFHASAHFPLMSCHLSQDKVICETGYS
                     DGSTAIDYDVEMYDYEDNLIAKVRTDKRSIAEFSHPETDFYLVFDAGHESPVEVDVVE
                     LKEK"
     gene            155062..155616
                     /locus_tag="VP_RS16060"
                     /old_locus_tag="VPA0161"
     CDS             155062..155616
                     /locus_tag="VP_RS16060"
                     /old_locus_tag="VPA0161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479626.1"
                     /translation="MITQKVRPDNGSREGKWVALTIAGILACASVLMPLHQVDSPHSE
                     VLSHQIRITDLHQEELGLIAELKLAHEELRDLHAEFGTWPDTEEMASLWIAPFVQDQN
                     WKRKGSHQWQSIGDGIYLGIRQSEQGAASMILDSRQSHADIWLIDAHGFAPTPTLSEE
                     SHRHQQGWQQLILSSPSSAYPSHT"
     gene            155639..156565
                     /locus_tag="VP_RS16065"
                     /old_locus_tag="VPA0162"
     CDS             155639..156565
                     /locus_tag="VP_RS16065"
                     /old_locus_tag="VPA0162"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005530219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter substrate-binding protein"
                     /protein_id="WP_005459333.1"
                     /translation="MITRSLLRSMFASCALLVASTSSFASDKMKIGITLQPYFSYVHA
                     VVGDKAEILPLVDAGFNPHNYLPQPNDLKRLNEMDVIVVNGIGHDDFALKVINASQRD
                     DLVVIEANKEVPLLPAMGQSVGQGAVNPHTFVGLSTTIQKVYTIASELSKLDPDNADF
                     YRKNARQYAKTFRMMKRDAMLSLGELDTAGMKVATTHNAYGYILQEFGVDVAAVIEPA
                     HGVEPSASQLQETIEKIKRSGIDVLFYELNMPNRFVDTIEEATGVKLYRFSHMTHGEY
                     EANKVEVEMRENVETLIEAMKFVASKHAQEKA"
     gene            156565..157299
                     /locus_tag="VP_RS16070"
                     /old_locus_tag="VPA0163"
     CDS             156565..157299
                     /locus_tag="VP_RS16070"
                     /old_locus_tag="VPA0163"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009696849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter ATP-binding protein"
                     /protein_id="WP_005459358.1"
                     /translation="MLGPSISIDNLSLQYGDNVILQNVTTTFEPGKCHVIMGPNGGGK
                     TSLLRSVLGLTPFTGDISVHWPNKTHNKLGGNVGYVPQKAMFEASLPLTVMDFVLLNQ
                     TRIPLFWRRKTKQTQRALVQLDRVGMAARSDRRMGQLSGGEQQRVLFAQALLDDPSLL
                     VLDEPTTGMDEQGVRYLEGLIHEVVAQGKTVLAVHHDVTAVRRLDAEVHVVNRQIVAS
                     GHHSDVLSPDRIETLFKHYTTKVEAA"
     gene            157299..158174
                     /locus_tag="VP_RS16075"
                     /old_locus_tag="VPA0164"
     CDS             157299..158174
                     /locus_tag="VP_RS16075"
                     /old_locus_tag="VPA0164"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010646291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter permease"
                     /protein_id="WP_005479618.1"
                     /translation="MEWLRALAVSGVDAGWLSDSFAYAFMVNAMVAALILGPLLGGLG
                     TLVIAKRLAFFSEAVGHAALTGIAIGVLLGEPPENPIIGLFSFCMIFALLLHFVRNRT
                     NVPYDTLVGVFLALALAVGAALLMYVARKINIHMLENVLFGSILTVTDRDITLLAVSC
                     LIILLLLIPTFNRILLTCISPDIARVRGFNTSFYDYLFVMMITLVTIAAVKIIGAVLV
                     GALLLIPGATARLLTKRMGSFVLLSSLLATVACLVGTILPMELDLPVPSGASIIIVSA
                     AFFLTATVYRIIRKA"
     gene            158210..159079
                     /locus_tag="VP_RS16080"
                     /old_locus_tag="VPA0165"
     CDS             158210..159079
                     /locus_tag="VP_RS16080"
                     /old_locus_tag="VPA0165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017817369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_005459366.1"
                     /translation="MKMKTLTLGLGLMAMSTLSSLAMAKDILTSTPVTYMLSEQLMKG
                     TGVETTYLPPKRYGIERMANWFATKGANQVSEAGKSATVAITMRAIWDQDPTYVYARQ
                     GNIRLIEIDASQAISPRAQGVAALKLEDGATSKYVWLNPSNLIRMTAIVGDDLQKLYP
                     QFQEQIQSNQQALMLSVRELINQQQAVIFEKEIDSIVLMSESLEDFASGNQLFVVKRQ
                     FKPELEWSEKDKLSLKAQFEQDKTLWLVTDKKPSKILTSLVSPDRILQIDNIDRWGSK
                     GIKTEKPLARWKM"
     gene            159295..160344
                     /locus_tag="VP_RS16085"
                     /old_locus_tag="VPA0166"
     CDS             159295..160344
                     /locus_tag="VP_RS16085"
                     /old_locus_tag="VPA0166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005453282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_005459338.1"
                     /translation="MKMKTLAVAVAALACGSQAFAAEVYNSDGTSLSIGGHVSVGVGE
                     YFEDEVKVHQVSPRINVAGKKDIGNGVTVDAKGEWALNYLKGGEQSFSTRLGYIGATH
                     EQLGRVVAGTQWAPYYDVAGVADLPIAFANDFLYDNHNNLGTGRAEKMISYRKSFQFG
                     EGFAFNLGLGWQGENDDTGLSLVQNPSTGLPEYVSKGNKYDQRGQIALSGSVAGFGIG
                     YVYSGGDVEISSLGTKSAESHLFSVNYGEYGSGLYAAVVYGMNDYFYEMREETSQLEG
                     LLAYGVNNWTFSVNYEGVEDDKDNKTVKSETALQAEYSVTPSFVTFVGYQFDLGNDYN
                     NEENDYWTLGARYYF"
     gene            complement(160553..162718)
                     /locus_tag="VP_RS16090"
                     /old_locus_tag="VPA0167"
     CDS             complement(160553..162718)
                     /locus_tag="VP_RS16090"
                     /old_locus_tag="VPA0167"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017080938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase B"
                     /protein_id="WP_005459357.1"
                     /translation="MRFTLTTLAVSVALIAGCSNQGTPTMTQYSQSQIVAQQTQAPVA
                     KKIPHAMTIHGDTRVDNYYWMRDDERKDPEILQHLEQENQYAETVLKHTEALQNELFE
                     EIKGRIAKDDNSVPVRKGNYFYSSEVTGDNEYEVHLRAKDFAGKDKQVILDVNELAKE
                     HEFFSIGGLYVSPNENLLAYGEDTLSRRVYTIKIKDLTTGNYLQDEIEGASSAVAWQN
                     DNNAFYYIKKDPQTLLGYQVYRHVLGTPQSSDELIFEETDSAYYTSLSKSKDGDEVYI
                     WHSSTETSGVSIIDANNPKAKAEPFYPREDGIEYSISKLDNWYYIYTNYQAVNFRLMK
                     VKQEEMHDRSKWQDVIAADDNTQLVDFELFDDHLVYEQRSNGLASVTVRQLSTGKEFP
                     LTFNDDAFAAYLTGNFELDNKKVRIYYSSLTTPGTYYDFDLKTGKSEIMKQTPVLGDF
                     DADNYQSERIMIKARDGKEVPVSLVYRKDLFKKDGTNPLYQYGYGSYGATIEPTFGSA
                     RLSLLDRGFVFAIAHIRGSEMLGRPWYEDGKKLTKQNTFNDFIDVTKGLVEQGYGAKD
                     KVFAVGGSAGGLLMGAIINQAPELYRGIGAHVPFVDVVTTMLDESIPLTTNEYDEWGN
                     PNNKTYYDYMLSYSPYDNVKAQNYPNMLVTTGLHDSQVQYFEPMKWVAKLREMKTDDN
                     ILLFKTDMEAGHGGASGRFKRLKEDALEYAFFLDLLNKK"
     gene            complement(163045..164250)
                     /gene="emrD"
                     /locus_tag="VP_RS16095"
                     /old_locus_tag="VPA0168"
     CDS             complement(163045..164250)
                     /gene="emrD"
                     /locus_tag="VP_RS16095"
                     /old_locus_tag="VPA0168"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux MFS transporter EmrD"
                     /protein_id="WP_005459347.1"
                     /translation="MSASFPLAKLTFLIAILTAVGQMTQTMYVPSIGHMAGEFLVSAS
                     SLQAVMACYLIPYGLSQFAYGTLSDRLGRKPIIIVGLLIYILGTLVALFAHQFEWFLA
                     GSFIQGLGIGCGGAMSRTLTRDCFEGAELHRANSLISMCVIFSPLMAPVLGGYLTEAF
                     GWRSSYLFLALFGIAVVITMMTSMMETLPKEKRKFEPVAKSYKHVLSDRRFQGFLICL
                     VATFAGVGVFEAAAGVLLGGVLALPATTVSLLFILPIPGYLVGAGLSSYIAQRRSERR
                     ALNVGLVSIFIGSAVVLIPGLFGVTTALTLIGGATIYFLGAGILFPAATTGAIAPFPY
                     HAGTAGATLGGMQNLGAGIATLLASLFPAHNQMPLGVLMMAMSIVAMLGLLWVHRAHD
                     HSNEMPQVI"
     gene            complement(164662..165582)
                     /gene="speB"
                     /locus_tag="VP_RS16100"
                     /old_locus_tag="VPA0169"
     CDS             complement(164662..165582)
                     /gene="speB"
                     /locus_tag="VP_RS16100"
                     /old_locus_tag="VPA0169"
                     /EC_number="3.5.3.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005593388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatinase"
                     /protein_id="WP_005393578.1"
                     /translation="MNDLFTKTDYSLYSNSMSFLRLPYIRNPVSADADVVVLGVPLDM
                     ATSGRPGARMGPDAIRRASVNLAWEGKKFPWDFNVLDKLKVIDAGDLVFDCGDAEDFT
                     YRLEAATSEILKSGKTMLGLGGDHFITLPILRAYAKHHGQMALIHFDAHTDTYANGSS
                     YDHGTMFYHAPKEGLISAKNSVQIGIRTEYKQQDHGFNVINAMQANDMSVNEILEEIR
                     RTVADKPVYVTFDIDCLDPAFAPGTGTPVCGGLNSDKALKIIRGLAGMNIVGMDVVEV
                     SPPYDHSDVTALAGATIALEMLYAYASGRE"
     gene            complement(165584..167494)
                     /gene="speA"
                     /locus_tag="VP_RS16105"
                     /old_locus_tag="VPA0170"
     CDS             complement(165584..167494)
                     /gene="speA"
                     /locus_tag="VP_RS16105"
                     /old_locus_tag="VPA0170"
                     /EC_number="4.1.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004412721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine decarboxylase"
                     /protein_id="WP_021451067.1"
                     /translation="MEKATKLDRIRADYNVHYWSQGFYGIDDQGEVYVSPRSDRAHQI
                     PFSAIVNELEAQQLNLPVLVRFPQIVHQRVHGICHAFNQAIEEYQYPNKYLLVYPIKV
                     NQQREVVDEILASQAQLETKQLGLEAGSKPELLAVLALAQQGSSVIVCNGYKDREYVR
                     LALIGEKLGHKVFIVLEKLSELDLVLEEAKSLGVKPRLGLRIRLASQGAGKWQASGGE
                     KSKFGLSASQVLSVIERLKREGSLDAMQLVHFHLGSQMANIRDVRNGVNESARFYCEL
                     RALGANIEYFDVGGGLAVDYDGTRSQSSNSMNYGLAEYARNIVNTVGDVCQQYEQPMP
                     VIISESGRSLTAHHAVLISNVIGTETYQPEEVHELGVDAPLLLQNMWRNWENLQDGTD
                     ARALIEIYNDTQSDLAEVHSQFATGVLNLEQRAWAEQLSLRIYFELSRKMSTKNRFHR
                     PILDELSERLADKFFVNFSLFQSLPDAWGIDQVFPVLPLSGLGDAEERRAVMLDITCD
                     SDGAIDHYVDGQGIESTLPVPAWSKDKPYLMGFFLVGAYQEILGDMHNLFGDTHSAVV
                     NVDEHGQFEISYINEGDSVEDMMRYVHIDVDAIRDNYKQLVSQRVEANEQAQILAELE
                     QGLAGYTYLEDF"
     gene            167818..168543
                     /locus_tag="VP_RS16110"
                     /old_locus_tag="VPA0171"
     CDS             167818..168543
                     /locus_tag="VP_RS16110"
                     /old_locus_tag="VPA0171"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010646304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_021451066.1"
                     /translation="MYLAEYPDKLLLLDGASRADISHLKDFIEHQLHRPFSDLKLVVV
                     THMHPDHAGGAHKLRDLTGCKVLAAKRESQWYDGVDGWLMHLTDLMLARWMANRMRKP
                     KRNLWYSRKLKPDIELIDGECIPGFDDWQVLETQGHTDRDLSVYHSEQDVLYVADLMV
                     QVKKHLIAPFPIFHPNQYRQSLKRVFEMNPQCLLLAHGGEVTFDEKAYQHILHTAPTK
                     PMTHWRVTKVKARGLLFALFRRK"
     gene            complement(168610..169038)
                     /locus_tag="VP_RS16115"
                     /old_locus_tag="VPA0172"
     CDS             complement(168610..169038)
                     /locus_tag="VP_RS16115"
                     /old_locus_tag="VPA0172"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011081764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent zinc protease"
                     /protein_id="WP_005459284.1"
                     /translation="MNQKMIIGNAEAICLPELGITHLEARIDTGAQTSSLHVDNIDCF
                     EKDGQSYVAFDLHPDVYHLEQVVRCTAKLKANRKVKSSNGTFEHRCVITTMLRLGDQE
                     WPIDITLTNREKMTYMMLLGRQGMADKVLVDPSQSHLLAS"
     gene            complement(169104..170009)
                     /gene="rimK"
                     /locus_tag="VP_RS16120"
                     /old_locus_tag="VPA0173"
     CDS             complement(169104..170009)
                     /gene="rimK"
                     /locus_tag="VP_RS16120"
                     /old_locus_tag="VPA0173"
                     /EC_number="6.3.2.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005453290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6--L-glutamate ligase"
                     /protein_id="WP_005459235.1"
                     /translation="MRIAILSRNENLYSTMRLKQAGEERGHQIDVIDTLHCYMDITSN
                     NPMIRYKGEELPQYDAVIPRIGASITFYGTAVVRQFEMMGTFCVNESVAISRSRDKLR
                     SLQLLSRKGIGLPRTGFAHHPDNIQDVIKNVGGAPLVIKLLEGTQGIGVVLAETNKAA
                     ESVIEAFMGLKANIMVQEFIEEAKGADIRCFVVGNKVIAAMKRQAKEGEFRSNLHRGG
                     SAQLVRLSKEERATAVNAAKVMGLNLCGVDILQSKNGPVVMEVNSSPGLEGIELATGK
                     DVAGMIFDFIEKNAKPNSNRTRGKG"
     gene            complement(170468..171358)
                     /locus_tag="VP_RS16125"
                     /old_locus_tag="VPA0175"
     CDS             complement(170468..171358)
                     /locus_tag="VP_RS16125"
                     /old_locus_tag="VPA0175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005459241.1"
                     /translation="MLNPVWLHTFKTLVEVGHFTQTAEKLYMTQPGVSQHIKKLEQSC
                     QHALIKRENKSFELTEQGRMVYAYALELEEREKSLLEELSFDDAYSGHCKLACSGALA
                     LMLYGPLLEQQTQHPSLSIHLEAAPNQSILNGISEGRIDIGIVTDAPNKSHFQSERIG
                     REALCLILPHAYKAEPLTPEILQKCGVIGHPDAEHYMTLFFDQCAEPQLKEIKMSDMP
                     LSGFVNQLSQILLPVSKGLGFTVLPQSAVESFPNREELHVAQLKQTVYEDLYLVKKRG
                     RTLPLRYTTIKEVLSSIIGK"
     gene            complement(171895..172140)
                     /locus_tag="VP_RS16130"
                     /old_locus_tag="VPA0176"
     CDS             complement(171895..172140)
                     /locus_tag="VP_RS16130"
                     /old_locus_tag="VPA0176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009705115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005459280.1"
                     /translation="MSHFTIKLRQILHKTRDEWAKFAIREMEIPPNTIAKFYGYKSSC
                     DLEQILKQDKNDANSDICSTPCARSLTSDVSKTTIFD"
     gene            172309..173175
                     /locus_tag="VP_RS16135"
                     /old_locus_tag="VPA0177"
     CDS             172309..173175
                     /locus_tag="VP_RS16135"
                     /old_locus_tag="VPA0177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_005459287.1"
                     /translation="MAHIEKVPQRPGFSWRYRRIDEVEKEYDLHFHDDVFELVIHRHF
                     TGSLHIGHHELEVTHNQMLLIAPGVPHSIHSTLVESKCETHVIWFKREWIANLMFYCA
                     ELRKLDPLLKAANKGVVFSERTAQHVVDLLHELMTFPAMEQLSRFLHVLSLIAHDEGA
                     KTLMTHSYLSMSEHELQERERVASVNAYLEQHFATKVTLADLANYLSLSESAVTRLFQ
                     KHFKEPFSQRLMKLRINHAADLLQSTSLPIGIVFERVGYRNQALFNRHFKTYKGLTPR
                     DYRQHYQQRIQP"
     gene            complement(173790..174128)
                     /locus_tag="VP_RS16140"
                     /old_locus_tag="VPA0178"
     CDS             complement(173790..174128)
                     /locus_tag="VP_RS16140"
                     /old_locus_tag="VPA0178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020334643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YggL family protein"
                     /protein_id="WP_005459294.1"
                     /translation="MKLDKIDNKNRRIRKKLFLGEFAILGFEISCETDINDFDRYDAF
                     VDDFIDYIDTLGLCFGGGGLELFEGFLCSTERYGSATEEQKAQVVAWLEARPEVKSAK
                     AGDLLDANYL"
     gene            174486..176522
                     /locus_tag="VP_RS16145"
                     /old_locus_tag="VPA0179"
     CDS             174486..176522
                     /locus_tag="VP_RS16145"
                     /old_locus_tag="VPA0179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005393601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoX family phosphatase"
                     /protein_id="WP_005479992.1"
                     /translation="MSKETFDATRYNQSDNKPFEEVLEASLSRRSILKGGLGISAMTA
                     FGAFGLAGCNSSSSGTSASNGSGVSKAVLNFDSIPGSLTDAVSIPQGYTAQVLVPWGT
                     PLNAQGSAWKNDGSNTSSDQLNALGMHHDGMHFFPLNDSTTDGLLCINHEYIDTSALH
                     PNGPTVANGVRTIVDEVRKEINAHGVSVVRIQLEDNMWKLADTDPLNRRYTGATVMDL
                     SGPVAHTALTVTRFSPDGSQARGTLNNCGNGYTPWGTYLTCEENWPGYFVNAGTRTEE
                     QDRIGVDDKSTRYLWETLAGNSEERLDEFTRFNVAPTGTSSADDYRNEANGHGYIVEI
                     DPYTQNSRAKKRTALGRFRHEGCAFGKLEAGKPVVFYSGHDSRFEYLYKFESAAAWDP
                     ADANPANRLATGDKYMDEGTLYVARFNEDSTGTWLPLTLDSVTTSGGTLADHFNSLAE
                     IIINTAGAADLVGATPMDRPEWCSVDPFTGSVYLTLTNNTRRTDETNPANPRLNNKFG
                     HVIRWDEGTSATDFTWDIFVFGSPANGDADTNRSGLNELNQFASPDGLAFDGRGILWI
                     QTDNGADEVTSYTNDQMLAVVPSKLTNENGAQAVIGADNQAELKRFFVGPNGCEVTGF
                     TISPDYKSLFVNIQHPGNWPYSDDAAQETPAGTTVRPRAATVVIRREDGGEIAV"
     gene            complement(176615..178006)
                     /gene="ascB"
                     /locus_tag="VP_RS16150"
                     /old_locus_tag="VPA0180"
     CDS             complement(176615..178006)
                     /gene="ascB"
                     /locus_tag="VP_RS16150"
                     /old_locus_tag="VPA0180"
                     /EC_number="3.2.1.86"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000643228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-glucosidase"
                     /protein_id="WP_005459314.1"
                     /translation="MIEFPDNFLWGGAIAANQVEGAYNLGGKGLSTSDMLPNGILSPH
                     QTREERTPGIKDLAIDFYNRYPEDITLFKEMGFTCLRLSIAWSRIFPNGDELEPNEEG
                     LAFYDKIFDELAKHDMQPFVTLSHYEMPYALVENYGGWGDRRVIEFFERYAKTVLERY
                     KDKVKLWLTFNEINMSLHAPFTGVGLPEDATEQQIYQAIHHQLVANAKAVKLCQEIVP
                     NGKIGNMLLGAMNYPYTCNPDDVLAAMHENNKWLFFGDVQTRGQYPGYMKRYFRENGI
                     EIQMQDGDLEDIASASVDFISFSYYASGCASADPKQKEVGNIVESVPNPYLEKSQWGW
                     LIDPKGLRILLNFLHDRYQKPLFIVENGLGARDEFDENGEIQDDYRIAYLNDHLVQAH
                     EAILDGVELMGFTSWGPIDLVANSTAEMSKRYGYIYVDRHDDGQGTLERKRKKSFYWY
                     QDVIRTAGGSLKR"
     gene            complement(178240..180312)
                     /locus_tag="VP_RS16155"
                     /old_locus_tag="VPA0182"
     CDS             complement(178240..180312)
                     /locus_tag="VP_RS16155"
                     /old_locus_tag="VPA0182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_005459312.1"
                     /translation="MTLSGKGKTWLLVIFANAMMLFSYSASREIAHQLLSAQTQTEAQ
                     QKLLNYIGEVRRALKRFYHLPYLVTNNPETIAFVKGNLTYYEPLQAQLTQLDKAANTE
                     GWLILSTSGEVLVSSLIDERFSRSDRRAIVEQIHRQGEGVSLVNKTKGSSPLYYLSAP
                     IFDGLNIAGIVVVQINLSLLTEQTITSQDIITLQNRHQRFFLSSSTTYNADWFNEPNH
                     AVDEETQKLYDNTVIHFWTLDQQRYFAHTVKLDDLNWYVSYLIPTKPVQQAINVIGWS
                     VAALLLLIILLVIIGLQRHQKNQNQQRIQALLEESQRRLKQMINKTHVGLLLINEQGQ
                     LFDLNPMAKRLFCLPENVNRQTFAWELFDAGNPNSTTLTLLRDLPKHKELAEISAVET
                     MARRSDGSVFPVLFSLTTFPWHGELYFLATLIDISKRKKAEQSLQLINQELAQRVEER
                     TQALRQAQEQLIESSKMAALGRMSSAITHELNQPLTGLRTLLTTNELLAERGETAMMK
                     ANNVLVQKLIDRMASMTSQLKTFAYNKPEKLQALSLTSALEETLRVYQSQLANVDVRV
                     RIPSDLPQIQGEEQRLQQVLGNLISNALDAMQSRDNPQLSIVVTPTNSHVEVVVSDNG
                     CGVALEQLDTIFEPFQTSKKIGEGLGLGLSITANNMRDMNGQVTAKRNPGSGMSFLLR
                     FQLANTID"
     gene            180581..181936
                     /locus_tag="VP_RS16160"
                     /old_locus_tag="VPA0183"
     CDS             180581..181936
                     /locus_tag="VP_RS16160"
                     /old_locus_tag="VPA0183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_005459318.1"
                     /translation="MAFESTPNIALIEDDDIVRQATSQWLQLAGFNVEAFSTGDAGKA
                     AILSQYFDAVVSDVRLPDSDGLSILESLIDHHIQAPVILITGHGDVDMAVSALQKGAF
                     DFIEKPFQPERLSQRVTEAVETYRAQTSTQDRQEYLASVSGLEQVLIGRSRVMQQLRE
                     QVAKLARIDTNVIIYGETGCGKELVATSLHKESQRKLHRFVPINCGAIPENLFESELF
                     GHEPGAFTGASKRRIGKLEYADKGTLFFDEIESMPLSMQVKVLRSLQEHTVERVGGNQ
                     QINVDLRVIAAAKEDLNDHEEFRQDLYYRLNVAQIYLPPLREREEDALILFEHFALQT
                     NPDSRPLSDADRNAVLSYAWPGNVRELRNVAMRFALDDTVSVMEILSSRPSSTTEETQ
                     AGVPLMIQLHNFERKVLHDSLVRHQGRINEVMQELDLPRRTLNQKMQKFGLNRSDYTD
                     S"
     gene            complement(181973..183181)
                     /locus_tag="VP_RS16165"
                     /old_locus_tag="VPA0184"
     CDS             complement(181973..183181)
                     /locus_tag="VP_RS16165"
                     /old_locus_tag="VPA0184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_005459327.1"
                     /translation="MESHYLDIRTLNFIIILFSCIYAISLLCYQYTQSKIKGLKTFAI
                     SLLFIGLGPFLLGFRDSAPDWLTIILSNTIIIIGFLLTLYGVSIFRKFPLKCAHVLTF
                     LVPVFSGLFYYFTFYSPSIRIRIIFLSIYLSLVTFCSGVAMIKGKRDDLKLPVQVMAY
                     AFFGFSAFMAGRTVWSIWAPEVTSFMNAGIIHQLTFLFSICLIVALSFSMLWLINARL
                     VKSINDLSHLDALTGLYNRRAMEVIVPNLVNQAREKNTPISIVMTDVDDFKTINDQYG
                     HTTGDSVMATIATIFKQTLPESACTVRFGGDEFMIVLLANTENAKAYTELVRRSIERE
                     TSLLAFKNQVTMSFGISELMPNDSLQDALTRADEALYCSKHTGRNQVTTFQDESEVGG
                     KFIQTPTKSA"
     gene            complement(183285..184595)
                     /gene="brnQ"
                     /locus_tag="VP_RS16170"
                     /old_locus_tag="VPA0185"
     CDS             complement(183285..184595)
                     /gene="brnQ"
                     /locus_tag="VP_RS16170"
                     /old_locus_tag="VPA0185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012130112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transport system II
                     carrier protein"
                     /protein_id="WP_005459306.1"
                     /translation="MLSARNIAALGFMTFAMYLGAGNLIFPPFLGYQAGENFLSGMSG
                     FLLTGVGLPALALVMVAIVNGSDKLTAALPKPLATSFWVMVFIVIGPAFVIPRAITVA
                     YQFSFAPIFGEAALVPFTIVFCVATIWFALYPGKLVDNLGKILTPALMAILIIMSVTA
                     LIYPAGELTQASGPYVSGAFAEGLTQGYMTMDALGSIGFGWIIFRAIRSMGVDCPKAT
                     AKYTLIAALMYAVAMAFVYISLSYIGSTSSYLGSEFSNGGDILTAFTFNHFGAFGSVL
                     LGAVMVLACLTTAIGVTTAGSEFYDNTFSKVNYKSCVVITMVLSGFIANIGLEQLLAI
                     TLPAVVALHPVAIALMMMAPVRNKMSQFMLVLTAFTALAFGCVDALHILGYMPEAVDQ
                     WMSHNMPLYNEFASWIVPSVIMATIGLLFTKKAEEIKEFELVNE"
     gene            185478..186488
                     /locus_tag="VP_RS16175"
                     /old_locus_tag="VPA0188"
     CDS             185478..186488
                     /locus_tag="VP_RS16175"
                     /old_locus_tag="VPA0188"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017635521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TAXI family TRAP transporter solute-binding
                     subunit"
                     /protein_id="WP_005459299.1"
                     /translation="MKMNKLVKALAIAVTSFGIATNAAAEERSYILATASTGGTYYPV
                     GVALATLSKVKLAPKHHFSLSAISSAGSGENVKLLNENEAQFAILQGLYGAWAWSGEG
                     PYEKSGRQEKLRSVSMLWQNVEHFIVRSDLAKTGTVSDLKNLEGKKFSIGKKNSGTEN
                     SGRQIMKGLSVDPDKFNLAFMGYGGSASALQNGTIDGMNTPAGVPVGAVTQAFAALGK
                     DISILSFTDEQIKQANGNYKLWTKYDIPANTYPGLDKPITTIAQPNFLAVRDDISEED
                     VYQLTKAIYENLPFLQGIHKATKAMAIEKAISGLPLPLHPGAIRYYKEMGIEIPSELM
                     AQ"
     gene            186570..188693
                     /locus_tag="VP_RS16180"
                     /old_locus_tag="VPA0189"
     CDS             186570..188693
                     /locus_tag="VP_RS16180"
                     /old_locus_tag="VPA0189"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017188534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP transporter permease"
                     /protein_id="WP_005459237.1"
                     /translation="MSDSMEKELQKFELPTRTDFPWVTTTITVFGVVLSALHIWFNTL
                     STLPELWISATHFAGFAVICALWYPAHISLKQSKMALAVDVLIAAGAIACLLYIPYAE
                     DALYERGVKFVTSDWVFAIMAILIVIELIRRTMGWFIPVLIVICLSYVVLWGKWATGI
                     FHFPGLSMETLLYRSFYSSEGMFGSISRISWTFVFMFILFGAFLVRSGVGDYIINVAR
                     AAAGKIIGGPGFIAVLGSGLMGSVSGSSVANTVSTGVISIPLMQKAGFPSRFAAGVEA
                     AASTGGQLMPPVMGAGAFIMASYTQIPYVDIIAVSFVPALIYFLSVAFFVRIEAKRSG
                     VQKITTSDESLIKVLVSGWHNLIPLVVLVTLLVKGFTPTYAAGLSIISVVVSSWFSKD
                     HKMGPKAIIEAMSQGAKNMATTAVLLVGIGLVINVISTTGIGNTFSLMINGWANGDLF
                     IMLVLIALASLVLGMGLPVTAAYIVLGTLSAPALYKLIAENQLLELMVSGQLPEQAKA
                     IFMLAAPDKLDLLNAPMALETAKEMLSLVPADFVETLLEQSLGLEAVGLALLAAHLII
                     FWLSQDSNVTPPVCLTAFAAATIAKTPPMRTGLMAWKIAKGLYLVPLLIAYTGLVSWD
                     VTSVITVGFFAIVGTYALIGAIEGYLEGPLNILMRLVLLTIGALLVWHDIPILIRVVC
                     CAVFVAVFVYSGRKFKLQQSQLSVL"
     gene            188702..189928
                     /gene="lhgO"
                     /locus_tag="VP_RS16185"
                     /old_locus_tag="VPA0190"
     CDS             188702..189928
                     /gene="lhgO"
                     /locus_tag="VP_RS16185"
                     /old_locus_tag="VPA0190"
                     /EC_number="1.1.3.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005384175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-2-hydroxyglutarate oxidase"
                     /protein_id="WP_005479979.1"
                     /translation="MKSVYDYIVVGGGIVGVSTAWQLQQRHPECSILLVEKESGFAKH
                     QTGHNSGVIHAGVYYAPGSLKADFCKRGVEKTLSFCSQHNIPVENCGKLLVATNEQEV
                     ERMNALYERCHVNGIDVGLLDEAQLKLAEPNITGLGAIYVKTTSIVDYRLVTEHMAQE
                     FQSLGGHISLRTKVVAADEKDEEVQLTCVSDGQSMQLNCKFLVTCSGLMADRMTKMMG
                     IPTDFQIVPYRGEYYRLDSKHNQVVNHLIYPIPDPDLPFLGVHLTRMIDGSVTVGPNA
                     VQGWKREGYGKVNFNLQDTLQMLSFSGFWKVTQKHLKTGLEEFKNSWWKPGYLKLVNK
                     YCPSIRVEDLQPYPAGIRAQAVLSDGTLVHDFLFAESARSLHVCNAPSPAATSAMPIG
                     EYICDKVDEKVVAKVV"
     gene            complement(189992..190387)
                     /locus_tag="VP_RS16190"
                     /old_locus_tag="VPA0191"
     CDS             complement(189992..190387)
                     /locus_tag="VP_RS16190"
                     /old_locus_tag="VPA0191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005459310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005459310.1"
                     /translation="MSVRKYWGAAATLAILTITNNVYAVDKQVSPAMKKKMQAICSAE
                     KSQPGGWQVSQVTPEAQRSLSMVLYQMNAEDKLKNINEVRTQVVAGTHYAFEFELQDG
                     EVWNAMVLRSARGDYMIERHAKKGELCPK"
     gene            190816..192216
                     /locus_tag="VP_RS16195"
                     /old_locus_tag="VPA0192"
     CDS             190816..192216
                     /locus_tag="VP_RS16195"
                     /old_locus_tag="VPA0192"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010453230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophanase"
                     /protein_id="WP_005479941.1"
                     /translation="MKRIPEPFRIKMVEPIKMTTLADREIALKEAGYNPFLLRSDDVY
                     IDLLTDSGTGAMSDNQWAGIMLGDESYAGSRNYYNLCSAVEHFFGYKLTVPAHQGRGA
                     EQILFPALIERMRQVRGGETPVFISNYHFDTTAGHIELNGGKAINVVTEEAFDTTTPY
                     DWKGNFDLNKLVETIEEHGSKNICAIITTVTCNSSGGQPVSMENMRSVYEIATKYDIP
                     VVIDSARYCENAYFIKQREEGYADKSILEIIREMYQYGDMLTMSAKKDPMVNIGGMCC
                     IRDHQELFQAVQTRCVPMEGFVTYGGMAGRDMEALARGLYEGADEDFLHYRISQVQYL
                     GERLREGGIPIQYPTGGHAVFVDAAKILPHIPADQFPAQALCNALYLEAGIRAVEIGS
                     LLLGRDPETGEQKASELELMRLTIPRRVYTNDHMDYIADALIELKNRAHELKGLMFEY
                     EPPVLRHFTARFREID"
     gene            complement(192335..192946)
                     /locus_tag="VP_RS16200"
                     /old_locus_tag="VPA0193"
     CDS             complement(192335..192946)
                     /locus_tag="VP_RS16200"
                     /old_locus_tag="VPA0193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017188538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2913 family protein"
                     /protein_id="WP_005459325.1"
                     /translation="MQSSKQARQSADANQLLSELAVHALLHLHFKIHASSRPLPTTER
                     NDLLQKWLKPKLKSNRYKLIKKPLKSLTQQAKGENGNLEALLERCIDANKPSNPQPHL
                     DSYLLLINEIEKKLGTTVLLSRPEDVDLSHDQHGCLLCVLSNNLNQHFDDNNAMIAPI
                     SMLFRGPMSQRSLFLGSIYASGTFNYEVQYQDEQFVRITLELA"
     gene            complement(192979..193062)
                     /locus_tag="VP_RS16205"
                     /old_locus_tag="VPAt06"
     tRNA            complement(192979..193062)
                     /locus_tag="VP_RS16205"
                     /old_locus_tag="VPAt06"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(193026..193028),aa:Leu,seq:gag)
     gene            193626..194834
                     /locus_tag="VP_RS16210"
                     /old_locus_tag="VPA0195"
     CDS             193626..194834
                     /locus_tag="VP_RS16210"
                     /old_locus_tag="VPA0195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004729974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NupC/NupG family nucleoside CNT transporter"
                     /protein_id="WP_005459233.1"
                     /translation="MSVLFSLFGIVALLGCAFLLSESRSSINWKTVSRALLLQLGFAA
                     LVLYFPMGQAALASLSNGVAGLLSFADEGIRFLFGDLASTGFIFAVRVLPIIIFFSAL
                     ISALYYLGIMQKVIQFIGGAIQKFLGTSKAESLVATGNIFLSQGESPLLIRPFLSNMT
                     RSELFAVMAGGMASVAGSVLGGYAGLGVELKYLIAASFMAAPGSLLMAKIIVPERQTP
                     SDYNNIELDKSEESNVIDALASGAMGGMKVAVAVGTMLIAFVSVIAMVNTGLENLGEM
                     FGFAGVTLQAILGYLFAPLAWLIGVPSHEILAAGSYIGQKVVMNEFVAFIDFVQHKAT
                     LSEHTQVIITFALCGFANIGSIAIQLGSIGVMAPERRKDVASMGLKAVAAGTLANLMS
                     ACLAGIFISL"
     gene            complement(194943..196037)
                     /locus_tag="VP_RS16215"
                     /old_locus_tag="VPA0196"
     CDS             complement(194943..196037)
                     /locus_tag="VP_RS16215"
                     /old_locus_tag="VPA0196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3541 domain-containing protein"
                     /protein_id="WP_005479954.1"
                     /translation="MRIKPISLAVLLSCSLILNVQASQEEVPALNYSQSAQLIRDTYE
                     RELFTLPPFKEGHFGLRMFRQTLDEKYYATIWTDMAQVASRLNRFANDVVKPEDIILY
                     SSERLTRYQEKEDERSQRRYTVTKHHPEYLYLGVDLLGAMARADEYGLKHQQDKTLRE
                     IIRRYDFTRYATDKEMIEAWSAQLANQVYWLRQLGEQDVVNAFIEAFRATYPDDNDKK
                     LSAQQYGNKIYGMTHIIFADSQYYQKRVNEADHQWIYDYFRDNIDTILLRAKEDIIAE
                     VGISFLLAGLDHDPVVEKTRQAIRDAISTEQGMIPSVDGDFDLKYGEHRNVLAIMLLD
                     WKGVHKAPTYQAHPKAFKSIPYGLVPKSPK"
     gene            complement(196107..196712)
                     /locus_tag="VP_RS16220"
                     /old_locus_tag="VPA0197"
     CDS             complement(196107..196712)
                     /locus_tag="VP_RS16220"
                     /old_locus_tag="VPA0197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ketoglutarate-dependent dioxygenase AlkB"
                     /protein_id="WP_005479964.1"
                     /translation="MQGQGDLFESTDWQEVRQGKLFYQPNFLSQQEADTYFSTLMSTL
                     PWQQERITIFGKSVLQPRLQTWHGDAPYTYSGLTMAPHPWTSELSSLKARCESLANTP
                     FNSVLANLYRDGQDSMGWHQDNEPELGRNPVIASLNLGDTRRFVLRNLHCKTQIEYEL
                     GHGALLIMAGELQHHWRHCVPKTAKPKGERINLTFRHILNY"
     gene            196850..198205
                     /locus_tag="VP_RS16225"
                     /old_locus_tag="VPA0198"
     CDS             196850..198205
                     /locus_tag="VP_RS16225"
                     /old_locus_tag="VPA0198"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor domain-containing diguanylate cyclase"
                     /protein_id="WP_005479983.1"
                     /translation="MRYSPRKQCYFALFFFAFVALCVGVIELLHQNQQDLQQERVQVE
                     AKEQLSILRSNLEAVLMADIYKASTLATLITLLPNSEEEELSIAADRILNKSKHITVI
                     GIAENDVISHIFPTQGNERVLGLDYRKVPAQWVQVQKAKDIQEIFIAGPVSLVQGGRG
                     LIVRVPVFRDPPINKEYWGVISAVVDFDGLMRETGVFDFSYHYPLTIRGYDSGGEYGD
                     MFFGDPNQTGKLYAKEHVHFPYGGWSMAAYAGGQLEQQISWFELNIVRIIGYPILIAL
                     SIALIVIYRLYIIADDRALHDELTHLPNRRYFMQSYKQQFEIAKRYKKRYSFALINID
                     LDRFKHINDTFGHDAGDKVLIATAERIKSSLRRSDMVARMGGDEFLVVVHNLGMEEHV
                     QKLLQKLRLALCSTPVIYDEELIYLRVSIGYAIFDPQMTSPEQMMKIADERMYQQKHG
                     G"
     gene            complement(198296..200293)
                     /locus_tag="VP_RS16230"
                     /old_locus_tag="VPA0199"
     CDS             complement(198296..200293)
                     /locus_tag="VP_RS16230"
                     /old_locus_tag="VPA0199"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009386155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_005479990.1"
                     /translation="MFAFVRQFPLYIMVSVVAGVPLLLAIFLAVQHTINLNTQSHQAL
                     KDQQLVTLITHYDNLAHNLAVERGLTAGVLGSQGKTEIVQKLTQQRKKVDDAVNSLVQ
                     LNTPLISSSDSYDLLQDVQVQLNRLNQVRQGVDRLSPQIAPFGYYSNLNQLIIDNIDI
                     LIAQTQSRELGTLGDALISVIVMKERAGQARGALNGVFAKGSATSVLFSNIEGYIQSG
                     DYASRKAQIAFPEQYRQSLQSHQSNPAWKKVEQVQQSFLNQSANLDNIQGPQATEWFP
                     MATERIGLMNQLRNQMVDQMLSAAEHSAQQATLNRNLLMAATTVISLLMIMMVWGLVA
                     SLRSRVGRLKQTLRSMSEHHDMTVELDSRGKDEIASISNSINALISNFRKLLFDVTKT
                     NNESSNRLQNIVESAQDLDSSSRSTIAKCDNIATAMTELAQSSVEIAQSAERAMGDTT
                     TMNNKVVDCQTQSELSYRSVQSLLEQINATEQCMAELANDTQSIGQIVETINSVSEQT
                     NLLALNAAIEAARAGEHGRGFAVVSSEVRDLAQRSQEATENISKLLDQIGEKTRFSVE
                     SMAKSKQASDDTFESVQQVNESVSLLESSIEHVNNHISTITHSTIEQSKACEAIDQDI
                     DVLASIAHKTGQHADDLNQIVSGYQAEAKELKHQLSAFKLA"
     gene            complement(200691..202247)
                     /locus_tag="VP_RS16235"
                     /old_locus_tag="VPA0200"
     CDS             complement(200691..202247)
                     /locus_tag="VP_RS16235"
                     /old_locus_tag="VPA0200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017819729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3612 domain-containing protein"
                     /protein_id="WP_005479975.1"
                     /translation="MSVSKSLIRQSHFLGTKIRNLRKNNHLTMEDLSARCVRINPEYA
                     PSVSYLSMIERGKRVPSIDMLEVIAEVFQKDPAWFLDDEPELEAITPNKGNRGGINGM
                     ALEPSFLFSNDILQIAIPEMLSQTGITGRQFAHLLIRAHQENHQNHFPDLERAAEEVG
                     LKRLNLSVEDLIDIAKSMGLDIRWVDRAPQDVIDELGVNAKQLITSFMEPPGTIYLNK
                     RMRDYPTRLKYDLSVYIGHRVLHSSDAMNNVLSIGHQNNWEQMDSPVSNSELNSQDIL
                     QAWRDFESSFFAGALLCPKVPFRQLLDRSGYEIDVHKKAGVSPSVAMRRMTVVSPYPH
                     WHYFDAYGPGKLKAVYRGNGIPLPWGNMRKVNDPCQHWAVFRRLSQPLDTSSAQISIL
                     NVGDEPRIYCCESVNVFDPAGNNRVLCAGIDLNPAISAQGGDAVSIAEELKSLCVASG
                     GSSVIPPHIKKDLTTIAKILNINWIERGIQSQARLICSRGAVCPRQPSCYSKCGEADE
                     TGDNVNIIGL"
     gene            202422..203000
                     /locus_tag="VP_RS16240"
                     /old_locus_tag="VPA0201"
     CDS             202422..203000
                     /locus_tag="VP_RS16240"
                     /old_locus_tag="VPA0201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase"
                     /protein_id="WP_005479980.1"
                     /translation="MNMLNFDKKEMQQQQRPFIAEAVFAVEAVSAEQQSEKQVKAKQL
                     LDRMFPLESGSHQDVSSYVIDYRHVLAYFKDGTHSGLKSPKHFVAYTGEKEDPKSILF
                     KDDSGNHVEVLFGCHKGTGCVELMDIDDIQLETRITFNPELTGNAPTAMRHWISLIKG
                     DKQGKPMACSEDKEYTAKNGDDYVLSYCYSID"
     gene            complement(203126..204139)
                     /locus_tag="VP_RS16245"
                     /old_locus_tag="VPA0202"
     CDS             complement(203126..204139)
                     /locus_tag="VP_RS16245"
                     /old_locus_tag="VPA0202"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005453351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_005479978.1"
                     /translation="MTDEFKKSTANLKKAVPLMIKNHVAATPANYALWYTYVDKTIPE
                     LNFEMDEVLEHYGICPPAANKQLYNNYVASRAETSLEDLKTNVEVLLHEVSSSMSDTL
                     SDTSSFSAMVDKSFNKLEKVEDNSLSIEEVMVVIRQLVAESHEIRHSTKFLNRQLTNA
                     SEEISRLKHQLAEVQKDALFDGLSNLYNRRAFDTDLSMLINANQAMTLILLDIDHFKA
                     FNDNYGHLFGDTVLKAIARRLQQSCRDGVSAYRFGGEEFALIVPNKSLRIARQYADTL
                     RRMIEKLRVRDKRSGTQVHSITASFGVAEFEVGDTVDSLVNKADKQLYEAKQLGRNRV
                     MPI"
     gene            204460..205797
                     /locus_tag="VP_RS16250"
                     /old_locus_tag="VPA0203"
     CDS             204460..205797
                     /locus_tag="VP_RS16250"
                     /old_locus_tag="VPA0203"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DASH family cryptochrome"
                     /protein_id="WP_005479934.1"
                     /translation="MKKKIGLYWFTFDLRLHDNSLLVDASSFLDELVCLYCRPSVTPF
                     LHHFAQEVTLGRARQKFIDASLCELNDALGQLGQRLWTLDLPPYQALKYAIQYLSVTH
                     LYSDAMAGSDEQSILHKLQDEYPHLVIVQHSVRSLFDESKLPFTLPDLPETFTQFRKC
                     VEGIDIAHPIDAPSRLPPMPKGAQLPTLSSFYFDESALFSGGEWSGLAHCRRYFFSGL
                     ASSYKETRNGLDGMAYSTKFSPWLALGCVSPRMIHAMLKQYEQTQGANDSTYWIYFEL
                     LWREYFYWYARCYQQRLFRFGGIRNQPPLTSFYAHRFQQWKNGTTPYPIVNACMHQLN
                     HTGYMSNRGRQLVASCLVHELGLDWRYGAAYFETQLIDYDVGSNWGNWQYLAGVGADP
                     RGSRQFNLEKQTQMYDPNHEFIERWQGRDSRAQQDVVDMVGWPITTQQENGDK"
     gene            205798..207342
                     /locus_tag="VP_RS16255"
                     /old_locus_tag="VPA0204"
     CDS             205798..207342
                     /locus_tag="VP_RS16255"
                     /old_locus_tag="VPA0204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cryptochrome/photolyase family protein"
                     /protein_id="WP_005479939.1"
                     /translation="MRYDTVRLILGDQLNSEHSWFQQADDTVLYLIAELKQENTYVTH
                     HIQKVCAFFSAMAIFAQEKQEEGHHVLHLTLDDTAAFDDLDQVLQHYVREVGASKFEY
                     QRPDEYRLLEQLTKLKLESVVKRCVDTEHFLLPFAEIEQQFPQGKHVMMEHFYRRMRK
                     RFDILMQDGKPVGEKWNYDANNRNKLKVKDIEQLPKPLMFSLNVDEIVERLTRHKIST
                     IGSLNGDLLWPVNRAQSLSLLAHFCQVCLRHFGRFQDAMTVEHESKWSLYHSRLSFSM
                     NSKLLHPKEVIDAALSAYQSNKHIDIAQVEGFIRQILGWREFIRGVYWANMPQYPQKN
                     EFEASRDLPDYFWTGKTKMACMRNTIGQSLDYAYAHHIQRLMVTGNFCLLTEMNPDQV
                     DAWYLGIYVDAIEWVEMPNTRGMALFADGGIVGTKPYAASGSYIKKMSDYCKGCHYDN
                     KARSGEGSCPFNSLYWRFMDKHEKRLATNPRIGMIFRSWDNMEASQRQAILDTAERYI
                     ADLEHL"
     gene            207342..208049
                     /locus_tag="VP_RS16260"
                     /old_locus_tag="VPA0205"
     CDS             207342..208049
                     /locus_tag="VP_RS16260"
                     /old_locus_tag="VPA0205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005530143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_005480002.1"
                     /translation="MNILIVGGNGGIGLAMVKEALVRFPQAQIHATYRRTKSDYEHSA
                     LIWHQVDVTDETQVKNLSQAVNSIDWVINCVGMLHTPNKGPEKNLRMVEPDFFLQNIA
                     VNTLPSMLLAKYFTPLLKCSGAPKFAVVSAKVGSISDNHLGGWYSYRASKAALNMFLK
                     TMSIEWQRTLKNGVVLALHPGTTDTALSEPFQANVPEGKLFTPERVASDLMGQIVKAA
                     PQDSGAFLTYDGERLPW"
     gene            complement(208053..208202)
                     /locus_tag="VP_RS16265"
                     /old_locus_tag="VPA0206"
     CDS             complement(208053..208202)
                     /locus_tag="VP_RS16265"
                     /old_locus_tag="VPA0206"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010450720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2256 domain-containing protein"
                     /protein_id="WP_071653083.1"
                     /translation="MKGFKSHLPTKLCPVCERPFSWRKKWARNWETVIYCSERCRRSK
                     PEKKP"
     gene            complement(208235..209377)
                     /gene="msrB"
                     /locus_tag="VP_RS16270"
                     /old_locus_tag="VPA0207"
     CDS             complement(208235..209377)
                     /gene="msrB"
                     /locus_tag="VP_RS16270"
                     /old_locus_tag="VPA0207"
                     /EC_number="1.8.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012130086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-methionine (R)-S-oxide reductase MsrB"
                     /protein_id="WP_005479994.1"
                     /translation="MKKISKLLVGFSFALPVLFLLLSKTGTADTMDKMKALENAEIAT
                     LAGGCFWCTESDLEQLPGVLDVVSGYSGGHVKNPTYRQVSSGKTGHIESIEVKYDPNV
                     VNYEQVLDYFFRHIDPTDDKGSFVDRGPQYRPAIFYHNAEQKQIAEQFMMEIDNAKVY
                     PKPLKTELIKFETFYPAEEYHQDYYKKSSLKYKYYRYASGRDKYLDEVFGDDRKEHPK
                     TLRQLIDEKKLLSKVKAYNKPSQSKIKSTLTELQYYVTQEEGTERPFDNEYWDNKEAG
                     IYVDIVTGEPLFSSTDKYKSGTGWPSFTKPINPGYIVEKTDYKLIYPRTEVRSKFGDS
                     HLGHVFTDGPKPTGLRYCMNSAAMKFVPVSKMAQLGYGDYLFLFEQ"
     gene            209583..209981
                     /locus_tag="VP_RS16275"
                     /old_locus_tag="VPA0208"
     CDS             209583..209981
                     /locus_tag="VP_RS16275"
                     /old_locus_tag="VPA0208"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC family protein"
                     /protein_id="WP_005479962.1"
                     /translation="MQAEVKWVEDFKFLGQSQSGHSIVMDGNGGATAPSPMEMVLMAA
                     GGCSSVDVVDGLKSAGQKVVSVNAKLTTERREIAPRIFTQVNIHFEVSGDELDPEVVA
                     KVAADSLEKYCSVCLMLGKGVEMTHSWEIV"
     gene            210105..210659
                     /locus_tag="VP_RS16280"
                     /old_locus_tag="VPA0209"
     CDS             210105..210659
                     /locus_tag="VP_RS16280"
                     /old_locus_tag="VPA0209"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005530134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar O-acetyltransferase"
                     /protein_id="WP_005479970.1"
                     /translation="MTELEKMMSGQVFDGMDKEIDAIRTQATLALRAFNNNTDESKRD
                     ELQKQLFGNAGLCIVQAPFHCEFGKTIEIGEETFINMNVVMLDGAKITIGNHVLIGPS
                     VQLYTASHSVDYRSRRRWETFCKPITIEDDVWIGGNSVINQGVTIGARSVIAANSVVN
                     HDVPPDCLYGGTPAKLIRRLNEEE"
     gene            210747..210980
                     /locus_tag="VP_RS16285"
                     /old_locus_tag="VPA0210"
     CDS             210747..210980
                     /locus_tag="VP_RS16285"
                     /old_locus_tag="VPA0210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017422602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005393681.1"
                     /translation="MSNKTEVLMCPTCGVETHHVVVLVRKKSGFEGDKNRNKKEFIAG
                     FLKSVVFGAFLASMDEFERHLICENCGHKTIQQ"
     gene            212012..212881
                     /locus_tag="VP_RS16290"
                     /old_locus_tag="VPA0211"
     CDS             212012..212881
                     /locus_tag="VP_RS16290"
                     /old_locus_tag="VPA0211"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005535132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479976.1"
                     /translation="MQHTTKWMMTPLAMLLGTLFSAPSFAVETSVIDSTSTPESTQNE
                     GDTSCIVCKFSGAVYLSYDTNIYDKDDYRSVRNFSWGGDLVYSFSSDTKAYFSTGGYR
                     ALEDEVGTYATDSVLGLQYTNLYRFGDTGKIGVAGQLTIPTSETSRKDELHTAVRLDV
                     PISFSAWSVDFSVSPRLRKNFHEYKTMGGRSLTEWTYSLFAVAEKSWESFAVGITALG
                     GNSISYQGTRRSSWQYEGALYGTYEFDESWSLLLAASSTGFYQDAERGTLGNIDLLDQ
                     EKASYIATVTYSF"
     gene            212913..217031
                     /locus_tag="VP_RS16295"
                     /old_locus_tag="VPA0212"
     CDS             212913..217031
                     /locus_tag="VP_RS16295"
                     /old_locus_tag="VPA0212"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017188550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479971.1"
                     /translation="MFKKLTLVSAITAALAGCGADDQAYDYVERDAKEVAVKDLKDGR
                     WFYVPTTGAAPRFALNQFPFLQGSPRYVELCFTKEGLEVRSYDKNYPDAHLSKDANNY
                     CGEEKFVADDDGVNFAQVLTIPGDFAAYRCQEDAHGDCTNKEETNEDASLNYKKKTHF
                     TPRPEDLEIAEFNMEDLYGITEGIDEIGAPRLISWDFDPKNGLLNFELERTFRIDLDN
                     ISDYINFATKASLDEALVDGAFKSRFYYSLVHESEVATEGYQPILYPVGDENDIGFFT
                     TSTKKLNPVTNKYDRDVVYLNRFNPDQGSIKYYLSDNFFEEKNKLFLDATLQSIDKMN
                     QALNVFGADAGKPEIEIVNKTKAAGIHPGDLRYNVINLIDEPLANGLLGYGPSVSNPM
                     TGEIIKGHVNQYAGVARTGVPFYWDNLARFYNRNQLDLDGLEPLPTSSESVKTEVADR
                     IEALSTMAAMASLKSDENIHAPLVSKEDIVSGKAATKSPTQLMKNFNDDMEFEKVVEA
                     EENRLSFWAENNVYPIEASWVSSTNKAMLDNLKLDDERYFEIKLDDAGNEVSRQLKRW
                     KYLPKELQVKAADAITVATYSNTLVHELGHNMGLRHNFKGSNDKANYYTLEQAHQLGL
                     NNIPAYSSTMDYAPSMLDETPTWGLYDIAAFKFGYGRKVETIQDSSGSAPASVAKPAD
                     SASDEDKAAYARYLADQQAYQQSFAYKFGNNPDNTSLMVCSEVKALTGNEKGKSLYNC
                     DFSRFDTAALSDDPELNAKTRYGALYYLDKVNEIERKSYDFCTDGNVSLNSDCNRFDE
                     GTNLEEIVSYEWQNYLDSYDRRNLELYGTTGLFSSDYPGYLVRRYMEMSAIRDKMEDL
                     ERIDNLYTNLGYTSSTDKPGDFLLRIASNPQYCSEGKADNSWFCDYANGAKKSAAFFL
                     DILRTPEHQCVIENAAGNQKVISFGQLLDNNSHQIPADYDLSTASCFDDLAARFIEDS
                     DEGYIAVAETANGRFLNSIGSFDPDYPWSNAVSVLGNWPDKALASHFLARRFSNRFTD
                     EVSFASLLDIPGVQAEYEDIMGNIVANDALNTPVKLVGKDGKEYTNLKGVTVNLHITE
                     QMESLPPMPRGIARFLDIGAEGRGRVGDVILRMGVRQMKSYDYTVKTRGQSQFDTFTK
                     QQDRYGIIAGDKVEFVIDGEKFVATKANKLAYDYANQLVTSKGYDLKTYLDSYEPATL
                     NKVAESIDSAWGPFQTAIVPAFHDPVLLLDAPMVNAMKRTIDADIAAGVLSFSQSFIN
                     FTTANVTSGDLVIDATSGTLSYKGGKAHDELKAFEAYTDAMLLIYNDHTEDMMFAVDN
                     VYAGYMASSDADKELWLKDLNMIQAYLRGDIGAVAGDYYKMLDRLPTAVSFQ"
     gene            complement(217102..217284)
                     /locus_tag="VP_RS16300"
                     /old_locus_tag="VPA0213"
     CDS             complement(217102..217284)
                     /locus_tag="VP_RS16300"
                     /old_locus_tag="VPA0213"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009844271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479943.1"
                     /translation="MKVLIQYTQAGKYRDQAWESLTLRSKGDMQAVTPSYAAQLIERS
                     KATLVMTEDGQIIFHS"
     gene            complement(217449..218135)
                     /locus_tag="VP_RS16305"
                     /old_locus_tag="VPA0214"
     CDS             complement(217449..218135)
                     /locus_tag="VP_RS16305"
                     /old_locus_tag="VPA0214"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017422459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YafY family transcriptional regulator"
                     /protein_id="WP_005479958.1"
                     /translation="MSKSERLFELLTLMRAKRYAVTAKELAERMEVSERTIYRDIQSL
                     LSSGVPIQGEAGVGYLLQAGSHLPPLMFSEKEMMALELGMRMVRAWSDVELAEASHSA
                     STKILSVLPDKLKQQVEDCPLIVPDYHTQSETAKRGQLLRHAIDHQFKVSLDYQDESG
                     QVTERKIQPLGQFFWGKVWTLVAWCELRDDYRQFRLDRIQALRMHDEEFQSAETKSLK
                     HYIAQYESKD"
     gene            complement(218183..218497)
                     /locus_tag="VP_RS16310"
                     /old_locus_tag="VPA0215"
     CDS             complement(218183..218497)
                     /locus_tag="VP_RS16310"
                     /old_locus_tag="VPA0215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005384326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479981.1"
                     /translation="METVIETVQFRLTAGTTEQDAIAAAKQSQTFVKNLPGFLYRSLS
                     HEATDDVWTDIIYWRSMDDAKQAGKQIKQAIEFQPLLSMIDCESFELKHHNLKMCSEL
                     EK"
     gene            complement(218613..219536)
                     /locus_tag="VP_RS16315"
                     /old_locus_tag="VPA0216"
     CDS             complement(218613..219536)
                     /locus_tag="VP_RS16315"
                     /old_locus_tag="VPA0216"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005490825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005490825.1"
                     /translation="MNAIASLPVFVAVVECGSFSLAAKQLNLTKSAISKRINQLEDDL
                     GIRLLNRTTRKLSLTEAGERYFEYASQALNLAQQGVDAVSELQGSPQGRLKITVPMSF
                     GVLHIAPLISEFLARYPKIEVDLTLEDKMVDLVKDGFDLGIRIGELSSSNLIAKRLAP
                     CKSVLCASPDYLAEFGTPQKPSDLVSHNCLRYSYFRGGVEWMFINNGSEYKVLPKGNF
                     IVNNSEAIRQLLLRGSGIAQLPTFIAGRDFAAGNLKPVMEEYSLPEHAIYAVFPERKH
                     MPLKVRAFIDFISEKLGTDLPYWDRYNSPEK"
     gene            219675..220349
                     /gene="yjjG"
                     /locus_tag="VP_RS16320"
                     /old_locus_tag="VPA0217"
     CDS             219675..220349
                     /gene="yjjG"
                     /locus_tag="VP_RS16320"
                     /old_locus_tag="VPA0217"
                     /EC_number="3.1.3.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017422462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrimidine 5'-nucleotidase"
                     /protein_id="WP_005374109.1"
                     /translation="MKYDWILFDADETLFHFDAFKGLQLMFSRKGVDFTEQDFAHYQT
                     VNKPLWVDYQDGKVTADELKHKRFTEWAEKLNTTTADLNSAFLEAMADICSLLPGAKE
                     LMEALQGKAKMGIITNGFTELQAIRLERTGMTEYFDKVVISEQVGVAKPDLGIFEYAM
                     QQMGNPCKTRVLMVGDNLHSDILGGNNFGIETCWLNTTGASVDERIAPNYTVESLSEL
                     KNILVA"
     gene            220401..220940
                     /locus_tag="VP_RS16325"
                     /old_locus_tag="VPA0218"
     CDS             220401..220940
                     /locus_tag="VP_RS16325"
                     /old_locus_tag="VPA0218"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005596309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_005374107.1"
                     /translation="MSDIKQLDSKVVYQNKWMTVREDKILRPSGAEGIYGVVDKPDCA
                     AILAIDNGMIHLVQQYRYTVGQRCWEIPQGAWESNPDADHLELAKGELREETGMQAST
                     MAYVGAQFIAYGFLNQTCHVYFASDLTDVGNQLDSEEEDLITRAFSVEEFEQMMIDGT
                     IKDCVTIAAYGLAKLKKFI"
     gene            complement(221020..221454)
                     /locus_tag="VP_RS16330"
                     /old_locus_tag="VPA0219"
     CDS             complement(221020..221454)
                     /locus_tag="VP_RS16330"
                     /old_locus_tag="VPA0219"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005393700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005480927.1"
                     /translation="MKLFNTIALCLLAAVASFQSVAGDNDWDKIADKTVSFKSETDTV
                     NPLSPFANARFSHIKIKCTQGTVDLKSVKVIMKDGQEKTFDSLGVLTKGMSSRSLSLP
                     TKDNAKLDKIELNYESVGSTALQVAGVTKKAQVEILGKKIDE"
     gene            complement(221475..222026)
                     /locus_tag="VP_RS16335"
                     /old_locus_tag="VPA0220"
     CDS             complement(221475..222026)
                     /locus_tag="VP_RS16335"
                     /old_locus_tag="VPA0220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017420336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YtfJ family protein"
                     /protein_id="WP_005480925.1"
                     /translation="MKTPSVLSLLLALAPTFAFSHNLSVGQTTPSVSIDTYGEMTLQG
                     DDVAYQPWATQQMLGKVRVIQAIAGRSKAKEMNAPLMSAITAAHFPEDQYQTTTVINQ
                     EDAIWGTGTFVKSSAEDSKKTFSWSSMVLDKNGVLATTWDLQQESSAIIVQNKQGEIL
                     FVKEGALTQDEVTHVIELIKQNI"
     gene            complement(222105..222824)
                     /locus_tag="VP_RS16340"
                     /old_locus_tag="VPA0221"
     CDS             complement(222105..222824)
                     /locus_tag="VP_RS16340"
                     /old_locus_tag="VPA0221"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006960710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase family protein"
                     /protein_id="WP_005490923.1"
                     /translation="MNKTLLAFSLSLLTLSAAQASEWGYGNDKHGPEHWGEIAKDCAT
                     TKNQSPINIENPADAKLEALNPSYTGQVIGLTNNGHTLQAQVNGRNSFTIDGETFELQ
                     QFHFHTPSENQIKGRQYPLEAHFVHANEDGELAVISVMFDAGDQNAALSKLINAIPQE
                     NQTTFFKDTFEINDLLPKTANYYRFNGSLTTPPCSEGVRWFVLKDTQTLSKDQAAKLM
                     EVMGQNNRPLQPLNARVVLSN"
     gene            complement(222903..224252)
                     /locus_tag="VP_RS16345"
                     /old_locus_tag="VPA0222"
     CDS             complement(222903..224252)
                     /locus_tag="VP_RS16345"
                     /old_locus_tag="VPA0222"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005374103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_005490781.1"
                     /translation="MQRQFTLSPIYLLIGLASSTAYAGGFQINEHSATGLGRAFAGDA
                     VIGDNASVVSRNAAAMTLFKQNALSFGVTYVKPDVTVKNAQYHRANINADVDVSMGGG
                     LIPNLQPPSVSVTPSETVADIDDVDGVGQPAVVPNFYFIHPINDDWYLGLSTYSNFGT
                     DMEFKPNYGAPVFGGVTSVASVNLGASLAYKVNDRFSIGGGIDVIYGSGELYRDMDVG
                     VCVGGNILGNELEQRCGAVKGNALDVEAGGIGLGANIGMMYEFNERHRLGLSYKHSPN
                     IDAKGDIHFAGESYDSLAMPLPDIAEFSGYHRVLPKFALHYSVQWIGWSAFDSLKADD
                     QLLKDFQWQDSAHYSIGATWYANERWTLRTGYMFDKTPVDELTSLSIPDSNRHWLSAG
                     ASYQWSSDTTVDIGMTYLIGEDVNVEEYAYEGVPAPMVTGVTHSNAFLIGAQLSHRF"
     gene            225024..226199
                     /locus_tag="VP_RS16350"
                     /old_locus_tag="VPA0223"
     CDS             225024..226199
                     /locus_tag="VP_RS16350"
                     /old_locus_tag="VPA0223"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017819744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter periplasmic adaptor
                     subunit"
                     /protein_id="WP_005384341.1"
                     /translation="MKLNKKWLVLCGLLAIGAGGYHYLQRPEPISPYATEVVRKGNIE
                     KAVLANGMLQASKLVNVGAQVSGQIQRLAVNLGDEIKQGDLIAQIDSLTQQNSLKEAQ
                     ASLNSLNAQYQAKQAQIKQANYEYVRQKGMLAAKASSRADYENAEATLAIYKAELAQL
                     DAEIEKAKINVDNAQLDLGYTTINAPMDGTVVYTAVEEGQTVNANQTTPTIIELAKLD
                     TMTVKAEISEADVIFVHPGQTALFTILGKPNQQFKGTLRAIEPGPTIMDGDDSDLSIS
                     DSDAIYYNAVFDVKNPQGILRIGMTAQVSIVLEQSENTLIVPSQVLQKSGGKGNYTVP
                     VLEQGQVVQKPVTVGINNKVNAEILSGLKEGDQVVLGNAMDGESSSRGDRRRPPMRF"
     gene            226201..228165
                     /gene="macB"
                     /locus_tag="VP_RS16355"
                     /old_locus_tag="VPA0224"
     CDS             226201..228165
                     /gene="macB"
                     /locus_tag="VP_RS16355"
                     /old_locus_tag="VPA0224"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004725718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MacB family efflux pump subunit"
                     /protein_id="WP_005481460.1"
                     /translation="MSDVLLKVEDLTRRFVSGDESLTVLNHINLEIKRGEMVAIVGAS
                     GSGKSTLMNVLGCLDKPSSGRYFINGQDVSTLESDQLAELRREYFGFIFQRYHLLGDL
                     TAVANVEVPAVYAGVPHRQRTERAQSLLARLGLEDRLTHKPSQLSGGQQQRVSVARAL
                     MNGGEVILADEPTGALDSHSGQEMMALLKELHQLGHTIILVTHDMNVANFADRIIEIK
                     DGEIIADTLNAQVVINEQAAKTPSASFHRPAQAVSKWWKWDSFIDALKMALLAMSSHR
                     MRTFLTMLGIIIGIASVVSVVALGNGSQQQILSNISSMGTNTIDVRPGKGFGDRRSGR
                     VKTLTADDAKSLESLPFVDSVTPSLSNSLTVRYANQDATASVEGVGEDYFRVRGYEIA
                     KGQFWDEESVNSLAQEAVIDDNTRKEMFADRNPIGEVIFLGSLPVRIVGVTQKKEDAF
                     GNSDALKIWVPYTTMSGRMMGQRYLNGITVRIDENAPSAAVEQSIINLLKMRHGTEDF
                     FTINTDTIRQSIEKTTATMTLLISAIAVISLIVGGIGVMNIMLVSVTERTKEIGVRMA
                     VGARQADILRQFLIEAVLVCLCGGIAGIGLAFLIGFAFSTSGSSFQMIYSMNSIIWAF
                     ICSTLIGIAFGFLPARNAAKLDPIEALARD"
     gene            228180..229556
                     /locus_tag="VP_RS16360"
                     /old_locus_tag="VPA0225"
     CDS             228180..229556
                     /locus_tag="VP_RS16360"
                     /old_locus_tag="VPA0225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005497922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux transporter outer membrane subunit"
                     /protein_id="WP_005481477.1"
                     /translation="MKFKTRLVAAALSAVWLSGCGSLMRSDYQAPAVQVPANWQQMQV
                     AGDVSMDPWWLAFNDPTLNQYITQVLAQNNDLTLATLTLKKARLQLGLTQDDLFPTLS
                     SSTSGQVQKSLDGGESADSYSTNLSVNYELDLWGKISADVDQAKWTAVASQQDREATA
                     QSLVATTASLYWQIGYLKQRLNLSQRNVEDAAQTLQLIEKQYQLGAVDQLDVLEAKRT
                     LASLQAQQSEFEQSLLEANNAFAILFNQPPKSISANIQMLPEGDMPSLSVGTPSDLLI
                     RRPDIKAAIYEVKAALANKDAADLDYLPKLTLTGALGGSSKALKDLLSNPIGSLGADM
                     TLPFLQWNEMKNSQAIADLDYQSAIVSYRQVLYAAFQDVENALSAREKLKYQAARLQE
                     QYDAASAAESIYAARYQYGSTSIMDYLNAQEETRNAQASLLENRYNQFLTQVTLYQSL
                     GGTDVAPL"
     gene            complement(229683..230936)
                     /locus_tag="VP_RS16365"
                     /old_locus_tag="VPA0226"
     CDS             complement(229683..230936)
                     /locus_tag="VP_RS16365"
                     /old_locus_tag="VPA0226"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011999174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SGNH/GDSL hydrolase family protein"
                     /protein_id="WP_005463990.1"
                     /translation="MKKTITLLTALLPLASAVAEEPTLSPEMVSASEVISTQENQTYT
                     YVRCWYRTSYSKDDPATDWEWAKNEDGSYFTIDGYWWSSVSFKNMFYTNTSQNVIRQR
                     CEATLDLANENADITFFAADNRFSYNHTIWSNDAAMQPDQINKVVALGDSLSDTGNIF
                     NASQWRFPNPNSWFLGHFSNGFVWTEYIAKAKNLPLYNWAVGGAAGENQYIALTGVGE
                     QVSSYLTYAKLAKNYKPANTLFTLEFGLNDFMNYNRGVPEVKADYAEALIRLTDAGAK
                     NFMLMTLPDATKAPQFKYSTQEEIDKIRAKVLEMNEFIKAQAMYYKAQGYNITLFDTH
                     ALFETLTSAPEEHGFVNASDPCLDINRSSSVDYMYTHALRSECAASGAEKFVFWDVTH
                     PTTATHRYVAEKMLESSNNLAEYRF"
     gene            231409..233442
                     /locus_tag="VP_RS16370"
                     /old_locus_tag="VPA0227"
     CDS             231409..233442
                     /locus_tag="VP_RS16370"
                     /old_locus_tag="VPA0227"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011082339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S8 family serine peptidase"
                     /protein_id="WP_005464000.1"
                     /translation="MHYTTSKKQGLFTLSAVAVALTASMSAFAAPPMGFDESKLPTKY
                     IVKFKEDPVSRSSMGGNSFWGPRIAQESVLQQVKARKVEKLGNRAIYSVELDGDDLEP
                     LRNRGDVEYVEVDPPRYLLSETVPWGYNAVNAQQLDDFNAGNRTVCIIDSGYDLSHND
                     LSGNRVAGTNDSGTGSWSDPGNNNAHGTHVAGTIAAIANTEGVKGVMPNQNVNLHIVK
                     VFNEAGWGYSSGLVKAIQTCADNGANVVNMSLGGSQSSRTEQNALKAIYDQGVLLIAA
                     AGNDGNTAHSYPASYDSVMSVAAVDNQNDHAAFSQATDQVEIAAPGVAILSTVTVGEG
                     KLSDITLNGVSQFDRGIVPHNRLVHNGTEFVPAPVAGSVTATLASCDVSGGNFNCGDM
                     SGKICLTERIGNQSSGTYPEVDAVRACYNAGASAAIVYSNAALAGLQNPFLVDQNNAY
                     RMVSVTVDRAFGQELLGYVGQEITVATTSGEDYEYYNGTSMATPHVTGVAGLVWSYHP
                     TCTAAQVRNALIKTATDIDVAGRDNRTGHGLVNAEAAKLFLDAGCNGPDGGGSSSDSS
                     YSNTNPVAIPDNKTSGAISALNVDRTGDSGTVSIDVDISHTYIGDLRVTLTSPTGGQV
                     VLHDNTGGSANDIKTTFQVDFSGFESQGSWELKAVDSARRDTGTINSWSLTFQ"
     gene            233452..233799
                     /locus_tag="VP_RS16375"
                     /old_locus_tag="VPA0228"
     CDS             233452..233799
                     /locus_tag="VP_RS16375"
                     /old_locus_tag="VPA0228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005464009.1"
                     /translation="MKKLTLLSVTAGSLTALLAIGMSATSLANNQGFPLVDERPTSAE
                     QQPARYFVKYHKGKESEVRALLRHNNLEVVDALVKQQVLVVTGSQEDVDKLSTSDAVE
                     YTEQEPTRKLLSQ"
     gene            complement(233923..235179)
                     /locus_tag="VP_RS16380"
                     /old_locus_tag="VPA0229"
     CDS             complement(233923..235179)
                     /locus_tag="VP_RS16380"
                     /old_locus_tag="VPA0229"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011815933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate transporter subunit IIC"
                     /protein_id="WP_005463995.1"
                     /translation="MEFFSFLMNDVLSEPAVLVGLIALIGLIAQKKPVTECIKGTVKT
                     ILGFIVLGAGAGLVVSSLGDFATIFQHAFGITGVVPNNEAIVSIAQEAFGKEMAMIMF
                     FGMLVNILIARFTPWKFIFLTGHHTLFMSMMVAAILASSGMKGVPLIALGSVVVGSVM
                     VFFPAIAHKYMKQVTGSDDVAIGHFSTLSYVLAGFIGSKFGNKEHSTEEMNVPKSLLF
                     LRDTPVAISFTMGIIFMVTCLFAGGDFVREVSGGKHWSMFALMQSITFAGGVYVILQG
                     VRMVIAEIVPAFKGISDKLVPNAKPALDCPVVFPYAPNAVLVGFLSSFAAGLVGMFLL
                     YVMGLTVIIPGVVPHFFVGAAAGVFGNATGGRRGAILGAFAQGLLITFLPVFLMPVLG
                     DLGFANTTFSDADFGAVGILLGLIVR"
     gene            complement(235189..235476)
                     /locus_tag="VP_RS16385"
                     /old_locus_tag="VPA0230"
     CDS             complement(235189..235476)
                     /locus_tag="VP_RS16385"
                     /old_locus_tag="VPA0230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019614059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIB"
                     /protein_id="WP_005463968.1"
                     /translation="MKIMVVCGHGLGTSLMMEMSIKSIVKELNVDAAVDHIDLGSAKG
                     TSCDIFIGTKDIAEQLEALGVEQRIVALDNMVDKVAMKERLSVALQELGAL"
     gene            complement(235544..235987)
                     /locus_tag="VP_RS16390"
                     /old_locus_tag="VPA0231"
     CDS             complement(235544..235987)
                     /locus_tag="VP_RS16390"
                     /old_locus_tag="VPA0231"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011192680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIA"
                     /protein_id="WP_005463973.1"
                     /translation="MLRELITSDVIRIHSDATDWKDAISKSCEALIENGAIEPSYVEA
                     IYRSHEELGPYYVVGPGMAMPHARPEDGVNRLSLAITVIQNGVNFNSEENDPVKMLVT
                     LAATDSNSHVDAISKLAELFMNEEHVEAICNAQSKEDVLAIIDKY"
     gene            236237..237265
                     /locus_tag="VP_RS16395"
                     /old_locus_tag="VPA0232"
     CDS             236237..237265
                     /locus_tag="VP_RS16395"
                     /old_locus_tag="VPA0232"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005463961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_005463961.1"
                     /translation="MSEPRKRRSTGNVTLADVAKQAGVGTMTVSRALRTPELVSDKLR
                     EKIQQVVDELGYIPNKAAGALASAESYSIALIIPSLFEKACAHFLPSFQQALNKAGYQ
                     LLLGYSDYSIEQEEKLLSTFLESRPAGVVLFGSEHSQRTHQLLEASNTPVLEIAELSS
                     KASYLNIGVDHFEVGKACTRHLIEQGFKNVGFIGARGNHSTLQRQLHGWQSAMIENYL
                     TPDHFLTTHEAPSSQLGAEGLAKLLLRDSSLNALVCSHEEIAIGALFECHRRVLKVPT
                     DIAIICLEGSSMGEHAYPSLTSAEFDYERMGTKAAEKLLHAIKGEPEERPTSMGFKLK
                     RRASTAIN"
     gene            complement(237342..238157)
                     /locus_tag="VP_RS16400"
                     /old_locus_tag="VPA0233"
     CDS             complement(237342..238157)
                     /locus_tag="VP_RS16400"
                     /old_locus_tag="VPA0233"
                     /EC_number="3.11.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011999177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonoacetaldehyde hydrolase"
                     /protein_id="WP_005464042.1"
                     /translation="MSNSPIQAVIFDWAGTIVDFGSFAPTSIFVEAFKQGFDFDIDLE
                     EAREPMGLGKWDHIQAVGRIPAVDKRWNEKFGRSMTNEDIDAIYAAFMPLQKAKVADH
                     AEPILNAVEVVNGLKDKGIKIGSCSGYPREVMDVLIPVAADYGYQPDYVVATDDLPQG
                     GRPAPFMALKNVIELDVTDVKACVKVDDSAPGIFEGHNAGMWTVGLLLSGNEAGLTFE
                     EYQAADEATLEKAREKARAKFIKSAPHYLIDTISDLPEVIVDIEQRLAAGERP"
     gene            complement(238248..239627)
                     /locus_tag="VP_RS16405"
                     /old_locus_tag="VPA0234"
     CDS             complement(238248..239627)
                     /locus_tag="VP_RS16405"
                     /old_locus_tag="VPA0234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005374071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="WP_005481438.1"
                     /translation="MTQNIKPTHFRSEGDVNTTPARQAWNASMDDERTQVLLKRDSEV
                     FLHQAMSTPCLDTLDAAEGIYIQDATGKKYMDFHGNNVHQLGYGHPHVIKRVQEQIAK
                     LPFSPRRFTNETAIECAEKLTQICGGELNRVLFAPGGTSAVGMALKLARHITGNYKVV
                     SLWDSFHGASLDAISVGGEACFRQGMGPLMAGVERIPPAVSYRGAFPVADGSDVHYAD
                     YLEYVIEKEGGVGAFIAEAVRNTDVQVPSKAYWKRIREICDKHNVMLIIDDIPNGMGR
                     SGEWFTYQAYDIEPDMLCIGKGLGGGLVPIAAMVTKDKYNTAEQISMGHYTHEKSPIG
                     CAAALATMEAIEQDGLLDKVKADSQFMREKLLEMKAKYPVIGDVRGIGMLWGIELVTD
                     HESKARAYDEAEAVLYQCLNNGVSFKVSQGNVIQLSPPLIITREQLTEALAIFEEAIA
                     KVCKDFNYF"
     gene            complement(239654..240757)
                     /gene="phnW"
                     /locus_tag="VP_RS16410"
                     /old_locus_tag="VPA0235"
     CDS             complement(239654..240757)
                     /gene="phnW"
                     /locus_tag="VP_RS16410"
                     /old_locus_tag="VPA0235"
                     /EC_number="2.6.1.37"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004749659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoethylphosphonate--pyruvate transaminase"
                     /protein_id="WP_005481450.1"
                     /translation="MKNEYLLLTPGPLSTSETVREAMLKDWCTWDDEYNKDIVEVIRT
                     KLVKLATKHSGYTSVLMQGCGTASVEATIGSAIGKEGKLLVVDNGAYGARIAQIADYL
                     NIPCHVVSPGETSQPHLNEVETALASDPAITHVAIVHCETTTGMLNPIEAFASAAKAH
                     GKVVILDAMSSFGGIPMDIADLGIDFMISSANKCIQGVPGFGFVIAKQTELEKCQDQA
                     RSLSLDLYDQWHCMEVNHGKWRFTSPTHTVRAFYQALLELEQEGGIEARHNRYQTNQK
                     TLVAGMRSLGFEPLLSDDLHSPIITSFYSPTHSDYQFKAFYTRLKEQGFVIYPGKVSN
                     ADCFRIGNIGEVYPADIERLIGAIEKAMYWQVA"
     gene            241029..242036
                     /locus_tag="VP_RS16415"
                     /old_locus_tag="VPA0236"
     CDS             241029..242036
                     /locus_tag="VP_RS16415"
                     /old_locus_tag="VPA0236"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006069275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative 2-aminoethylphosphonate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_021483882.1"
                     /translation="MKNRLMKGSLAALVSLLATNAMAAQEVTVYTAFETDILAKYKSA
                     FEKDNPDIKIKWVRDSTGIMTAKLLAEKNNPQAEVVWGLAGSSMALLKDEALLKPYTP
                     KGLEELHANLNDPQSNQAWFGNDAFFNAVCFNEAVAKQLNLPKPTSWEDLTKPVYKGH
                     IVMPNPASSGTGYMQVSAWLQNMGEDQAWNYMRDLDKNIAHYTHSGSKPCVQAGMGEV
                     AIGISMASRGAKLKTQGAPLAVITPKGIGWESEAVGLVKESDAAKRVVDWSISKAANE
                     LYVEMYPVVGHKDVKATVSNFPNVQENMAKMDFAQMGSKRAEILATWSEKFDAKSEPK
                     S"
     gene            242149..242559
                     /locus_tag="VP_RS16420"
                     /old_locus_tag="VPA0237"
     CDS             242149..242559
                     /locus_tag="VP_RS16420"
                     /old_locus_tag="VPA0237"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005463976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_005481458.1"
                     /translation="MEIQRINAEQTLSLRQQVLWPSKSIEFCKVDEDETGYHYGSYVN
                     GELVGVASVFFNNGAARLRKFAVSSSQQGKGIGSRMLEMMIEDARALNSEVFWCDARE
                     SALRIYQKFGLQKEGERFYKSDIPYFKMSLDLSV"
     gene            242663..243781
                     /locus_tag="VP_RS16425"
                     /old_locus_tag="VPA0238"
     CDS             242663..243781
                     /locus_tag="VP_RS16425"
                     /old_locus_tag="VPA0238"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004411464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative 2-aminoethylphosphonate ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_005481435.1"
                     /translation="MSINQPYLNIKNVVKQFGQFTALKQISLAIEKGEFVCFLGPSGC
                     GKTTLLRAIAGLDLPTSGAIFQNGQETTFLPPEKRDFGIVFQSYALFPNLTVQENIAV
                     GLKNQGMSTKEALEKVEQWLETIGLPTSGQKFPNQLSGGQQQRVALARALALSPGLLL
                     LDEPLSALDAKVRVHLRDEICKLQRKLGITTIMVTHDQDEALSMADRIVVMNHGVIEQ
                     VGTPQEIYQQPATRFVAEFVGSMNFIETSVVTESQVRIAETLLPAPSLTNRKIQRGDR
                     FDLAVRPENIKFVENYRNSLPVRITATEFLGAFFRVDCELQNDSQAKPIVVDVPVETV
                     QNLNIRIGDVRYIQFLESGLHGYVIPSQGNAFTKALAA"
     gene            243790..245514
                     /locus_tag="VP_RS16430"
                     /old_locus_tag="VPA0239"
     CDS             243790..245514
                     /locus_tag="VP_RS16430"
                     /old_locus_tag="VPA0239"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011151850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative 2-aminoethylphosphonate ABC transporter
                     permease subunit"
                     /protein_id="WP_005481462.1"
                     /translation="MDAKTMTMNSLTTQDKAKSMMGSISRDNIVLFGLLAGLSTMMIL
                     FILMPLWAMLAKSVQNSDGEFVGLANFATYFSSSSLWVSVGNTFSLGLVVTTVVGILA
                     FGYAYALTRSCMPFKGLFHILGTAPILAPSLLPAISLIFLFGNQGVAKELLGGHSVYG
                     VIGISMGLIFWTFPHALMILTTSLRTSDARLYEAARALKTSPMKTFFMVTLPAAKYGL
                     ISTLIVVFTLVITDFGVPKVIGGSYNVLATDIFKQVVGQQNFAMGAVTSIMLLFPAVM
                     AFGADRWVQKKQKSLFDTRSVPYQPEPNKTRDGLCFVYCSLISVAVLAVLGMAVYGSL
                     VTFWPWNKALTLNNYNFAEMSTYGWSPFFNSLTLAGWTALIGTAVIFVGAYCIEKGRA
                     FGPVRQAMQMLSVVPMAVPGMVLGLGYIFYFNDVNNPLNVLYGTMAFLVINTVVHYYT
                     VGHMTALTALKQLPSEIEATAASVRLPQYKLFFKVTLPVCMPAVLDIATYLFVNALTT
                     TSAVVFLYSTDTIPASVSILNMDDAGQTGAAAAMAVMIMVAAAIAKIVQMTLGKWLES
                     RTQAWRKR"
     gene            245524..246228
                     /gene="phnR"
                     /locus_tag="VP_RS16435"
                     /old_locus_tag="VPA0240"
     CDS             245524..246228
                     /gene="phnR"
                     /locus_tag="VP_RS16435"
                     /old_locus_tag="VPA0240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011151851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate utilization transcriptional
                     regulator PhnR"
                     /protein_id="WP_005481525.1"
                     /translation="MQYVKIKDSIVEQIEAGMLSPRQKLPAERKLAESFDTTRVTLRE
                     ALSLLEAEGRIYREDRRGWFISPEPLRYDPTQTLNFPNMAKAQNRVPKTELIAAKGTL
                     ANKQSARLLQLQPFSDVFRVDRVRYLEDRPVVYVTNYIRPEIFPNLLSFDLTNSLTDI
                     YREHFGVVYQKTRYRISTSTLLGEVAQALRATSGTPAMVVERTNYNQHGELIDCDIEY
                     WRHDAISIESVAELNQ"
     gene            246294..247202
                     /locus_tag="VP_RS16440"
                     /old_locus_tag="VPA0241"
     CDS             246294..247202
                     /locus_tag="VP_RS16440"
                     /old_locus_tag="VPA0241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004728054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter"
                     /protein_id="WP_005481519.1"
                     /translation="MDFLAIALVVFSAVLHAGWNILGKSHSGSGVAFTMAASLSACGV
                     LTPYLIWYLTTLGWTSLPVEFWGMLAFSGIAQIVYLVGLIMAYKHADVGVIYPIARAL
                     PVMMVGGFSVALGHALSSQQWLGFVLITFGCILVPLTHVRQVSLVAYLNVGVFWALIA
                     AIGTTGYSVVDKEALTLLTQQASTIFNDQYSAIFYLGAQFWAMGLPVLLWCLITRNDQ
                     ELQAAWRIRKSASMAGIMMASTYGLVLFAMTMTDNVSLVVALRQISIVFGLLMGIWLL
                     AEKWYLTRGIGVAFILAGIVLSLEGA"
     gene            complement(247256..247807)
                     /locus_tag="VP_RS16445"
                     /old_locus_tag="VPA0242"
     CDS             complement(247256..247807)
                     /locus_tag="VP_RS16445"
                     /old_locus_tag="VPA0242"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005374044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin family protein"
                     /protein_id="WP_005481509.1"
                     /translation="MSYKYAVACLLSALSVTAHAEPTKHIVGANLGYGDVSYDVNNGH
                     DDGDMFLGDVYYRYMFDQNFGLEAGYKGAFNGIGSVLMSPISEITDVSYGGPRISGYV
                     SYPLGAGFELYGKGGITYYTLSYTLKNNGQNKEYDESSLGGEAAAGVAWGYKHFGLNL
                     EYNYAKNSDFDSGGVMFGAQMRF"
     gene            complement(247859..248767)
                     /locus_tag="VP_RS16450"
                     /old_locus_tag="VPA0243"
     CDS             complement(247859..248767)
                     /locus_tag="VP_RS16450"
                     /old_locus_tag="VPA0243"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005395337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF535 domain-containing protein"
                     /protein_id="WP_005481513.1"
                     /translation="MTANKSIFDHTKVIYADEYANTYNPIWVYRMKFIMRALYYKRAF
                     KHLANNIESSLLDMLCTRTHRFLEKPFRPYIIKNNSAFDRSNLVVDHYKTISELLSKE
                     TIAEIYTDSKGLTLTSFEIDDIEYSVRLVYEARYQKEGDMSLVLHSAEDGNFYTLSFT
                     VGHVDTGRCIMIGGLQGPRSSEENNAKIKKLTRKLYGQRPKSLMVSLLTLIAQVWEVN
                     TILAVKTQSHTYAARRYSKGRIKTDYDALWQELGGIEYNRHFYALKVNDTRRDTEGMS
                     RSKRSMYRRRYEWLDNTKAEFATRLR"
     gene            249125..250525
                     /locus_tag="VP_RS16455"
                     /old_locus_tag="VPA0244"
     CDS             249125..250525
                     /locus_tag="VP_RS16455"
                     /old_locus_tag="VPA0244"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005445400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_005481488.1"
                     /translation="MAHLSYWFKQALELEQPQPAKPLNEDIAADVAIIGGGYTGLWTA
                     IMIKQQAPKKHVVVIEKGLCGSGASGANGGCMLTWSTKFPTLKRLFGEAQAAWLVKES
                     EQAVLEIDAFCKQHHIDAQLSLKGVYYTATNHVQAGSMQPVVDELSRLGVNSWRRCKE
                     DELHANTGSPRHLEGFHSSVAASVQPALLARGLRRVALEMGIEIFENTPMTKLDFGQP
                     ATVSTPDAQIKAKQVVLALNAWMVEHFTQFKNSIVVVSSDMVITKPLGESLRKTGWQA
                     GTSVLDSRIFVHYYRDTPDGRLMLGKGGNQFSFNNQVDVMFNKPTRYQNLLRKSFDKL
                     FPSLKEAEFEYSWTGGSDRSTSGFPFFGKLNEQRNVFYGFGYSGNGVAQTRMGGKILS
                     SMVLGLDNEWTRSGLAKGPLGHFPPEPFRWIGAMTVRNAVRRKEEAEDCGQKPFIWDK
                     WLAKLAGPAGKADKLD"
     gene            250639..251763
                     /locus_tag="VP_RS16460"
                     /old_locus_tag="VPA0246"
     CDS             250639..251763
                     /locus_tag="VP_RS16460"
                     /old_locus_tag="VPA0246"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004728055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxypeptidase family protein"
                     /protein_id="WP_005481455.1"
                     /translation="MKIFSNFDSGSIHVVKADDKNDIQLKIPNDNMSEFYQWFHFRLE
                     TEAEQSHTIKLLDLAKSAYPEGWQGYDVVASYDREEWFRIPAEFDGDTLTFTVIPERS
                     SIYFAYFAPYTYDRHLDLLHMAQSAHHCKLDTLGHTLDGNDMSLLTFGEPEEGKKKIW
                     MIARQHPGETMAEWFMEGMIQRLLDENDTVARALLEKAVLYVVPNMNPDGGIRGHLRT
                     NAVGVNLNREWQTPSMEKSPEVFLVRERMLETGVDMFLDVHGDEAIPYNFVAGSEGIP
                     SYDENLAALENAFKQALLTITPEFQDEIGYDKDEPGKANLTVGSNWVAEQFKCLSYTI
                     EMPFKDNNNHPDPLYGWSPERSVMFGQDVLAATLAVTDKI"
     gene            252218..253195
                     /locus_tag="VP_RS16465"
                     /old_locus_tag="VPA0248"
     CDS             252218..253195
                     /locus_tag="VP_RS16465"
                     /old_locus_tag="VPA0248"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011999191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA family protein"
                     /protein_id="WP_005481521.1"
                     /translation="MKKIAIAVATVLAGGVISNVALADTYIGGKVGYNSLNDACYLNE
                     PCDDDSFAAGMHIGYNFNEYVAAEYGVDYLGDFTANFKKPGLNTVDGDLWALTLAPKF
                     NLPLTDSWNLFAKVGAAYMMAGDEKDFVPTGSLGAEYKINYNWSLRAEYQRYQDMSDD
                     IVDDMDSDFFGIGFNYKFGSEPVVQEEAVEEVVETRPSTRIVEHVYPAQTATVQFGLE
                     SAEVKDASALSGTVDLMNTYPQAKVEITGYSDTTGSAQYNQQLTEKRAKAVANEFEAK
                     GIAADRMTVKGMGEANPVASNETRQGREANRRVEVVVPAFEYQTTEQAQ"
     gene            253400..254269
                     /locus_tag="VP_RS16470"
                     /old_locus_tag="VPA0249"
     CDS             253400..254269
                     /locus_tag="VP_RS16470"
                     /old_locus_tag="VPA0249"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020195720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_021451302.1"
                     /translation="MQNLPPLNALKAFEATARLRSFTKAAKELNVTRAAVSQQVKSLE
                     LQLDAILFERNGAQLLLTQAAQAYLPVVSQTLQMLSVATQHLFARQKNTQLTLHVAHS
                     FCSQWLMPRLADFHRQHPDVVVKISTTANTVPNASAIADVEIINGYGDWQSEQAVQLT
                     QENWIVVASPGFLNLNSVIHLTDIALAPKLCTGGYHESWQAWLRFQGYKGKVSKPIAE
                     FEHSLLAIQAAVNQLGILLVRDFLVEDELQQGLLVPIGGWSMPSASAHHMVVRESDKP
                     QVEAFTHWVMQSL"
     gene            254435..255214
                     /locus_tag="VP_RS16475"
                     /old_locus_tag="VPA0250"
     CDS             254435..255214
                     /locus_tag="VP_RS16475"
                     /old_locus_tag="VPA0250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005432466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase family
                     protein"
                     /protein_id="WP_021451301.1"
                     /translation="MEMLQGGRDNAIYRTGDRVSRPASSWTMTVHQLLNHLHSNGFTQ
                     CPKVIGIEGGKEWLSFVEGDTFNYPLQGSIASVTALLSAAKMLRRMHDASEDFLISHQ
                     SEVCHWMLPDRVPQEVICHGDFMPYNVALNGETVVGVFDFDTAHPAPRLWDVAFSIYG
                     WAPFKTDENDRMGNLEQQIQRAKLFCDAYGCSKLERENLVDVMTLRLTALVDYMRLMA
                     SSRDERFQANLEEGHHIAYLQDIDYLRQHHQAITLGMLKER"
     gene            complement(255211..256086)
                     /locus_tag="VP_RS16480"
                     /old_locus_tag="VPA0251"
     CDS             complement(255211..256086)
                     /locus_tag="VP_RS16480"
                     /old_locus_tag="VPA0251"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005463979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005481507.1"
                     /translation="MAINLDIQNILVLKRMYELRNVRLVAESLGKTSGAISKNLTKMK
                     TQFDDPLFVQTKHGFEPTTFVETNMAHFEQILMSVDSIKPQNFSPENFDGQLSIYANT
                     LFWDYFGDELYMSLLKQAPRAKFSFLRWGNEAKNRLIDGKNAVAIHYFDEDLPQSVAQ
                     KELGKGKAVFFVRKDHPAQDFDDLQLYPFLLFKTPGWNDYRYPLLERLKNIGFNASPK
                     VEIEHPAMIHKIILQTDHFGITMSDHVPQGCRSIALPNRLELNVSYVMSCRRSQQHAP
                     LNLWLFDKIKHVIAN"
     gene            256295..256531
                     /locus_tag="VP_RS16485"
                     /old_locus_tag="VPA0252"
     CDS             256295..256531
                     /locus_tag="VP_RS16485"
                     /old_locus_tag="VPA0252"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005464033.1"
                     /translation="MKKLIALGLMVCSANVAFAADGSYTGTIDMTMSNTNQVDVERAN
                     SQLTLKGRNEAMYGGVMIQTDASTQPIELRGRRD"
     gene            complement(256625..258121)
                     /locus_tag="VP_RS16490"
                     /old_locus_tag="VPA0253"
     CDS             complement(256625..258121)
                     /locus_tag="VP_RS16490"
                     /old_locus_tag="VPA0253"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005395321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_005463935.1"
                     /translation="MWNKLNKSMMFCQMMFGLSFYGVLVSLTRFFLEDLNYNEADTMM
                     IVGAFSAIGPLFAIAGGFIADKFLGAYRSLSIAFLAFAAGYVLLVLGASATNVPLSMC
                     GIALASYGRGLMSPSYPSLYKRTFKSQEDFEKGYPINYSVNNVGAFLGQYLFPMIVLV
                     IGFNGGFTISAVMAGAALVMLLMFRKGLTGVAAELDQKAVSLKNWVFFALISVAMIAL
                     VFFMFSNMDIGQNIVYAIGGAAILYFVSLMLKASKAESLKMGTILIVTFLTTCFFVYY
                     GQMMTSMNMVAINTLKGSLFGFIPLEPEAAMAMNPLWCMVGGPIVAGFFGMLEKRDVH
                     LSTATKIAMAFVLTAIAFGILTFAVTTVGEDVVIMPEIFLAIHFFQAIAEVIVGSMVV
                     AFILSVAPKHIENFSVSLFSVAIALSGIVGAAFSTSIAMEKGQEITQEIVQTVYGDYF
                     QLLTVLAVVMVAIAMAASVVIRKMLDAAKESEAQAQPVEIEAGVEVQS"
     gene            complement(258481..259851)
                     /locus_tag="VP_RS16495"
                     /old_locus_tag="VPA0254"
     CDS             complement(258481..259851)
                     /locus_tag="VP_RS16495"
                     /old_locus_tag="VPA0254"
                     /EC_number="4.3.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019275150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-serine ammonia-lyase"
                     /protein_id="WP_005481453.1"
                     /translation="MLSIFDIFKVGVGPSSSHTNGPMLAGFHFTQLLSDSMAKVRRVQ
                     VDLYGSLSLTGRGHHTDRATVLGLMGNKPDTIKMTSAKSALQHTIENHTLSLAGSHQI
                     EFSYDHDIVFHSDNLPLHENGMTITALDAAGAQVAFETYYSIGGGFIATAAELEHGGQ
                     QASAEVPFPFSSADEMLEKAEKNGLSLGGMILQNELAFREQEEIDQRAEQIWKVMSLC
                     MQRGFDTEGILEGGLNVTRRAPNLLKKLEANAAVENDPMEIMDWINLFAFAVSEENAA
                     GGQVVTSPTNGAAGVIPAVLMYYHRFIKELDLKQLKDFLAVAGAIGILYKTNASISGA
                     EVGCQGEVGVSSSMAAAGLTALRGGSNEQICIAAEIAMEHSLGMTCDPIGGLVQVPCI
                     ERNAMGAVKAINASRMALKRTSKCLISLDKVIETMYQTGKDMNKKYRETSLGGLAIIH
                     MAPPCE"
     gene            260010..260852
                     /locus_tag="VP_RS16500"
                     /old_locus_tag="VPA0255"
     CDS             260010..260852
                     /locus_tag="VP_RS16500"
                     /old_locus_tag="VPA0255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005497960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YdcF family protein"
                     /protein_id="WP_005481531.1"
                     /translation="MKLGNVVIVLGKRLVNNQLSAEGISRVEALAAKIREMPMENTAL
                     VFCGGKTQGQSISEADAMYAYFQTLNTSLAKPFPTSQTLLENRSLNTFENMRNAAKVL
                     CESGLFPLPSQATVEVILLSNVYHLERILEIQTLMDEQGLLRVIKSQCASVGLDLHIS
                     LDIQKHISVPYPHQGPQAEAFLLLDELTTYRVYLEGVKSGAFQRDLTSVRAQPLLRAK
                     QAISQLRALPLEMDVLQQIAEMKKAIEMTAFDESVATAERALEMFHPILTALNRRLDP
                     ESIQ"
     gene            complement(260842..261498)
                     /locus_tag="VP_RS16505"
                     /old_locus_tag="VPA0256"
     CDS             complement(260842..261498)
                     /locus_tag="VP_RS16505"
                     /old_locus_tag="VPA0256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005481502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005481502.1"
                     /translation="MKTQIVKQAETAQNNVITDESKRIIYKSCLSALMIVAISILVNL
                     SIRLDYVVLGSSLGEVSITETLQVIMLAIASWSFFQLSKQEEQVKHAAILISGFFAVL
                     IIRELDYWMDMIRHGSWVFPALTVTALACAKAYQGGKGTVNEMARILQVPHMKLLIGA
                     VVLLLVFSRLYGMGSFWQQVMNESYIRDVKNISEEGMELLCYCLIALSAVRMRREITE
                     "
     gene            complement(261751..262011)
                     /locus_tag="VP_RS16510"
                     /old_locus_tag="VPA0257"
     CDS             complement(261751..262011)
                     /locus_tag="VP_RS16510"
                     /old_locus_tag="VPA0257"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005463993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF333 domain-containing protein"
                     /protein_id="WP_005463993.1"
                     /translation="MKKTSLMMAMAGTMVLAGCSTYDGATRSTEYTSVANPAAVYCVQ
                     QGGELDTVSENGERVTYCVLSDDERVEQWEYYRNNHKESDEQ"
     gene            262345..262863
                     /locus_tag="VP_RS16515"
                     /old_locus_tag="VPA0258"
     CDS             262345..262863
                     /locus_tag="VP_RS16515"
                     /old_locus_tag="VPA0258"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005476644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX domain-containing protein"
                     /protein_id="WP_005464022.1"
                     /translation="MRHLQSTIHPELDHLDDKIIFQRNAARAIVLDGEDVLLLYTERY
                     HDYTLPGGGIDEGEDVIAGLVRELEEETGAQNIHSIKPFGIFEEFRPWYKDDADVMHM
                     ISYCYTCKIDRELGETAYEDYEVKNGMRPVWMNVHEAIAHNEKTMAESPKKGMSIERE
                     TFLLHLIAKELL"
     gene            complement(263365..264111)
                     /locus_tag="VP_RS16520"
                     /old_locus_tag="VPA0260"
     CDS             complement(263365..264111)
                     /locus_tag="VP_RS16520"
                     /old_locus_tag="VPA0260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005463918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase domain-containing
                     protein"
                     /protein_id="WP_005481481.1"
                     /translation="MKINRFKRWSSCLQIQPPSRLDTVGLFISACLLFSTSFLCQAKP
                     NTTDIEQQYQVLAPYKLQIDQRLTSVNPLLDHIFKQLKSKSLPKSLVLVPMLESSYNA
                     KAVSHANAAGLWQLIPATAMRFGLTVDSNVDERFDTQASTKAALDYLAFLYNKFDQNL
                     ALTLAAYNAGEGRIARAIKKAGTDDFQQLTLPKETHQYVSRFFALEKLIDIGQLQHSS
                     FQPLLLFAAESAAPSQPLIDFSRLPPLVNL"
     gene            complement(264092..264529)
                     /locus_tag="VP_RS16525"
                     /old_locus_tag="VPA0261"
     CDS             complement(264092..264529)
                     /locus_tag="VP_RS16525"
                     /old_locus_tag="VPA0261"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009705036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlgN"
                     /protein_id="WP_005481448.1"
                     /translation="MASAASQRIQYFVRSISEDIKLYQQLLTLLQQQKALYLKFDGEA
                     LNTNVQQQTPILNKLSRSSNERSQCIRELGLPCNDSSVTRIFNALPAKIGAQARKQWT
                     LLETLIKQCQQYNQSNGQSSAAFHELVSQLKQPVQHTYEDKSF"
     gene            complement(264553..264834)
                     /gene="flgM"
                     /locus_tag="VP_RS16530"
                     /old_locus_tag="VPA0262"
     CDS             complement(264553..264834)
                     /gene="flgM"
                     /locus_tag="VP_RS16530"
                     /old_locus_tag="VPA0262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004725067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis anti-sigma factor FlgM"
                     /protein_id="WP_005464040.1"
                     /translation="MKIDKVAGGHVPQTNFQQASKKPVETMEQTKVSEPAFQANTAAI
                     DRAQAEMKSLPDVDMEKVEQVRNALARGELSLDTKALSKAIMQFHTGHE"
     gene            complement(264970..265767)
                     /gene="flgA"
                     /locus_tag="VP_RS16535"
                     /old_locus_tag="VPA0263"
     CDS             complement(264970..265767)
                     /gene="flgA"
                     /locus_tag="VP_RS16535"
                     /old_locus_tag="VPA0263"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011999205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body P-ring formation protein
                     FlgA"
                     /protein_id="WP_005481529.1"
                     /translation="MTYKQEWKPNFRFTESKKIRGKTLISSKWILLLGILSTGQTFAS
                     PDQTTFSSEELKAVVAKHFEQEVDRVAKSNQWGEYQLEYDLWVPGSANHLPKCDAKLV
                     ITGRDNQPLPVGNLKRSVSCEDLTAPWRINVTIKSSVTLPVVVAATTVGRSEVVTANH
                     LKLETRTISRSDDFYTAPKHAIGLETTRRLRAGQVVDPTSLSAPALIEKGNEIIIIAS
                     KDGFSASTKGVALEDGAQGQQIEVENLSSGRVIRAVVTGRNQVHTQF"
     gene            265846..266208
                     /gene="flgB"
                     /locus_tag="VP_RS16540"
                     /old_locus_tag="VPA0264"
     CDS             265846..266208
                     /gene="flgB"
                     /locus_tag="VP_RS16540"
                     /old_locus_tag="VPA0264"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005432433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgB"
                     /protein_id="WP_005463947.1"
                     /translation="MAITFENALGVHPEALNFRVQRTKVLASNLANVDTPGYLAKDLS
                     FTTVMNQMSTNGVSNSVPKLQVQAQYSVPYQNSKDGNTVELGVEQAKFTQNNMDFQTS
                     LTFLNMKFNGLAKAIEGR"
     gene            266211..266645
                     /gene="flgC"
                     /locus_tag="VP_RS16545"
                     /old_locus_tag="VPA0265"
     CDS             266211..266645
                     /gene="flgC"
                     /locus_tag="VP_RS16545"
                     /old_locus_tag="VPA0265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006963060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgC"
                     /protein_id="WP_005464013.1"
                     /translation="MSFTDIYSITGSAMTAQTVRLNTVASNLANADAVSANPDDAYKA
                     LKPVFATVYQKTQMTTENGIYPNAEVRIVDVVQNKGQAEKRFEPNNPLANGEGYVYYP
                     DIDVVAEMADMMSATRSFETNVEVLANVKSMQQGLLRLGQGS"
     gene            266645..267328
                     /gene="flgD"
                     /locus_tag="VP_RS16550"
                     /old_locus_tag="VPA0266"
     CDS             266645..267328
                     /gene="flgD"
                     /locus_tag="VP_RS16550"
                     /old_locus_tag="VPA0266"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017004954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook assembly protein FlgD"
                     /protein_id="WP_005463939.1"
                     /translation="MSLAQYTALSSDAPVKAAAKENSGIAPNPTDKNSASSLQNEFIS
                     LMVAQIQNQDPLNPLDGTEYVGQLAQFSQVQSTENMSKVMQNSMVLLDNMQVLSTAGL
                     VGQTVYVNSKEFELGDGAQNGKIELSHGSNQVTLVVKDQFGQKTNVPLGAHGAGDVEF
                     SINPEELGLKPGKYTVSVEVQEGQASPNVLLAGTVEQVRIPSSGGAALVNVNGVGNVP
                     FYQITQFGA"
     gene            267355..268551
                     /gene="flgE"
                     /locus_tag="VP_RS16555"
                     /old_locus_tag="VPA0267"
     CDS             267355..268551
                     /gene="flgE"
                     /locus_tag="VP_RS16555"
                     /old_locus_tag="VPA0267"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014204707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body protein FlgE"
                     /protein_id="WP_005463978.1"
                     /translation="MSFNIALSGLDATNTELNTISHNIANASTYGFKGARTEFAAVYN
                     GMQPGGVEVASISQNFDKNGSITGTGRSMDLAINGSGFFVTKDHMGQTLYTRSGVFGT
                     DKSNFVTANNGAKLQGYSVDSNNNLMTGSVGNIQVSTSSLNAKATDKLDFVANFDASA
                     KAIDKAVTPFDPADPTSFNSSYTTQVYDSLGNSHTVTQYFTKTADNAWEVNVQVDGGK
                     TPVSTIPVTFNKDGTLAAPTGSFNVAFPAAGANAMSVDINLKGSTQFGAAFGVSTNSP
                     NGYTSGELAGVRVEDNGMVYATYTNGQSQLQGQVVLADFANTQGLAKVSGTAWTQSFS
                     SGAPIMGVPGSGTLGNLTPGALEGSNVDLTSELVALMTAQRNYQANAKTISTSDKLTQ
                     ALFNAV"
     gene            268564..269295
                     /locus_tag="VP_RS16560"
                     /old_locus_tag="VPA0268"
     CDS             268564..269295
                     /locus_tag="VP_RS16560"
                     /old_locus_tag="VPA0268"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017006383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgF"
                     /protein_id="WP_005464045.1"
                     /translation="MDSLLFTATSGASRVLKAQHVRSNNLSNADTAGFRADMERVRSV
                     ELQGPGFDGRTMVVTNSASTRFDSGDVVKTGRALDVAVMGEGYLAVETPAGNEAYTRA
                     GNIQIDTFGAMSINGFPVVGENGPLVVPDYQKIEISERGLVSVIPPGGGAEIAVGTLK
                     LVKPEINQLQKESDSLLHSVDGVPFAADETVQLAPEHIEGSNVSAIDELIGVMSLTRN
                     FEMQVRMMKTAETLAQAGNKLMAAR"
     gene            269321..270106
                     /gene="flgG"
                     /locus_tag="VP_RS16565"
                     /old_locus_tag="VPA0269"
     CDS             269321..270106
                     /gene="flgG"
                     /locus_tag="VP_RS16565"
                     /old_locus_tag="VPA0269"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004725074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgG"
                     /protein_id="WP_005481471.1"
                     /translation="MHSALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDL
                     FYSIQRQPGAQVDQVNELPSGVQLGSGVRVVGTQKVFTQGNTQNTTQDLDLAVMGQGF
                     FQIENSDGQIMYTRNGQFHINSEGLMVNSQGLPLEPQIQIPDNATSFSVGVDGTVTTT
                     TADDPTPQQLGQITLAKFINPAGLEAVGGNLFRETEASGPADELIAGADGAGSIKQGA
                     LEGSNVQVVEEMVDMITTQRAYEMNAKVVSAADDMLKFVSQSM"
     gene            270139..270810
                     /gene="flgH"
                     /locus_tag="VP_RS16570"
                     /old_locus_tag="VPA0270"
     CDS             270139..270810
                     /gene="flgH"
                     /locus_tag="VP_RS16570"
                     /old_locus_tag="VPA0270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017004951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body L-ring protein FlgH"
                     /protein_id="WP_011106240.1"
                     /translation="MKWLSKSWAVAVVLLVGCAGRQEFIPPQPNAEEYAPPKLDYTLP
                     DAQSGSLYRHQYTMTLFQDRRAYRVGDVLTVVLSEETSSSKKAGTKFGKSSAVNFAAP
                     TIGTKKFDELGVSIDGSRNFDGSASSSQGNKLQGAITVTVHDVLPNGVLRISGEKWLR
                     LNQGDEFIRLTGIVRVDDITRNNQVSSQRIADARITYAGRGALADSNAAGWLTQFFNS
                     PWVPF"
     gene            270810..271931
                     /locus_tag="VP_RS16575"
                     /old_locus_tag="VPA0271"
     CDS             270810..271931
                     /locus_tag="VP_RS16575"
                     /old_locus_tag="VPA0271"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016959274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body P-ring protein FlgI"
                     /protein_id="WP_005463987.1"
                     /translation="MKPINTFFSSFLLALTLGLPATSQAEVEIPIMDLVDVRGIRENQ
                     LVGYGLVVGLAGQGDRNQVKFTSQSITNMLRQFGVQIDDSMDPKLRNVASVSVTASVD
                     PMAGPGQTLDVVVSSIGDAKSLRGGTLLLTPLRGIDGEVYAIAQGSVVVGGLSAEGKS
                     GSKVEVNTPTAGRVPNGATLEREIKTDFNQRDEITLNLRKPSFTTAKNIAREINNTFG
                     PNVAVAINKARVDMRAPKDTQQRVIMMSMLEEMSVVEGRKPARIVFNSRTGTVVIGKN
                     VKVGEAAVSHGNLTVRISESEKVSQPNAFADGETKVVNQTDIDVNEELAQMVIWPPGT
                     ELNTIVDAVNSLGATPTDLMSILQALNEAGALNAELVVI"
     gene            271942..272481
                     /locus_tag="VP_RS16580"
                     /old_locus_tag="VPA0272"
     CDS             271942..272481
                     /locus_tag="VP_RS16580"
                     /old_locus_tag="VPA0272"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011999207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein"
                     /protein_id="WP_005481473.1"
                     /translation="MKLDGSSDQAQLNSMLYHDNSALANIKHSRDQEGALEMVAGQFE
                     AMFLQLVLRQMRSSSDVLADKDSPFSSKQQGVFRDMYDGQLAMELAKKQSSGIANMLI
                     QQLSPSMREVAFDSARNVSSANDGKTVDSESISQLELEEITDPFNSTAQAVASVKQVL
                     GEAGMTTAFSQPLIRKMEL"
     gene            272482..273855
                     /gene="flgK"
                     /locus_tag="VP_RS16585"
                     /old_locus_tag="VPA0273"
     CDS             272482..273855
                     /gene="flgK"
                     /locus_tag="VP_RS16585"
                     /old_locus_tag="VPA0273"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017004949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgK"
                     /protein_id="WP_005481537.1"
                     /translation="MNLVNIALSGLNANRVALDVTAQNVANVNTPGYSRQQALMATVG
                     DGKSNRLSSGMGVEVTSIRRVTDQFLVKQTWSTNSLAAYAAGYTSNMSQLENTLGADG
                     FSISAGLDSLNAALNDATVKPESMPYRQQIINESEALARRFNTLTQSLHNQHKDMNDQ
                     RTAALTHANSLMSNIAHVNKQIVEMQGTGGNPAQLMDTREKLIGELSQVIEVKTTDQP
                     DGSMQVTLVSGQPLVMGSDFGQLSAIPDPSDPYLADLHVNFANQSFAIGDSVGGKLGA
                     INDYQTEVLKPNQVALDDMAKALADEYNAVLATGKDLKGNAGKPLFNYDPDNPAASLT
                     ITDLSAEELAFSSDGTPGNANVLKSLIDLSNKPVAVTGYGSVSLNDAFTSMVGQTAIK
                     ARQADADYQAKLAMSKQAHTARDNVSAVNSDEEAANLMTFANAHNANMKVISTANQLF
                     DSVLQLF"
     gene            273867..274766
                     /gene="flgL"
                     /locus_tag="VP_RS16590"
                     /old_locus_tag="VPA0274"
     CDS             273867..274766
                     /gene="flgL"
                     /locus_tag="VP_RS16590"
                     /old_locus_tag="VPA0274"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005435920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgL"
                     /protein_id="WP_005463980.1"
                     /translation="MRISDNQFSQMMLQSLQSNSAGLGKVLQQMSTRERLTKLSDDPM
                     ASIKLLNLERENSAIAQYQSNIANLKTTLSSQETHLDSVNESLKSMRDIVLWGANGSL
                     TDQDRSGMITELKSYRDSIESSFNAQDEEGHFLFSGTKTDTAALNKSSGAYVVEGNSD
                     VRVVTVAKGVTMDSNMTAQEILDIGGGKNVLNQIDALIAEFEKPSPNFQAEVDASLNA
                     IDDTMANVLGAMTEIGGRHNNLDLMDGAHSENKLFVDKVSGDLSALDYGEASVRLSNY
                     MAALQATQASYVKINDLSLFDRI"
     gene            274784..275824
                     /locus_tag="VP_RS16595"
                     /old_locus_tag="VPA0275"
     CDS             274784..275824
                     /locus_tag="VP_RS16595"
                     /old_locus_tag="VPA0275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017007553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin"
                     /protein_id="WP_005481431.1"
                     /translation="MVMSTVEVRAHSIRLGGQEQASIMPTRSADSSSTIKPRPIQVQA
                     DTASAYSVSGIQLTQGQQQATAVQIASKSLQTIGKELTHIKRGLTQAVTQGTQNVPGL
                     QDTLVRSKANIQRVVEQARFDGQKVIDNELHLKLDKADIRRFSIPGLNVHRLSDRAEQ
                     IRLDFPQGQAVMIQFDGQSDGARTVKMLDRSLIAMGMRASLAEDGTILFEARDNAYQQ
                     MQQKVLVTGEGHRFPAGQPNVLNLKSEPDGIAELSFDLGSRDGIKQTISKVNQHLRQV
                     QTSLEEAKAFHGELNTQMRSIQSKSHQLSVDEVNAKLDGFIETSGQFTSTFQALNAQA
                     NVRRHTVVALLK"
     gene            complement(275949..278663)
                     /locus_tag="VP_RS16600"
                     /old_locus_tag="VPA0276"
     CDS             complement(275949..278663)
                     /locus_tag="VP_RS16600"
                     /old_locus_tag="VPA0276"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005497984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2339 domain-containing protein"
                     /protein_id="WP_005481511.1"
                     /translation="MFTTLALITAFFAILIGLKAASRISLLEKELSKLQKEVASLRVS
                     TRRDSKLEASQPEPDTSESSLGAASSMRSDSGDSALSAPSNIEPEFEPSYLATQQHHS
                     EQEQTELNQSQQTQVQLATFTEQEDPLIQKHAQKLIANFQENWLVWVGALAMLIGGGY
                     LVQVIGSHIEFSPLMRVSFAFSLSLLMVLAGEWFHRKEQNNPDRAARAQGFTYVPAAV
                     TGTGLTGIYCTVIFAFVVYQMLTPSVSLIVLAAAAFCSLALSLRQGPLMAVLGLIGGY
                     TAPLWIGGNEPNYFLLAGYICAISFAATLLMQKVHRAWIAPSIAVPHVIWMLLLIESI
                     PTELLFSWLAIYLSITLYLIFAVPRMGWMLNPRFRHYQNKWTNQPTATSLAVALLTFS
                     AITRMPELNTLQMAYCYTLLVAIIWLPALRTGWSLRVFLPSILVSATALIVLTIAFDA
                     LYMLEREASILFALAVSIALIGFRTYCQSLSDRSQISNVLLLVLAPTMGLVTLFYADE
                     FMHGYALYWTLFCALIAAHYAFLSQRLRPLALECSAVVHALISGVAFVWLSDTWLTTT
                     ISIQVAVMALQIQAGFFRPASWAVKIVMGILVVRLTLLPFIPQWQPVESGHWAWVILS
                     YVPSLAILAYARSVLAKQDSDLTNWFEGAFLHVFLMALFTQTNYWLTGQYGYLGHIDF
                     TSAVVFANQALVMGLVYSYRSQFAQQLTLVYQAYSYLLWGAFALLTVWLNSVESPLIS
                     NNVSAQAMPVFNMLSLGWLLPACILIAAVVRRWNTLRVHRLAVACLGFALAAIWLGMS
                     IRQFWQTTSMTLFQPTSMAELFSYSVAGLMVGGALTWRGVTHKAMMMQRIGLVILAFV
                     ALKVFLWDVSSLDGFWRAISFLGLGASLIALGWLFQKLHRSVTQTSEP"
     gene            278978..280777
                     /locus_tag="VP_RS16605"
                     /old_locus_tag="VPA0277"
     CDS             278978..280777
                     /locus_tag="VP_RS16605"
                     /old_locus_tag="VPA0277"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005463905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_005481446.1"
                     /translation="MQVGNEALVLSAVGVIGLGCQWLAWRLRLPAILFLLLAGLIVGP
                     FMQWLKPDEILGNLLFPLVSLAVAVILFEGSLTLNFKEIRGVSGSVWSIVSIGAIISW
                     AATSVATHYFLGFTWELAMLFGSLTVVTGPTVIVPLLRTVRPNSTLANILRWEGILID
                     PLGALFVVMVYEFIVSHSAVNSMEVFGTIIAVGVILGVTSGAAVATVLRRAWLPEYLQ
                     PFAVLMVVLGVFSVSNHIESEAGLLTVTVMGMWLANAKDINIQQILHFKEHLTILLIT
                     GLFIFLAARISLDDFAALGSGALLLFVFMQLVSRPLSIFLSTMRSNLNLKDKLFLSWV
                     APRGIVAASISSLFAIKLTEYGVDGASLLVPMTFMVIIGTVVLQSATARPMAIALGVA
                     EPAPRGFLLIGANRVAREIGQALARYDRRVLMTDSNWEYISQVRMMGLDYYYGNPISS
                     HADDNLNMIGIGQVVALTPDQHFNIMACMQFVDEFGEDKVHCLQKVKTNGNGSEKHSV
                     AQEYHGKLLMGGNVSYTQLASLLSRGAEIKHTKLSENFTYQDYLEHHKTNLVIPLFNV
                     EDKGKIQFCDDPDQFAPSTTSTIVSLILPESAQ"
     gene            281021..282040
                     /locus_tag="VP_RS16610"
                     /old_locus_tag="VPA0278"
     CDS             281021..282040
                     /locus_tag="VP_RS16610"
                     /old_locus_tag="VPA0278"
                     /EC_number="5.3.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011999214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 2 isopentenyl-diphosphate Delta-isomerase"
                     /protein_id="WP_005481444.1"
                     /translation="MAPQTNRKDLHLDAVLHHDMSMKKKTAGFESVEFEHCALPECDF
                     NTIDLSTEFLGHRLALPFLISSMTGGARDAETINCRLAEAASELGIAMGVGSQRISLE
                     ESQHSGLGKTIRELAKGVPLYSNLGAAQLRDKGKLDNAQRAVEAIQADALFVHVNPMQ
                     EAFQKNGDHNWIGVLHAIEQLKPRVNVPIIIKEVGFGISGDVAQRLVDAGVDAIDVAG
                     AGGTSWSAVEGYCQDNPHMQRAAELFRDWGIPTATCLAQIRAQHPKLPLIASGGIHNG
                     LEAAKAIHLGANLVGQAGAVLKAATISTQLVVDHFEQMALELRLACFGTGSAKVNALT
                     KARRL"
     gene            282201..282464
                     /locus_tag="VP_RS16615"
                     /old_locus_tag="VPA0279"
     CDS             282201..282464
                     /locus_tag="VP_RS16615"
                     /old_locus_tag="VPA0279"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005435930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3012 domain-containing protein"
                     /protein_id="WP_005481466.1"
                     /translation="MKKLVMLMLAVSALTACSDEVGTEGWCNDMRDKPKTEWTADNAV
                     DFAKHCVLQDGVGSEQWCESLKDKPKGDWTANEATSFTKHCIF"
     gene            282817..283218
                     /locus_tag="VP_RS16620"
                     /old_locus_tag="VPA0281"
     CDS             282817..283218
                     /locus_tag="VP_RS16620"
                     /old_locus_tag="VPA0281"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010450854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GFA family protein"
                     /protein_id="WP_005481510.1"
                     /translation="MEVLKGSCLCGKVKLEVADEFKYMGNCHCSECRKFTGSDYSSAG
                     GIALDKLLVIQGKEDIQTYQKSENTELCFCRHCGSSLYSKKNNGIVNIRLGVLDDAPS
                     HKPSFHIFVASKAPWLEITDNLTQFEAGPKL"
     gene            283455..285134
                     /locus_tag="VP_RS16625"
                     /old_locus_tag="VPA0282"
     CDS             283455..285134
                     /locus_tag="VP_RS16625"
                     /old_locus_tag="VPA0282"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020334387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LruC domain-containing protein"
                     /protein_id="WP_005481540.1"
                     /translation="MRTGKLIALSGCCLSFSASALMTSDFTFESGSDSSNYSAKGKPV
                     NTYSVAETLPQDVLSNVYSMLPEGTLVNSAFIAPERYSSIDIDEELNGAEFATAKVTF
                     LNEGAGYRNTLGYFVFDTNNPPINKDEIAAHVIIFPNTSKAPDGEMEEGDTIDLNVQL
                     TAGQTLAFFIIPNGWGWSGSYNNIASLGSWGTPFYSYSNLNPESTSENRRHNVAFIDT
                     QNEFLVLGFEDIYRPDGDNDFNDLLFTVEVSPFTAIDGVNTDGSTDSKYEPLVQENNP
                     EVTVTSVYPSSDTYATMAFEDRWPLMGDYDFNDVVWRYRVTELLNGQREIKNITFDYT
                     LQAMGAGFSNGFAVHLPNVNPANIASTVLTRNGEPVTHQVVQSGGEAVLVVSENLRKD
                     LEALGELDSNCTFYRTQTACVSQQTSDVLNYQLTVELSTPVSREQVGYPPYDSFIFAS
                     KDSYHGDFTATPPGMSWQTHFKSFAGTSEMNNSFFNLHDDNSGGAESFLTNNNMPWAI
                     NIRDEWDHPIENVDISKAYPDFPTWVISSGESETTWYQASTANKVIPATQQ"
     gene            285145..285609
                     /locus_tag="VP_RS16630"
                     /old_locus_tag="VPA0283"
     CDS             285145..285609
                     /locus_tag="VP_RS16630"
                     /old_locus_tag="VPA0283"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017818447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005481436.1"
                     /translation="MKHSTKLLMTTLISALIVACGGGGGGGGSTTPPAPAPTPSVQVL
                     DNTADIVAERDFSFDIGEKITLSVNYTGSTEGALHLYSKAAYTTANGDVIADPTSRVT
                     TLYPNMAGDVELEVNGNWTHLYAQWVPMSAQESEQNWSIALNNSNNNYHIDF"
     gene            complement(285765..286115)
                     /locus_tag="VP_RS16635"
                     /old_locus_tag="VPA0284"
     CDS             complement(285765..286115)
                     /locus_tag="VP_RS16635"
                     /old_locus_tag="VPA0284"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005481539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-like domain-containing protein"
                     /protein_id="WP_005481539.1"
                     /translation="MKKAISLFLATLSLGLLAPNVAASERAEQGWQLIEQGAMIVDVR
                     TPQEFSEGHLDNAVNFPLSELDKHFKDVKKDQLIVLYCRSGNRSGQAYQYLQSQGFTN
                     LHNAGGLEELQNAQ"
     gene            286375..286665
                     /locus_tag="VP_RS16640"
                     /old_locus_tag="VPA0286"
     CDS             286375..286665
                     /locus_tag="VP_RS16640"
                     /old_locus_tag="VPA0286"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011082031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone GroES"
                     /protein_id="WP_005481493.1"
                     /translation="MKIRPLNDKLIVERQEVENKSEGGIVLTSQSVKKSNRGKVIAVG
                     LGKRFENGERAAMEVKVGDQIIFNDGYGVKTEKIDGAEYLILSESDVLAIVE"
     gene            286699..288297
                     /gene="groL"
                     /locus_tag="VP_RS16645"
                     /old_locus_tag="VPA0287"
     CDS             286699..288297
                     /gene="groL"
                     /locus_tag="VP_RS16645"
                     /old_locus_tag="VPA0287"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005463958.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin GroEL"
                     /protein_id="WP_005463958.1"
                     /translation="MAAKDVLFANDARQKMLKGVNLLADAVKVTLGPKGRNVVLDKSY
                     GAPTITKDGVSVAKEIELKDKFENMGAQMVKQVASKANDEAGDGTTTATVLAQSFINE
                     GLKAVASGMNPMDLKRGIDKATEAAVEKLREMSKPCSDKESITQVGSISANSDRAIGE
                     IIAEAMEKVGRNGVITVEEGQGLDNELSVVEGMQFDRGYLSPYFITNQENGSVELDNP
                     YILLVDKKVSSIRELLPVLEEVAKSSRSLLIIAEDIEGEALATLVVNNMRGIVRATAV
                     KAPGFGDNRKAMMEDIAVLTAGTVISEEIGLELEKATLEQLGSAKKVTITKDTTTIVG
                     GAAEASAIADRVASIEKQIETTTSQYDKDKLQQRVAKLSGGVAVIKIGAATEVEMKEK
                     KDRVDDALHATRAAVEEGIVAGGGVALTKIAKELADLKGDNDDQNVGIRVALRAMEEP
                     LRQIATNAGDEASVVANAVKAGDADYGYNAATGEYGNMIEMGILDPAKVTRSALQFAA
                     SVAGLMITTEAMITNHVEDKELDI"
     gene            288403..288612
                     /locus_tag="VP_RS16650"
     CDS             288403..288612
                     /locus_tag="VP_RS16650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015728462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005464025.1"
                     /translation="MTRLPAFSFSISEPGGNEASSTWPTAIHFPLVPAGPEFSIENAL
                     PKRPTVTIFTIDLSQLLKGDARVIH"
     gene            288767..289738
                     /locus_tag="VP_RS16655"
                     /old_locus_tag="VPA0288"
     CDS             288767..289738
                     /locus_tag="VP_RS16655"
                     /old_locus_tag="VPA0288"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leukocidin/Hemolysin toxin family"
                     /protein_id="WP_005463923.1"
                     /translation="MNKKILLPLMLGISATAAASDNKVVESVLIDNIALEGYVKKSYE
                     VVMQSEPELFPYEFRGSRVQMKLLVELFHNSKNDKKAARVITLGNGYVPGKPGVKHTF
                     DAAIVDRFTQNYPVAFDYSIYQAGGTPVFSEDYSPQNEANDVSVSTTTVAPSIGLTAT
                     ATPGSAPSFSGSLTTDLGVAYTSRYSSKDYVTAAKPKASMERGMGVKWTTSLSQIYTN
                     DYQYYGKWAGVYHYTGCSNENLLPEENLPRLIYGFKPKFQYVFTPEFERGEEPKTEMI
                     ARAGMKEVDEGFSRNACNWYDQGTTSHYTEAQIRFTIDWDKLTVITQ"
     gene            complement(289828..290439)
                     /locus_tag="VP_RS16660"
                     /old_locus_tag="VPA0289"
     CDS             complement(289828..290439)
                     /locus_tag="VP_RS16660"
                     /old_locus_tag="VPA0289"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004411163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysE family transporter"
                     /protein_id="WP_005481530.1"
                     /translation="MEFVTLALLGVLIVISPGADFVLVLRNSLNQGREAGVYSAIGIS
                     MAISIHIAYSMLGISYLISQNEWLFNLVRYLGAAYLVYLGIKGIFSSQPASNSETIQQ
                     SEYSMWRFFMQGFLCNLLNPKTMLFFLSIFSQVISPDSSQQHIALFYGIYMIALHGIW
                     FSIVAVLFTSLQLQAFLLKIKHRLNQACGAGLVIFGAMLGLKA"
     gene            290549..291439
                     /locus_tag="VP_RS16665"
                     /old_locus_tag="VPA0290"
     CDS             290549..291439
                     /locus_tag="VP_RS16665"
                     /old_locus_tag="VPA0290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005481469.1"
                     /translation="MRHLKSFYVFHVAASSSSYTEAADKLNITHGAVSKQIKQLEQYL
                     SQPLFLKEGRKSVLTAEGELLKTYTKTAFQTLETGVNTLIQEKHQHLEVSCEPTLTMR
                     WLMPRLAAFNDEHRADVRLSTAGGPVTLGATGLSMAIRRDDFAQQHDYNKTILVEEWV
                     GPVFSPEYWQSIQDDLDAVRLLNSQTRPHAWVDWQQSTRCETFNGNTQQSFAHFYFCI
                     QAAVDGLGAAMGSYPFVMDDIKRGNLVAPFGFVLSGCNYVLLSQDKKRTELEHIFITW
                     LQTQMVECVPLPSQQNTQGE"
     gene            291499..291870
                     /locus_tag="VP_RS16670"
                     /old_locus_tag="VPA0291"
     CDS             291499..291870
                     /locus_tag="VP_RS16670"
                     /old_locus_tag="VPA0291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005395273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_005395273.1"
                     /translation="MENLNIVEIKSFVPAKDYALSKRFYEAIGFDMASDFGDVAYFSQ
                     GSCAFLLQNFYEPEHGNNFMMHLLVEDAESWHQHLSKVGHEEFGSRLTELVEQPWGMR
                     ECCLFDPSGVLWRIGQNMNTD"
     gene            complement(291971..292192)
                     /locus_tag="VP_RS16675"
                     /old_locus_tag="VPA0292"
     CDS             complement(291971..292192)
                     /locus_tag="VP_RS16675"
                     /old_locus_tag="VPA0292"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017635120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005481464.1"
                     /translation="MYVLNKLGQGLIFLPTIFCFSYILRPILMVILIPGGLALLALIG
                     GAEVRAELKAMLLEELFGVSPSHTTSKKA"
     gene            292318..292854
                     /locus_tag="VP_RS16680"
                     /old_locus_tag="VPA0293"
     CDS             292318..292854
                     /locus_tag="VP_RS16680"
                     /old_locus_tag="VPA0293"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005481442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_005481442.1"
                     /translation="MTKRQQTRDKILKAAWASFAQNGYDMTTTRQIAREAGVADGTVF
                     SHFPTKLSILREGMLTQLQQISQETLVSVEGKTAIEIGLALTEKYYRYYFANVELSRA
                     LLKEVIWDLDYYQSFNQALFQSASVSSVLEDKIPLIFDCYFMTLIAHLSRAEPDVEAA
                     LTDLHAKFRQIIPIESLG"
     gene            complement(292928..294370)
                     /locus_tag="VP_RS16685"
                     /old_locus_tag="VPA0294"
     CDS             complement(292928..294370)
                     /locus_tag="VP_RS16685"
                     /old_locus_tag="VPA0294"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005481536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005481536.1"
                     /translation="MTFRQEYNGCKSFVCPNCGVPDLSLYSRSNRLGYDAWHCPECGA
                     YPPVLINEPILALAHQLQQQTFELKLLPHCECRLPAWQRYGRTAVGSPRVKCRCCQKT
                     ATLPNPIKESRTLQPLLDALLAEVSPKDLQYKLGLNHRRFSQSLERLASMLDTFSRLY
                     ERHLSFSNIQTRSFVQVARSGFRHHGREQRAAHIWTLCSADAQTGYVLLLSDNAWFPQ
                     TEMSEHVIPQPLWEQSRYQLTQQEEMPNESDIFLQAQRTYDKILSRSQFDQLAYCDGS
                     HAKSKEVLLTRPVFAAHAHMQNLAKYFANKVPKRFVLEHESFLRGAAITAFTSAIKRG
                     TTQLYYCHIGQSEENLSLNHAKQKMSWWDETWRRGNIQNQYGSWQVGMGWLTQKSARP
                     SESIDELIPAHPNWNSEFWNRYTQWLPPSYAAHLSLQRIKQWQAIYRFLYNYSAMQSP
                     PKVGVDEIDLSRVDSIAESINRSVNAPVHL"
     gene            complement(294404..295969)
                     /locus_tag="VP_RS16690"
                     /old_locus_tag="VPA0295"
     CDS             complement(294404..295969)
                     /locus_tag="VP_RS16690"
                     /old_locus_tag="VPA0295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleotidase C-terminal domain-containing
                     protein"
                     /protein_id="WP_005481484.1"
                     /translation="MKTFSKKPLLYALAAFSIGVSFSSFAEIRNVTLLHTNDIESVYE
                     PVDAFWNPDISRIGGIPYLATLIKQTRAQEETSFLFDAGDIFTGSLAKKTQGKLSFDL
                     YSAMGYDAITLGNHEFEYGWQTLKENMPRAAYPVLNANIKFEQNNAPFASPYTIVERD
                     GIRVGVIGVMGVDAFYNTMWKGNRKGLTIDDPIKITQFWVDKIRDEVDMVVVLTHQNK
                     TAPMQTDKEADPEVQRGFDEDYDMAGKLKGVDVIFGGHSDHGLWKPVVHPKTGTVIGL
                     TFGQGKYLGYTKFAVDTEKHDVKLLDGKLIPVESDKLERDKKTSDLIANARKQYPELG
                     QQLAAINDTAYRRYYRESNVGNLVADMMREAAKADVGMISSGSIRVDLNKGPVTMENV
                     MDLFPFTDKLSVVKLNGVQLKELLEYSYTLPYGLAQFSGIEAHYDNAKPQGKRLLSLN
                     VNGKPVNDSQSYKVATYSYAASGGDGYHVFEKGTLESQGDSVTQVLIDQFKAKKNVTV
                     PALGRQVDVSVKE"
     gene            296248..297303
                     /locus_tag="VP_RS16695"
                     /old_locus_tag="VPA0296"
     CDS             296248..297303
                     /locus_tag="VP_RS16695"
                     /old_locus_tag="VPA0296"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005481503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitronate monooxygenase"
                     /protein_id="WP_005481503.1"
                     /translation="MKNNAFNALLGTELPVIQAPMAGVQDSQMAIAVSNVGGLGSLPC
                     GMLNKDAIVKELQLIQQATNRPFNLNFFCHEMPKYDANKHEEWQKTLQPYFAEVGATV
                     QAQPNAPTRMPFNHDIADAIEPFAPPVISFHFGFPADDLLARIRGWGGKILSTATTVD
                     EALWLEAKGVDGIIAQGLEAGGHRGMFLSDDLSTQLGLLALLPQIVKRVNLPVIAAGG
                     IANKSGVEAALKLGASAVQVGSAYLLCDEAKTSSLHRYAIASERAQHTAVTNVFSGRP
                     ARGIVNRAMSELGYICESAPKFPYASIEMTQLRALMEKQNRDEFTPLWCGQNSSGCKE
                     VSAAEMTLSLVEGIDLN"
     gene            complement(297376..298776)
                     /locus_tag="VP_RS16700"
                     /old_locus_tag="VPA0297"
     CDS             complement(297376..298776)
                     /locus_tag="VP_RS16700"
                     /old_locus_tag="VPA0297"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000105920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIC"
                     /protein_id="WP_005463953.1"
                     /translation="MSTITAQATNNSDFKKLLSTMKGHLLFGTSHMLPFIVAGGVLLA
                     LAVMASGKGAVPADGLLADISNIGIKGLVLFPIILGGFIGYSIADKPALAPAMISSGI
                     MADMGGGFLGCIVAGFIAGGVVFQLKKIPLSANMTALGAYFIYPLVGTLISAGIVLWG
                     IGEPIKIFMASMNEFLASMAGASKVVLGTILGGMTAFDMGGPINKVATLFAQTQVDTQ
                     PWLMGGVGIAICTPPLGMALATFLFKKKFTKQEQEAGKAAAIMGSIGISEGAIPFAAN
                     DPVRVLPSIVAGGIVGCVFGFLTDVLLHAPWGGLITAPVSSNIPMYVVGIALGSLTTA
                     VIVGFWKPVADEEAEDEIVEAAPTQAQAAPAAGEGEYDIVAVTCCPSGVAHTFMAAKA
                     LEKAGAAAGLKIKVETQGQNGIQNRITDLDVANAKLVILAHDIQVKDAHRFAKANVVE
                     CSTKEAMRNAATLVKA"
     gene            complement(298788..299228)
                     /locus_tag="VP_RS16705"
                     /old_locus_tag="VPA0298"
     CDS             complement(298788..299228)
                     /locus_tag="VP_RS16705"
                     /old_locus_tag="VPA0298"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005436338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIA"
                     /protein_id="WP_005463920.1"
                     /translation="MITELTNVNLIKGNLQANNKKEVFEELAKMLFENNRISSKEAFL
                     TDIEARETLSVTSMDGIAYPHAKSKAVTEPAIAVGVKREGIEYGDEEGVKPTVFFMIA
                     SPDNGADHHIYVLQELFGKFSEEFIEDIHNAKDENQILNILINS"
     gene            complement(299493..300455)
                     /locus_tag="VP_RS16710"
                     /old_locus_tag="VPA0299"
     CDS             complement(299493..300455)
                     /locus_tag="VP_RS16710"
                     /old_locus_tag="VPA0299"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005464008.1"
                     /translation="MSPSRKLTKGLLHQLDLNLLKVFIVLAEEQKTVLAAKRLNMTQP
                     AVSRALSRLRQHFNDELFVRTRHGLKPTRKGQLLADNLPRIIDELSIVLEGLDDFDAG
                     SHAAHIRIAINNFFGVSLPAKFYLKINKLAPNMVFSIENWGPTTLNRLVNGDIDLGIN
                     YSLNNVPKEISRRYLANDHFQIFAREGHPLTEKIVTVQDIASFPIVSAIVPDWNEKKP
                     RIIQLDQSQTLGFNVAFRSESIASLLEITATSDVLFPTSMYLLQNHHPRLSKLTLAES
                     IVETLVSESQEIELYMHYRNRSNPMFKWLLSIINELFEYDFPQD"
     gene            300631..302124
                     /locus_tag="VP_RS16715"
                     /old_locus_tag="VPA0300"
     CDS             300631..302124
                     /locus_tag="VP_RS16715"
                     /old_locus_tag="VPA0300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1254 domain-containing protein"
                     /protein_id="WP_005481490.1"
                     /translation="MNLKAVPKALLVTLLASSLPISSVAYAAPNANESSLVQQQWEGN
                     WPTQNEAEKLVQELYYQRAISAYYQMQPAMNVIGMRDGSESKFGKGYNVLPIWKDRMD
                     SRTLVPTPNADVVYSMNYLDLKETGPLVVAAPPKVIGMFTDFFQRTITDVGLIGPDRA
                     RGGLYLLLPPNYDGPVPKGYFTFTSSTNNVFLFFRTVMKKGENGADPSDAVKIAEQTR
                     IYPLWDEEKNIQPMKFPNASGQRINMMYPTDFSYWEKMKQFVDEEPISAISPELRGVL
                     ASIGIVKGKPFNPTVEEKQLLEKAVKTAPKMITAQRLLGRKDERNLYYKDRQYERAWA
                     GATSEYMQESYLDIDQRAAFFQYAYSSAPAMVMRTMNAGSKYPFTVRDSKGDILNGSH
                     QYKLHLPANPPAKLFWAVTLYNVVDGTMPETSQLLPSKNGFDNIEKNTDGSIDLYFGP
                     QLPNGAPESNYIKTIPGRDFLTAIRLYGTGIEFFDQTWKPDDVLKIK"
     gene            complement(302385..302861)
                     /locus_tag="VP_RS16720"
                     /old_locus_tag="VPA0301"
     CDS             complement(302385..302861)
                     /locus_tag="VP_RS16720"
                     /old_locus_tag="VPA0301"
                     /EC_number="1.8.4.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005481508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-methionine (S)-S-oxide reductase"
                     /protein_id="WP_005481508.1"
                     /translation="MEKIYFAGGCLWGVQEFMRHLPGVISTEAGRANGKTDNTQSEYD
                     GYAECVRTEFDPSQVSIETLMGYFFEIIDPYSINKQGDDVGEKYRTGVYSRDTKHLEI
                     AKSFIATRYDADKIAVEVLPLKNYVPSDEEHQDRLTRFPNDYCHIPLDLLHKYKNK"
     gene            303043..303432
                     /locus_tag="VP_RS16725"
                     /old_locus_tag="VPA0302"
     CDS             303043..303432
                     /locus_tag="VP_RS16725"
                     /old_locus_tag="VPA0302"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_005481479.1"
                     /translation="MKIEHVAIWTERLEELKGFYEKYFNAVSNDKYHNPKKHFSSYFL
                     SFESGARLELMSMEGVTTCENSHSMQVTGLAHFAFALGSEQAVDQITKTLVEDGYQRI
                     DGPRYTGDGYYESCVLDPDGNRIELTV"
     gene            303524..304264
                     /locus_tag="VP_RS16730"
                     /old_locus_tag="VPA0303"
     CDS             303524..304264
                     /locus_tag="VP_RS16730"
                     /old_locus_tag="VPA0303"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017189618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR/GlpR transcriptional regulator"
                     /protein_id="WP_005463954.1"
                     /translation="MNPRQNEILQLVNDRKRVQVTELSDIIGVSGVTIRQDLNFLEQQ
                     GYLKRVHGAATALQSDDIDTRLEVRFDIKQTLANKAADLVAPNETVLIEGGSANALLA
                     RTLAERGDVTIITPSAYIAHLIRNTSANIILLGGVYQHQGESLVGPLTKLCIENIHFS
                     TAFLGIDGFHQDTGFTSRDMMRADIAEAILAKKRRNIVLTDSSKFGQIYPSSIGKTNE
                     ISVLLTDKAAPKSDLEQLKKLGVEVVLG"
     gene            complement(304283..304639)
                     /locus_tag="VP_RS16735"
                     /old_locus_tag="VPA0304"
     CDS             complement(304283..304639)
                     /locus_tag="VP_RS16735"
                     /old_locus_tag="VPA0304"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005452996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_005463914.1"
                     /translation="MHQHEKLNYVEFGTPNIGATKAFFEHVFGWQFVDYGPDYAAFSG
                     QGLDGGFYSAEQVSQTSNGAALLVFYSSDIHATLEKVAKFGGQIIRPIFEFPGGCRFH
                     FTEPSGNEFAVWSESH"
     gene            304896..306410
                     /locus_tag="VP_RS16740"
                     /old_locus_tag="VPA0305"
     CDS             304896..306410
                     /locus_tag="VP_RS16740"
                     /old_locus_tag="VPA0305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006712977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="WP_021450939.1"
                     /translation="MQMSKSFLLITVGLASTSLQAQTLTRDNGAPVGDNQNSITAGEN
                     GSVLLQDVHLIQKLQRFARERIPERVVHARGTGAHGEFVASGDFSDLTVSAPFTEKGK
                     VTPVFVRFSTVIHSKGSPETLRDPRGFATKFYTEQGNWDLVGNNLPVFFIRDSIKFPD
                     MVHSLKPSPVTNVQDPNRFFDFFSHEPSATHMLTWVYSNLGTPASYRTMDGFGVHAYK
                     WINQQGDVNYVKFQWKSQQGIKSLRPNKVTEMQGKDFNHLTNDLYAAIGRGNYPKWDL
                     YVKVLSPEALSKLDYNGLDATKVWLNVPDRKVGTMTLNRLPENFFLETEQSAFAPSNL
                     IPGIEPSEDRLLQGRLFAYADTQLYRLGANLFQLPVNRPLTSVNNHNQNGLSNNAQLS
                     NGDVNYEPSRKLNLAEDNQFKAVETKLVGTVQQKAISKPRDFYQAGVLYRSMNEQDRS
                     DLIANLAGDLNKVIDKDIKATMVSYFYRADKEYGSRLAEATDTNLSQVKNKAMM"
     gene            306512..306979
                     /locus_tag="VP_RS16745"
                     /old_locus_tag="VPA0306"
     CDS             306512..306979
                     /locus_tag="VP_RS16745"
                     /old_locus_tag="VPA0306"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005490844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ankyrin repeat domain-containing protein"
                     /protein_id="WP_005490844.1"
                     /translation="MKNVFLLSSVLFSLGLSFSLFASQDKLETQYQSLVELFFDAARI
                     GNNEVVETFVSQGFPIDQRNNESYTALMVAAYQGNKDTVRLLLDSGANACLQDKRGNT
                     ALMGALIKREISIAKDLYQAECSPDLRNKAGLDLKTFAEIYGQSEVLKSLQNK"
     gene            complement(307098..307751)
                     /locus_tag="VP_RS16750"
                     /old_locus_tag="VPA0307"
     CDS             complement(307098..307751)
                     /locus_tag="VP_RS16750"
                     /old_locus_tag="VPA0307"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009706388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinamidase"
                     /protein_id="WP_005479858.1"
                     /translation="MTVRVNYQTTAVIDVDPEKGFSELCPDELPVAGALDIVPELLKN
                     HAKGRLKLVSRDLHPPKAAWDAETPANMLEPVGLPNVDVKWNRHCVLGTTGVELLDGL
                     PPVLDYDFQVNKGMDPDAHPYGIFFHDVADTKTTGANEFLKCNKIDTVVVGGLALDFC
                     VKKSVMQALDLGFKVIVNLAATRAVLPDTVDSVIAEMKEKGALFVKNADDIIVERFA"
     gene            complement(307784..308509)
                     /locus_tag="VP_RS16755"
                     /old_locus_tag="VPA0308"
     CDS             complement(307784..308509)
                     /locus_tag="VP_RS16755"
                     /old_locus_tag="VPA0308"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005373953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_005463941.1"
                     /translation="MIVTVDIIPFRLSGCADKGLEVLLIKRSNPNRPYHGVWALPGGF
                     VFDKDLTSEGGRPADENFEAARRRICREKIHTYPRHFSEAFIDGDPKRDPEDWSLNIT
                     HYALVDRNNVEQINNAGVPECQLKWFPLQAILNGEETLAFDHQKTIEKAWQKLRASIE
                     YTSVLLFALDKEFLVADIISAYQEFGIDISRMTIKRRLIDSGVLKPTNKVASTNKGKG
                     GKPAMVYTLTSDEVTFFQNCLRG"
     gene            308809..310119
                     /gene="pncB"
                     /locus_tag="VP_RS16760"
                     /old_locus_tag="VPA0309"
     CDS             308809..310119
                     /gene="pncB"
                     /locus_tag="VP_RS16760"
                     /old_locus_tag="VPA0309"
                     /EC_number="6.3.4.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009706387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="WP_005479835.1"
                     /translation="MTTTLFSSRIIQSALDFDVYKVNMMSAVAALYPDAMVSYKFIVR
                     SEEDLSELLPEVKAEVLKLQDVRFTEDEIAYMKRVAPYLKPEFVEALRHFRFNPQSDV
                     SFHNKTMSDGSSQLRITINGLWKETILYETIIMSIVSEVRSRQRWSDIPFEQFQTVLE
                     DKVRYLKAELERRNITNFKFADMSTRRRFSFQAQRTMLEYLSKELPQCLTGTSNYHLA
                     RELDLTPIGTVAHEWFMGHQALVNVRDSQKIALQRWQKMFNGALGIALTDTIGIDAFL
                     KDFDEELSHAYVGVRHDSGCPFTWGEKMIAHYESLGIDPMTKTLVFTDGLNFEQALDI
                     CEHFQGRVQVSFGIGTSLANDMGNYVNDQGEAYQPLSIVIKMVTCNGSPVAKISDEPE
                     KAMCEDIFFLMNLKRRFEQPLDLNECRKLIDRLESEGQNYLIDA"
     gene            310413..310772
                     /locus_tag="VP_RS16765"
                     /old_locus_tag="VPA0310"
     CDS             310413..310772
                     /locus_tag="VP_RS16765"
                     /old_locus_tag="VPA0310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004744564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479882.1"
                     /translation="MNLVVHLQKKAIRKHGYEMATRQAWKCGIKANLVRRVIGLFKGQ
                     IVCVVEGCRAELSSVVNNQLHDEEKQGRYVFVGGVCWEPNNIIAPGFPDFMFMHVRNL
                     SHRHKYLTDDELFLSLA"
     gene            311025..311543
                     /locus_tag="VP_RS16770"
                     /old_locus_tag="VPA0312"
     CDS             311025..311543
                     /locus_tag="VP_RS16770"
                     /old_locus_tag="VPA0312"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine zipper 2TM domain-containing protein"
                     /protein_id="WP_005479777.1"
                     /translation="MNMKSIAIATAVVAVLAGCKDKTPPAPTQANITLVEAVTETVKN
                     PHQVCKDVVVTQQVEPTDDNKIIGTVGGAAAGAALGNQIGGGSGKVIATAAGTIAGAL
                     TGRKIQENVQKGDVITTTKKQCHTEYTTSEKVVGYDVTYEVAGAPTTVRMASKPATKT
                     FPIQDGKVVLPQ"
     gene            311714..312493
                     /locus_tag="VP_RS16775"
                     /old_locus_tag="VPA0313"
     CDS             311714..312493
                     /locus_tag="VP_RS16775"
                     /old_locus_tag="VPA0313"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_005479901.1"
                     /translation="MEDFYLNSRGLAGYFEAQWFDKFVEDKQVDAITSESKLVPLSFA
                     KSSHCSQVADFITQAVSKNGKPPHALLGVGAALGRNYYELVQRLDSLKQATLVEPSGM
                     LLNGLKQLLVEEQQVELTYIHGLNTLKTVEVDNRELVQNCAHVDLELINQPLEKDTVS
                     KFYDLVVCLNVLDQCESPLRVINALKQATQIGGVLVVSCTYQWNAKHIKDRAEAVDDI
                     KAYFGEDWRFVSEAEHEYRMRFNERYAMQFLSHVVAYVRTT"
     gene            complement(312565..313473)
                     /locus_tag="VP_RS16780"
                     /old_locus_tag="VPA0314"
     CDS             complement(312565..313473)
                     /locus_tag="VP_RS16780"
                     /old_locus_tag="VPA0314"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010453083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_005479806.1"
                     /translation="MKVTSVGAAMLLLIVGNLIAVLSDSLIKSVANEVPMFQFVFFRQ
                     ISAVMFLLPVCLLAKQTNFMEGFKWHAVRAHVWLLGAVFMVMAISSLPLATANAIFYA
                     APLIMLPLAAIFFGEQLSKQSVAAAVMGFAGVLVIIRPDQIDWAAISAFVVALTLAIN
                     NLLIRKLPKNQSVMQTLLMTNLAGIPVALLLVLIEDQPWQWGAFPVAAGSSLFIMIYA
                     ATCVLAYRSIDSNKIASAEYSGLIGAVVVGFIWFGEIPDIFMAIGTVMIVVPLIWLSK
                     RERRKQKEHAQLQAQKEHEQQQAHVA"
     gene            313565..314449
                     /locus_tag="VP_RS16785"
                     /old_locus_tag="VPA0315"
     CDS             313565..314449
                     /locus_tag="VP_RS16785"
                     /old_locus_tag="VPA0315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009706381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005479909.1"
                     /translation="MKLPPLRAVHCFEVVARNLSFSLAAEELNVTQSAVSHQIRLLED
                     YLGESLFIRQGRKLSLSDSGARYLEDISPAISSIAMASQKVREGDKGSIRLAIYSSLA
                     VKWLIPRLADFKRLYPEIDLTLNMVAGDPEQTDSVGDCFITVQRPKRNYMAVKLYAET
                     LYPVCSHKIWKEIQDQSIPDALWQYPILSTDSIYRERGKDWAEWCKAGGYTLPNDVDV
                     QHFSHMLLAIEAARYDQGIAFANDFMLNERDKAQDLVYIPSHGLETGDSFYFVHKKNR
                     AKQAEIVKLTNWLKQQCL"
     gene            314632..315246
                     /locus_tag="VP_RS16790"
                     /old_locus_tag="VPA0316"
     CDS             314632..315246
                     /locus_tag="VP_RS16790"
                     /old_locus_tag="VPA0316"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019278047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane beta-barrel protein"
                     /protein_id="WP_005464189.1"
                     /translation="MLKKTWLTAALLATCSMANAAPYIGASIGKATFDDISGSIKSNT
                     YNASEKLEVKDNESLSGKVFGGYTFNEYISLEGAIGGYDALDGSVVTVGDMKFLAIQP
                     KLTLPIGDRFNLFAKAGLSYFNAEFKVSNSVLTGDEGHTTFSETTVTGLYGLGAEFAI
                     TKNLALQVEWEYMKPELDVAKLGSEKVTVEAEISAFSVGMSYRF"
     gene            315405..317063
                     /locus_tag="VP_RS16795"
                     /old_locus_tag="VPA0317"
     CDS             315405..317063
                     /locus_tag="VP_RS16795"
                     /old_locus_tag="VPA0317"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SgrR family transcriptional regulator"
                     /protein_id="WP_005479873.1"
                     /translation="MNDVNLRYLDFLLKHFEPHKHHLVTLSELESVICTSRRNVSIVM
                     KKLAAYGWVDWQPAIGRSNPSRLSITITLQQAMTEFLVEELARGRMNSITKLIDWFGQ
                     TAVRSLTIASEKVNELNESKNAILISSYPWVSNIDPAETFRHTELHVVKSVYDGLLTQ
                     NSNGGIEPALAHEWKMEENVMTLWLRPGIFRHDGELLSIDDVVWSLERLKQIKGPVYE
                     LWQCIETVTAETPNCLKIVLKRANQFFPYMLATPHASILCRDTASFGSGYSYHIGTGP
                     FRISSWNKESITLQAHKEYFSARALLDQITLSHGDVQNLNMLSFNQVSDHVEIEKISA
                     LSYLTYRERRDSQLTKQEWQQLANYINQQKRHHEPQSAVDSIQLSPLEPSCSAETAPT
                     LQGKVVLAEPIWTIPNLMRHSEWLHEVIRSTGLELEVIKVEDISFPESVSHLADLLFI
                     EEVMEAPFEYGVFEWLSVATGLRFSFEQNQMERHREQLQEAIAYEQPISHLLGIEEAL
                     RAQYVYLPLFIGYEEVTKTQQVRGVQVKNTGYSDLHRLWLAHSS"
     gene            complement(317154..317930)
                     /locus_tag="VP_RS16800"
                     /old_locus_tag="VPA0318"
     CDS             complement(317154..317930)
                     /locus_tag="VP_RS16800"
                     /old_locus_tag="VPA0318"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005429041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MipA/OmpV family protein"
                     /protein_id="WP_005464165.1"
                     /translation="MNKTLIALLTLAAAGTATAGDTYIRNGNIYNNQGGWVAEVGVAQ
                     GSDLFKDQKHNTAPILNGGYHGEDFNADLGGINYRFLGETNDLINMSAYVVGSGIIRD
                     GDVAKSLKGTQKRRLAVDLGLNTDFTLDEHNVISTYLQHDISGAYKGYLAGATYFHIM
                     NFGSVDFVPFANLTYQSEDYVDYYFGIKDREATANRKAYKGDATVSYGLGYKLVMPIN
                     DNWQINQTTQYTRLGSGISDSSVVDSANQWVVGASVSYNF"
     gene            complement(318146..318670)
                     /locus_tag="VP_RS16805"
                     /old_locus_tag="VPA0320"
     CDS             complement(318146..318670)
                     /locus_tag="VP_RS16805"
                     /old_locus_tag="VPA0320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper resistance protein NlpE"
                     /protein_id="WP_011106247.1"
                     /translation="MKKTMLALTGAVIILAGCQDEKPVETSAVETPQAVEMEVTDTEL
                     PVDAVPVEEEQVITTETFVDSEHNAKNALDWNGVYKGTLPCADCAGIDVTLTLNQDGS
                     YVLEQDYQDKEDGKFKSEGHFTWDENGSIVTLTDEDAPNQYFVGENMLMMLDMNGEKA
                     TGELASFYNLTKQQ"
     gene            319047..319337
                     /locus_tag="VP_RS16810"
                     /old_locus_tag="VPA0321"
     CDS             319047..319337
                     /locus_tag="VP_RS16810"
                     /old_locus_tag="VPA0321"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005373924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF134 domain-containing protein"
                     /protein_id="WP_005464150.1"
                     /translation="MARPKIERRICGRAAHHCFKPNGVPFHQLEQVAILPEELEALRL
                     ADLEGLSQQQAADQMGISRQTFGNTVKSARFKVAKSLVEGHALVFPNEESNL"
     gene            319334..319834
                     /locus_tag="VP_RS16815"
                     /old_locus_tag="VPA0323"
     CDS             319334..319834
                     /locus_tag="VP_RS16815"
                     /old_locus_tag="VPA0323"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dinitrogenase iron-molybdenum cofactor domain
                     protein"
                     /protein_id="WP_005479888.1"
                     /translation="MIYAIPNDGERVANHFVKAPYIAIYSDTDGMLKNLANIAAMPQA
                     GCKAKSQLIQSLQDYNVEAVLVRNIGERALEKLLHSGKQVFRLSTRSSLEDVLAVPRE
                     PLTDASQGRPSTNHQKKGGCGSCGCGGKKAKPSLLARPKQAAALFAAKSSPAILSVKA
                     SIKKAG"
     gene            319836..320045
                     /gene="nqrM"
                     /locus_tag="VP_RS16820"
                     /old_locus_tag="VPA0324"
     CDS             319836..320045
                     /gene="nqrM"
                     /locus_tag="VP_RS16820"
                     /old_locus_tag="VPA0324"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(Na+)-NQR maturation NqrM"
                     /protein_id="WP_005464141.1"
                     /translation="MVWLFTFLGFLAIILLMSLGVIFHNKRIQGSCGGLNNVGVDKVC
                     NCETTCAEPERHLYQISEPNSSPER"
     gene            complement(320023..320835)
                     /locus_tag="VP_RS16825"
                     /old_locus_tag="VPA0325"
     CDS             complement(320023..320835)
                     /locus_tag="VP_RS16825"
                     /old_locus_tag="VPA0325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005373921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase"
                     /protein_id="WP_005490790.1"
                     /translation="MKTGSPVSQQELNQMGSAKVFLIEKDGVQVIEKRNPTQIEVAFY
                     QRYAELFNALGIHVPRLIQFDDQKNVLHIEYVPHAVDQAFLLEDDRVIEQLVKLHQLP
                     PTSDGIYHRHQWTPQATQQALTTLELGSETEQFFHNLQQRSAHLFDGQNLISGDSNAG
                     NWGQRENGELVLFDWERFSTGHVAIDLAPLIEGMGTFDDYLKVAGRYIKCAEKGETTE
                     LARDIGIAKAWIVVEVVNILVSRKNPQTSKYLDWFRQTLPQWAKSLSAQVMS"
     gene            321023..321217
                     /locus_tag="VP_RS16830"
                     /old_locus_tag="VPA0326"
     CDS             321023..321217
                     /locus_tag="VP_RS16830"
                     /old_locus_tag="VPA0326"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011081853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005373920.1"
                     /translation="MAVMKQDIPNRVTVYHDNIDQEQELKNAMLPEKPRYFNGAPTYK
                     ANSIEEFESKISQIGLSLDK"
     gene            complement(321293..323317)
                     /locus_tag="VP_RS16835"
                     /old_locus_tag="VPA0328"
     CDS             complement(321293..323317)
                     /locus_tag="VP_RS16835"
                     /old_locus_tag="VPA0328"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_005479820.1"
                     /translation="MLINKIRNIAFVGQTGTGKTTLIEKLLFTCDATHHLGSVEKGDT
                     VTDFDPQSIQYQHSIEATPVALRWNKHRLNIIDTPGQNELLGRTISVFPAVETSALVI
                     DPQTPLNQTSDRLFTFAKEQQKCQMIIINKLDNHGNQLERLLENIVEHFGDHCLPINL
                     PSADGESVVDCYFEPELGRETLLATVDEAHETLIDQVIEVDEELMELYLEQGSELTAE
                     QLHDPFEEALRTGHVIPVCFVSAQTGAGVELLLRTLAEIMPMPNEGNPPLLEKNGKKI
                     KVNCETLEHTVAHVYKVSVDPYMGKLAYLRVYQGEINAGSQLYIGESNKAFKVGHLYQ
                     LQGKDRTEIPRALAGDFCVLAKVDDLEFDSIVHDSHEEDGVQLKTLDLPDSMYSLCLK
                     PLKRGDEQKLGDVLNKIASEDPSLRIEHRARTNETIISGQGEFHLKVALEKMANVYKL
                     DVETCQPSVEYFETITKPAEGHYRHKKQSGGAGQFGEVQLKVRPLERGAGFKFINKVV
                     GGAIPTALIPAVEKGILQALEEGAISGNPIKDVEVTVYDGKYHSVDSKEIAFVIAGKK
                     AFLDAINNADPIVLEPIVQMELHIPTANVGDVSGDLSGNRGLIEGTEPIDSSFTLLRA
                     KSPVNELQDYARRLRSITGGEGSFSMTLSHYEPAPPAVQKQVCQGSTQQG"
     gene            complement(323611..324603)
                     /gene="ycjG"
                     /locus_tag="VP_RS16840"
                     /old_locus_tag="VPA0329"
     CDS             complement(323611..324603)
                     /gene="ycjG"
                     /locus_tag="VP_RS16840"
                     /old_locus_tag="VPA0329"
                     /EC_number="5.1.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017819792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-Ala-D/L-Glu epimerase"
                     /protein_id="WP_005479845.1"
                     /translation="MKIHVEPVTIAMATPFRISRGSRTECHVVRVTIEHRGMIAQGEC
                     TPYPRYGESVESVIKAISHAAHELQSLYAKGDADVMALKSQLQSLLPAGAARNALDCA
                     LWHLHALLSQKQQVHDLFTLPEAIVTAMTVSIDTPQAMAKQAQAYLSQGAKLLKVKLD
                     GENVIERVAAVRDAAPHAQIVLDANEAWQSLDLATVFAQLEPFNITMIEQPLPQDCDD
                     VLASIPHPIPLCADESCHTREQLPQLVGKYEMVNIKLDKTGGLSEALLLADDAKELGF
                     SLMSGCMLGTSLAMRAALPIAAQASVVDLDGPVLLGQDVTPSLVYRDGEIVLSK"
     gene            complement(324655..325659)
                     /locus_tag="VP_RS16845"
                     /old_locus_tag="VPA0330"
     CDS             complement(324655..325659)
                     /locus_tag="VP_RS16845"
                     /old_locus_tag="VPA0330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005531797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1611 domain-containing protein"
                     /protein_id="WP_005479828.1"
                     /translation="MQIAQPYLLFLGDVTDPLAAKTARGIYQWRPEICLGQIRLTPET
                     VSLGLTDMTLQQAQQQGAKTLVLGTANPGGVIPEAWQATLLEAAEMGFEIASGMHQRL
                     AEFAPLADLEQRGLTKLYDVRHYDAPLKVGNGKARAGKRVLTVGTDCSVGKMYSALAI
                     EHALKRKSCRAEFKATGQTGILIAGSGISIDAVVADFISGAVEAISPDFTDHDWDIIE
                     GQGSLFNPSFAGVSLGLLHGAQADALVLCHEIGRPHIRNLPHASLPTIEQTIEANLAA
                     ARLTNPKAQLVGICLNTSAISEEDAAQLCQDWSDKYQVPVTDPVRFGVNAVADKILTI
                     "
     gene            complement(325761..326642)
                     /locus_tag="VP_RS16850"
                     /old_locus_tag="VPA0331"
     CDS             complement(325761..326642)
                     /locus_tag="VP_RS16850"
                     /old_locus_tag="VPA0331"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005479800.1"
                     /translation="MNLRQLEVFYAIMQAGTVSGAARLLHVSQPNVTRVLAHTEQQLG
                     FALFERVKGRLVPTQEAKALLPEAEKVYQQLGQFRSLTNKVKQGTQHLRVGAPPVLAA
                     HLLAPTVALLSKEHGISFELLTANRDELCSGLLKHELDVAIAFGEETPPAIMGHVLLK
                     ENLALIAPKSAAIPAEKTVILKELISHDLPIIGLDSRDPLGLLLHQTLSARDEHYQHA
                     ITVRSYSAAAELVKHQAGFAIVDPWTAKQYRQDDAVSVHALEPNMSFSVSILFAEHTP
                     QSIATKQFITALKQQMV"
     gene            complement(326797..328005)
                     /locus_tag="VP_RS16855"
                     /old_locus_tag="VPA0333"
     CDS             complement(326797..328005)
                     /locus_tag="VP_RS16855"
                     /old_locus_tag="VPA0333"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005373900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_005479795.1"
                     /translation="MKNKTQPYLAGRFFDSISSGLFMMALPWVMLSEPKMGTFVALVS
                     LSCTAISFLATPFFSTLVDRHSRKALLVLNQWIQSGMALVVFIAYWLGFESHWLLAFA
                     QLVYWVSSNFAWTTNNAFTQENYQHHEYAKISGQQEIVMQSTTLGAGALGIVLLEMWG
                     MKEFALFAASASALAAMFYILTPYTQQLRASKSVAFIAQLKESKQIFRLEPRFYGFIL
                     LSCLSYPALTYLSKLVPIWFSEQSISGDWFAGFNISFGLGSLLTGFIVTKVLSRASHS
                     HIMFASMVMVSLAFIGMSFAISPLTILLFTALFGVFNALNRIARVNWMHHTVAVHQRG
                     RVDGGISMFATTIQSLSYVLIAMLSHYELTQYGFAIAAVVMVLAVVLMGLLSRDVEPF
                     NDLPLHAAAK"
     gene            328206..328643
                     /gene="soxR"
                     /locus_tag="VP_RS16860"
                     /old_locus_tag="VPA0335"
     CDS             328206..328643
                     /gene="soxR"
                     /locus_tag="VP_RS16860"
                     /old_locus_tag="VPA0335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="redox-sensitive transcriptional activator SoxR"
                     /protein_id="WP_005464169.1"
                     /translation="MEISVGEVAKRSGVKVSALHFYEQKGLISSWRNQGNQRRYHRSV
                     LRRVAVIKAAQQVGLSLEEIKHALDELPKHQAPNKEQWEVMASHWHEQLEQKIQKLKA
                     LQNDLGGCIGCGCLSLETCALRNPEDVLGKDHSGSNLTLEEGA"
     gene            complement(328647..329042)
                     /locus_tag="VP_RS16865"
                     /old_locus_tag="VPA0336"
     CDS             complement(328647..329042)
                     /locus_tag="VP_RS16865"
                     /old_locus_tag="VPA0336"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017029707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2391 family protein"
                     /protein_id="WP_005464146.1"
                     /translation="MSSHFNLEDASQVLVGAFALAVPISFSEEAWRLGESLPMINLLM
                     LLSLSVIFLSFFAYQSVFQSHIRKRIPIFVFRVVIAYSIAAIVVALVLFCLDKLPLFT
                     DPIVAIKRVIVITMPASMGAIVVDSFDKE"
     gene            complement(329056..329907)
                     /locus_tag="VP_RS16870"
                     /old_locus_tag="VPA0337"
     CDS             complement(329056..329907)
                     /locus_tag="VP_RS16870"
                     /old_locus_tag="VPA0337"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005464201.1"
                     /translation="MRLFIALFFSLILSLPTLASEEKYSESDLLDRPLMERYILDELK
                     SLRQDYQSLEKRMITEITDRELTVADKSLNYANVTVTYFFYIIAGVASLIAFVGWQSL
                     REFKHNTKEMADKRLEKIAQEYEKKFVALERDLKRKTRIISENNKEIEKINEIHNLWL
                     RAQSSQTPEQRIEIYDEILVIRPGDLEALTYKADAAMEINEYHWALSICNRVLEVDYT
                     NGPALYQRACAYSRLGIEEQAIEDLERAIDYSPSIRDLLAEERDLELLHGNERFEKLL
                     QLSNNNE"
     gene            330146..330616
                     /locus_tag="VP_RS16875"
                     /old_locus_tag="VPA0339"
     CDS             330146..330616
                     /locus_tag="VP_RS16875"
                     /old_locus_tag="VPA0339"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ASCH domain-containing protein"
                     /protein_id="WP_005479843.1"
                     /translation="MDAKAKNYLNRYLDALSLEQKSAIPSVSADYYCADEYNANVCAE
                     LVRIGQKTASCSMELWYSEHGEPMPEVGHLQVVTNWDGEPVCVIQMTDVSTCRYDEVT
                     AEFAYAEGEGDRTLNWWRDAHAAFFKAECDELNVDWHEQRLLVLERFKVVYPFE"
     gene            complement(330685..331272)
                     /locus_tag="VP_RS16880"
                     /old_locus_tag="VPA0340"
     CDS             complement(330685..331272)
                     /locus_tag="VP_RS16880"
                     /old_locus_tag="VPA0340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_005479827.1"
                     /translation="MSVSWDPYYQKVAQQPHRVNVEKALQFHTLAKKIAVDAGCGTGR
                     DSSFLLAQGFRVHAFDNNSDAIKTCETRFSEQPNFSISQACFSDFDYPKCTLFIASAS
                     LFFCPKAHFENVWNQIDSSLPSGGVFCGDFLGVNDSWVDSNSHAHLTSLTRQQVEQCF
                     EGYDIVSMHERDEDGTTIVGTPKHWHVFSVTAVKC"
     gene            complement(331396..332877)
                     /locus_tag="VP_RS16885"
                     /old_locus_tag="VPA0341"
     CDS             complement(331396..332877)
                     /locus_tag="VP_RS16885"
                     /old_locus_tag="VPA0341"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004744643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase D family protein"
                     /protein_id="WP_021451966.1"
                     /translation="MFSVLSACSSIESNQPSEKSTTFHFGYQQDSVLAHYFEAYGQDP
                     KTITGFYPLNQGHDALLARTSLIESAQKSLDLQYYIYRGDETSQLITWRLYEAAKRGV
                     RIRLLLDDMQKRNDNVMAALNAHPNIEIRLFNPHQYRSARIFALTSDFERLNRRMHNK
                     SLIADSVSAIVGGRNIGNEYFSFESEVEFGDFDLLLYGEAVQQTADQFDLYWNSVHAV
                     PMEWISPQSQSVSDAAIQKQVTKLNLQEKFSSGRYDFTALDMYQDLKQGKLNLYWGDG
                     QVWFDLPDKVTTHDSQLVGNLTELLKSVEHSFVLISPYFIPTEAGTKALTNAAKRGVD
                     ITIVTNSLASNDVFAVHGWYAKYREDLLESGIKLWEVKSSAKLKSKWSLTGSSRASLH
                     AKAMTIDDKTLFVGSMNWDPRSAALNTEMAVVIEQPEYVQAFLAKLPSQLKDNAYRLT
                     LRDGDIVWTNTKTGEEYDSEPEAGVFRRLGAWFSGILPIEDQL"
     gene            333655..334812
                     /locus_tag="VP_RS16890"
                     /old_locus_tag="VPA0343"
     CDS             333655..334812
                     /locus_tag="VP_RS16890"
                     /old_locus_tag="VPA0343"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005392685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter periplasmic adaptor
                     subunit"
                     /protein_id="WP_011106254.1"
                     /translation="MLAKPIVRWLLPFVVVGGSYAGYAAIAATAPEKESTKETITEPT
                     VRASSLFPTDHKVVITSHGELVPFEKTHLSAQVSGEVISWHPNFVTGGIVKRGEVLFT
                     IESDNYEAAVLQAEAGLASARASLIEEQAKAEVAKRQAKKLSDKQVTDLYLRKPQVLS
                     AQAQVKSAQAALKRANRDLENCRVVAPYDALVVERDVGVGQFVTSGSRVATLNNIEVA
                     EVHVPIAGFDSAFLPESIKELTATVTQQGILSTTREGKVVRDLGMIDSATRMINMVIQ
                     VEDPYGIDNQQPPIKFGSYVEVSFTGKELKHIYRLPQELVKNRTVWVVNDENQLQPRT
                     VTVLRAEGEFMLVGEGLEQSDQLVLTLPEYPQKGMAVQIAKKNDDSETVVQ"
     gene            334826..337984
                     /locus_tag="VP_RS16895"
                     /old_locus_tag="VPA0344"
     CDS             334826..337984
                     /locus_tag="VP_RS16895"
                     /old_locus_tag="VPA0344"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter permease subunit"
                     /protein_id="WP_005479898.1"
                     /translation="MEDTNQKGIIAYFANNPVAANLLMVFIIIMGIVSYMFIQRQMFP
                     NIEVNYIDVRATYPGASPQEIEESILVKVEESIKDVTGIKKVVSRASRGSAYISIEVD
                     VNADIKRVLDDVNQRIDTISNLPLGMEPINVYQVEWRQDVIEMGLVGDRPLEELKPIA
                     KQIEDELLQLNNVMLVYLSAPEEEIAIEVDPLVLRKYDLTLNDVSNAIRRYSANFSAG
                     EVKTNSGMIAVRIENQYYRGDEFRNIPVKLGANGAKVLLQDIATIKDGFTEEERYFEY
                     SGQNAIYMSVEATRDQNIIPVAQSVRDYIEAKNKTLPSDVQLKILVDMTYYLNGRLDM
                     MLKNLLQGAVLVAIMLTIFLRFRLAMWVMIGLPVCFLGAVMMMPALGITVNIVSLFAF
                     IMVLGIVVDDAIVMGESAYSEIEEKGGGVENVVRGVKRVATPATFGVLTTIAVFAPFL
                     LSSGIDSAFFYGIAGVVILCLIFSLIESKLILPAHLAHTHFKPVKPGGWRDRFNQRFF
                     GFVNGTYRNFVKACTHWRWTVFAVFCGLLLISAALVKSNYVRVIPNPKVPTDYPAITI
                     EMNDTVSSEQTIEALKSIERVMQEVESQTIADHGQGMIRDVLSYNRSRTEGRVLVPLV
                     DEEIRPFNTFELARRWREAMPVIPGMKSIKIREQSAGGGDRDEFGYLLFGSNINELNQ
                     AGRYLIERLQQEEGLFDISSSIDSGSKEVLLSLAPVAYDLGLDLTMIAQQVGGSFYGG
                     EAQRLIRDGEEIKVMVRYPQLTREAFSSLRYAVITTPAGKKVMLGDVVNISEQPGVST
                     IRREGGYQTVYVYGSIDEELVEPQEIVKIIDDSILPDMKKLHPSVKTELGGDIEEQAA
                     QRNEQIMFFVAGMIIVYILLAVPLKSYTQPLIVMSVIPFSLTGAIWGHFWLGLDISMM
                     STFGLIAAAGVVINDSLVMTDYVNQVREKGMTIKQAVVEAGCARFRAITLTSITTFAG
                     VLPIMFETSLQARFVIPMAVALGFAVLYATVLTLVLVPCLYLMLEDIKNIFRAIKRFF
                     QRVIGRFRKSSVSSDISANTSN"
     gene            338323..338589
                     /locus_tag="VP_RS16900"
                     /old_locus_tag="VPA0345"
     CDS             338323..338589
                     /locus_tag="VP_RS16900"
                     /old_locus_tag="VPA0345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005429553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011106255.1"
                     /translation="MKSVILSTLGLIVVISSPIAAANTLDREEWSSDLRQDFSEMKHE
                     AVADIQQMNIDAIDARDARIVKNIKDEQAQLVKVKCRKDEASKS"
     gene            339173..340576
                     /locus_tag="VP_RS16905"
                     /old_locus_tag="VPA0347"
     CDS             339173..340576
                     /locus_tag="VP_RS16905"
                     /old_locus_tag="VPA0347"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479915.1"
                     /translation="MVLLVTTKSLTLRCKLQDCLFIFCVTVAIISYMLLPLSSKIINL
                     LFRFEYILINVGLILSLEPNMTWEILNQKPTESNARDVVVLNRFSNFLGQFDIDPRIL
                     DKREVKITRQAILVIQAMTDFDRKNVIKDIYKIIDNPKRASLTKHRRNPFWRLARNID
                     PFRTYHFLILYRISDSGSVVIEEIMLDSNLHGSKLESKKQRTMLYDVRKETKSRYSED
                     KSTNEDIQSALNSWDGKGANIIPKINCDHVTINGMNNDYDTASKLMGVHTDVAYRKDN
                     IVRYNLFHNPTDGGVFDLAECIFDQTRIFKSRNAKQLASLIIKTQSERRRVKWTVHSQ
                     GAIIFRSAIEEVKNLRPELRLDGHELAVHSPGGNYGILSMKAKHLGMKVQPLRANPAD
                     FVPNVIGLNGVTSITKMNLSLSPVFIWACFLSKTIGGSPHSLPYLGLNTYEKQLRESG
                     ARQKARVIGKYAKIGKH"
     gene            340576..341394
                     /locus_tag="VP_RS16910"
                     /old_locus_tag="VPA0348"
     CDS             340576..341394
                     /locus_tag="VP_RS16910"
                     /old_locus_tag="VPA0348"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011106257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011106257.1"
                     /translation="MSIMSLLKLKFRSGAKLSKPSHRIYRFGSIVCDLTVPGGFYESN
                     RAEEDSEITRDFLESNVRNDYHNQFFLVGRLEWPYHTIIPYPGTYDYYGQLTMKLSLI
                     PYVKSSNIKKSLYDIRDDIFFRYDDFYNAEEHDPKTGRGYNKYKEKSIYKHYTEEVVV
                     GNEELRNELINTRVLDILITPPTINVHNNYIKYESEKSLSKFKSHYCFLFNKYCYLSI
                     EFHHDGWTDRYMKVCLENAQEAENMIVSSINISELLDEDLSDNEVRNIKPKSSY"
     gene            complement(341424..342083)
                     /locus_tag="VP_RS16915"
                     /old_locus_tag="VPA0349"
     CDS             complement(341424..342083)
                     /locus_tag="VP_RS16915"
                     /old_locus_tag="VPA0349"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-IB family hydrolase"
                     /protein_id="WP_005479924.1"
                     /translation="MSKPLYVFDMDETLINADCAMIWNAFLVEKGIATQPNFIEEDQR
                     LMALYAEGKMDMEDYLEFCMAPLADMPIAHVLMLVEECVEHHILPKQFEQSKTLIAQL
                     DRDDIDMVIISASVTFLVEAVGRRLGIPVALGIDLVEKHGSYSAEIAGVPSYREGKVI
                     RLKAWLDAQPESYSEVHFYTDSINDLPLCEYADYAYLVNPCPQLKARADKANWTLLRW
                     N"
     gene            complement(342085..343104)
                     /locus_tag="VP_RS16920"
                     /old_locus_tag="VPA0350"
     CDS             complement(342085..343104)
                     /locus_tag="VP_RS16920"
                     /old_locus_tag="VPA0350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020334419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_005479814.1"
                     /translation="MSYVTAKNLTKRFGDNTVFEDIQFAIEQGEFITLLGPSGCGKST
                     LLRSLAGLNPVDGGEIWVNGEEITHQVPQERGIGMVFQSYALFPNMTVEGNIAFGLKM
                     KKLASDEIQREVTKVIELVDLKGKEKHYPHQLSGGQRQRVALARALVVKPRILLLDEP
                     LSALDAKIRKHLRQQIRDIQKEMNLTTIFVTHDQEEAMIMSDRIFLMNKGEIVQAGTP
                     EAIYTHPANEFVAGFMGHYNLVDANKAKQLFNIDTKWKVAIRPESIYVKEHGRQYGNH
                     ISAPQMGTIKNHQLLGNVIRYQVCVEECDLTVDLLNRSSERLLANGSQLELLFNLNEI
                     QPVRA"
     gene            complement(343104..343889)
                     /locus_tag="VP_RS16925"
                     /old_locus_tag="VPA0351"
     CDS             complement(343104..343889)
                     /locus_tag="VP_RS16925"
                     /old_locus_tag="VPA0351"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005599801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_005479788.1"
                     /translation="MQDVNSRFHKSVVYTIVGIMLIPILATFIYSISSRWGATILPDG
                     FTFDWYIKLLTDPRFLQAFGRSLFIGLSALALSVVLILPAIFVVFYYFPKLDKLMNIL
                     ILLPFAVPPVVSSVGLLQLYADSKISLIGTPWILVGTYFTIALPFMYRAISNSFEAIN
                     LHDLMDAAHLLGSSTTKAFLLIILPNLKKGLMASLFLSFSFLLGEFVFANILVGTRYE
                     TLQIYLYNMRQTSGHFTSALVMTYFLFIFLLTWLASRFSRGVK"
     gene            complement(343893..344792)
                     /locus_tag="VP_RS16930"
                     /old_locus_tag="VPA0352"
     CDS             complement(343893..344792)
                     /locus_tag="VP_RS16930"
                     /old_locus_tag="VPA0352"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004414927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_005479865.1"
                     /translation="MSSSVLSPSASRAAKPTTSVWLKRIKPAIWLVPFALFFYLFQLA
                     PMIWVLFNSFIYDGEFALDNYIEVLDSAFMLQAFGNSLWLSVWSSIFGLAIATLLVSS
                     LRRVDSKLRDAVIAFTNMSSNFAGVPLSFAFIIILGTNGAITLLLKQYGLLGDFDLYG
                     KWGLLAIYIYFQIPLAVLLLYPAFDALSDDWQAAAALLGARTAQYWAKVALPVLSPAL
                     FGTFIILIANAIGAYASVYALTSGNYNVITIRIASLVSGDLFLEPNLAAAISVILMAL
                     LAFITVINQWLIAKSYAAKKSRK"
     gene            complement(344789..345613)
                     /locus_tag="VP_RS16935"
                     /old_locus_tag="VPA0353"
     CDS             complement(344789..345613)
                     /locus_tag="VP_RS16935"
                     /old_locus_tag="VPA0353"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase family protein"
                     /protein_id="WP_005479833.1"
                     /translation="MSNKVILVVLDGLNYQVARNCMGYLNGLLEHGHSRPEMRATLYP
                     VQCELPSMSRPLYECILTGVRPVESGIVNNNIVRLSNHDSIFSLAKSQGKVTAAAAYH
                     WVSELYNRAPFEPIRDRFTNDETMNIQHGCFYHWDHYPDEALFIDAEHLRRTHQPDFL
                     LIHPMNIDDMGHKHGLDSRQYRNSARSADIILSNYIEQWLADGYQIIVTSDHGMNNDL
                     SHGGILPEEREVPMFVIGDKFTHQECHVKQTEICGTVCQLLNLDHNKPYTQALLAL"
     gene            complement(345644..346726)
                     /locus_tag="VP_RS16940"
                     /old_locus_tag="VPA0354"
     CDS             complement(345644..346726)
                     /locus_tag="VP_RS16940"
                     /old_locus_tag="VPA0354"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005599808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="WP_005479781.1"
                     /translation="MKTLLSRSTAVPAKLLAATAITATLSAPAFSADANVESLVKAAQ
                     KEGSIYSVGMPDSWANWKDTWADLQSNYGLKHQDTDMSSAQEIAKFEAEKKNATADIG
                     DVGFAFARVAVKKGVTQPYKPTTWNDIPDWAKDKDGHWALAYTGTISFISNNNLVKDA
                     PKTWGDLLKGDYKVTVGDVGVAAQANNAVLAAAFANGGDESNLKPAIKFFAELAKQGR
                     LSFTDPNIANLEKGEVEVAIMWDFNALNYRDKIDRERFTVTIPQDGSVISGYTTIINK
                     YAKNPNAAKLAREYIFSDQGQINLAEGYARPIRTSITLPKSVQDKLIANDQYSNVHPV
                     TDFSAWEKSARKLPRQWQESVLIHQQ"
     gene            346936..347664
                     /locus_tag="VP_RS16945"
                     /old_locus_tag="VPA0355"
     CDS             346936..347664
                     /locus_tag="VP_RS16945"
                     /old_locus_tag="VPA0355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017630970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTRA domain-containing protein"
                     /protein_id="WP_005479878.1"
                     /translation="MKTTGAGQLGTQLGKIKTSLRQQIHTGVVSQGQKLPSERELSEL
                     FSTTRITIKDALVSLETEGLIYREERRGWYVSPERICYNPLSRSHFHQMIREQHRIAA
                     TQLISVRSEMAAGDYAKALDIEQMTPIHIIERLRCIDGRAVLFVENVLKASLFDGILA
                     ENLTMSLTGIYREKYGYETMRSRFDVIPTSAPAHVAKALNLAEGQPVLKICRVNYKQD
                     GELMDCELEYWRPDAVMIRIDSVG"
     gene            complement(347734..349353)
                     /locus_tag="VP_RS16950"
                     /old_locus_tag="VPA0356"
     CDS             complement(347734..349353)
                     /locus_tag="VP_RS16950"
                     /old_locus_tag="VPA0356"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BCCT family transporter"
                     /protein_id="WP_011106258.1"
                     /translation="MHGFRALKSEVIMSNMTNAAPHTPIQEADYSAIHPPSLLKRLEL
                     TNPVFWLSGSFLSLFVLLALTNTESLTAMVNAGFGFATKYFGAYWQVLLLLNFLIGLA
                     LAFGRTGYVRLGGLAKPDIDTFKWLSIVLCTLLAGGGVFWAAAEPIAHFVTAPPLYGE
                     ASPKTSAINALSQSFMHWGFLAWAILGCLSSIVLMHLHYDKGLPLKPRTLLYPIFGDK
                     AIHGWIGNLADACSIIAVAAGTIGPIGFLGLQISYALNSLFGFPDNFITQSMVIVAAI
                     VMYTLSALSGVSKGIQLVSRYNIILSVLLIGYILFFGPTSFIIDGYVQGVGRMVDNFF
                     PMALYRDDTGWLSWWTVFFWGWFIGYGPMMAIFIARISRGRTIRQLILSISIAAPLIT
                     CFWFSIVGGSGLAFELANPGLISSAFEGFNLPAVLLAITGELPFPMIISVLFLILTTT
                     FIVTTGDSMTYTISVVMTGSAEPNAVIRSFWGLMMGVVAIALISMGSGGITALQSFIV
                     ITAVPVSFILLPSILKAPGIANQMAKDQGLV"
     gene            349622..352030
                     /locus_tag="VP_RS16955"
                     /old_locus_tag="VPA0357"
     CDS             349622..352030
                     /locus_tag="VP_RS16955"
                     /old_locus_tag="VPA0357"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005451266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 2 protein"
                     /protein_id="WP_005479868.1"
                     /translation="MAQIELNGTWQLTSPQRPDIDIPMNLPGDNVSALLQAELIPNPY
                     FADNEAKVRWIEACDWHIERQFEVGDSTLCASHIWMTLTRVDTLAQFFINGERVLTSS
                     NMFAQQRVDIKPYLKQGTNTIRVEFARVDLEGIARAKKLPFPIPSAMGNNQIPHMNLI
                     RKTQCHSGWDWGICLMVSGIYDPIQIDVVTDIWLKNVSTEQQWQADGSVILDVLLEVQ
                     TDNQSHHVVVEFDGEVQFIQTEGSGHYHCQFHVQKPQLWWPAGYGDAHLYTISVGCGE
                     QTLSRKIGLRQLSLNSQADEHGSAMEFIVNGTPINAKGANWIPVDAMPGRECERRYRD
                     LLQSAVDANMNMIRVWGGGQYESETFYKLCDELGLLVWQDMMFACSLYPSNDEFLKDV
                     EEELRFQIPRLKAHPSIALWCGDNEVIGAIGWYDESKHNKVKYTVNYDRLNRMIEQVI
                     TQQDDSRRFWPSSPCNGELDFGDAWHDDSKGDMHFWDVWHSGKSFSAYLNINPRFCSE
                     FGFQSWQSFAEVKQFVPERDWNITSPTFEQHQKNPRGNSIITEMFTRYFCFPSGFEQM
                     LYLSQVQQAMAIKTACDHWRAISPICRGMLYWQLNDNWPVSSWSSLEYSGRWKQLHYH
                     AKRFFAPQYLVFSEHTGKLSLHLLNDAKEPASVNAQLKWVDWQGEEKQCWSLEQTVIA
                     DSNTILWQLDESFEKDELTSGFFYVEAQIGEDRISNTWFCTHELKTLPMAKANIDVSI
                     EDSQITLVADKPAFFVHVECDTQGRFSDSSLTLLANQPVTIEFLGDDLAAMSASLRVY
                     HLMQ"
     gene            complement(352083..352736)
                     /locus_tag="VP_RS16960"
                     /old_locus_tag="VPA0358"
     CDS             complement(352083..352736)
                     /locus_tag="VP_RS16960"
                     /old_locus_tag="VPA0358"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_005479863.1"
                     /translation="MMNTNTTNNTVLLFTFNNIQGRGLQTAIEQNLEKPVLLTQGADV
                     NLPSTRDEHYVAIVDSSLPELPEVKQTLSELEHVDATVLVNAEPNLRIESLLTWSNLK
                     GLFYFEDDFDKVMMGLKGILNGENWLSRDILNQLIGHLLSLNNTVGELETKLEMELTR
                     REMQVLSALCQGGSNLDIADSLFVSEHTVKSHLYSIFRKLEVKNRMQAITWAKRNLL"
     gene            complement(352736..353551)
                     /locus_tag="VP_RS16965"
                     /old_locus_tag="VPA0359"
     CDS             complement(352736..353551)
                     /locus_tag="VP_RS16965"
                     /old_locus_tag="VPA0359"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_005479824.1"
                     /translation="MVSKLEFSHAVAAIRKERGLTQGQLADELARSYSAFESLNQPTL
                     SQWESGKVTPSLLKRLAFAHYIGKQYQYTSSEYKRVKASQSKSIYLSFKDIVYEYRVT
                     DVKNCALSQISLTEYEQINAVHKQLITPGGIEDTLNQFNESPSKARLYYCEGMLVGHL
                     IYQELRSEFRILSFWHLGRSILKYLVTDILQVMGNTIIHFPVHEPVIKQLLFDIFIRD
                     FYQHRRVTFFRAPATQIFGNPMVKYCFDGLLDLVLYRFHQVGNEFMQSRQEVH"
     gene            complement(353617..354633)
                     /locus_tag="VP_RS16970"
                     /old_locus_tag="VPA0360"
     CDS             complement(353617..354633)
                     /locus_tag="VP_RS16970"
                     /old_locus_tag="VPA0360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005451272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_005479826.1"
                     /translation="MDRTQFTKIFTRYYMRSTSLGIIFTLFACAIRGVNLVVYLPYVL
                     SASTCFTYLWASRTFTLEQKHQSVVIALILGYTLTFYLYFFLGGHFLFSSLVTINLLL
                     TMVEFGVFWSFFTYALSMTFCFYIDLITAGNDPFKLHALKEFFIQSTFLFLFNLFIYK
                     GLRSIECYWHGIWQKQYEQVEKLERLLEIDELTGCYSRFKGNQLIEQQIQRAQPFTLL
                     YIDLDGFKAVNDEFGHDAGDKVLQITAQRILHLLDDGQFATRIGGDEFILCLPNIEDT
                     KELEQFQSLLHHACSAPIFIHFQNVHIGLSVGMARFPHEGSCSDSLIQHADQMMYLTK
                     RSRT"
     gene            complement(355004..355258)
                     /locus_tag="VP_RS16975"
                     /old_locus_tag="VPA0361"
     CDS             complement(355004..355258)
                     /locus_tag="VP_RS16975"
                     /old_locus_tag="VPA0361"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005441438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011106259.1"
                     /translation="MNNSRWVGLLGGTIVLLCTFLLFGSSVHADWYMMPAEAVNGIAF
                     TLAFGLGLNSIFAYVTAFITLAALFYIGYVVGYRVHQKLR"
     gene            complement(355443..356945)
                     /locus_tag="VP_RS16980"
                     /old_locus_tag="VPA0362"
     CDS             complement(355443..356945)
                     /locus_tag="VP_RS16980"
                     /old_locus_tag="VPA0362"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux transporter outer membrane subunit"
                     /protein_id="WP_005479783.1"
                     /translation="MKKFILTPVVLALSLAGCAVGPDYQAPTTSMAETYLNAENAGLS
                     TDSQHVKFWWTKFHDPVLNQMVQDMQSQNIPLKVAAERVKMANNYKTMVESFKVPTIN
                     LGAGYMNYQFSKNDSSLGPILNPLSDSVSGLPPQIGNVTLMDNQHDGVFAGASIAWEV
                     DLFGRIDRQTNAAQIRLEQAQIYQSGLNTVITADLIHNYLQYQGASERLELAKSNLED
                     QRRTLDLVGKVVRSGYGSDLDLAQAKATLAAMESLVPQLEIAQQAHKHRLAVLLGEPL
                     TQVEIRLSKQHSVPVMQNMVPVGLPSDLLKRRTDIRLAEREMAALNEELAASVADQYP
                     KFFLTGAPGLSASSFDDLFSSDSFGWMGAAGVSWNLFDGGRGEAIEAINQARFDSATL
                     SYQHTVEAALAETESTLFTYGRSQENQRRIDEALKATNNAVNKAKSLYRAGLIDHLSV
                     LDAQRQQRMMQDQQIAAKLQTAQATIALYKSLGGDWTLQPEAQPETNAKG"
     gene            complement(356942..360004)
                     /locus_tag="VP_RS16985"
                     /old_locus_tag="VPA0363"
     CDS             complement(356942..360004)
                     /locus_tag="VP_RS16985"
                     /old_locus_tag="VPA0363"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter permease subunit"
                     /protein_id="WP_005479778.1"
                     /translation="MINLAEFAIRQRKFVLFFIVLSVIAGIYSYFDLGKLEDPSFTVK
                     TAVVVTLYPGASAEEVEHQVTDTVETKLQEMAELDRLRSLSRPGLSMVFVDLKESLNS
                     KALPQEWDLLRRKVDDVKLQLPSSAQISVVQDEFSEVYGMLFSIHSTDAAPEELRRYA
                     EELQRQIKAVDGIKKIELHGVQPRVVHIDMPDERLAQYGLSIAQVWNQLSTQNSTFEA
                     GKFDAGTERIRIAQTSEFQSLEDIRNLIINGGTGEFGSGLIRLGDIADITMGYQTPAL
                     AENRYNGEPAVTLAVSPVQGINVVSLGDTIQDIIANYQASLPLGVDISTVAYQPEEVQ
                     KSIDDFVGNLLESVAIVFVVLLVFMGFKSATIVGASLLLTILLTLVYMNIASIDLHRV
                     SLGTFILALGMLVDNAIVITDMMIAKLNKGIERTRAAIDSVKETAVPLLGATVIAIMG
                     ASPVLFSKTDSAEFASSVFYIVASSLLLSWIVAMTFTVLMAWMFIKPKANNEETKPSR
                     YKQLVFWTVDNPRKALAALVPLILVTAVAIPYVAVNFIPQSDRSIVFLDYWLPNGAKI
                     EQTSADMRKVEEWLVAQPEVESISSYVGTSAPRFSVTVEPEPLDPAYGQILINTKDYE
                     SISHLVTRGDDWLKEAFPDAEPRFRALKLATKDKFAVEVRFSGPDETVLHQLAAEAKT
                     IFASNPDAKYIRDDWRQESKVLKPILNQDKMRQAGINRADVAFALKRASDGMPLGQMN
                     LNDELIPIQLRGTSQNMASLETLPVRSLLGFNSVPLGQVVDGFELVTEESMIWRRDRV
                     KTITVQAGVSRDSTPANVRNAIKDQVEAIQLPAGYSMEWGGEYYDEDKAVTDIMKQQP
                     KAMLIMVIILVAMFNGFKQPIIILATLPLAASGAVFALLGFDKPFGFMALIGAITLTG
                     MIIKNGIVLMDQIELERTNGKSLSDAIKEATVNRTMAISMGALTTALGMIPLLSDLLF
                     DQMAATIIGGLAAATILSLFVMPALYRLVYKEKAPSTQTNAELEEASS"
     gene            complement(360015..361097)
                     /locus_tag="VP_RS16990"
                     /old_locus_tag="VPA0364"
     CDS             complement(360015..361097)
                     /locus_tag="VP_RS16990"
                     /old_locus_tag="VPA0364"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter periplasmic adaptor
                     subunit"
                     /protein_id="WP_005479920.1"
                     /translation="MNHQIKTAALSTIALSLLGCNQAQPQVEEPSASRPVQVIEVNER
                     NEELNKSFSGIVKAKETASLSFRVPGTVESVFVNKGSVVEKGQVIATLDKHDYQVSLE
                     ELQARMLEAQSAHKLAKAELKRVKQATSDDAIASVNLDRAISSYERSLSAVKVVEKNI
                     QRAKDALRYTTLRAPFTGIVADVSVDPHEQTLPGGSVVSIQQEDSWEVDIDVPENMIA
                     QFALGQPASLTWYDSEQSYRATVAEIAPKKHLLKQTYTVTLDIDSISSALFNGKAVTV
                     NTALNTSHSSHCFPYSAILGEKQTLHVNVVRDAVIHSEPVNLDSIDAYQACVTGSFEQ
                     GDYVVISGSHYLSEGDAAPNLTIKTL"
     gene            complement(361202..362083)
                     /locus_tag="VP_RS16995"
                     /old_locus_tag="VPA0365"
     CDS             complement(361202..362083)
                     /locus_tag="VP_RS16995"
                     /old_locus_tag="VPA0365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005479816.1"
                     /translation="MKIDDLKLFTKVVQLGSFTAAANALDLPRANVSRRIGELERYLG
                     TQLFHRTTRSLSLTNKGDAYYQDLQKVLTLLDSANQQASNESIEVRGKIKLGLLPETY
                     EHLQPILFEFQDQYPQVELDIRNINNGFIDMFQQGLDIALHGGMLFDSDIVARKILTL
                     DRCVVASPNYLQTHGTPATLEELSDHQCICFRWPNGNVDNLWHFQEQNVALKPKLISN
                     NIGFIKSSTVLDRGISYIPKLLVKNELESGALVQVLSQYAVTEETGWLLYPQPKTLNQ
                     ASRLLIEHLCNKIPKLL"
     gene            362196..362555
                     /locus_tag="VP_RS17000"
                     /old_locus_tag="VPA0366"
     CDS             362196..362555
                     /locus_tag="VP_RS17000"
                     /old_locus_tag="VPA0366"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017083478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479810.1"
                     /translation="MLRFIQRRRIKKVIKLMSTRLIVGYGSREYFSVGQVKTSTSELS
                     ACQQKIALALYANPQDLDLENQPELQAIRSDVAHDFFAGVDYTAQDVLHLFGAGGWKG
                     GRMEDGMSHHFGMHSRY"
     gene            362693..363727
                     /locus_tag="VP_RS17005"
                     /old_locus_tag="VPA0367"
     CDS             362693..363727
                     /locus_tag="VP_RS17005"
                     /old_locus_tag="VPA0367"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000846696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_005479793.1"
                     /translation="MKLIIKGLGLSALVLSMFAHADSKTLNVYAWGGYLPEASLKAFE
                     KQEGVTINYSTFENNESMYTKLKLLKGSGYDVVFASAYFIEKMGREGLLSKIDHAQVP
                     NMQDTMDGLLGQAHDPKNDYSLPYIWGITGISYNESMVEQPVTKWADLWESQYEQQVM
                     LIDDVRDVFGMALKKNGHSVNTKDEAEIKQAFDSLVALKNNVLLYNSDAPQVPYVSGE
                     TSVGMQWNGNAFQGQVEMPELKFVMPEEGAVLWMDNFTIPSGSKNKTLAHKFINFMYQ
                     SENQAEIVTSLGYASATNAGRDKLPEELKNNRTIFPSSEDMKKGEFINDVGAETLAIY
                     EKYWQRLRTQ"
     gene            complement(363834..365093)
                     /gene="tyrS"
                     /locus_tag="VP_RS17010"
                     /old_locus_tag="VPA0368"
     CDS             complement(363834..365093)
                     /gene="tyrS"
                     /locus_tag="VP_RS17010"
                     /old_locus_tag="VPA0368"
                     /EC_number="6.1.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine--tRNA ligase"
                     /protein_id="WP_005479869.1"
                     /translation="MTTPLLQDLQDRGLIAQASDLEEIQTLLSQPQTVYCGFDPTAGS
                     LHIGHLVPLIMLKRFQDAGHQAVALIGGATGMIGDPSFKATERSLNSAEIVSGWVNDL
                     SNQIQQLMNHQLSKPMIMVNNADWMRAINVIDFFRDVGKHFSINTMINRESVKQRLQR
                     PDQGISFTEFSYALLQSYDFAELNRQYGCRLQIGGNDQWGNIVSGIDLTRRQNGEQVF
                     GLTLPLITKSDGTKFGKTEGGAVWLDPSKTSPYAFYQFWLGAEDADVYHFLRYYTFLS
                     CEEIASIEAQDQASQGKPQAQRILAEEMTRFVHGEEGLASAERITQALFSGNVQQLSL
                     GELKQLELDGLPSIESAQQDLVELLIESGLASSKRVAREHISNNAISVNGEKVSADNP
                     SLSFPLFDQYWLLQRGKKHFCLVKRAA"
     gene            complement(365175..365981)
                     /locus_tag="VP_RS17015"
                     /old_locus_tag="VPA0369"
     CDS             complement(365175..365981)
                     /locus_tag="VP_RS17015"
                     /old_locus_tag="VPA0369"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020194657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_005479785.1"
                     /translation="MPNQNFNAQLAEAISALNTPNFTPKLMSVIHSIFDFDCAIILGY
                     REGKHPIYLYDSIENERELLFQRYLTNSFQNDPFFQNLNQHKQQGIFTLKDVAKKGIE
                     YQTYRKQFYDQTGWKDELSMLVEIESGRWVILYFGCLREGKRFSAAQINNLRSHFSVL
                     QSLCQQHWKQAEFNLSEPVVRPDAYTGNMKVAIEQALSSFGIESLTRREQEVASLLAQ
                     GFDTKEISAHLHLVQGTVKNHRKRIYSQLNVSSLSELFQLFLNHLIMHSK"
     gene            complement(366206..366985)
                     /locus_tag="VP_RS17020"
                     /old_locus_tag="VPA0371"
     CDS             complement(366206..366985)
                     /locus_tag="VP_RS17020"
                     /old_locus_tag="VPA0371"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005439266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005464130.1"
                     /translation="MKKPIVILTTLMLLTSPAHADWDEISNKMSELGEAVSDTAQDVW
                     DDTKAFSKQAWQDFTNWSEEAINTAGEWTDASIEKSKEWIDAADKKIDELMEGDTPEE
                     ARQAIDLMADSTLLKLFNEKPEAKAIYDKAYGYAVFDSRKLSLLFHTNSGSGVAVDKT
                     TEKRTYMNMFGMGVALGLGGKFYQQVVLFESKQDFDTFVNEGWEATSEASAVAGEDAE
                     EFSAQFNSGVAVYQLNSKGLLIDANVSGSKYWVNEELTNAQ"
     gene            complement(367205..369574)
                     /gene="ppsA"
                     /locus_tag="VP_RS17025"
                     /old_locus_tag="VPA0372"
     CDS             complement(367205..369574)
                     /gene="ppsA"
                     /locus_tag="VP_RS17025"
                     /old_locus_tag="VPA0372"
                     /EC_number="2.7.9.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008075129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate synthase"
                     /protein_id="WP_005479906.1"
                     /translation="MQKNTLWFNGLSMDDVDKVGGKNASLGEMVSNLANVGVSVPNGF
                     ATTSYAFNQFLDHEGLDERIHQLLDELDVDDVEALRKTGATIRQWVLQAPFPADLEQE
                     IRNNYEELIEGNTELSVAVRSSATAEDLPDASFAGQQETFLNVKGIDAVLEATKHVYA
                     SLFNDRAISYRVHQGFDHRGISLSAGIQRMVRSDKASSGVMFTLDTESGFDQVVFITS
                     SWGLGEMVVQGAVNPDEFYVHKPMLEAGEHPIVKKTFGSKLIKMIYSNNQEIGKQVDI
                     IDTSEEERNTFSLNEEEIKELAKQAMIIEKHYQRPMDIEWAKDGIDGKLYIVQARPET
                     VCSQTEQNVIERYELNNKADVLVEGRAIGQRIGKGPVRLVDSLDQMSLVQEGDVLVTD
                     MTDPDWEPVMKKASAIVTNRGGRTCHAAIIARELGIPAIVGCGDATSKLTDGATVTVS
                     CSEGETGYVYQGDLDFEVKRSSVDELPLLPTKVMMNVGNPDRAFDFAQIPNEGVGLAR
                     LEFIINKMIGIHPKALLNFDAQSDELKAEIKQRIRGYKDPIDFYVSKLTEGIATIASA
                     FWPKRVIVRMSDFKSNEYSNLVGGKAYEPHEENPMLGFRGASRYISPVFEDCFELETQ
                     AIKRVRNEMGLKNVEIMIPFVRTPSEAASVIDLLAKFDLRRGDQGLKVIMMCELPSNA
                     VLADEFLKYFDGFSIGSNDMTQLTLGLDRDSGDVAHLFDERNAAVKIMLKMAIDAATK
                     AGKYVGICGQGPSDHEDLAEWLMEQGISSVSLNPDTVIDTWLQLGKVSK"
     gene            369791..370627
                     /locus_tag="VP_RS17030"
                     /old_locus_tag="VPA0373"
     CDS             369791..370627
                     /locus_tag="VP_RS17030"
                     /old_locus_tag="VPA0373"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="kinase/pyrophosphorylase"
                     /protein_id="WP_005464081.1"
                     /translation="MQINNQSRDVFYVSDGTAITCETLGHVVLGQFPFIPNEKTFPFV
                     ESQDKVADVVKEIETSYQRNGVKPLVFFSIVVPGVREMLLEAPAYSYDVLESIVQKVQ
                     DDIQMAPAPKLQRSRSVGKDSDTYFDRIAAIEYTLAHDDGITLKGLEQADIILLGVSR
                     SGKTPTSLYMAMQFGLRVVNYPFIAEDVKMMRLLPEFEVHRHKLFGLTITPERLNEIR
                     ENRLSGSDYASEEQCKLELDTVEALFRREAIPYINTSSLSVEEISTRILERAGMKRRL
                     FG"
     gene            complement(370709..371773)
                     /gene="ansB"
                     /locus_tag="VP_RS17035"
                     /old_locus_tag="VPA0374"
     CDS             complement(370709..371773)
                     /gene="ansB"
                     /locus_tag="VP_RS17035"
                     /old_locus_tag="VPA0374"
                     /EC_number="3.5.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006644993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-asparaginase 2"
                     /protein_id="WP_005479812.1"
                     /translation="MTKNLFRLSTITLGLCLSSLSFAQSDLPNIKILATGGTIAGAGQ
                     SATESNYTAGKVGVESLISAVPSMTNIADISGEQVVSIGSQDMNDEVWLKLAKRVNEL
                     LAQDDVDGIVITHGTDTLEETAYFLDLTVKSDKPVVIVGAMRPSTAMSADGPVNLYNA
                     VVTATDEDSKGRGVLVAMNDTIFDARDVTKTNTTSVSTFQSPNFGPLGYIHNSDAKYQ
                     RSPERKHTTETPFDVSKLNTLPKVGIVYNYANASSLPVKALVDAKFDGIVSAGVGNGN
                     LYHTVFDELEKASKDGIVVVRSSRTPTGSTTLDAEIDDDKYGFVASGTLNPQKARILL
                     MLSLTQTKNYQDVQKMFQYY"
     gene            complement(372186..373442)
                     /locus_tag="VP_RS17040"
                     /old_locus_tag="VPA0375"
     CDS             complement(372186..373442)
                     /locus_tag="VP_RS17040"
                     /old_locus_tag="VPA0375"
                     /EC_number="6.3.4.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006644190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthase"
                     /protein_id="WP_005464135.1"
                     /translation="MSSIVVVGANWGDEGKGRIVDFLAEQASASIRFQGGNNAGHTVV
                     NDLGTFKLHQLPSGVFNPDCLAVLGPGMVISPALLSQEIAEVEEAGVKVNMCISDRAT
                     LCLPLHALEDTLEEQRLGDKAYGSTRQGIAPAYGDRVMKKGILVGWLKQPEVLVERLQ
                     FMMDWKLPQLRALYPTFEFEQTAEEMANWLLEVSAPWRDSICNVTLPLKELQAKDKTL
                     LFEAQLGAGRDLVYGEYPWTTSSNVVSMYAGIGSGLPALRPERVIAVAKAFSSSVGTG
                     TLITAMEEQDAFRELAGEFGATTGRPRDMGYFDAVATKNGVELQAATEIALTKVDCLT
                     GLNDLKICVGYEGDHSENPIWPQTAALAPIYEKMESWSEDITGCRKFEELPVAAQKYV
                     LRIEELMGVPVKMVSVGPGREQMIMR"
     gene            373548..374417
                     /locus_tag="VP_RS17045"
                     /old_locus_tag="VPA0376"
     CDS             373548..374417
                     /locus_tag="VP_RS17045"
                     /old_locus_tag="VPA0376"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005373812.1"
                     /translation="MLDLNWLRTFVTLAEVKHFGKTATELHMTQPNVSLHIKQLEQAT
                     RTKLIERNPVQLTQAGKRLLATAQRMLNELQICQSDLNAINDLTQGTLSIAASDIVSR
                     LLLIKPFQQFKSEYPGIDLALFNTTSSQAVDLVKSARADIGFVIAQKESQPLHFTPLT
                     QIHWCAFGDNIFEWQDNRKESQTLILLGHDTRTRELIDASLPELNLPKHRVMEVGSVE
                     AQIDWAEAGFGTAIVPDFSLDPRLKLSREVTPLPSFPNTDFGYIVRQNQVLSKAAKQL
                     LAWVGENVSVVEG"
     gene            374422..374814
                     /locus_tag="VP_RS17050"
                     /old_locus_tag="VPA0377"
     CDS             374422..374814
                     /locus_tag="VP_RS17050"
                     /old_locus_tag="VPA0377"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005451308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome recycling factor"
                     /protein_id="WP_005479876.1"
                     /translation="MKETKITISLPSLIHRIGGDHAKRAKTLAAEKQCDLKRIRRSRN
                     WQISGEALDVKAFLDHLKSEEAEVMRFAINKIEQALLAHQDKLEPLDVKLIRLVRQNP
                     NITLAELMAETNCTLVQARTARFDAELL"
     gene            374892..375506
                     /locus_tag="VP_RS17055"
                     /old_locus_tag="VPA0378"
     CDS             374892..375506
                     /locus_tag="VP_RS17055"
                     /old_locus_tag="VPA0378"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004736401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysE family translocator"
                     /protein_id="WP_005479900.1"
                     /translation="MDIWKLLLFIPACFALNMAPGPNNLLAMNNARCYGFRAAFVASL
                     GRIAAFSAMIALSASGLAVILYTSEMLFLAIKLVGALYLLWIAFNLWRSESSPISDLD
                     NSRNYAGLAKQEFTLAAGNPKAILIFTAFLPQFVDANANVQEQFFALGSTFLILEMVA
                     ISIYAIFGLYLRHWFSNPKMAKRFNRGCSLFLTISGVNLLISKQ"
     gene            complement(375600..376121)
                     /locus_tag="VP_RS17060"
                     /old_locus_tag="VPA0379"
     CDS             complement(375600..376121)
                     /locus_tag="VP_RS17060"
                     /old_locus_tag="VPA0379"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004412719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2058 domain-containing protein"
                     /protein_id="WP_005479918.1"
                     /translation="MAKLTLQEQMLKAGLVNEKKLKKAKKGSKKSRVQAREVKAAVEE
                     SKRQQVERDKQLSQQQNAERLSKEIKAQINQLIEMNKIELKDGDIKYNFTHGTLVKSL
                     YVDSLIREQLIKGILAIAIVGESYVVIPRGVANKIAQRDESVIIEQKEAESEIPAEDD
                     PYADFVVPDDLMW"
     gene            complement(376257..377261)
                     /locus_tag="VP_RS17065"
                     /old_locus_tag="VPA0381"
     CDS             complement(376257..377261)
                     /locus_tag="VP_RS17065"
                     /old_locus_tag="VPA0381"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_005479808.1"
                     /translation="MHIVRSGAADRFDSLVSELGQNPVEIMAAVGLSAAQFRDPDTYL
                     AYPRLAELLEEAAARCQQPLFGALLAERQNLQSLGDLPMLVSRAETVGEALVRVNDFL
                     YLHSSGVTLNMTPQDDWVRLSLSIDVHSERGIAQLMQLSVSHLAMFIASLLDIEASHF
                     SLHLTQHASFEAEQSAFAQQNKLRFGDKFDGILLKASLLNAKNHQDEDALERHFQQHL
                     KELQTRYPNNLSDQAANMIGRLLSTGECSVERVARALDLHPRMLQSKLKQQGTSYRQL
                     LQQVRQDFAEQRLSENSQSITDIALQLGYAETAVFSRHFRRWTGKSPRQWRLDKMAAR
                     "
     gene            377393..378154
                     /locus_tag="VP_RS17070"
                     /old_locus_tag="VPA0382"
     CDS             377393..378154
                     /locus_tag="VP_RS17070"
                     /old_locus_tag="VPA0382"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011715537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_005479886.1"
                     /translation="MELINKTAIVTGAAGGIGRAIIHKLLEQGAKVLAVDISPQSLNV
                     YQDFDAEQLRTFVADVTEYQEVEAMVKHAAEQFGSLDIMINNAGIGAPKPLLDHDPIA
                     DFEPISKVNQNGVYYGILAAGRQFQAQGTPGVILNTSSVYARMASEMTFTYNVSKAAV
                     DMMTKCAALELAPLGIRVCAVAPGRVDTPMLRQYDEIGLWNHIRKEQMRQTFTQPEEI
                     ANVVTFLVSEKANCINGCTVSASDGFENFKYPLMG"
     gene            378195..378707
                     /locus_tag="VP_RS17075"
                     /old_locus_tag="VPA0383"
     CDS             378195..378707
                     /locus_tag="VP_RS17075"
                     /old_locus_tag="VPA0383"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011621115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,4'-dihydroxyacetophenone dioxygenase family
                     protein"
                     /protein_id="WP_005479856.1"
                     /translation="MSLPEVIQHQDFLLTLNTNEESIIKDALPGVDVYPLFLDPENGT
                     WVVRAKFKPGITLPKHYHTGVVHFYTLSGAWHYIEYPDQVQTAGSYLYEPGGSIHTFH
                     CPESSGGADGFMVIQGANINFDEEGNFINIMDAGWIEQVVIATAKAQGFTARYIKPGA
                     IAGLSDELAE"
     gene            378712..379770
                     /locus_tag="VP_RS17080"
                     /old_locus_tag="VPA0384"
     CDS             378712..379770
                     /locus_tag="VP_RS17080"
                     /old_locus_tag="VPA0384"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006741401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding dehydrogenase"
                     /protein_id="WP_005479913.1"
                     /translation="MQQMNSIVMQDGSVRLKQVEIPKPAAGQVLVRSLACGICGSDLH
                     ITRHADEVFDVFHQLGLMPDEAGEHAQVMLGHEFCAEIVEYGSDTQQTLAVGSRVTSV
                     PMLLSQNGAGVGVTPGTYGAYSEYFLLDEALLLPVPDGMPSEAAALTEPLAVGLHAVN
                     RSEIETEETALVVGCGPIGLAVIAALKQRGVSNILAVDLQEEKLQLASEFGANRLISP
                     TKEDEIAVGEQYAMNSRLVIYECVGKHTLIDDFLRRAPARARIVISGIHTTPAIINYA
                     YATVKELDLRFSYYYQPHEFEQCLQAIAEHKLPWQKMLTAKVGIDGVEDAFRQLMTPN
                     DHIKVVIEPWRCGALEVI"
     gene            complement(379854..380978)
                     /locus_tag="VP_RS17085"
                     /old_locus_tag="VPA0385"
     CDS             complement(379854..380978)
                     /locus_tag="VP_RS17085"
                     /old_locus_tag="VPA0385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkene reductase"
                     /protein_id="WP_005479847.1"
                     /translation="MKQRPNKLFEPAQLKALSLQNRIVMAPMTRARTTQPGNIPNEMM
                     ATYYQQRASAGLIISEATQISDDSQGYSFTPGVYTDAQVAGWQGVTQAVKLQGAAMFC
                     QLWHVGRVSHPTFQNGEQPIAPSALAPVETQVWIADEQGNGNMVDCVEPRAMTQADIN
                     RVVGDFANAAKRAIESGFDGVEIHGGNGYLIDQFLRTNSNHRTDNYGGSRENRIRFLI
                     EVVDAVIAAVGAHRVGVRLAPFITFKDMDCPDIVPTILEASKQLQERDIAYLHLSEAD
                     WADAPTIPETFRIELRKRFRNAIIVAGRYDPQRANEVLEKGYADLVAFGRPFVANPDL
                     VSRLQHHHPLAELDGSTLFGGNERGYTDYPALQQECAEQA"
     gene            complement(380989..381618)
                     /gene="grxB"
                     /locus_tag="VP_RS17090"
                     /old_locus_tag="VPA0386"
     CDS             complement(380989..381618)
                     /gene="grxB"
                     /locus_tag="VP_RS17090"
                     /old_locus_tag="VPA0386"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin 2"
                     /protein_id="WP_005479838.1"
                     /translation="MKLYIYEHCPFSARVRFVAGMLNIQLDVINIAYDDESTTTNIIG
                     AKQVPLLIKDDGEAMAESLDIINYFLELASSSENSHPSTPVLDWQKQAFLPLQKVGYP
                     RWSNMTLPEFATETAKQAWREKKETEALNFEALINDTPAIAKEVAALIEQTKPLLNLS
                     SEKQTSLVDQAIMFSILRGFFSAPEVQWDPAVLHWMATARKATNVPVLI"
     gene            381824..382759
                     /locus_tag="VP_RS17095"
                     /old_locus_tag="VPA0387"
     CDS             381824..382759
                     /locus_tag="VP_RS17095"
                     /old_locus_tag="VPA0387"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005387025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005479860.1"
                     /translation="MDKFSDMTLFVSIVKHQGLAAAGRELGLSPATVTARLQAIEERY
                     GVKLLNRSTRHVSLTDAGAMYHQACLNIIDSVKETENLLQTGISEVRGTLKISAPRDI
                     GKQIISPMVSAFSEQYPDVTPYLYLNDNLSNLAESGLDLVIRYGELADSNLISRRLAS
                     SQRVLCASPDYLSKQGVPNCPQDLAAHRCLAMVRSNEELKTWHFKDEESHQSITVTPK
                     RFSDDGEVIRQWALDGAGIALKSILDIQQDLKQQRLVTVLDGYMKNFSAFSQGAEADL
                     HVIYQSRQYQPKRVRLFLDFLVEQFSALSDTSNQI"
     gene            complement(382712..383623)
                     /locus_tag="VP_RS17100"
                     /old_locus_tag="VPA0388"
     CDS             complement(382712..383623)
                     /locus_tag="VP_RS17100"
                     /old_locus_tag="VPA0388"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005387023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005479866.1"
                     /translation="MDKSLQQFLLVARCQSISAAARMAGLSQPTVTSNLKKLEENLGV
                     TLFERHPNGMVLTEYGRILYRHSNAMQHEYNQMMQSIDERKQYQVGKIKMGTGDAWWP
                     LFVKQALNEHLTKQPSASTHVEFGNHLGLMDSLINEQIEFFIGHEIVGLSSKCDVTFI
                     PLFQTVDAYFVSSNHPLLGKTVTEEMLHEYPALSVTYDAKKFAHVIDNPIPKQNERER
                     QQLDDRPTYEVDSLLASIDVLKESVAVMSYTRHLQSYLESFGLRCLTMENEPNPGTVG
                     IYRHRRETSESHLDLIAGITQRAKLLN"
     gene            383844..386723
                     /locus_tag="VP_RS17105"
                     /old_locus_tag="VPA0389"
     CDS             383844..386723
                     /locus_tag="VP_RS17105"
                     /old_locus_tag="VPA0389"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479899.1"
                     /translation="MKPSFIALAVASCIGLAGCGSDSSDAPVPVDKPIISADLYLRGL
                     NGDWGTAEHAKLNYLGNNEYETVLRVARGSNQFKIADPGWQIQYTYFEEPAAFDKAQE
                     YLPKPDTNEACMNGDCNSEITFEDKGYYKFSVSFADESRATMTVTKATQEEAEKYYSD
                     AILDPAMVHEGHQNKEVKLFANYDDSSDTVIFSVKDPKAELREFGISTTTELRDALDQ
                     GLVINEQTGPRVVSGDVAFDALFALTMKELDQLAVSEIKDGNYNYNNPIKAEVFETGA
                     KWHYVWTRDLAYAADLSLALMNPTRVQNGLNFKLSAFRDTTDQQYDGEQIVQDTGTGG
                     SWPISTDRTTWTLGAERLLSALDGEEYNQFAERAYKAISNTLEADRLAAFDAKSGLYT
                     GEQSFLDWREQTYSTWTPNDVNAIGSSKALSTNVVHYRAIQLAAKLAEKYDSTNAVKY
                     TEWAAQLKTAINEQFWNAERGMYVSYLFDNGKDIAVDKYDMLGEALAIISGVASDAQA
                     KQIMTNYPHSEFGVPVYFPQQPDVPVYHNRAIWPFVTAYSLRAAHQTQNVAAANNAIQ
                     SLVRGTATNLSNMENLEWLSGKSFIIHSDHGEDPSLDGPVINSQRQLWSVGGYLNMVV
                     ETLFGIHTETGKLEVKPFITSWVRNKLLAQSEQITLENFAFKGKNYSVTIDLPEVSKD
                     ETGYYPVENVTMDEEGHFHVTLGAFVNVDSSITLVSGVKPYVSEDSRVYSPQEPTLVV
                     KSVDNSVSIDVTSKYNVNLYRNGELIQKNVIAQSYSDTPTGFACYLAESINDKGFRSN
                     PSQPVCVGEEIRIKLDGEYQPLKDNVSVVTVSKDSGIVKGAESFTAPVTGTYQFDAWY
                     NNNLGQLNTGITNTVKLLEVLDDAGKVVGQGYLQMGHIGENQGMRYSTPIEVALEQGK
                     TYQFALKDHFNMSYLTSNETYIYAGGIEGEKNEAQIADIRITPLM"
     gene            complement(386830..388398)
                     /locus_tag="VP_RS17110"
                     /old_locus_tag="VPA0390"
     CDS             complement(386830..388398)
                     /locus_tag="VP_RS17110"
                     /old_locus_tag="VPA0390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005392756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_005464136.1"
                     /translation="MGFTSLGLSAPILKAIQEKGYDTPSPIQAKAIPAILEGKDVMAA
                     AQTGTGKTAGFTLPILERLSNGPRVRANQVRALILTPTRELAAQVQENVFMYGRHLPL
                     SSAVVFGGVKINPQMLRLRKGADVLVATPGRLMDLYNQNAVKFDQLEVLVLDEADRML
                     DMGFIRDIRKILALLPKQRQNLLFSATFSDEIRDLAKGLVNNPVEISVNPANSTARTV
                     EQSIYPADVKKKAPMLVKLIKDGDWKQVLVFTKTKHGANRLAKFLIEQNLPAAAIHGN
                     KSQGARTKALADFKSGEIRVLVATDIAARGIDIPQLPQVVNFELPKVAEDYVHRIGRT
                     GRAGEVGKAISLVCALEASELFAIERLIQEVLPRKELEGFAPTNVVPESKLDTRPIKP
                     KKPKKPKKPKAPNASSENAPATEKKAGNGANKPKRRFNGGNNGNKNSTNQGGAGKPKG
                     NREGQGRAHSKPDDRKPNGNKPNGNKPNGNKPNGNKSGNAGKPSGNRKPNNAKPAGNK
                     PSGQRRKPRPQAAN"
     gene            388634..389062
                     /locus_tag="VP_RS17115"
                     /old_locus_tag="VPA0391"
     CDS             388634..389062
                     /locus_tag="VP_RS17115"
                     /old_locus_tag="VPA0391"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010452909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_005479871.1"
                     /translation="MNSYVEHANISVVDAQKMIQFLTAAIPEWKVRGGGKIDNWFGRP
                     IEWFHVGDDHSYIAISSGGKGDATHWTSHFTGFKHIGIVVPDVEALIERLSKAGYELD
                     HRGDEHPFRKNVYYLEDHGMLFEFIEYFSEKGCERNDYNQ"
     gene            389632..390987
                     /locus_tag="VP_RS17120"
                     /old_locus_tag="VPA0392"
     CDS             389632..390987
                     /locus_tag="VP_RS17120"
                     /old_locus_tag="VPA0392"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005451328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_005464113.1"
                     /translation="MSLKNKSFYWVGEPPTSNFCEGVILVNQIEEVPVGLGGMVCISY
                     QDTQQINHALKAFFKEKGRWSWAVYVTVETPYSRCIADGVFEEVESKKVWRSIQSKID
                     SIDEPDVLDPLIGWLGVNRQRRVSALKSLESTSIYSFPITDLLFPDIYSTYRYVLSEQ
                     GRGVLEPEALIDRIRVCSHCNSGHLNYVEVCPDCSSIDIDSQSSLHCFTCGHVGEQHS
                     FQRRGKLECPKCLTQLRHIGVDYDRPLENHVCHSCSSLFVEAATISQCLSCDSKIKVE
                     ELVVRKIYQYRLGEVGEYIFQHGKSIQAPELSIKGKVEVSFFQNLLAWLNKVALRHKD
                     QHLLLGLHLPTIDEYGKQYGDAKLFSLMDQLTCRLSGLFRDTDICCQYKQDVLLVLMP
                     NTTNASLSVLQQKLSDLGDLVEDEEFELDVFAWDLPDPVIEGGVSVWIESLMGEIYAA
                     R"
     gene            390974..392290
                     /locus_tag="VP_RS17125"
                     /old_locus_tag="VPA0393"
     CDS             390974..392290
                     /locus_tag="VP_RS17125"
                     /old_locus_tag="VPA0393"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017819371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_005464097.1"
                     /translation="MLQDSLVLLDYLRGMLLHNEELWLLLFPVMIIIELPLYLLVLTG
                     IFRWSYMREEPELKRFPSVSFVITCYGEGEAIGITIDTLVEQIYPGHIEILAVVDGAV
                     QNQDTYKAALNGERRHTGVRNRKVRVLPKWQRGGRVSTLNAGLSMASGEIVINVDGDT
                     SFDNDMVFTMMKQFADKNVIASGGALRVRNHNANLLTKMQSLEYMLSMQAGKTGMATW
                     GVLNNISGAFGAFRKNLLKQVGGWDTHTAEDLDLTMRLKQYKCRYPDNKLAFSTHSIG
                     HTDVPDTLKGLVLQRLRWDGDLLFLFLRKHNEGLSPRLLGWGNFVFTLAYGVIQNVLL
                     PLLVVIFSVYMVIVYPLKFVLALMLMLYFVYLFLSALIFVVYIGLVSERKKEDLKSVK
                     WLFLYPVYQFFMRLITAFSMVNEVVRRSHEESSMAPWWVLKRGKKF"
     gene            392292..393329
                     /locus_tag="VP_RS17130"
                     /old_locus_tag="VPA0394"
     CDS             392292..393329
                     /locus_tag="VP_RS17130"
                     /old_locus_tag="VPA0394"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017819370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family efflux transporter periplasmic
                     adaptor subunit"
                     /protein_id="WP_005464076.1"
                     /translation="MKVNFHLDKKNKPQSESGMKVVYGQAKRGGYRLRWYLILAIVVS
                     PLLFMAYYLFRTQVLVTAPAIITSYPLTVTATRSAIVGPIPVNVGTEVAQDQALLLLK
                     DNALNKEIDFIKEELIKLSKNQVQSTDELYKNAIASSEEGLKKVQEIQKKYDVYRKKG
                     QVSEVDYAAIVSVNNSLSNQLSSQKIAYVDAMRDLEELELAGPVTQEYRSLMRELVVK
                     RAQQENLTFRSPMKGRVLDVHVHEGQNVSENTPLLTIARNVTPEITAFLNPKYLQYSK
                     MDTKAKVVFPDGRKFSATVSKPVEVVNKLPSELQSPFEGQPAYLKVTLSFDEALEKSR
                     WIEGVEVEVRF"
     gene            complement(393379..394089)
                     /locus_tag="VP_RS17135"
                     /old_locus_tag="VPA0395"
     CDS             complement(393379..394089)
                     /locus_tag="VP_RS17135"
                     /old_locus_tag="VPA0395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoate--protein ligase A"
                     /protein_id="WP_005464070.1"
                     /translation="MVAKNKLIRFTATEVADAFEKEDELIKQVQSNQLSQVLLLWQVK
                     SPTLVLPAGKKWPVSNELEHALNTSGWKLFSRKTGGAPVPQVPGIINLSHIYHWPEGE
                     PYDIKKAYLDLCAILTVFFKQLGVKVDVHATPYSYCDGEYNLNIGGQKVVGTAQRVLL
                     KKGGGQVVLSQACILINADVEKIVKPVRLCNQLCGHDDDIRGDVHTPLFHHISDRPSV
                     DSLFQQLTSAFLTHAKTE"
     gene            394314..394640
                     /locus_tag="VP_RS17140"
                     /old_locus_tag="VPA0396"
     CDS             394314..394640
                     /locus_tag="VP_RS17140"
                     /old_locus_tag="VPA0396"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017819832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4156 domain-containing protein"
                     /protein_id="WP_005464102.1"
                     /translation="MKKRVMCLALAASLTGCVTFPTQESEQVQVLWDNVNAIENCELK
                     GTVIGSEGHFYDYWLHADKDMVWGTLNQMRIKAADLGADTLYLYQPLSFSTSVTMFAN
                     AYKCKQ"
     gene            complement(394736..395764)
                     /locus_tag="VP_RS17145"
                     /old_locus_tag="VPA0397"
     CDS             complement(394736..395764)
                     /locus_tag="VP_RS17145"
                     /old_locus_tag="VPA0397"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017819833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005464082.1"
                     /translation="MNTRTTTGLVTTGWSVIFSLFTAFAAYASTSPNCSDVLAGNTTA
                     VSQKMMVLLGEDITKSNRITTVIPAQNNPFVTEELVSVSNDVSPNGRLPQKTLEEIRK
                     VRSDLEKAAQEVSRLQGTFEVAFVSLIDGYCQFSNHELTQHAKIDFDHLEGLTLYSIP
                     ALLAMVDQSYAMAENRLANEQNQLSNIEKEKQRQKQQASAAAAARYQDGNVLVKVENF
                     DGSNVMFSVTNVGSQGSLQPNFNTFSAYRTESGELVYKSESLLHLADTAGNTLQTMGI
                     AELSSKGGNSLSISPGETRKFVTSIASEVAPHAQLSLEFPAKVLNTEQDFTLSFSDSV
                     AVATANVN"
     gene            complement(396178..397326)
                     /locus_tag="VP_RS17150"
                     /old_locus_tag="VPA0399"
     CDS             complement(396178..397326)
                     /locus_tag="VP_RS17150"
                     /old_locus_tag="VPA0399"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PLP-dependent aminotransferase family protein"
                     /protein_id="WP_005464060.1"
                     /translation="MEIAQSLQQTKSSYIREILAAASDKNVISLAGGLPDEKTFPIDL
                     MKPTLENLANMPEVFQYGATAGYAPLLNFLTDYYQLPESHLAMITTGSQQGLDLIARA
                     YVNPGDKVVMEAPSYLGAMQVFGLVQANIVTVSQTECGPNLEELEQCFATQQPKMFYA
                     VPDFHNPTGVCWALETRQKVAELCIQYDVAFIEDAPYRELRFSGEALPLVSGFCPQHS
                     IVLRSFSKIASPGLRIGVVTGKRSYLEPLIKIKQGADLHSSIPMQALLHGLLQHDNFE
                     THISTICALYKSRYDVMFAELQKQLPESCLLKPVDGGMFVWVEIPECDTFELAKTLLA
                     NWVAVVPSPVFYPEGSKVKAALRLNFTNATPEELTTAVTRLADVLNAL"
     gene            397452..398321
                     /locus_tag="VP_RS17155"
                     /old_locus_tag="VPA0400"
     CDS             397452..398321
                     /locus_tag="VP_RS17155"
                     /old_locus_tag="VPA0400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017015470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_005464103.1"
                     /translation="MSHQQVSRINDVLFYIHQDISRDLSAKELADVAAYSEQHFHRIF
                     KDVVGESIHQYIRRTRMEYAANQLMFDTGSSVLDIANKCGFNSVSSFSRAFKATFTMS
                     PGAWRKHDLQVAEKPYLKDPEVAAGYHRVAKRELPEPKIMEVPQRFAAYVRHEGYNRS
                     IRNAWLILKAWASSENRDFSVQYGLHHSNPAWVELDKCRYVACMAIDKPLKVRGVVNQ
                     MTIPGGLHAVFRLTGVYGELLPQLSMVLEKWLPNSGFKQRSTPAYVHYHKNHFLSHDE
                     AFELDFYLPISFF"
     gene            complement(398429..399466)
                     /locus_tag="VP_RS17160"
                     /old_locus_tag="VPA0401"
     CDS             complement(398429..399466)
                     /locus_tag="VP_RS17160"
                     /old_locus_tag="VPA0401"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4382 domain-containing protein"
                     /protein_id="WP_005479922.1"
                     /translation="MNTIKFSLVGAAVVVALFGCNSDSNTITTTTPVTLSVSDAPIDD
                     VSEVVITYSKVAFLPLDGGSPQIFEVYKTDEEGNYVDENGDPIPDGEDPLPLSVNLLN
                     YQGSDVQELVEDEVIPSGNYKLCVFANDGAHPDYPSYVIDEATGNQIPLTVKGDGACP
                     QGVGKEPNSGVLFFNNTFAVNPDNNEFVVEFDLRRGLKDGTGQNEGYSIQRTSVTLFN
                     TVTTGEIQGDVAAQTYADCEIDTSSANDYAHAVYLYEGSVAKEDMGPFAGEDGKATPI
                     AATNVVPDMEQVNYEYEFGFVEPGTYSVGYTCTANDDSEEGIVAGETFSIYQATSGLT
                     VSAGADTDANF"
     gene            399699..399938
                     /locus_tag="VP_RS17165"
                     /old_locus_tag="VPA0402"
     CDS             399699..399938
                     /locus_tag="VP_RS17165"
                     /old_locus_tag="VPA0402"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009697034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YdcH family protein"
                     /protein_id="WP_005479911.1"
                     /translation="MLGENHSLTHEFPEHLDTITQLSQNDASFAENVKNYNALDKEIR
                     VLELQGSPIDDHAMNVLKHNRAELKDWLHSRIMGS"
     gene            complement(400001..400909)
                     /locus_tag="VP_RS17170"
                     /old_locus_tag="VPA0403"
     CDS             complement(400001..400909)
                     /locus_tag="VP_RS17170"
                     /old_locus_tag="VPA0403"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005464099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_005479818.1"
                     /translation="MVYLLPFFTVMIWGGNSIVNKMAASTIEPSAMSFYRWFVAMVLL
                     TPFCLPAVIKQRHVIRPYLTKLAFLALLGMVLNQSLGYYAGLTTTASNMALITSLVPL
                     ISVFLSVPLLGKSVSMLSIVGGVISLGGLAFMLGHGDVTYFLHQDMTQGDSLMLLAAL
                     VYAAYCVLLKRWKMPFNSLTLVYMQGFFSVIMLTPLWLSSEQLLPSQEALPLIAYAGI
                     AASIFAPLMWVKAIDLIGADSSAMFMNLMPVVSVALASTLLGEEIHVYHIIGGLMVIS
                     GVILSQIKVRKKQDLVVSESLTTTTR"
     gene            401008..401796
                     /locus_tag="VP_RS17175"
                     /old_locus_tag="VPA0404"
     CDS             401008..401796
                     /locus_tag="VP_RS17175"
                     /old_locus_tag="VPA0404"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004411395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_005479930.1"
                     /translation="MKNSARNLHPSLSIDRAPSDVFMNFEAFLSNTETRIHSHPWGQV
                     QLISGGILEMDAEDTRFLAPPHLAIWVPAGIRHTSYNRKPIEYCSLNIAPELTAHFPT
                     KTSLIKVTPIVSAIIEDFRQRDINVAQSDEDKRLVRVLLDQLAKQEVEHHFLPTTDNK
                     YLQPILKAVEESPTDEISLAEWAAKVHTTERTLARHCQSELGMSFTEWRLRVRYLHSM
                     ELLRKGQTVKEVALTLGYNQASPFIAMFKKYSGMTPEQYKNRLL"
     gene            complement(401791..402708)
                     /locus_tag="VP_RS17180"
                     /old_locus_tag="VPA0405"
     CDS             complement(401791..402708)
                     /locus_tag="VP_RS17180"
                     /old_locus_tag="VPA0405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004745458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M14 family metallocarboxypeptidase"
                     /protein_id="WP_005490846.1"
                     /translation="MKSGYSYPIGTPGQPWGEAERKAWVAQREVKRSYQEEVVSKIDA
                     LRDRFDVEQYGALSYDQARFPLFCIKTRNWDSAKPIVLVTGGVHGYETSGVHGALKFV
                     ATEAEHYAEHFNIVVAPCVSPWGYEVINRWNPNAIDPNRSFYADSPAEESANLIKLVS
                     TLGDVLMHIDLHETTDSDETEFRPALAARDGIEYIEGMIPDGFYTVGDTENPQPDFQK
                     AVIESVAKVTHIAPADEHGEIIGSPVVQFGVINYPMVKLGLCGGVTNCVYGTTTEVYP
                     DSPKVTDEECNDAQVAAVVGGLDYVLAQL"
     gene            402881..403786
                     /locus_tag="VP_RS17185"
                     /old_locus_tag="VPA0406"
     CDS             402881..403786
                     /locus_tag="VP_RS17185"
                     /old_locus_tag="VPA0406"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005453434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF808 domain-containing protein"
                     /protein_id="WP_005490863.1"
                     /translation="MAGASLLTLLDDIAAVLDDVALMSKMAAKKTAGVLGDDLALNAQ
                     QVSGVASEREIPVVWAVSKGSFKNKLILVPSALLISAIIPWLIMPLLLIGGLFLCFEG
                     AEKVLEKLFPHSHPHEEKEELVDTGESLEDYEKRKVAGAIRTDFILSAEIIVIALGTV
                     TGASLVTQILVVSLIAVIMTIGVYGLVAGIVKLDDLGFYLEIRSKGKGWMAKVGSALV
                     AFAPKLMKLLTIVGTAAMFLVGGGIVVHNVPAIHHFVEPIIMNFSGHSVATAILPILL
                     NGIIGFVAGLIVVAVWTVVEKLRGK"
     gene            complement(403875..404903)
                     /gene="pyrC"
                     /locus_tag="VP_RS17190"
                     /old_locus_tag="VPA0408"
     CDS             complement(403875..404903)
                     /gene="pyrC"
                     /locus_tag="VP_RS17190"
                     /old_locus_tag="VPA0408"
                     /EC_number="3.5.2.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005480191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="WP_005480191.1"
                     /translation="MTTLTITRPDDWHVHLRDGEVLKDTVRDISRYNGRALIMPNTVP
                     PVTNTEMALAYRDRILKEQHGEQFEPLMALYLTDNTTPEEIRAAKATGKIVAAKLYPA
                     GATTNSDSGVTDAKNIYHVLEAMEEVGMLLLVHGEVTHHHVDIFDREKEFLDTVLAPI
                     VNDFPNLKIVLEHITTADAAQFVNNASDNVAATITAHHLLFNRNHMLVGGIKPHFYCL
                     PILKRNTHQQALIEAATSGSKKFFLGTDSAPHAKGAKESACGCAGSYTAHAALELYAE
                     VFEKEGKLENLEAFASFNGPDFYGIARNADTVTLEKSAWDVPESMPFGNDIVVPIRAN
                     EQIEWKVK"
     gene            complement(405061..405225)
                     /locus_tag="VP_RS17195"
                     /old_locus_tag="VPA0409"
     CDS             complement(405061..405225)
                     /locus_tag="VP_RS17195"
                     /old_locus_tag="VPA0409"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013053490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YqaE/Pmp3 family membrane protein"
                     /protein_id="WP_005480188.1"
                     /translation="MDTKKLILILLCIFLPPVAVYMEKGLNKDFFINLILTFFFFLPG
                     TIHALWLTMK"
     gene            405492..407309
                     /locus_tag="VP_RS17200"
                     /old_locus_tag="VPA0411"
     CDS             405492..407309
                     /locus_tag="VP_RS17200"
                     /old_locus_tag="VPA0411"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017188687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MOSC domain-containing protein"
                     /protein_id="WP_005491107.1"
                     /translation="MSQPVLSQINVFPVKSVGGVSLSSAWVEKQGLSFDRRFMIAKAD
                     GSMITARKYPQMVTVKSALLADGVVFSSLGMEPLKIRYQDFKMQETPATVWKDAFTAY
                     TTTDDADDWFSQVLGQRVELLFSGEQSNRVRESLGQNVSFADGYPVLVISQASLEELN
                     KRSSEQHSMDQFRTNLVVSDTKPFEEDSWKRIRIGEVEFESLKPCERCILTTINTQRG
                     TFRESKEPLKTLQQFRANERGGVFFGQNLVARNEGIIRQGDKVEVLEYKEPEFYPDNS
                     PVRMTLTCVEREEIAQDFVTLWLEPSNCSLPNYLPGQHLPIEVDINGKKIGRRYTLSS
                     SPSRPGRYAISVKRIAGGRVSNALLDNLQVGDVLEAENPDGQFHLKTHDAQPLLLLSA
                     GSGVTPMLSMVRYLADHNQLNDVVFYHQCRTEHDIPCRSELEQLKREHSGLEVKICLT
                     QPAVDWFGLKGRLSLSHIKQIKDVEQRQVFVCGPDGFMQKAKNLLLKKGLPEAHYHQE
                     AFGVSAVEARPEKEVEIEFNGLKIQGNNQKTLLDQIEDAGKVVSNSCRAGLCGACKVQ
                     LTSGQVHHPDVPALTDEERAMGTVLACCAIPETDVTVTE"
     gene            complement(407395..408225)
                     /gene="nadE"
                     /locus_tag="VP_RS17205"
                     /old_locus_tag="VPA0412"
     CDS             complement(407395..408225)
                     /gene="nadE"
                     /locus_tag="VP_RS17205"
                     /old_locus_tag="VPA0412"
                     /EC_number="6.3.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019276001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ammonia-dependent NAD(+) synthetase"
                     /protein_id="WP_005480808.1"
                     /translation="MEQSIRDEMRVLPSIDPHFEIERRIAFIKRKLQEAGCKSLVLGI
                     SGGVDSTTLGRLAQLAVDQLNEETGSNDYQFIAVRLPYGEQKDEDEAQLALSFIKPTH
                     SISVNIKQGVDGMHAASNIALEGTGLMPEDAAKVDFVKGNVKARARMIAQYEIAGYVG
                     GLVLGTDHSAENITGFYTKFGDGACDLAPLFGLNKRQVREVAATLGAPEVLVKKVPTA
                     DLEELAPQKADEDALNLTYEQIDDFLEGKPVSQQVVDRLVSIYKATQHKRQPIPTIYD
                     "
     gene            408448..408981
                     /locus_tag="VP_RS17210"
                     /old_locus_tag="VPA0413"
     CDS             408448..408981
                     /locus_tag="VP_RS17210"
                     /old_locus_tag="VPA0413"
                     /EC_number="2.7.7.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005480803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nicotinamide nucleotide
                     adenylyltransferase"
                     /protein_id="WP_005480803.1"
                     /translation="MKKIAIFGSAFNPPSLGHKSVIESLSHFDLVLLEPSIAHAWGKN
                     MLDYPIRCKLVDAFIKDMGLSNVQRSDLEQALYQPGQSVTTYALLEKIQEIYPTADIT
                     FVIGPDNFFKFAKFYKAEEITERWTVMACPEKVKIRSTDIRNALIEGKDISTYTTPTV
                     SELLLNEGLYRETLSGK"
     gene            408995..409477
                     /locus_tag="VP_RS17215"
                     /old_locus_tag="VPA0414"
     CDS             408995..409477
                     /locus_tag="VP_RS17215"
                     /old_locus_tag="VPA0414"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011999471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005480810.1"
                     /translation="MVRVAVFSACALLVVTQANSACNYLSDRSVVFEDNTMPICEEIF
                     DTVGVLSTDTLDWYAAEATAEGPTENYWEEWAIKSQDIPFLTQNVDKNYFGLGIWMPE
                     ELREEENKMTTEEWLRSHGLMFSIGFGNKADGEPRMRFDYRWHEYYDADWMMQIEVPF
                     "
     gene            complement(409644..410252)
                     /locus_tag="VP_RS17220"
                     /old_locus_tag="VPA0415"
     CDS             complement(409644..410252)
                     /locus_tag="VP_RS17220"
                     /old_locus_tag="VPA0415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009697130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_005480809.1"
                     /translation="MNYAIEFHDANYPFLNVAARKKSLKHSLLSVVSGLAIIKLGKQE
                     YAIEPGQYFWIPQGCLSSLTFLPNTHVHRCDFSVRLNDAFAQQAGFIKPSILLKALIE
                     KLAKTETRSDIQLDLLAVVKHEVLAISPNLSNSALSQAINQWKPGCEARISRELCLVL
                     TLREARKMKLSGKKESQIVEHLFAGNTEEYEQLCFLVFGEAL"
     gene            410445..411554
                     /locus_tag="VP_RS17225"
                     /old_locus_tag="VPA0416"
     CDS             410445..411554
                     /locus_tag="VP_RS17225"
                     /old_locus_tag="VPA0416"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014234738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_005480805.1"
                     /translation="MTANTDPYIEIRPYNDEEIPAALDRLIQDDEFITAILDHRFENK
                     AKWFKTLMSPFLRIYLKAKWSKLDSVEAIQIEVKKYLQDTLNKTTDGVTFSGLDKLDK
                     NTSYLFVSNHRDIAMDPALVNYGLYQSGHRTVRIAIGDNLLKKPCATELMRLNKSFIV
                     KRSAKAPREMMKALGQLSGYIKHSLDTGNSIWIAQKEGRAKDGNDFTDPAILKMFHVE
                     GRKQKVAFGEYMRSLKIVPVSIAYENDPCDIAKAKELFEKAENGRYEKGEFEDIESII
                     QGIVGYKGRVHVAFGDVIEQEFETPESLANEIDRQIHENYKLYPINLLAAGREDSSII
                     TEAVKRQLADKLEQLPEGARPYLVASYANPVNNQD"
     gene            complement(411667..412266)
                     /locus_tag="VP_RS17230"
                     /old_locus_tag="VPA0417"
     CDS             complement(411667..412266)
                     /locus_tag="VP_RS17230"
                     /old_locus_tag="VPA0417"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005480807.1"
                     /translation="MRFIPLALALIAFSSSPSAYELDYYSKFGHIDNYGNLDLRNKPY
                     TELPSGLVIKGNVDISQTPITQLPKGLDVGGSLDAKNSALKTIKSGVKIKGYANLLGS
                     KIESWPKGVTLGGYLNLTDTPLKTLPAKLRVKGDLSVIRTPLKALPEGLVVDGNLYIG
                     GSALTEFPDTMTVKGNIFLGGNKIIKWPKNLTLGGAVAR"
     gene            412475..412747
                     /locus_tag="VP_RS17235"
                     /old_locus_tag="VPA0418"
     CDS             412475..412747
                     /locus_tag="VP_RS17235"
                     /old_locus_tag="VPA0418"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005453446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YnjH family protein"
                     /protein_id="WP_005498191.1"
                     /translation="MKFKRVSIFTLSAMVALLSGSVFAKSYSTPESKALVVADGKIGQ
                     RICYYEDKAYTAGAVIKVDDVLLVCSDENDYETNGSLKWVVLKQKK"
     gene            complement(412792..413091)
                     /locus_tag="VP_RS17240"
                     /old_locus_tag="VPA0419"
     CDS             complement(412792..413091)
                     /locus_tag="VP_RS17240"
                     /old_locus_tag="VPA0419"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005441132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YfcZ/YiiS family protein"
                     /protein_id="WP_005488152.1"
                     /translation="MSVELEESQVCEACGCAGEIGFIIKEGDEVADVTIFAETKDALE
                     SELAKYIELAKSVCAGVEYNVSELTEESKELTARFKFEVSAEKLIFELKTRSLAR"
     gene            413616..414077
                     /locus_tag="VP_RS17245"
                     /old_locus_tag="VPA0420"
     CDS             413616..414077
                     /locus_tag="VP_RS17245"
                     /old_locus_tag="VPA0420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004411412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_005481342.1"
                     /translation="MPKRSKEDTEITIQKIMDAVVDQLLRLGYDKMSYTTLSQQTGVS
                     RTGISHHFPKKTDFTAALDGRIFKMFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRL
                     LFHHIVTSESAHEFAANGIDRLYKMVESQFGSGGDKELEWLIGRSLIQMSK"
     gene            complement(414221..415003)
                     /locus_tag="VP_RS17250"
                     /old_locus_tag="VPA0421"
     CDS             complement(414221..415003)
                     /locus_tag="VP_RS17250"
                     /old_locus_tag="VPA0421"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006960626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter ATP-binding protein"
                     /protein_id="WP_005491112.1"
                     /translation="MNHVVLSGRNISMKYGHRLVLDDISIDIRAGEVTALLGPNGAGK
                     STLLKLLCGEVPSHNEIDYFGEPKEAWKPEEIAKHLAMLPQHSTLTFPFLAREVVELG
                     AIPLSLSNKETTELALHYMQKTDVLHLAESLYPALSGGEKQRLHLARVLTQLHQSGDK
                     KILMLDEPTSALDLAHQHNTLKIAREAAKAQNAAVVVVLHDLNLASQYADRLVLLHNG
                     KLVCDDNPWQALTPERIEQVYGYRSIVTKHPTLDFPQVHAAA"
     gene            complement(415003..416040)
                     /locus_tag="VP_RS17255"
                     /old_locus_tag="VPA0422"
     CDS             complement(415003..416040)
                     /locus_tag="VP_RS17255"
                     /old_locus_tag="VPA0422"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004745622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_005491087.1"
                     /translation="MLLRRIPLSTTLITLSGFLAFIAIASITVGPMNISFTDSLRSLV
                     GAHSELAPHIQLVINEIRLPRTILCMFIGAILAICGVVMQGLFRNPLAEPGIIGVSAG
                     AALGGAFAIVVFAEFSQNHPQLMNLAALPLFAFLGGALTTVLVYWLGTNKFGTSVTIM
                     LLAGVAISALSGAAIGFLNFSADDQMLRDLTLWSMGSLAGANWAGIGLSSVTLVVLLF
                     WFHKKAMSLNALLLGESEARHLGVPVQKLKRQLILLSAVGVGVTVSICGAIGFIGLVI
                     PHLGRMLAGPDHRTLLPISALLGALLLTCADMIARVLLTPAELPVGIVTALIGAPFFI
                     YLLFQQRGKIL"
     gene            complement(416050..416919)
                     /locus_tag="VP_RS17260"
                     /old_locus_tag="VPA0423"
     CDS             complement(416050..416919)
                     /locus_tag="VP_RS17260"
                     /old_locus_tag="VPA0423"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005433515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin ABC transporter substrate-binding protein"
                     /protein_id="WP_005479207.1"
                     /translation="MKNTLSPVRTALTATALLLASTNLFANNAPNSERVVSAGSAVTE
                     LLLALDAKDSLVAVDVTSTLPQGMELPDVGYHRRLSAEGLLALSPTKLIGSDEMGPTT
                     TLNQLKSAGVDVEIVNTEANVDGLLHRIDQIATIMNRESQAANLKQEVKTQVESLQAN
                     QPAPSAKKKVLFLLIHEGRPANVAGLDTTPDAIIALAGGDNPAAKKLTSYKPLSTEAM
                     VEMQPDVILVSGRSYETMGGADAILKAMPLLAATPAGQTKNIITIDRHALVGGLGLKS
                     LSEAKRLNALLYP"
     gene            complement(416947..417360)
                     /locus_tag="VP_RS17265"
                     /old_locus_tag="VPA0424"
     CDS             complement(416947..417360)
                     /locus_tag="VP_RS17265"
                     /old_locus_tag="VPA0424"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="WP_005454456.1"
                     /translation="MIKVPQDNNRNGLTPDLTPLLDIIFIVMVFLMLTAAVKLDSLDV
                     ALPSTDSQAVAEVDKQSITVNILKDEPYWAINGQTYIDWENFTLALLEESKSTDKPIV
                     IGAEKTANIQSLVQLLGFLQENGIQATQLLTEESP"
     gene            complement(417357..418049)
                     /locus_tag="VP_RS17270"
                     /old_locus_tag="VPA0425"
     CDS             complement(417357..418049)
                     /locus_tag="VP_RS17270"
                     /old_locus_tag="VPA0425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MotA/TolQ/ExbB proton channel family protein"
                     /protein_id="WP_005479222.1"
                     /translation="MEQLQELQTQFGLMTWPLIICSALTVMIIAERLFQVFISLGVGK
                     SAIRQHLASLDPTNSRDIEALADELSGKRPLLYRGVAMLLAHHSFAKSLREDAAGMWL
                     QEKRHQLHSGLRLLTLIGVISPLIGLLGTVLGLIEMFKGIAVSTGNITPNDLADGLGL
                     AMRTTAAGLIIALPAISGAQIIGLWADRVLAKLEHTLNYVNLWLEGISLQHVSPEKTT
                     ASVTKTAETKAS"
     gene            complement(418049..418792)
                     /locus_tag="VP_RS17275"
                     /old_locus_tag="VPA0426"
     CDS             complement(418049..418792)
                     /locus_tag="VP_RS17275"
                     /old_locus_tag="VPA0426"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017818599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy transducer TonB"
                     /protein_id="WP_005479220.1"
                     /translation="MNVQRYVIAGGASLVIHAALLFVSQENKVFAMPAGNPASSVSLN
                     LVSAPPPTLEKPTPENVEPPKEPQPQKQSEPEKKIIKKQVVKKEAVKKKVVEKKPEPI
                     KQPKKVEPTKTVAKQETQPKAEPKKKIEPVKKDTVTQQTASASQSKGATSQPILVDKP
                     TFVSQPTQPRYPRSAQRRGIEGAALYEVWLDENGNQIKHVLLESSGTESLDASALRAI
                     KQWQFTPHILGGLKVAHRVQIPVRFKLEG"
     gene            418955..420325
                     /locus_tag="VP_RS17280"
                     /old_locus_tag="VPA0427"
     CDS             418955..420325
                     /locus_tag="VP_RS17280"
                     /old_locus_tag="VPA0427"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011999480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme anaerobic degradation radical SAM
                     methyltransferase ChuW/HutW"
                     /protein_id="WP_005479251.1"
                     /translation="MSVDIDKFDESVLGSDSPDPLRFAFVKKHSAHAGGASVPVPPPQ
                     QAGLLSSITSDQNVRNNKRCLYIHVPFCRVRCTFCNFFQNAASRKLVDEYFAALMQEL
                     KEKAALPWTQSGIFHAVYIGGGTPTDLSPEQVRVLGQAIHDYFPLASDCEITLEGRIN
                     RFSDELYQGALDGGFNRFSFGVQSFNTQVRRSAKRLDDREDVLKRVSELAKEDKIPVI
                     IDLLYGLPYQTKEILEQDLNDFMSTGAHGLDLYQLVVGGTAPMLNLVEKGKIPPPATT
                     PEKAGMYELGVNFMAKHHMKQLSVNHWAVDNRERSLYNSLAKTYAEVLPIGCGAGGNI
                     GGYGMMLHRTLDTYIKAVNEGQSTIAMMMKHSPLEPLFAALKSGFDRGIVQASKLPVF
                     MGSDTFDFLMPMFKVWQDKGLVELQERSLVLTLAGSFWAVSLAQACIQVLTSEMNESV
                     PKVSNN"
     gene            420359..420862
                     /gene="hutX"
                     /locus_tag="VP_RS17285"
                     /old_locus_tag="VPA0428"
     CDS             420359..420862
                     /gene="hutX"
                     /locus_tag="VP_RS17285"
                     /old_locus_tag="VPA0428"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019277742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme utilization cystosolic carrier protein
                     HutX"
                     /protein_id="WP_021451074.1"
                     /translation="MESIEQQVEVLLEQEPQLLPAAMAERLGVTEFDVVAALPQEMVA
                     ISPGEQAQTILESLVGFGPVTTIVHSFGSIFEVKAPFPKGKVARGYYNLMGREGELHG
                     HLKLDNVKNIALVSKPFMGRESHYFGFFSECGSNIFKVYLGRDEKRELIAEQVTAFRA
                     MQAELNQ"
     gene            420981..421511
                     /gene="hutZ"
                     /locus_tag="VP_RS17290"
                     /old_locus_tag="VPA0429"
     CDS             420981..421511
                     /gene="hutZ"
                     /locus_tag="VP_RS17290"
                     /old_locus_tag="VPA0429"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006960636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme utilization protein HutZ"
                     /protein_id="WP_005457554.1"
                     /translation="MDQQVKQERLQGRLGPEIKEFRQERRTLQLATVDSEGRPNVSYA
                     PYVQNQEGYFVLISQIARHARNLLENPNVSLMMIEDEDSSKQLFARKRLTFDAVATVV
                     ERDTEMWQLVVGQMKARFGDIIDGLSQLEDFVLFNLKAEKGLFVKGFGQAYQISGDDL
                     VDFVHLQEGHKKIENA"
     gene            421586..422122
                     /locus_tag="VP_RS17295"
                     /old_locus_tag="VPA0430"
     CDS             421586..422122
                     /locus_tag="VP_RS17295"
                     /old_locus_tag="VPA0430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017036763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP:cob"
                     /protein_id="WP_005479198.1"
                     /translation="MRPVSKELSEICYPFIYEDSPVCDFEITADELCSRIGLVLSMEL
                     DDFSRDILTRLQPNVYHLNGSVRGKLAITESEVEELKADYEAIKARIDGGFKGFVLPG
                     GHATSSQLHLCRSQAKKTVRALVAIEHAGKKQPAPILFRYANLMANVIYSLASYINHV
                     YQVEETEFVSRSYTMPKK"
     gene            complement(422263..423177)
                     /locus_tag="VP_RS17300"
                     /old_locus_tag="VPA0431"
     CDS             complement(422263..423177)
                     /locus_tag="VP_RS17300"
                     /old_locus_tag="VPA0431"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020335367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheV"
                     /protein_id="WP_005457535.1"
                     /translation="MAKVVSKANQSQGMLMFKLTLQQNFAIGTLKVREIVPYMPTTKI
                     PYSHHHVIGTVTIRDLTVPVIDMSAAVGFRPITQEEYKNCYLIVTDCLRTVVAFMVRS
                     IEKIIECDWKAIETPPASAGKNIFVTGITRYGDQTVQMLDVELLLSKIYPQYENANIP
                     MLTDVERERLKALNILLVDDSSIARKQLSDALDSINISYQICKNGSDALQLMKNEAEA
                     NRPIDILVSDIEMPGLDGYELAFEVQNDSALNHSYRILHTSLSSEICVDRAHQVGAHE
                     ALEKFNAGELIEAMLRGAKELEANAMAS"
     gene            423443..423724
                     /locus_tag="VP_RS17305"
                     /old_locus_tag="VPA0432"
     CDS             423443..423724
                     /locus_tag="VP_RS17305"
                     /old_locus_tag="VPA0432"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_005479216.1"
                     /translation="MANTAAALHILVKHKEQAEDIIKQLKKGAKFQTLAKKYSTCPSG
                     KRGGDLGEFRRGQMVPQFDKVCFSGEVLTPHLVKTKFGWHVVKVLYRIP"
     gene            423787..425514
                     /locus_tag="VP_RS17310"
                     /old_locus_tag="VPA0434"
     CDS             423787..425514
                     /locus_tag="VP_RS17310"
                     /old_locus_tag="VPA0434"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
                     /protein_id="WP_005479264.1"
                     /translation="MTKIAYSYTRLSTEKQIKGHGFTRQREAIEKVCCQHGWQLSDQT
                     FNDLGVSAWKGANATTGALSQFIDLAKKGAIRPNSVLIVESVDRLSRQQVDKSLRLML
                     ELLEVGVSIFTLSDSKLYTTNSDSVMLDLMMWLMTAQRAHEESEIKSLRVRAAKKKNK
                     ELIRKGIIVTRKCPEWLTVSDDKSCFLVNNERAEIVRKIFTWYSQGFSTKPIALKLNE
                     LGIPYWGKSSTWSYRHIRSLLKHRGVIGEIQLLKRIDGRDVADGDPVEDYYPAIIDRG
                     LWATCQQIKSSKTTAKGRVVERGMANLFRGLLKCECGSGLAINSSTVKGRTYRFLRCS
                     QLKTTGCQAKNWHYEKTERILLIALRHSLSSFSEEDHAVSLRECQHYLARISEELKEK
                     ERQAENAINYLLDKPSKLLEARLQTLEDDIARLKAIQEQAEHRLEAVHYEKSTALDKV
                     EELQRVLEDIANDDDSRHKANGLLRRLIDTITLGSISNPRSKEFMEVSGNDYHGLIII
                     KRRDGLELRIEVLKDYGLSISWEGDDFTVIECSPTQQLNSQHEHQKFINVGEQTVDLW
                     DDEGWVASS"
     gene            425692..426558
                     /locus_tag="VP_RS17315"
                     /old_locus_tag="VPA0435"
     CDS             425692..426558
                     /locus_tag="VP_RS17315"
                     /old_locus_tag="VPA0435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011847630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_024699324.1"
                     /translation="MAGRQKIPEKVKQTLRREVGFGCPVQGCANPYLEYHHFDPPVKV
                     KPHNNPEGMIALCAQHHKKADGGAYTNEQLHALKKDKANANDVKGNLDWLRRDLLAVV
                     GGVFYYETLNIVRIDGVDVVSLDRDEEGYLRLSINMLSLSSEERIVIDKNSWERVGYP
                     SDLRSPPQGKELEVSYSNGDYLYLRFWELKTKEQAQSRYNSSMLNHLRFPITAIEVNL
                     AIAGTGINLSPDKTTIGGLNLMGGLIENCGVGVCVEGSGFRWLQNSVAQRQESILEIE
                     GNVISVQFRRPK"
     gene            426746..427390
                     /locus_tag="VP_RS17320"
                     /old_locus_tag="VPA0436"
     CDS             426746..427390
                     /locus_tag="VP_RS17320"
                     /old_locus_tag="VPA0436"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
                     /protein_id="WP_005479233.1"
                     /translation="MITQSNDSNSMVFAYVRVSTKEQNVDSQLSDISKLYPDAEITTE
                     KVSGTVPAKERAGLSVLLGKLRKGDTLVVWWVDRLGRDYRDAESTIRELLDRGVCIKT
                     INQGLTFSYSNKDDDMQNMVTDIQITMLTAMAAAERKNRLASAEAGRQALKANPAKWA
                     EKFQGRKANTKQHQRIIELLLEGKSIRGVAQELGCNASTVQRVKKKAVEAGTVF"
     gene            427538..427738
                     /locus_tag="VP_RS17325"
                     /old_locus_tag="VPA0437"
     CDS             427538..427738
                     /locus_tag="VP_RS17325"
                     /old_locus_tag="VPA0437"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479249.1"
                     /translation="MNDVLTIKASNHLDTQTLLTTQDSQLHQEVWGHVKALVELGVFE
                     DATNGIENVLAPYMAEVNAELI"
     gene            428400..429011
                     /locus_tag="VP_RS17330"
                     /old_locus_tag="VPA0439"
     CDS             428400..429011
                     /locus_tag="VP_RS17330"
                     /old_locus_tag="VPA0439"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005483022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_021454809.1"
                     /translation="MTYVNNSKLKAKLACALEYSDLSRRQMAVFDNACRLSGVGRGLS
                     RSRIFRLLQTLDTLTYDSLERRLNVSLKALSRESYSKRTIALYLSVCRKVASQLAQMY
                     GIPRHETTIPESEFQYRPSVSDKRVFTVAERMLPKGAKYLIVSMSTLEEALRLKPRTI
                     RESLKRLDHHGYIVCLGGDEGANYSITFKRSIHATSALSLQAA"
     gene            429180..429689
                     /locus_tag="VP_RS17335"
                     /old_locus_tag="VPA0440"
     CDS             429180..429689
                     /locus_tag="VP_RS17335"
                     /old_locus_tag="VPA0440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HI"
                     /protein_id="WP_005479244.1"
                     /translation="MNTQLQTTHLLHNAQHPLSIYCDGSAPDNQHGCLQGGVGIAVYD
                     ALGQCVYEYSSSVRRTGGVTSQRAELLALIIALLVAGEGDNVFSDSQYCVRGFNEWLD
                     SWKRNAWRNSSKKPVANQDLWMLIDELKAIRPRVSVEHVAGHSGIKGNEHSDRLATQA
                     AVDSKQTLS"
     gene            430401..431858
                     /locus_tag="VP_RS17340"
                     /old_locus_tag="VPA0441"
     CDS             430401..431858
                     /locus_tag="VP_RS17340"
                     /old_locus_tag="VPA0441"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3360 domain-containing protein"
                     /protein_id="WP_005457552.1"
                     /translation="MSDSSKTFYRDVRKKPHEFESREDFLNHDLTVMSFRRWGIHLPS
                     RDYSIEIEDWVPALAATIGKVVMVTAMVAAFAAQFGLSPEFVAENVRYELLIAGALFV
                     ILFSAILNPNANLAGTHGPMIPLIPMIAAAGGHPLALGLMVCAFGLILAFTKGGSKLM
                     TLTGIGVRGGLLIYLGAVGLIGQINKTEAWAASTDQGYISFVVIGLTVMVYAYLAKIN
                     KRWLAIPLCSALAGIVAYAMGAEFAFTTEPGLPNFSPFYWWGEDTGWQLGWPTLEHFI
                     AVTPFALLAVAMWSPDYLGHRVFQELNYPKEAKGVLMDVDDTMVGASIRQGVGSLLGG
                     GNLASSWGTYMIPAAIAKRPIPGGALLTGLMCIAAAVIGYPMDLAMWEPVLRVALIVG
                     VFLPLLEAGMQMIHKHKDSLSAGICIFACAFVNPVFGWAITMLLDNLGLIGDHERANE
                     LSGKDKYLIPGVAFIVCAGSLAVVGQLPGIPALIS"
     gene            432614..432889
                     /gene="hxsD"
                     /locus_tag="VP_RS17345"
     CDS             432614..432889
                     /gene="hxsD"
                     /locus_tag="VP_RS17345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016800223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="His-Xaa-Ser system protein HxsD"
                     /protein_id="WP_024699317.1"
                     /translation="MLIHQLEKSTFSESVVRHALYWMSPLTTWKLADEDIRWTVHFSS
                     QDEDIILEFERLLNDYLLREKLSKKTSSYLEGISAAVLSSVEKKLSK"
     gene            432886..434283
                     /gene="hxsB"
                     /locus_tag="VP_RS17350"
                     /old_locus_tag="VPA0442"
     CDS             432886..434283
                     /gene="hxsB"
                     /locus_tag="VP_RS17350"
                     /old_locus_tag="VPA0442"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017098571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="His-Xaa-Ser system radical SAM maturase HxsB"
                     /protein_id="WP_005479204.1"
                     /translation="MNVLPFNFEFLDSDIALLTNQAGFHAYLSRMELNSLIDKNSTDD
                     AVIDELLERKLFICDDEYKSASVGSLASGMSKRLMSALNFNPIFMIVPTLRCDHTCHY
                     CQVSRASVKASNYDLEPDLIPLLLQRIRSLGNAPYKLEIQGGEPLLRFDLVQKIYQEA
                     VSNLGVDQFEIVIATSLSLLNDDVLTWSEDKPINFSTSLDGGAFTHNSNRVLKGGNSF
                     ELVKQGVEKIRRRLGPDRVATVTTVTEALLQKPEDIVDAHSDLGFSDMFVRPISPYGF
                     ANKGNAKTYDIKAFMAFYEQLLKVLNRKRLAGERIIEHSALIHLRRIFNADYSGYADL
                     KSPSGLILNCIMFNYDGRIYGSDEARMLQKTNPDIDFSLGTIQEPVIESNSLYKSILS
                     QSFISVHPGCASCAYQPFCGSDPCQNISVFGEPIGDKSLSRFCQYHKAMFTLILKHLY
                     AEDGIGEMLKEWLHE"
     gene            434276..435394
                     /gene="hxsC"
                     /locus_tag="VP_RS17355"
                     /old_locus_tag="VPA0443"
     CDS             434276..435394
                     /gene="hxsC"
                     /locus_tag="VP_RS17355"
                     /old_locus_tag="VPA0443"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014658381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="His-Xaa-Ser system radical SAM maturase HxsC"
                     /protein_id="WP_005457560.1"
                     /translation="MSNVIRPDTFSLEEDGFSTSGFYQIRKDKGTSDSRYLEQVFLAK
                     EQQAHLNSASDDFVGVITHATLHNSVDDGDVVNINQFGQLRVILSRRANHNTLLVTER
                     CNNLCLFCSQPPREERDDWLLSYGALALAAFGFDGDVGISGGEPLLYGDAFIKFLEFV
                     SDHAPNTRLHVLTNGRAFSDSEFTGQLALMASRLDITFGIPLYSVRGRIHDHLVGRDG
                     AFSQTVVGMINAGNSGIKMEVRFIPTQHNASELPQVAEYVARVFSGVVQLSIMNLEAT
                     GWAKRNWSALKCAPEDYEDALIKGLLTAEMAGLNPTLFNFPLCHLPSSIRSYAVKSIS
                     DWKNYYPSECSDCQLKDSCGGYFSSSRGKYHASPRRII"
     gene            435391..435924
                     /gene="hxsA"
                     /locus_tag="VP_RS17360"
                     /old_locus_tag="VPA0444"
     CDS             435391..435924
                     /gene="hxsA"
                     /locus_tag="VP_RS17360"
                     /old_locus_tag="VPA0444"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016799683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="His-Xaa-Ser repeat protein HxsA"
                     /protein_id="WP_011106271.1"
                     /translation="MKRNFNLAALLPGFFALNSGANAGTAAPEELDVKDELLLDKVVL
                     APLNEAIPLYIAAHRSHSSHRSHSSHRSSAGSTYSAPVKKQKSQPLTQPSTPSYTAPA
                     TKRPVSTAEELEKRKELIIRVQFALYTSGYYKGIIDGIMGKQTRKALNAYRVDNNIPV
                     SQTLDTVTLNSLGIIAR"
     gene            435921..436277
                     /locus_tag="VP_RS17365"
                     /old_locus_tag="VPA0445"
     CDS             435921..436277
                     /locus_tag="VP_RS17365"
                     /old_locus_tag="VPA0445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016799684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03982 family His-Xaa-Ser system protein"
                     /protein_id="WP_011106272.1"
                     /translation="MKRVFYFIISLCCIAWIGIYVVSPVFAYFYYKNQFMEQTAECSL
                     AMDETWYIEQLESNTLNQTAKVHLLACHEYDKTRKIMLAMRVPESVLGYLGLEAIELH
                     QRSIEPLIEQHRFRER"
     gene            436280..437515
                     /locus_tag="VP_RS17370"
                     /old_locus_tag="VPA0446"
     CDS             436280..437515
                     /locus_tag="VP_RS17370"
                     /old_locus_tag="VPA0446"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017109368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylamine utilization protein MauG"
                     /protein_id="WP_005457553.1"
                     /translation="MKAWLLVMFASFQVSAMSLDETLRVAIQAFELEGNVCSKPLVKE
                     PSYLADVGKVVFERPVLSGDKDTACANCHLDNKALTDGLPLAIGVGGIGEGEERLASD
                     GAVVPRNAFTLFARGDSRFNTFFWDGKVQAIDGKIFSPVGEGSSLGFDSALAVAAVLP
                     LLARDEFLGTSKRFNTNRHVDLVESQYYADKVPAQNTFIQERLLEKNDPDVRMLLAAM
                     ESANIPQADLTLPLVGNALASFIRQKVSEECTPSAWEQYINGDTSALSEVQKRGAILF
                     YGKARCASCHSGDLMSDMSFHSIGVPQGNQGPHMFGQDFGRALVTLDNSDRYAFRTPS
                     LVAVSKTAPYGHNGIFPTLKGVVKHHISPIFYYRDPTVSDQMILDNNESLDRRSDMLR
                     WIRVDESELSQLLTFLDAL"
     gene            complement(437900..439522)
                     /locus_tag="VP_RS17375"
                     /old_locus_tag="VPA0447"
     CDS             complement(437900..439522)
                     /locus_tag="VP_RS17375"
                     /old_locus_tag="VPA0447"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005457551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="patatin-like phospholipase family protein"
                     /protein_id="WP_005457551.1"
                     /translation="MSRFYVDYWSREWVDENDFPEAELVSFKEDYANRDLGVAFSGGG
                     TRSAACTVGQLKALDELGLLPRVKYISAVSGGGWAATPFTYTKNTEQYFGEIRDPENI
                     TCSNSKSVHPKSMQSAITNSPLISNLITGGLKLKGDESFAYSLGEVFLKPYGLHDSSR
                     YFTFNEETEALTRQGFPPNTKTDFYLVRKGAPYLILGATLLNEDGLASDKKYHVEYTP
                     FYSGVRVGHIDKDLWSSNDYFGGGYVTSCGYDCIGPYNKRTLEGREQLLVKQAPVLSF
                     DITNEKAFSLNDIIASTGAAPQEITNNIRLGALGFPEFNHIPLNTLEGDNSVSEEYPH
                     SDGGHLENLGIMPLLARKMTKIVVFVNTKKPFTPNKKKPLDSGFNKSVKALFVPIDNL
                     FKKGDFATNVVFDNGEEELTKLIGQFSQLVKKESSSDEYIAKTALFAKTKLVTTSNEH
                     YGINAGHEVEITWVYNCRSSAWEKKLKDKDLGKLIANKKRLIGDQKGLEDFPHYGTFF
                     ENFRGVVELTKVQTNLLTNLSYWVAKKALNGV"
     gene            440038..440772
                     /locus_tag="VP_RS17380"
                     /old_locus_tag="VPA0448"
     CDS             440038..440772
                     /locus_tag="VP_RS17380"
                     /old_locus_tag="VPA0448"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005457547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005457547.1"
                     /translation="MTPQLPKWVTDLAIVGLIFTVGGYATRIELAINGINEDIAEMEK
                     KIVSFDTAISIHHGPNWTERARSNDLKRVEDLEKTIGGISEKFEERVTTLGSGFTSTS
                     KDMSDIQRKVEAINRWTQQGDVLIKKSRLDKFRALANYATYESPDPTQVSINKQHSRG
                     KNFKIGDRLILENPANGSSVEVGVKSMLDDPNSSNILVQLPQDLLLELGLTTQGGRYE
                     LYIQGKPEALRWKSLDQIYQELSAQQ"
     gene            441200..443104
                     /locus_tag="VP_RS17385"
                     /old_locus_tag="VPA0449"
     CDS             441200..443104
                     /locus_tag="VP_RS17385"
                     /old_locus_tag="VPA0449"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005457556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S8 family serine peptidase"
                     /protein_id="WP_005479213.1"
                     /translation="MHHSLSLPILLLSSAIVQAAVPESLAIPQAYLDSHPHPVHTTLP
                     PAYAVDRILVKFRPGAAASDVGELMRESRAEALKVISGIDVHVLQVPVGTVEAQLARF
                     NQNPNVLYAEPDINHIVQYVPNEGLGGSIYASDYFSEQWALNNTGQVHSTVVNDPLFG
                     PYLDEASGLPGADINAPEAWDMTKGSSAVKIAILDSGIDCRMAGDSVSSIEFGNGKCV
                     EQQKFVTDYQSDTLEDVVGHGTHVAGIAAGQTDNGIGIAGVGFNSSVGNLKTCYEYLI
                     YSCDPFFGCFLIAATGVCPLSSSIDAITYAADNGYHVINMSYGSDEIDEEGNPISLVG
                     YSQAENDAVNYAWGKGVLLVSAAGNAGDPIKNYPAAYDNVIAVGATDDDDNRASFSSF
                     GSDWVSLMAPGDSILSTMPNEQCGTFDYDNDACLHWQSGTSMASPHVAGAAALLWAYK
                     YADQLSDPATCQDASGVPCNQMIRMMLEQGADPIGADGQDLQSISQYGRLNLVGALTA
                     TPSEPPPPPPLVVKAPEALSISINNSIVSLTWNYSGDQGAIAGFRVERESRNAKRNRW
                     QSLSSWDVLDPTVMTFEDSSANGEVHYRVGTIQQSDGSLFWSGWSDNITVAGSGGGKG
                     GGKGGGKPNK"
     gene            complement(443196..444689)
                     /locus_tag="VP_RS17390"
                     /old_locus_tag="VPA0450"
     CDS             complement(443196..444689)
                     /locus_tag="VP_RS17390"
                     /old_locus_tag="VPA0450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VPA0450 family T3SS effector inositol
                     phosphatase"
                     /protein_id="WP_005479246.1"
                     /translation="MSTIQINSQHRGNLDLADIQNIKTNAKEGDTVKFGSVFGKEYSV
                     TKSNDGEISLKQKENRSFFNRFFSKTDSSKNSDLKLNLMNQQLHKKENNGNVKVLTLT
                     YNQANQKMPAETKNYFQNLIQKGDYDVVLFAEQESKLLANDLELDGMNLLSQNKMKVM
                     TKGLGEGISYTSMSVFAKDGVDINVKNESEYRHGIGGRNMEFFMGITGNKGGVKTALE
                     INGQPLNVISAHLDSNKEVKREFEGNKLMEGINPNEEVLITGDLNEREKRVAEGSDVL
                     YDPIAHDDTHLAKHGFKFKPLDSHTYMQLDKHTGNIKQKEGRDRPDFGELDNTGLTNK
                     TGNLQNHQTSVITDGFENVSDHKPVQSTFEVRSFSQKLIENAFTQNANDFKNDAAYLK
                     PGTNPTNATFDDVTSANQARLGLENLNPNEQAFVKENFASFIIGKDAIFSQLTSGFME
                     EMSQLHASDLAKNPTHLQAQQIALSEKYEQLSDKVNAEFNKQFVANL"
     gene            complement(444730..445179)
                     /gene="ati1"
                     /locus_tag="VP_RS17395"
                     /old_locus_tag="VPA0451"
     CDS             complement(444730..445179)
                     /gene="ati1"
                     /locus_tag="VP_RS17395"
                     /old_locus_tag="VPA0451"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005457555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ati1 family type III secretion system chaperone"
                     /protein_id="WP_005457555.1"
                     /translation="MDIYQESISFLGNDANFDANGLFQCELSSNTNDHDEALFLTIFK
                     NETTINLHMSLTSPVELPTPLPEAIAIAIGEHALEPFRGGFGVGLMPDSRRLTVYKVI
                     SLANKPQSYVQNTFQQLLEKIEQWHLFIEQTDNEEAIPEQLPAGIFI"
     gene            445402..445956
                     /locus_tag="VP_RS17400"
                     /old_locus_tag="VPA0452"
     CDS             445402..445956
                     /locus_tag="VP_RS17400"
                     /old_locus_tag="VPA0452"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b"
                     /protein_id="WP_005457561.1"
                     /translation="MSFTWRKKMDAKTNNAISKSMMFFHWVIGLGMIAVLISGLVMDD
                     ESNNLLFNAHMSFGLLVLALSVPRLVGRLIGGMPKPMTERSKFESIAAAVVMYSLLAL
                     TVVLPLSGIAVSVGEGYGLSLFGFELVSSGREIHMLKELGEGIHEFSGEALLPFLLVL
                     HLGASFMHHFIKQDGTLLRMLGKA"
     gene            complement(446097..448262)
                     /gene="katG"
                     /locus_tag="VP_RS17405"
                     /old_locus_tag="VPA0453"
     CDS             complement(446097..448262)
                     /gene="katG"
                     /locus_tag="VP_RS17405"
                     /old_locus_tag="VPA0453"
                     /EC_number="1.11.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase/peroxidase HPI"
                     /protein_id="WP_005479257.1"
                     /translation="MTQQNAHSEGKCPVMHGSMTTNNRTEKNWWPKSLNLDILHQHDA
                     KTNPMPSDFDYQEEVKKLDFSALKQDLIALMTDSQEWWPADWGHYGGLMIRMSWHAAG
                     TYRIADGRGGAGTGNLRFAPLNSWPDNANLDKARRILWPIKKKYGNQLSWADLIAYAG
                     TMAYESMGLKTFGFGFGREDIWHPEKDIYWGSEKEWLAPTNNPNSRYSGERDLENPLA
                     AVMMGLIYVNPEGVDGQPDPLKTAHDVRVTFARMAMNDEETVALTAGGHTVGKAHGNG
                     DAANLGPEPEGADIHDQGLGWLNKTTRGVGNNAVTSGIEGAWTSQPTQWDNGYFHLLL
                     NYDWELKKSPAGAWQWEPIDIKEEDKPVDPENPNVRHNPIMTDADMAMKMDPEYRKIS
                     ERFHSDPAYFADTFARAWFKLTHRDMGPKARYIGPDVPQEDLIWQDPVPNGNANYDID
                     AVKAKIAASGLSVSDMVTTAWDSARTFRQSDKRGGANGARVRLAPQKDWQGNEPERLA
                     RVLPVLENIAKDTGASVADVVVLAGNVGIEQAASAAGVNVTVPFLPGRGDATQEMTDV
                     ESFEVLEPLHDGYRNWLKQNYVVTPEEMLLDRTQLMGLTAAEMTVLVGGMRVLGTNHG
                     GSKHGVFTDRVGQLTNDFFINLTDMKYTWEPVGENLYEIRSRRSKDVKWTATRVDLVF
                     GSNSILRAYAELYAQDDNAGKFVEDFVAAWTKVMNADRF"
     gene            complement(448389..448859)
                     /locus_tag="VP_RS17410"
                     /old_locus_tag="VPA0454"
     CDS             complement(448389..448859)
                     /locus_tag="VP_RS17410"
                     /old_locus_tag="VPA0454"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008044948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA starvation/stationary phase protection
                     protein"
                     /protein_id="WP_005457571.1"
                     /translation="MTHIDIGIDREHRLSTAEGLKQLLADSYTLYLQTHNFHWNVEGP
                     NFRELHLMFEEHYTELATAVDEIAERIRTLDVPAPGTFKEFAKLSVIEEVEGVPSATE
                     MVDILTHNHEQVVKTARKVLKLAQQADDESSVALVSDRMRIHEKTAWMLRSLQK"
     gene            complement(449099..449989)
                     /locus_tag="VP_RS17415"
                     /old_locus_tag="VPA0456"
     CDS             complement(449099..449989)
                     /locus_tag="VP_RS17415"
                     /old_locus_tag="VPA0456"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogen peroxide-inducible genes activator"
                     /protein_id="WP_005457564.1"
                     /translation="MLSIKQLSYALAVSKTLHFRKAADLCHVRQSTLSTGVSELERQL
                     GIKIFERDNKKVLVTPLGREVLDKASNIMLQLEDMAHLDHSCGEPFCFPLSIGMIPTI
                     APYLLPKLLLTLKEQYPNAKIDIVEEQSHVLVDMVHSGEIDAAVLAIPYPCDGLLTLE
                     FWQEDFYWVALDGQMHTDKSSITSEELLETNLMLLKEGHCLKDHILDACRLSEQTSNQ
                     EYRATSLNTLIQMVMSGMGTTLIPEMALEQLVTHYPVLSAVHLNEPGPHRRIALAFRP
                     NYVDVSSLEALSRIAKQSLK"
     gene            complement(450104..450979)
                     /locus_tag="VP_RS17420"
                     /old_locus_tag="VPA0457"
     CDS             complement(450104..450979)
                     /locus_tag="VP_RS17420"
                     /old_locus_tag="VPA0457"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005457566.1"
                     /translation="MLEGRLYERYLPGYLESNSEEEKQRLWQQADPNTIYQLNSELQK
                     LHGEGNDLISFSDPHRSHLPIAAWPDMLSADIAFWRKHQHWLLQSNDPVTPTNEDDLS
                     VNYKIPLNYINQYNGEHLRLFYGSRLVYARLFSALHYILNHVKSVIEDWSHDRYPYQL
                     PIELYIPTTSEPQSAVRSTYHHFNSANYQSLKNYFQQHYSSWIEEQYLNWMFELNTQL
                     NHQTAATYIIEYEDEFGIPRVDFICKNENTLRMIRPAHFVEDMRQMVSSTDYLDHQVQ
                     QVALRIERQCRAKGW"
     gene            451057..451215
                     /locus_tag="VP_RS23640"
     CDS             451057..451215
                     /locus_tag="VP_RS23640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005457572.1"
                     /translation="MKPMKALDEIVTNVPPKYLMSNVMLISIMINELVINKLVVYRAG
                     QYFQLEGV"
     gene            complement(451236..452216)
                     /locus_tag="VP_RS17425"
                     /old_locus_tag="VPA0458"
     CDS             complement(451236..452216)
                     /locus_tag="VP_RS17425"
                     /old_locus_tag="VPA0458"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005457565.1"
                     /translation="MSLWGFLGAGLAYLLMTFAFVFGGIFWLCAEGNTLRETKRQSSI
                     MSGIIVCTMGTWVIAFSIYIYGYFWDNSSHYYSYLLAPWPLAIVGITLRNHWVSQYSS
                     VKQEKNEKWQRHWREILGEDTEDLPPYRYDYGLYSGIWQANETLREQCFAALTHGNSV
                     YERVKAFQKMTTHEHNTDDQILLSKLAQLENEIIQALEQHSQKNVSIETGSGTLCKES
                     KHNVYRHENGPTEEQLYNSINLQHDLDRELRNIIYDRLGDDGLDEYFFLRAPLEELTE
                     NETAINWMLWGLVSDHFDVDPYQTALELNLMNAEPRWGQDERFVVVTTAA"
     gene            452749..455199
                     /locus_tag="VP_RS17430"
                     /old_locus_tag="VPA0459"
     CDS             452749..455199
                     /locus_tag="VP_RS17430"
                     /old_locus_tag="VPA0459"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017188214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="collagenase"
                     /protein_id="WP_005479219.1"
                     /translation="MSHIRFFPRHRLALACMLASVSSFSFAQNQCAVADLQQSRDLAA
                     AVSGAEYDCYHAWFSAPSATLNDIYSEASLSRIQVALDQEIARYRGEAEQARVLENLG
                     EFVRAAYYVRYNAGTGTPEFSEALSQRFAQSTNLFLNNPHALDQGREQVGAMKSLTLM
                     VDNVKQLPLTMDSMMAALMHFNRDTAKDTQWVDGLNNLFRSMAGHAANDAFYRYMANN
                     THHIDTLARFASDNAWALDTDANFIVFNALRETGRLLASPDQETKRKALAVMQQVMQR
                     YPLGSEHDKLWLAAVEMMSYYAPEGLNGLNLEQAKQDLAARVMPNRFECQGPAIIRSE
                     DLTDAQAAKACEVLAAKEADFHQVANTGNQPVADDLNDRVEVAVFASNDSYVDYSSFL
                     FGNTTDNGGQYLEGTPSRADNTARFVAYRYANGEDLSILNLEHEYTHYLDARFNQYGS
                     FSDNLAHGHIVWWLEGFAEYMHYKQGYKAAIDLIPSGKLSLSTVFDTTYSHDSNRIYR
                     WGYLAVRFMLENHPQDVESLLALSRSGQFAQWAQQVTVLGQQYDAEFERWLDTLEVVV
                     EPEQPGTDPEEPSEPTDPEVQVTELAANQSLQLSGEAYSEKLFYVDVPANTVRFNVSI
                     EGAGDADLYMSYNKVAHYYDFEMSQYADGSNEEIQFAPEQNGYVKAGRYYISLTGRDS
                     YDSVNLVAALEVEAQTPPTQVQDDLAPVVLESGEAKVLTVHQQRYAAVYVPEGVKEVR
                     VWMSSQSNANDPYGAGNVDLYASRKHWPTAEQHEYASNYAGSNEYLAIPVTEAGYVHF
                     SLQAPQQGDDVEMLVYFF"
     gene            455486..455716
                     /locus_tag="VP_RS17435"
                     /old_locus_tag="VPA0460"
     CDS             455486..455716
                     /locus_tag="VP_RS17435"
                     /old_locus_tag="VPA0460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010649632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479230.1"
                     /translation="MKTLIYDTLISLASQEPEQHARIRQNLYEQLDLPFDKQLALYSC
                     ALGPASSGKLESSQGINNAVDCAVKLLETPER"
     gene            456193..457542
                     /locus_tag="VP_RS17440"
                     /old_locus_tag="VPA0461"
     CDS             456193..457542
                     /locus_tag="VP_RS17440"
                     /old_locus_tag="VPA0461"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017818605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-amylase"
                     /protein_id="WP_005479245.1"
                     /translation="MSGLQETQSAGANVILHAFDWKYADIAQRANEIHELGYGSVLVS
                     PPMKSAHDERWWQRYQPQDYRVIDNALGDTQDFIYMVRELERVGVLVYADVVFNHMAN
                     EAHLRRDLQYPRQDVLDQYRQNEHKYQSLKLFGDLSKPLFSEEDFVEAFGIKDWKDKW
                     QVQNGRITGGPTDPGLPTLRVCEHVVEQQRAYLKALKAIGVKGFRIDAAKHMTLEHLK
                     RVWTDDITQDVHIFGEIITDGGATEEEYQLFLEPYLQETRLGAYDFPLFSTIFKAFSK
                     KGSFKSLIDPYCFGQALSNGRAITFVVTHDIPNNDVFLDLIMDEEDEWIAYAYILGRD
                     GGVPLVYTDLDTSGIKNKNGKPRWKDAWNDPRMAKMIAFHNVTHGESMTVLEGNDDML
                     VLKRGEKGIVVLNKSTRAQSLSLKTECDWFDLMSDQSVKAGIELKVPAKSFMLLVQK"
     gene            complement(457611..457904)
                     /locus_tag="VP_RS17445"
     CDS             complement(457611..457904)
                     /locus_tag="VP_RS17445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005597725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_005459687.1"
                     /translation="MELEAVAKALKELGHPTRLCIYKEVVKAGYKGIAVGGVQEKLGI
                     PASTLSHHISSLASAGLITQRREGRILFCVAEYECLDDVIDFLRAECCVNECQ"
     gene            458149..458442
                     /locus_tag="VP_RS17450"
                     /old_locus_tag="VPA0463"
     CDS             458149..458442
                     /locus_tag="VP_RS17450"
                     /old_locus_tag="VPA0463"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011999500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005459692.1"
                     /translation="MIAVHRDYCLSSSSELHAHVKVNPVGRLEVEIIELEERHTTEFD
                     DLSFESRGCETRICGKEDATPWQFNLAVTDALELSHLVEEANEEYEILMNDLM"
     gene            complement(458551..460509)
                     /locus_tag="VP_RS17455"
                     /old_locus_tag="VPA0464"
     CDS             complement(458551..460509)
                     /locus_tag="VP_RS17455"
                     /old_locus_tag="VPA0464"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_005479240.1"
                     /translation="MTGIFLQAFVYLVAAVIAVPLAKRLGLGSVLGYLIAGVVIGPII
                     GLVGEETTTIQHFAEFGVVMMLFLVGLELEPKMLWAMRNRLMGLGGLQVGGTVAAIMG
                     IALYFEQPWTIALAIGLIFALSSTAIVLQTFSEKGLTKTEGGKNAFSVLLFQDIAVIP
                     MLAFIPLLALPELVEQAQNAVQTAAQHHDDLNLVADLPGWAYGIVITASIAIVVVGGH
                     FLSRPLLKYVASSGLREIFTATALMLVIGIAALMSLVGLSPALGTFLAGVVLANSEFR
                     HELESNIEPFKGLLLGLFFITVGAGINFSVLFGDFWLIMALTIGVMVLKALVLFILAL
                     IFRVKGSNRWLFTLSLAQAGEFGFVLLSFSVQNHVIPFELSQTLALVVAISMFLTPGL
                     FILFDRVILPRFETQSNERESDTIEETGTVIIAGIGRFGQIVNRLLVSNGVTTVVLDH
                     QANQVDNMRQIGTRAYFGDATRPDMLHTAGIEHAAALVVAIDNQESSVELVKYVKHTY
                     PKVKIIARAFDRGHGYLLRQAGADVIESETYHSALEMGGHAMKALGIHPFFVEQQKDT
                     YKRVEARKSEMLYQAWEDDSEGERFDNNFRELFIQLEEKMAEEMRKDRHDKLSRSERG
                     WTPPPKGYAENFDGENVQDITPPKEEAI"
     gene            complement(460506..461123)
                     /locus_tag="VP_RS17460"
                     /old_locus_tag="VPA0465"
     CDS             complement(460506..461123)
                     /locus_tag="VP_RS17460"
                     /old_locus_tag="VPA0465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005442521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent oxidoreductase"
                     /protein_id="WP_005479200.1"
                     /translation="MTNKKVLILFAHPSQHRSEVNTPLFKEAQKIEGVTCVDLYGEYP
                     RFNINIDREQQRLREHDVVIFQFPLYWYSTPAILKEWQDLVLEYGFAYGTEGTELQGK
                     TMLCVLSAGGKEEAYKAEGHNHFTIRELLAPIEQMSALTGMHYIAPLALFGSRTAAEE
                     DRIPRHIERYKKLLTALVEDRLDVEAAASLIKLNSALPELIKEAS"
     gene            complement(461359..461784)
                     /locus_tag="VP_RS17465"
                     /old_locus_tag="VPA0466"
     CDS             complement(461359..461784)
                     /locus_tag="VP_RS17465"
                     /old_locus_tag="VPA0466"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011082464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_005459700.1"
                     /translation="MKYKHILVALELSDESTVLIDRAVSMANYLDSDISFIHIDGTHG
                     EIYRELVDIKENPDQRPLNEHSMECLRTFSDYMDYPLKHFFVGTGDLADKLEVTIKEQ
                     EVDLLICGHHQDFWSKIISYSRHLINKSPVDILVVPIHE"
     gene            462230..463801
                     /locus_tag="VP_RS17470"
                     /old_locus_tag="VPA0467"
     CDS             462230..463801
                     /locus_tag="VP_RS17470"
                     /old_locus_tag="VPA0467"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010452817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-F family ATP-binding cassette
                     domain-containing protein"
                     /protein_id="WP_005479209.1"
                     /translation="MPVLQAFNVSHQFDNGETLFQSISCSMTKRRVGLVGRNGIGKSL
                     LASILAGETQPASGVVTSPSSFMMYRQQPSDLLSGQQSIAQFLGTDSVLHALKQIEQG
                     DVSEHWFELVGEQWDIELKLKQQLAAMGLPQDPGFSCARLSGGQLARLQLWQLFENET
                     ELLILDEPSNHLDTEAKQWLIESMRHFGGAILLISHDRELLREMEEIWELSGLGLQVF
                     GGNYDVYAEQKRTELQAVERQLAQVDKQKKRLAEQAQKNREKADQRAAQGNKLRKDGS
                     QPKILLDGKKDSATASTSNRNKNEQLRQVHLQAKERALQSRHEQLKAQKLYLADNPNR
                     SRKVLSIQEGILPFGDSTPITLQIFANDKVHLKGKNGCGKSTLLKTLLGELSLLSGEL
                     QVNTPLYYLDQHFGAVNPNLSLLENVMETCQEMTESEARTLLAGIGFRRDTVFRLGCV
                     LSGGEKMKLAMLIVSHQHSQPLLLLDEPDNHLDLESKIMLSQALNAYKGGFVLISHDQ
                     DFASESGVLRQIELT"
     gene            464008..466167
                     /locus_tag="VP_RS17475"
                     /old_locus_tag="VPA0468"
     CDS             464008..466167
                     /locus_tag="VP_RS17475"
                     /old_locus_tag="VPA0468"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005391283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S9 family peptidase"
                     /protein_id="WP_005479228.1"
                     /translation="MKKNTLAFATALALGSVLSVAHANEAAQSSVEQVTPKAITYPTT
                     QKVDVVDDYFGTKMSDPYRWLEDDLSPETAEWVKAQNAVTFDYLSKIPYREQIEERIT
                     KLMDYEKQSQPFKEGRFTYFYKNDGLQNQDVLYRQLGDGDAEIFLDPNTFSEDGTTSL
                     AGVSFSRDGSLVAYSISEGGSDWRKVIVLDTETKKPVGETLVDIKFSGISWLGNQGFY
                     YSSYDKPKGSELSAKTDQHKLYFHKLGTKQSEDQLIFGGFEEEKYRYVGGYTSDDERY
                     LFISASVSTSGNKLFFKDLSKPNSPLKTILDNTSSDTWVIDNQGTKLYLVTNLNAPNK
                     RVVTVDASQPQPKNWKDLIPETKNVLRVSTAGGNLFASYIVDAISMVKQYDMNGKLIR
                     EIKLPDIGSAYGFSGKKDETEVYYSFTNYKMPSTTYRLNIKDGDSEVYYKSKAPFDPA
                     LYDSRQVFYTSKDGTKVPMIITYKKGTPMDGCAPTILYGYGGFNISLTPSFNPTRAAW
                     LELGGVYAVANIRGGGEYGKEWHNAGIQMQKQNVFDDFIAAAEYLIDEKVTSSNKLAI
                     NGGSNGGLLVGAVMTQRPELFKVALPAVGVLDMLRYHTFTAGAGWAYDYGTAEQSKEM
                     FQYLKGYSPVHNVKAGVEYPATLITTGDHDDRVVPAHSYKFAAELQSKQAGSNPTLIR
                     IETNAGHGAGTPTRKIIETNADIYSFALFNMGIEKLQ"
     gene            466698..467489
                     /locus_tag="VP_RS17480"
                     /old_locus_tag="VPA0469"
     CDS             466698..467489
                     /locus_tag="VP_RS17480"
                     /old_locus_tag="VPA0469"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009706239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479226.1"
                     /translation="MNLVKPSVVIMAAALQLASSAYAQTNNDEELQDMSDPLAVYTQA
                     GFGITDKGANIKIGQTYQSSQPGTMAMNIIEMKGIGGELFGIRDNDDPMYANVDDSID
                     SFRLRNFQVEVAKGLGRQLDVNYDVDNDKLDASYSFIQGLPKFGMLQLFPLAGAGVTI
                     ANDFSGDDKGYEIPGTFTVVGMYSKIELTDKIWINYNPMYMHTLSGSSQYKDTYYAGE
                     DNILTHEFALSYQINPRANIRYFANWNEHVNFGDGDHRIEFNYQF"
     gene            467580..468722
                     /gene="vmeP"
                     /locus_tag="VP_RS17485"
                     /old_locus_tag="VPA0470"
     CDS             467580..468722
                     /gene="vmeP"
                     /locus_tag="VP_RS17485"
                     /old_locus_tag="VPA0470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005391278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter periplasmic adaptor
                     subunit VmeP"
                     /protein_id="WP_005391278.1"
                     /translation="MKAKYKFALVSIAISSALLSGCKTGDIATKTAQAPSVETVTLTE
                     TKITPYHTFIGRTEAVNDVDIMPRVGGELTAIHFKDGDMVEKGQLLFEIDDRPYKAAL
                     AYAKASLQKAKAQLVQTTRDAERVKKLIKDKSISEQQYDDAIAAHAAAIASVEEAKAT
                     LVSARLDLEFSSVRAPFSGRVGFSNFRVGDRISKIQLVPLVSITQIDPIRFGFDVDEK
                     LYRRVRSAIDVAHRNDDKLDVDLTLTLSDGSLYPLDGKIYAVGNKIDLETGSIRAEAQ
                     FDNPTYALMPGEYGNLTIKLRNKTIDGLLIPSAAVQQDQAGDYVMVVGDDHVVSRRNV
                     ELGQTYGVKRAVLTGLAANEKVIVNGLQKVRPGATVKDVELQSEQG"
     gene            468733..471873
                     /gene="vmeQ"
                     /locus_tag="VP_RS17490"
                     /old_locus_tag="VPA0471"
     CDS             468733..471873
                     /gene="vmeQ"
                     /locus_tag="VP_RS17490"
                     /old_locus_tag="VPA0471"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter permease subunit VmeQ"
                     /protein_id="WP_005479247.1"
                     /translation="MLSKFFIHRPKFALVISLAMTLMGMIALKVLPISEYPQISPTVI
                     TVSTMYPGANADVVKKTVAQPIEAKVNGVEDMIYMSSVIGNDGSYTLRIYFRVGADGD
                     MAQVRVNNLVAQATSSLPQEVNQIGVTVKKKSSDMLGVITLRSPKQSYDSIYLSNYAD
                     LNIVERLKRIEGMSDITLLGKKDYSMRIWLNPNKLATLKLSASDVIGAIKTQNIQVAA
                     GKIGGMPAPGDQQYQYVLQTKGRLTSAEEFENIIIRASKKGSLIRLKDVARVEVGAQG
                     YEADGRMNNEPAAVLALYQLPTANALDVMERVKEAMKEYEKSFPDDLVYDIAYDSTEY
                     VETSIDEVYETLVIAVLLVTFVVYVFLQNWRATIIPTLAIPVSIIATFAIMGVMGMTI
                     NTISLFGLILAIGIVVDDAIIVVENVERVIHEEHLDPIPATIQAMKEVTGPVLATTLI
                     LLAVFVPVALLPGISGRMFNQFAVTICVSVLISAINALTLTPALCALMLKSTHSQPIA
                     PLRAFNRGFEAITRKYQGLVGFLSRRIVLSIGVYGALIAVLAFAFMTVPSSFVPNEDK
                     GVFMVEMRLPDAAALQRTAPLMKKYVDELKQMEGVENVVSVAGFSVINMASIPNSGML
                     IIKLDNWSKRKDPELHQRALMNKVNQMLNSTPDAASFVFATPAIKGMGAVDGFNLVLQ
                     DNLGRSPQELAKTTADFVGQINQLPEVARAFSIFRANIPQRYIDIDRDKAISMGVPLN
                     EIFSTLQAQLGGAYISDFNLFGRSYQVKVQAEEQYRDNIDDIDHLFVRSSSGKMVSLA
                     TLVKVKPIFGPDTLSNYNMFSSATVNGAPAPGYSSGDVVKAIEKLAAESLPSGYSYEW
                     SGMTYQEMKAGNMAPIAFALSLLFTYLFLVAQYESWTIPAAVMMAVPVAILGAMGTLL
                     LVGQPFDLYVQIGVVILIGMSAKVAILIVEFAKVLREEKGLSIIDAAKEAARIRFRAV
                     QMTAFAFIWGVFPLVIASGAGAASRHSLGFAVFGGMILSTFVGTLLTPVFFVMMQSLR
                     EKFKRKKPTELEVSEQ"
     gene            471994..473097
                     /locus_tag="VP_RS17495"
                     /old_locus_tag="VPA0472"
     CDS             471994..473097
                     /locus_tag="VP_RS17495"
                     /old_locus_tag="VPA0472"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005452605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein transport protein"
                     /protein_id="WP_005459708.1"
                     /translation="MKNLSKIVVASSLLTCAAAQAGGLYLYETTASDIGLASAGMAAR
                     AQDASVMAANPAGLANVSGKSFSGNLIGLYGDAQLDTMTGDAGNVIGFVPMASAFYSQ
                     QVNDKWTLGIGLYGNYGLGLEYEGLLNNHLDIPTATTQALTIQPSASYRINDHWSVGA
                     ALGIQYGMYEVETKGALNFNDEDQDTQLNGRVGVLYEATPGTRLGLSYSSETEFEFDN
                     SNSIAPQQLIFSAYHEVNDDLAVMWNVNWQDWSEYTTTLKAADLVDVETQDTYQIALG
                     TQYKLNEKMMWNAGFAFDTSMYESQSNGDITVPTGKAYRIGTGIDYKLDSENSIGFAF
                     EAVLMESSETPRLQAGFDEPALYFMSMSYNWKN"
     gene            473274..474071
                     /locus_tag="VP_RS17500"
                     /old_locus_tag="VPA0473"
     CDS             473274..474071
                     /locus_tag="VP_RS17500"
                     /old_locus_tag="VPA0473"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006742174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005459709.1"
                     /translation="MKNKLALVCTTLLVSTLAHGAEHRVKDNKNKLADDPTKVITKFG
                     ASYANNYDFDDQNISFSGSLALDQARKINLRINDDASEWRIGGSWLFPVGIVNFNFGK
                     NEYVNGADQTNYSVGTFMPLSYFGIEPAGFQIFPMAGYTYNTGDVPVCDGAESSHCSE
                     PNFTGTPSAENGFNMMSSSGSSGYVGAFALKSFTKELTLISFAAGTYGSENSEGENYK
                     GFFGGIGLGYLVNKRHSFNVMTFVMDNNTYLDEADKRVAVSYQYQFE"
     gene            complement(474254..474784)
                     /gene="speG"
                     /locus_tag="VP_RS17505"
                     /old_locus_tag="VPA0474"
     CDS             complement(474254..474784)
                     /gene="speG"
                     /locus_tag="VP_RS17505"
                     /old_locus_tag="VPA0474"
                     /EC_number="2.3.1.57"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005459711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine N1-acetyltransferase"
                     /protein_id="WP_005459711.1"
                     /translation="MKKGLKMRALERSDLRFIHELNNNRNIMAYWFEEPYESYDELEE
                     LYRKHIHDDAERRFVVEDADGILIGLVELIEINYIHRSAEFQIIIAPDHQGRGYAMEM
                     IHRALDYSFSILNLRKIYLLVAVENEVAIHLYKKCGFIEEGHLIEEYFINGSYRDVKR
                     MYVLKHQYQKSIEEQA"
     gene            475058..475210
                     /locus_tag="VP_RS23645"
     CDS             475058..475210
                     /locus_tag="VP_RS23645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008221767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005459713.1"
                     /translation="MFSIGDVVVATKGVEQGEMVVTGLSSGGFYAHVKAGEKTLTYPA
                     KDLKKA"
     gene            complement(475338..476405)
                     /locus_tag="VP_RS17510"
                     /old_locus_tag="VPA0476"
     CDS             complement(475338..476405)
                     /locus_tag="VP_RS17510"
                     /old_locus_tag="VPA0476"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005459714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor domain-containing diguanylate cyclase"
                     /protein_id="WP_005459714.1"
                     /translation="MRLERTFDPNDLSTQNMESPICLPIGFVHFLAQSQTLQQVLDTV
                     AEWINRIFESDRTSITLYENSDYLKVYSFSGNKAIPADFLVPIDQAFVGRVFKNQQLI
                     ICDDVSQSDELDCVMLTSSGMGTCMDAPLMHGQMCLGTLNVAHHQTHFYTKEQAAQLQ
                     CIANWIALNIALHIQIMKMEHLATTDDLTGIPNRREFMRQIEHRLSEFRTQGIKFHVA
                     ILDLDNFKKLNDKFGHDAGDKSLIHAANTIKGHLRECDLLARVGGEEFAIVLRSRSSQ
                     EAMDTLETIRNALETTTIRYSGRDMTFTASIGVTQVCGLDDSFEPLVKRADLALYKAK
                     ETGRNRVEINHSEHQGVSNEQ"
     gene            complement(476708..477559)
                     /locus_tag="VP_RS17515"
                     /old_locus_tag="VPA0477"
     CDS             complement(476708..477559)
                     /locus_tag="VP_RS17515"
                     /old_locus_tag="VPA0477"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_025794721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbenicillin-hydrolyzing class A beta-lactamase
                     CARB-22"
                     /protein_id="WP_005479236.1"
                     /translation="MKKLFLLVGLMVCSTVSYASKLNEDISLIEKQTSGRIGVSVWDT
                     QTDKRWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATAKIDERNIVVWSPVMD
                     KLAGQSTRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTQFLRSIGDKATRLDRLEPR
                     LNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLP
                     KGWSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLI
                     LEHYKES"
     gene            complement(<477860..478120)
                     /locus_tag="VP_RS17520"
                     /pseudo
     CDS             complement(<477860..478120)
                     /locus_tag="VP_RS17520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_025794721.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydrolase"
     gene            478363..479712
                     /locus_tag="VP_RS17525"
                     /old_locus_tag="VPA0478"
     CDS             478363..479712
                     /locus_tag="VP_RS17525"
                     /old_locus_tag="VPA0478"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016799170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferric reductase-like transmembrane
                     domain-containing protein"
                     /protein_id="WP_024699316.1"
                     /translation="MKTVRNFVWMIIAAVSVLWWMSEPQLLSSTQFFQWRSALIQYSG
                     VLSLALMSIAMVLALRLPVIEQWVHGMDKAYRVHKWLGIAGVSLGVVHWLTYKVPKWL
                     VSAGVLEKPIKHTGGGPSGNNFFGLELWVKELRDVGLGMGEWGFYLLLALLVVSLWTV
                     VKYKPFKLSHRLMAAVYLMIAVHSVLLIKHAYWGEPIHFVALGFALMGSTAAVYSLLG
                     FVGRANRHPAKVVSTRYFPQARVMELVLAPSNNGQGKPWQGHKAGQFAYVRFGNEDPH
                     PFTIVSGEHEPEVRFLIKELGDFTTDLYHRVKIGEEVMVEGPYGRLAFDVNKPQIWIA
                     GGVGVASFFAILASLKSLKTHPPVHLFYCTRGLDSHLVDELWKMARLAQVKLNVIDTA
                     VSPRLNVERIASECGDLARYEFYFCGPEAFSQTLKKELNAYRVDTERHYHEELFVMR"
     gene            complement(479832..480413)
                     /locus_tag="VP_RS17530"
                     /old_locus_tag="VPA0479"
     CDS             complement(479832..480413)
                     /locus_tag="VP_RS17530"
                     /old_locus_tag="VPA0479"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005425081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-binding protein"
                     /protein_id="WP_005482705.1"
                     /translation="MKKTLITLALTMVSAGAFAQMDNSNMNHDNMDHGKMDHGSMSMD
                     NMNMDEMPMDHSKMDHSNMQGMAGMSAVGMPANGAKPDKVVHVILSDDMKITFKKDVK
                     IEPNDVVQFVVMNTGKIDHEFTIGSAAEQLEHREMMKNMSGNHMHDSGNAVTVEPGKA
                     KQILWHFHGDNNVEFACNIPGHAEAGMVKKVKL"
     gene            complement(480478..483618)
                     /locus_tag="VP_RS17535"
                     /old_locus_tag="VPA0480"
     CDS             complement(480478..483618)
                     /locus_tag="VP_RS17535"
                     /old_locus_tag="VPA0480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CusA/CzcA family heavy metal efflux RND
                     transporter"
                     /protein_id="WP_005482627.1"
                     /translation="MIGAIIRWSLNNRFMILIATLMLVLAGLYSVKNTPVDAIPDLSD
                     VQVIIKTSYPGQAPQVVEDQVTYPLTTAMLAVPGAETVRGYSFFGDSYVYIIFNDDTD
                     MYWARSRVLEYLSQVAPKLPPNAKPTLGPDATGVGWVYSYVLQDKTGQHDLAELRSLQ
                     DWFLKYELQTVDGVSEVATVGGMVKQYQVQIDPAKLRAYNLTLQQVNMAIQNGNQETG
                     ASVVEVAEAEHMVRTTGYLTSIEDIKSLPLKVTDKGTPLLLGDIADINLGPQMRRGIS
                     ELNGEGEAVGGVIVMRYGENASEVISKVKDKLEDLQRSLPDGVEIVTTYDRSTLINAA
                     VDNLWKKLAEEFIVVAIVCALFLFHIRSSLVIALSLPVGILAAFIVMHSQGINANIMS
                     LGGIAIAIGAMVDGAIVMIENVHKHIERTPLTDKNRWQVIGKAAEEVGAPLFFSLLII
                     TLSFVPVFALEGQEGKMFSPLAFTKTYAMASAAALAITLVPVLMGYFIRGKILPEHKN
                     PVNRGLVALYRPLLNLSLKYPKAMIVLALGLLASAYYPTSQLGSEFIPPLDEGDLMYM
                     PTTYPGISIGKARELVQQTNKLIKTVPEVKTVWGKIGRAETATDPAPLTMIETVIQLK
                     PHDQWREGVTTESLRKEFDNLVQFPGLTNAWVMPIKTRIDMLATGIKTPIGIKIAGPD
                     LKEIEKIGAQLEPILNNVRGTSSVYAERVAGGRYVTIDIKRRAAARYGLSIKDVQQVI
                     STAVGGMNVGETIEGLERYPINVRYPQDYRDSVVKLQNLPLVTPNGARIALADVADIR
                     YEDGPPMIKTENARPNGWVFVDIDGRDLGSYVVEAQQAVADQLVLPAGYSLAWSGQYE
                     YMERAKDRLSVVVPITLVIIMMLLYFSFRRVGEVLIIMLTLPLAMVGGLWLMHYLNYN
                     FSIAVGVGFIALAGVAVEIGVIMLVYLNQAWHHKKLHAEENQQALQIGDLTDAIREGA
                     GLRVRPVMMTVLTVIIGLIPIMYGSGTGSQVMQRIAAPMIGGMASALLLTLLVLPAIF
                     KLWKQREVNKTQNPEK"
     gene            complement(483621..485336)
                     /locus_tag="VP_RS17540"
                     /old_locus_tag="VPA0481"
     CDS             complement(483621..485336)
                     /locus_tag="VP_RS17540"
                     /old_locus_tag="VPA0481"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005487746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter periplasmic adaptor
                     subunit"
                     /protein_id="WP_005482717.1"
                     /translation="MNSNSIKIATIALLVGGALGFGVNQYLSGANHDMSGTGGSAASS
                     SNEPLYWVAPMDPNYKRDKPGKSPMGMDLIPVYAEDLAGEQDKPGTVKIDPSVENNLG
                     VKTAQVSLEQLSPRIETVGYIAFDESHLWQTNVRVAGWVEKLYINAVGEKVNKGDVLF
                     TLYSPELVKAQEELLNAYRTGRSGLVKGATERLVTLGVDRSQIRAITQRGKASQTIEI
                     KAPEDGVIASLNVREGGYLSPAQAVISAGPLENVWVDAEVFERQAHWMKAGSDATMTL
                     DAIPGKEWQGSVDYVYPILDPKTRTLRVRLKFSNPNGELKPNMFANIALQPVSDNAVL
                     TIPKSSVIRSGGMTRVVLSEGDGKYRSTRIEVGREADDKIEVLQGLTQDDRIVTSAHF
                     MLDSESSQTADLSRISSPTEATAQTAWTKGEITDVMKGHRMLTINHQPVPEWDWPGMV
                     MNFTLADGVDMGSLQKGQAIEFEIQKAASGQYEIVDYKADDTVLATDVWVTGDISMLM
                     ADFGMITLNHLPVSEWNWDAGEMNFSVGDEVDLSGFKEGQKVRFLVEKQGSDYVLKQI
                     EAIEG"
     gene            complement(485440..486861)
                     /locus_tag="VP_RS17545"
                     /old_locus_tag="VPA0482"
     CDS             complement(485440..486861)
                     /locus_tag="VP_RS17545"
                     /old_locus_tag="VPA0482"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TolC family protein"
                     /protein_id="WP_005482614.1"
                     /translation="MEFNPNRLVAPVCSLALVALPAFNVVAQSPTNTKAQQEAQAQSI
                     QAQSTNELANLISIALSNDGNRKQFYAQSEAMRETGVASATLMDPKLKVGFGGLPVDS
                     FKFDEDPMTNISVGLMQQFERGSTLNLQQKKANQQADGLSLQVHARELEVANSMTQLW
                     LELGYQQKAEQILLENRRLMTEMENFIQTNYSIGKSEAQDLLNAQLQVSKLDEKLQAN
                     AQMQRRLVSQLSEWLGSDWLNTYTQNGRSTLQASNTLTWASLNQKLSANSETTKHYRQ
                     LSDHPMVKMADVSISANETQVDIAEQAYTPQFGVEVMYAYRQANNMKGEPASDLVSAY
                     LTMDIPLFTGNRQDRNLAAAQYQVGAARSQKDTLLTQMNAKVNTLLVDRANLSQRLER
                     YQSTLLPQVQARIHAVERGYQNNTAQFNDVIMASTDELALKLEQQRLITDLNIVNSNL
                     AALLGGFEYQVSTPNITPEASAN"
     gene            complement(487080..487502)
                     /locus_tag="VP_RS17550"
                     /old_locus_tag="VPA0484"
     CDS             complement(487080..487502)
                     /locus_tag="VP_RS17550"
                     /old_locus_tag="VPA0484"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017189500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005489340.1"
                     /translation="MRLKSLHTIWLTLCTTLILLVSSVVNSAPLMSIKMMSSGTIMMP
                     EHMTEMASTNDHCGSPSMSMEMASSLSSDSTEMAMSCVDGSGMIHNCCTASCSFVFVP
                     LPAPVSQLSPLAYRASIASEITAPVVQVTHDLYRPPIV"
     gene            487745..492013
                     /gene="fdhF"
                     /locus_tag="VP_RS17555"
                     /old_locus_tag="VPA0485"
     CDS             487745..492013
                     /gene="fdhF"
                     /locus_tag="VP_RS17555"
                     /old_locus_tag="VPA0485"
                     /EC_number="1.17.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009706214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit alpha"
                     /protein_id="WP_005482725.1"
                     /translation="MIEIVIDGKYRIVEEGLTLLEAAKVCGVEIPSLCGMNKSNEKIP
                     CDLCVVEVESGGTKRACDLKVYRGLNVVTQSEQLSEHRRKALNRIMTDHYADCEAPCK
                     TACPAGVDIQSYLYHISQNDHQKAIEVIKRTLPMPLSIGRVCPAFCESECRRSLVDEP
                     IAIRQLKRHAADADLAAHEAYVPEKKPAKHRKIAVVGSGPGGLTAGYYLSNEGYDVTI
                     FESMPKAGGWLRYGIPEYRLPKDILDKEIELMCRNGMQVETNKKLGVDFTLSQLSEDY
                     DAVCLAVGASQAVEMNYPGSDLDGCYLGVDYLKDYVTEQNYVTGKKVAVIGGGNTAID
                     CARTARRAGADTTLIYRRTRDEMPAEDYEIVEAEHEGVTFHFLTNPAENIADENGRVK
                     AIRLERMALGEPDASGRRSPKPTGEFFTEAFDTVIAAVSQKPDLSFLENDDLSIPLTR
                     WNTSESDSQTMHTGTGNIFSIGDFRRGPATAVEAVGDGRVAAKAIDLFLNGDMADMPK
                     PAFNSRKEKKLAQVDPLHFENIQKVARSIMPELTPAQREQSFAEVELGFDNEEAMKEA
                     ARCLECGCQANTDCALRDYSTEYHAEQHFDVSVDVSSASVIGHQDWLDLRAKDLRHKY
                     EVDRSSEFIEFDANRCISCGQCIQACREQAVHGVLSFVSDKNGRPALRPDDRPRFRSD
                     EKGVGCSGLTLMGDSKCVQCGVCVQACPTGAMVDSRDRSQGRTEQLKAVDTICTYCGV
                     GCKLTMFVDERQNKIRYVKGADSPVNQGMLCVKGRFGFDFISSEERLTTPLIRKDGWL
                     QPATWDEAIQLVASKLSTIKQDFGSNALAGFSSAKTTNEDNYAFQKFIRRELGTNNVD
                     HCARLCHASSVTGLEASLGSGAMTNDIPSIKHSDVIFIIGSDTTSAHPIIASHIKQAI
                     RHHGARLIVADPKRVDMAEHAELYLAHRPGTDVMLLNGVMQQIIKNGWYDQEYIEERV
                     DGFDTLLQEVMSPAYNLDKVELVTGVKADDIFAMARMIGTAKRTAVYYSMGITQHTTG
                     HDNVRSIANLQLLCGNIGIEGGGINPLRGQSNVQGACDMGALPNCYPGYQKVYNPIVR
                     QKFAIEWDAPNLPSEQGLTLTEIIDAACKREVRGMYIMGENPVLSDPNQAHVIEGLEA
                     LDFLVVQDIFLTETAQYADVVLPSCSFAEKSGHFTNTERRVQRVNAAVKAPGEAKEDW
                     WIIQAIANAMGSDWHYQCVSEITSEIARVTPQYAGLRWDAITPNGVQWPSNKNNPNGT
                     RIMHQTQFTRGKGQMVGVPFRYAAELPDEEYPLVLTTGRVLEQFHTGTMTRKTKGLDN
                     LAGPRAMISVEDAEAIGIHNGQRLKVSTRRGNIEIDAFVTKRMQKGVVFIPFHFVESP
                     VNRLTTTATDPHAKIPEFKVAAVKIEISETAAQPEPVEEAVHHV"
     gene            492092..493033
                     /locus_tag="VP_RS17560"
                     /old_locus_tag="VPA0486"
     CDS             492092..493033
                     /locus_tag="VP_RS17560"
                     /old_locus_tag="VPA0486"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005487863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase family
                     protein"
                     /protein_id="WP_162828789.1"
                     /translation="MSSVFKWIILLLPALIWLAVRQIEHIWWAENLTSIPALIVFTYV
                     ILASAFFIARRWLQSAFSAFVAILFVSLLVPPQRSHVASCSHSLSVIQFNLFYENSDI
                     NQFINYLLRHPADLVVMQELTPRVGSLLHMLDDVYPHYHGGQRDVGYPSNLMILSRHP
                     ITEVSVYRAPNGQEVIRAVWLPKGQAPITLFAAHPPSPRTSELWHQRNALVRTIETLT
                     ALYPEPEVLVVGDFNLSSVSPRFSTLFPSFQTAPVTSWPTNIKGINVPEPMMIGIDHL
                     WLKSEQGQRIICSRESSALPQGSDHRMVTTQIGVHIP"
     gene            493249..493581
                     /locus_tag="VP_RS17565"
                     /old_locus_tag="VPA0487"
     CDS             493249..493581
                     /locus_tag="VP_RS17565"
                     /old_locus_tag="VPA0487"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005435454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031778806.1"
                     /translation="MCAYFGYNRYYVYPQQLETQAKSMLIQMANREEWMDVFEMMNRV
                     EAHKGHLELAAHVKSSDGKRAYSEGFITYSDRDGMVCKEVVFNFKINSLKNYSISDLR
                     DCSFGEYY"
     gene            complement(493691..494788)
                     /locus_tag="VP_RS17570"
                     /old_locus_tag="VPA0488"
     CDS             complement(493691..494788)
                     /locus_tag="VP_RS17570"
                     /old_locus_tag="VPA0488"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011263013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_005498311.1"
                     /translation="MKPIARMKAVMIKEIRQLSRDRITFGMVVMIPLIQLLLFGFAIN
                     TDIRNIPVGVVDQSGSTAGRIITQSVKVTQVVDIKETYATAQEAEQAIQDGIVRAVLI
                     LPSDLTQRMMQGRELGQWIVDGSDTMISSAILSLQTMPLTDFDFEIRPAPSKTFEVAL
                     YYNPSRRSAVNIVPGLLGVILTMTMILFTSAAIVRERERGNLELLITTPIHSIELMVA
                     KIVPYIFVGLIQVFIILGLGHWIFGVPINGAISQILFGTLLFIAASLTLGLVISTIAT
                     TQLQAMQMTVFILLPSILLSGFMFPYEGMPVAAQWISEALPATHFMRMIRGIVLRGAD
                     LMDLWRDTLWLLGFTVFGLVVASLRFKKSLD"
     gene            complement(494788..495714)
                     /locus_tag="VP_RS17575"
                     /old_locus_tag="VPA0489"
     CDS             complement(494788..495714)
                     /locus_tag="VP_RS17575"
                     /old_locus_tag="VPA0489"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005421899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_005482690.1"
                     /translation="MTEYAIQAQNVVKKFGDFTAINNITLNVPKGSIYGFLGPNGCGK
                     STTIRVLTGLLSPSEGSVDVLGLDIPKQSEQLRLKIGYMTQKFSLYDDLSVQENLEFI
                     GQIFGLSSKSLKERIEEQLTTYGLDQLRKQRVSGMSGGQKQRLSLAAATMHKPELLFL
                     DEPTSAVDPENRRDFWEQLFDLCDQGTTILVTTHYMDEAERCHRLAIMESGEIRADGE
                     PEQLMEQMGVNIIEVKADKLRELKEKLIQRDEVRSAAQLGIRLRILIHQHVEQPIEWL
                     KQTFPELQNAEMNHARPSLEDVFVSVTGKGRQ"
     gene            complement(495719..496666)
                     /locus_tag="VP_RS17580"
                     /old_locus_tag="VPA0490"
     CDS             complement(495719..496666)
                     /locus_tag="VP_RS17580"
                     /old_locus_tag="VPA0490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020335326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family efflux transporter periplasmic
                     adaptor subunit"
                     /protein_id="WP_005462020.1"
                     /translation="MKRIIFGTLIIALLSACSKDNTHQALGTLERDRVTFTATSNEII
                     RALPVKEGSLVSEGEVLVQLDTKNQQAVLAHAVAEQAKAGAYLLKLTNGERPEDIAAA
                     SARVARAEAQLTEAQKNYQRKAELVRKKLISQSEKDSALAARDSARAELDSAKEEFSK
                     LTAGSRLEDIEQAKAALMAAKAEVALQEQKLAELTITATRDGTLDNLPYNLGERVPVN
                     GVVAVIQANRVPYARVYVPADYRIGFIPGKTVTVNVDGLESPLQGTVRWVASEPSFTP
                     YFALTEEERSRLMYLAEVDLPESAKTLPSGVPAQVDLVE"
     gene            complement(496960..498591)
                     /locus_tag="VP_RS17585"
                     /old_locus_tag="VPA0491"
     CDS             complement(496960..498591)
                     /locus_tag="VP_RS17585"
                     /old_locus_tag="VPA0491"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005435463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_005482662.1"
                     /translation="MKLSNLSIKYKISALILIISLSVIALSVFFTSEIKMIEGKLTVF
                     SETTVPSVLLVKNTEIELGILRKDEFSLLTNVNHPQFMEWVAGLEKSEQKIDKYLDQY
                     EKGLWDQRDRDAFNKVKSAWVKYSAFNNEYAKLLLNNKIDEANKTLLNGFSTFTQLSD
                     AIRDLVELNQTYVQEDIASAHEAVRSAITYSIIAIVALLALSFTLGLFLTKQICTPLN
                     YVVNMASKIASGDLTYQLPRNKIGHDELGTLADACVDMQAKLLTLVDSISSTTAQVGT
                     AIEEVSAISEQTSTGMDEQQVQLNLIATAMNEMQATVNEVASNTEAASETANSASHDA
                     KEGRGVVQECINQIHEASLAIQSVGNMVTELEQDASNISVVVDVIQDIAEQTNLLALN
                     AAIEAARAGEQGRGFAVVADEVRTLASRTQASTEEIITIISKLQNCSKSAVSATNNSS
                     DLIQECVEQAQKAGATIDQIEKGADNIAEMSIQIASACSEQSSVTEELHRNVEHINQF
                     SSEVATGSRQTAIACRDLSELAVGLQEIVGQFKTA"
     gene            499136..500170
                     /locus_tag="VP_RS17590"
                     /old_locus_tag="VPA0492"
     CDS             499136..500170
                     /locus_tag="VP_RS17590"
                     /old_locus_tag="VPA0492"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactonase family protein"
                     /protein_id="WP_005482709.1"
                     /translation="MTTTGHVHFYIGTYTNPPSTSTSTGIARLSLNTETGELTRLDDV
                     VVQRNPSYLTTTEHGLYTFSEMDRNEGTELAFFRGSESVSLPINGDYPCHLDIKEPLL
                     AVANYGSGNVSVFQLDRDGKPLGLLADLYVDGCGPNLERQTSPHAHQVTFLKHSHQLV
                     VVDLGSDSVLIYDYDAQPPDFSLSQVIHLPAGSGPRHVVFNQQESTAYVVCELSETLI
                     VLVKHQDKWLISNQTELLEGEENQQAAAAIRLSQDETFLYVSCRAQNKISMFDVSGDT
                     PKRRAAIHCEGVFPRDFVLSHDQKWLLVANQHSNNVVSFRRNPQTGEITPTGYDCEIG
                     SPVCIVEQPL"
     gene            complement(500263..501054)
                     /locus_tag="VP_RS17595"
                     /old_locus_tag="VPA0493"
     CDS             complement(500263..501054)
                     /locus_tag="VP_RS17595"
                     /old_locus_tag="VPA0493"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005425113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhzF family phenazine biosynthesis protein"
                     /protein_id="WP_005482609.1"
                     /translation="MELDIYVVDAFTDTQFKGNSAAVVPLQEWLEPELMQNIATENNL
                     SETAFVKTIGTNQYEIRWFSPLTEIDFCGHATLAASMVLFDKLGVTGSIEFHTLKVGT
                     LTVIKNALGKIEMTFPTRAPHPVNAIPTQLIEGLNCEITHVLLSPQAYFVIVEDEQTV
                     FDVQYRSDQLKQLAPYDVVVTSKGSQYDFVSRYFWPANGGDEDPVTGSIHAGLAPYWA
                     QELGKASLVAYQASARGGVLYCEVKEDCVKVSGDGVLYMKGKIYV"
     gene            501243..501776
                     /locus_tag="VP_RS17600"
                     /old_locus_tag="VPA0494"
     CDS             501243..501776
                     /locus_tag="VP_RS17600"
                     /old_locus_tag="VPA0494"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004412760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YbhB/YbcL family Raf kinase inhibitor-like
                     protein"
                     /protein_id="WP_005482606.1"
                     /translation="MKAIHKSVLALSVLVIGSAHAFELTSKDIQEGHPMAKTFEYSGW
                     GCDGANQSPQLMWKDVPKGTKSFAITAYDPDAPTGSGFWHWIAFDIPASVNELPRGVD
                     ISKLGGKESRIDYGTTGFGGACPPEKDGMHRYQFTVWALPSDKLNLDENTPAAVVGFT
                     LNSVALDKAKLTATYTR"
     gene            501798..502577
                     /locus_tag="VP_RS17605"
                     /old_locus_tag="VPA0495"
     CDS             501798..502577
                     /locus_tag="VP_RS17605"
                     /old_locus_tag="VPA0495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015312999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_005482660.1"
                     /translation="MSHQYQVTLFRAEQQQKLRNVRIHSPSIIQIIKGSKRLFWKDEA
                     FDILHPNIMLCEANASLNFENLPQQGRFLSRMFSFHCVPSDDMLELSMSNALGENVPA
                     VETDKALQATLNALFSFEQESLSEATQRYWVLGLYQQLAERGLLHRLFTSSNTSFSEK
                     LSRYLSRSPGDDHPLERVAERFAMSRATLIRKLKQEGTQYREVLAEVRLNHALYLMQN
                     GSYNVALLAQLCGYQSEGRFSQRFKGKFGLTPSEYIKTVAS"
     gene            complement(502620..503675)
                     /gene="arsB"
                     /locus_tag="VP_RS17610"
                     /old_locus_tag="VPA0496"
     CDS             complement(502620..503675)
                     /gene="arsB"
                     /locus_tag="VP_RS17610"
                     /old_locus_tag="VPA0496"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005487771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ACR3 family arsenite efflux transporter"
                     /protein_id="WP_005482643.1"
                     /translation="MTTEVLNSASEKMSFLDRYLTVWIFVAMAIGVGIGAVYPQVAEW
                     NEAMSVGSTNVPLAIGLILMMYPPLAKVNYGLLGTVTRDKKAITLSLVMNWIVGPILM
                     FVLALTFLGDHPGYMVGIILIGLARCIAMVLVWNDIGGGNKEYGAALVALNSAFQILT
                     YSVMAWLFITVLPPFFGYEGFVVDISMGDIAESVLIYLGIPFLAGFLSRKWLVAAKGE
                     KWYNDVFIPQISPITLIALLATIVLMFSLKGEMILQLPMDVFRVAVPLAIYFVLMFFA
                     SFFIGKRMGIPYDKNASIAFTATGNNFELAIAVSIAVFGLNSDQAFAGVIGPLIEVPV
                     LIALVNVALRMKTKYQS"
     gene            complement(503760..504101)
                     /locus_tag="VP_RS17615"
                     /old_locus_tag="VPA0497"
     CDS             complement(503760..504101)
                     /locus_tag="VP_RS17615"
                     /old_locus_tag="VPA0497"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006960720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /protein_id="WP_005482591.1"
                     /translation="MSNKCNETCQIAFETTQQQLDKEQALAAQAKALSHPARLRILHI
                     LHTLDTMGGCLNSDLVSELGLAQSTVSEHLRILKQAGFISAEPNPPKVCYRIQREKLN
                     AFNAQFSGLFS"
     gene            504591..506348
                     /locus_tag="VP_RS17620"
                     /old_locus_tag="VPA0498"
     CDS             504591..506348
                     /locus_tag="VP_RS17620"
                     /old_locus_tag="VPA0498"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010451138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SgrR family transcriptional regulator"
                     /protein_id="WP_005482583.1"
                     /translation="MSDLNLFRYYQRLLSFGVGNEAKTTLQEIADLLFTSPRHARSLL
                     AQMQEIAWLSWRPKPGRNQRSTLLLNVELSALKESLALERIKLGKYEKALSILDEDEA
                     AFGRLLKTTSGASVKEGRLNIQLTYKRMFERVVPHQLQRSSERFLLRQIYCCLVSSDY
                     YGRVKPELAHHWRYDEQKFEWTFYLRPGLTFHNGNPIDADTVVSLFAKLSSLEYYEKE
                     LAHVANVTAPNPLKVVFTLNRPDLGFAGLISGVKYGIQPVSQVNVANNKLVVGSGPFS
                     VVEHSENRLKLQAFDGYYACRVLTDLVTIWIVNDEKMENPSLAANTLQPQPVLVDDMC
                     GHYMSTPNSETSPASKRSRTEDGCLFALFNHHAKHALSQAQRRYISDLIRPEQLAEVM
                     KSEKINFGSVAAYNLLPNWKPVLRPFGDVVKLPKLITIAGYNYTALRRCARAISSRLE
                     RAGSRVEIVMYSYRELSEKAKNGTLDETLVVTNINLDDNRHASAFSNFFSNAVLYHTL
                     GAQNAAWLDAQMENVRAFSPLEDYLSALEPIASTLISEYWIAPMFHHTQTLRFQGVLE
                     DVALTNWGWPDIRSVWSAD"
     gene            506781..507224
                     /locus_tag="VP_RS17625"
                     /old_locus_tag="VPA0500"
     CDS             506781..507224
                     /locus_tag="VP_RS17625"
                     /old_locus_tag="VPA0500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005421821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIA"
                     /protein_id="WP_005391226.1"
                     /translation="MLYELIDHELVDVINDRAYQWQDAVKKTTQYLENKGYVSQHYAD
                     AIIRSTEENGPYYVLCPGLAMPHARPETGVLKTGLGIHIFPSPVDFGSDLGPANILIT
                     LAAKDSDTHIEVIQALSEMFVDEENIAKLAQASSKEQVLDIIKAY"
     gene            507249..508664
                     /locus_tag="VP_RS17630"
                     /old_locus_tag="VPA0501"
     CDS             507249..508664
                     /locus_tag="VP_RS17630"
                     /old_locus_tag="VPA0501"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006742091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS mannitol transporter subunit IICB"
                     /protein_id="WP_031778805.1"
                     /translation="MRANVQAFGGHLTAMVLPNIGAFIAWGFITALFIPTGWMPNEAF
                     GELVGPMITYLLPLLIGYTGGQIVGEKRGAVAGAIGTMGVIVGADIPMFVGAMIMGPL
                     SAWVVVQVDKRIQHRIPSGFEMVVNNFSLGIVGMLLCLFAYEIVGPSVTAANLFVKSG
                     IEALVATGFLPLLAIINEPAKVLFLNNAIDQGIYYPLGLQAAAETGKSIFFMVASNPG
                     PGLGMLLAYAKFGQGLSKRSAPSAIIIHFFGGIHELYFPYVLMKPIMIVAMIAGAATG
                     IATFNLFDAGLVAGPSPGSIFSYLALTPKGSFIATIAGVTSATIVSFLVASAILKVSK
                     SEEKESEFEKSVSDMKEMKAEGAVKPVAAAATTQEPSKPISFVAFACDAGMGSSAMGA
                     STFKRKLVQAGIDIEVKNFAIEKVPSEADIVVTHESLESRAVNATGLPVVTIKNFLND
                     PALDELMDKIKQQTVATEQPA"
     gene            508712..509983
                     /locus_tag="VP_RS17635"
                     /old_locus_tag="VPA0502"
     CDS             508712..509983
                     /locus_tag="VP_RS17635"
                     /old_locus_tag="VPA0502"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005421823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding dehydrogenase"
                     /protein_id="WP_005482604.1"
                     /translation="MVKTTAAVICGEKNVQLRTFDLPNISADELLVKNISNSICLSTY
                     KAALLGSKHKRVPENIDEVPVMTGHEYAGVIVEVGENLKDQFKAGDYFVLQPAMGLPT
                     GYSAGYSYETFGGNATYSVIPKIAIDLGCVLPYHGDYFADASLAEPMSCIIGAYHASY
                     HTTQYVYEHDMGIKEGGALALLACAGPMGIGAIDYAINGPVKPKLIVVTDIDAARLDR
                     AESLIPVAKAKEQGVELHYVNTAQIDDPVAYLKALNGGKGYDDVMVYAAVAQVLEQAD
                     ELLGNDGCLNFFAGPTDKNFKVPFNFYNVHYESTHIVGTSGGSKGDMVESIELSSQGK
                     INPSFMITHVGGLQAAPHTILNQLDIPGGKKLIYPHIDLPLTAIDDFLSLADQDPFFS
                     ELDAILCANNYVWNAHAEKALLEFYDVSLTV"
     gene            510043..510561
                     /locus_tag="VP_RS17640"
                     /old_locus_tag="VPA0503"
     CDS             510043..510561
                     /locus_tag="VP_RS17640"
                     /old_locus_tag="VPA0503"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_005462031.1"
                     /translation="MSREDELLEKLDECENATAFLQVSNKIINLKLKALLPSVFVQDD
                     LVKEYAVDPLLREDGPLVTTDVVSKLMFAMGKISLQTYADIGLYDQVLEYVVTQPEKI
                     AFTDDVIYDFIKNQAVLSSQQDCFYLESINQLKFSSFESFSQMRYESLIKTVLKLSCE
                     MLIERIEEEINQ"
     gene            510571..511305
                     /locus_tag="VP_RS17645"
                     /old_locus_tag="VPA0504"
     CDS             510571..511305
                     /locus_tag="VP_RS17645"
                     /old_locus_tag="VPA0504"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005421825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside/nucleotide kinase family protein"
                     /protein_id="WP_005462052.1"
                     /translation="MKVNLNVSGFETEATFPDADVKRIHQPLIEKFTRLYHEKQERIV
                     VFLCAPPGSGKSTLAAFWEYLSEQDESQEPLQVLPFDGFHYPNEILDNNTIERDGELV
                     SLRSIKGAHQTFNLTELIDKLKQLKVKDPKWPYYDRNLHDPVDDAILVNRNVVVVEGN
                     WLLLNEPVWNELHRLADFTVFVDTQPEFLQERLVNRKIRGGTAPEAALAFYLNSDAVN
                     VDKVLNHSIPADLTLFLNQNGSFEIR"
     gene            511331..512077
                     /locus_tag="VP_RS17650"
                     /old_locus_tag="VPA0505"
     CDS             511331..512077
                     /locus_tag="VP_RS17650"
                     /old_locus_tag="VPA0505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017031841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase"
                     /protein_id="WP_005482669.1"
                     /translation="MDIVVDSHTHTIASGHAYSTILENALAAKNKGLKLLCTTDHAPE
                     MPGAPHYWHFNNQRILPRFLHEVGILRGVEANTLNVKGEIDLPLSSDQHLDWVIASFH
                     EPVFRPATEAEHTAALINVIKSGRVDVLGHLGNPNYPFDMEQVLRCAKSHNVAIEVNN
                     TSLTGKSRKGSDARCDQIVALGKEIGVYFSTGSDAHFCEEISKLDLAIELLEKHGVEK
                     DKILTTSTRRFLKFLLLRGKPRIPEFDAFY"
     gene            complement(512148..512894)
                     /locus_tag="VP_RS17655"
                     /old_locus_tag="VPA0506"
     CDS             complement(512148..512894)
                     /locus_tag="VP_RS17655"
                     /old_locus_tag="VPA0506"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482611.1"
                     /translation="MNYISIFRGLATSVFVMILGTTTLQAKPHPQHSVKPITQPGNKH
                     HSHPVNRPERPIRPPHRPSHDYRPPYYHRPPVVIRPPRYHSSFIYVRPGYWYPPYRGC
                     YYYYHNDLVGIATFAIFAGVTYAIVQDAYYQQRGSRYVYVQNPPAGNYTVISGSDVLP
                     NSASTTTNLSTVTTSPASPNQVSTTTTETSKTITKKASSPYKLGEIVDSLPHTKQTVV
                     IDGQSYFKYQDTWFAPLRADRKYVVVESPL"
     gene            complement(512960..513295)
                     /locus_tag="VP_RS17660"
                     /old_locus_tag="VPA0507"
     CDS             complement(512960..513295)
                     /locus_tag="VP_RS17660"
                     /old_locus_tag="VPA0507"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005462056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_005462056.1"
                     /translation="MHVDPIVEALIIRRKEHGLSREQMANIAGMSVKTYQRIERGESD
                     LKLSQYRSILRSLNLTDLDIALDIRGIEHVTAEDLVTVARLLSPEAQSLLVRLLSLVL
                     EQRSDPNAS"
     gene            513439..513750
                     /locus_tag="VP_RS17665"
                     /old_locus_tag="VPA0508"
     CDS             513439..513750
                     /locus_tag="VP_RS17665"
                     /old_locus_tag="VPA0508"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006742087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_021448112.1"
                     /translation="MEKHQSYKSITAKVSIRKMQRILDQLLNEIDEKHRASKENVVTL
                     TRQSQHRLMSYKELYLHREAIAESELLLAYESMSDTEKQIADMGLSELTYAIEALDRA
                     C"
     gene            514462..515619
                     /locus_tag="VP_RS17670"
                     /old_locus_tag="VPA0509"
     CDS             514462..515619
                     /locus_tag="VP_RS17670"
                     /old_locus_tag="VPA0509"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006231556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine transporter"
                     /protein_id="WP_005462067.1"
                     /translation="MNLKLVGSSLIVAGTALGAGMLAIPMVLAQFGLLWGTLLMLFIW
                     AGTTYAALLLLEASCKVGGGVSMNAIARETLGKGGQLVTNGLLYALLVCLLMAYIIGA
                     GDLVQKITASVGLSVSTVSSQVGFTILVGLIVSAGTGVVDKLNRGLFIGMIVALVLTL
                     FALAPSVSFEGLNEVVSSDKMALIKTSSVLFTSFGFMVVIPSLVTYNKEASKTQLRNM
                     IVVGSTIPLVCYLLWLFAVVGNLPPHELVQYSNVTELISVLGQQYNGLEFILSMFTGL
                     ALLTSFLGVAMALYDQNADLLKTSKPVVFVTTFILPLLGAVFAPEHFLAILSYAGIIL
                     VFLAVFVPLSMTMKVRRVPVEDNSVYEAGGGVMGMSMIFLFGCFLLFAQAV"
     gene            515835..516164
                     /locus_tag="VP_RS23650"
     CDS             515835..516164
                     /locus_tag="VP_RS23650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482698.1"
                     /translation="MSKQLSVAMVGVMLSLGVFSAEAMADPKHRHGHKHEHHHDHHHH
                     KRKHKHKHRHHDVIVVNPGPPRHQYYYYDRIPRNSTYIQIGNFTYLKVDDHYYRRSSD
                     RYIHVKL"
     gene            complement(516211..518082)
                     /locus_tag="VP_RS17680"
                     /old_locus_tag="VPA0511"
     CDS             complement(516211..518082)
                     /locus_tag="VP_RS17680"
                     /old_locus_tag="VPA0511"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016788092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_005462077.1"
                     /translation="MKFRHKVVTASSILLLITVSLLSTQQVMTIRSQTQEHINSSVKE
                     ILTSVSNTVQSEMNAKKDLARSITEIIELSPNDRTYVKDILEKPTPKSSFLAIGFGYE
                     SNGYVIENDDGWDAGPDYDPRQRPWFIAAKNKGDLVVTDPYVDASSKNVIISVGTPVK
                     QNGQFLAGMFYDLELTTLSDLVNQVNLFDAGYLFLVTDDGTTIAHPQSKYNGEKLNSY
                     LPQVDLNKATQHIEVDNNPYMVSLTHIPSENWYVGAIIDETAAYSVVGELRNSAIIYS
                     IIAVLASVIALTLLIRTLMRPLDTLNTAIKDVASGKGDLTQRLETDTDQEFSELAKNF
                     NTFMENLQQQIIESKSISDQILTGTQITAEGARDSAGAIQTQLQELEQLATAMHEMSV
                     TATEVANNAQGAASAAKEADQATIEGSSVVSESTQTINMLSDSIDLAVEEVQVLESAT
                     ANIETILKVINDIADQTNLLALNAAIEAARAGESGRGFAVVADEVRTLAQRTQESTTE
                     IRSMIEQLQSGASSVASAMHQSKGSAVEAVEKADLANDALQRIRDAIQRISDMNLQIA
                     SAAEEQSLVAEEINNNTVNIKDLSTQVADSANRTNEAMQSQHDNVRKQDEILNRFTV"
     gene            complement(518528..519892)
                     /locus_tag="VP_RS17685"
                     /old_locus_tag="VPA0512"
     CDS             complement(518528..519892)
                     /locus_tag="VP_RS17685"
                     /old_locus_tag="VPA0512"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004745611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjiH family protein"
                     /protein_id="WP_005462024.1"
                     /translation="MHNNTNATEAPKGNFWMFFIPSLIGLLLFMAPISYNGDLTIPVA
                     VMAKVIPALLGDALIAIVTAIIAFMAVASVLCKIFKPAAILRNGFLNGLFNPSPLWLV
                     VRLIGGAAVLMTFFQVGPKAIWEENTGGLVLTGLLPTLFAVFIFAGLLLPLLLNFGLL
                     ELFGALLSKVMRPVFNLPGRSAIDCMASWLGDGSVGILLTSKQYENKFYTQREAAVVG
                     TTFSAVSITFSLVVIAQVQLEHLFLPFYGAICLAGIVAAVIIPRLPPLSLKKDRYIDG
                     SKPAEDVDAVPEGHTTFSWGMDLALKRAAEVKSVQSVFKEGVHNAIDMVFGVLPVVMG
                     LGTVALVIAEYTSVFEILGQPFIPYLELLQIPEAVQASQTIVVGFADMFIPAILAASI
                     DNEMTRFVIAAMSVTQLIYMSEVGALLLGSKIPVNIVELFVIFILRTLITLPVIAGVA
                     HLIF"
     gene            complement(520361..521032)
                     /locus_tag="VP_RS17690"
                     /old_locus_tag="VPA0514"
     CDS             complement(520361..521032)
                     /locus_tag="VP_RS17690"
                     /old_locus_tag="VPA0514"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005435539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1275 domain-containing protein"
                     /protein_id="WP_005462033.1"
                     /translation="MISRLPRWVEYGAFLLALLAGCVNAVGLLGFQHQAITHLSGTVT
                     QLGNSLLTGMDNSIHLLFIVFSFLIGSAFSGFFIESSALKLGRRYGVALCIEGSLLLL
                     SLGFLVEGDSYGQYLASAACGLQNAMITTFSGAVVRTTHMTGIITDLGIMIGESLRGR
                     QFDRRKAKLFLFIFFGFLLGGSVGAALFMAYGLYALVFPAILAFGIALIYWAYLYSIS
                     SNQNA"
     gene            complement(521186..521587)
                     /locus_tag="VP_RS17695"
                     /old_locus_tag="VPA0515"
     CDS             complement(521186..521587)
                     /locus_tag="VP_RS17695"
                     /old_locus_tag="VPA0515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005489271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GFA family protein"
                     /protein_id="WP_005489271.1"
                     /translation="MTNIIHTGECACGLVQLRCKDEPLRTSICHCFECQKRTGSVFGV
                     QAKFDKEQVILDGDTTNYTRISDDGNEVKYEFCPACGTTMRLLLSTAPEIVVVPVGIF
                     NNTEFHEPKVSIYEQRKHGWVSFECTMEHIQ"
     gene            521748..522377
                     /locus_tag="VP_RS17700"
                     /old_locus_tag="VPA0516"
     CDS             521748..522377
                     /locus_tag="VP_RS17700"
                     /old_locus_tag="VPA0516"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012129776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482728.1"
                     /translation="MARSRILPIPLILLIPIVLLAIVIIAGVYRFSLSDDEIMAKFPQ
                     AEVQSNPIVAEVLGVQAKNPWTIQVPEQNAVSFLEEWDKENGYLIGQYDAGATKGQVL
                     VPTAFIAQRKINKEFWIAAPMIVTTQGSGAFYYVGLFKFDPIPSRVVLLDSVFIGDRV
                     KFAQINWQTDTKIAISFLTHGESQSMADEPNQSNSATLTRVGNNLHMQQ"
     gene            522502..523785
                     /locus_tag="VP_RS17705"
                     /old_locus_tag="VPA0517"
     CDS             522502..523785
                     /locus_tag="VP_RS17705"
                     /old_locus_tag="VPA0517"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011082474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan DD-metalloendopeptidase family
                     protein"
                     /protein_id="WP_011106286.1"
                     /translation="MSTNEITKRLPNLTSRRALLLYSLPVLVAIGVSHSLKESSLTKT
                     IALNLPESQVVERILDATTAEVVTPPNFEYQIQAGDNLSTIFSQLGFGYSSLMKVMET
                     DLNYLALDTLKPGNTLRFWRNDATGELEKMELQFSIADKVVYQLNSDGGYDFTDISIP
                     GVWRQEPLVGVIQGSFSSSANRLGLSSAEISQVVSLLKEQVNFGRDLRAGDRFEVVRR
                     SQTINGVSTGKNEIEAIKIYNRGREITAYLHTDGQFYNAKGESLQRAFQRYPVSRSWR
                     ISSGFNPNRLHPVTGRVAPHNGTDFAVPTGTPVVSTGDGTVIMTRKHPYAGNYVVVEH
                     GNKYKTRYLHLSKILVKKGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYGRPVNAMRA
                     NIPMASSVPKKEMATFIANRDEMDKLLKNKEKAVL"
     gene            complement(523838..525658)
                     /locus_tag="VP_RS17710"
                     /old_locus_tag="VPA0518"
     CDS             complement(523838..525658)
                     /locus_tag="VP_RS17710"
                     /old_locus_tag="VPA0518"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005452427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphodiesterase"
                     /protein_id="WP_005461969.1"
                     /translation="MDHVQISVQKLDEILKLNGSALLNRVTLDIHQQLKSHCTCVVEV
                     AHLQHAAHTISFASGGEISDNLSYHLSGTPCEKVAKDIGEHIFYQDQVYKRFPEDQMF
                     QDDGVQAYLGLPLKTQSGEVLGILLSTFTRSIHAKEAQDVLELHRFYANVIIHSLREK
                     WVSERSDKLLNQLSYEVSHDNLTGLLNRSCLADTLETLTQQATRPFNLAYLDIDNFKS
                     INDINGNYIGDQIIKFTANAIQQSLSSPNNAFRVAGDEFAFITYDEDPVAVCQEVLDK
                     IEAGYSDKSNRISFTVSIGIARAPVHMLNSDELILNASLALKDCKKHRDTRIQHYDTH
                     LSALYHRQTQLIEAMRIQLSTSITESHELYVVLQPIVDVNNDRWDYFEILARWNSSVY
                     GNISPAEFIEAAEQSGLIIELGERIIELACIAKQELEAHLGYTVKLSINCSAHELVDS
                     NRYINHLTTLLERYGHDASDFVIELTETVLLSQSGREQMVLNSLRYLGFKVALDDFGT
                     GYSSLNYIHNYPIDSIKIDATFVRNMLSNKTSEQVVYLIAQLAQLLDVDLIAEGVEDD
                     RALNKLIDMGCHYIQGYFYSRPHNVDELVHMINDRQVKRA"
     gene            complement(525907..526794)
                     /locus_tag="VP_RS17715"
                     /old_locus_tag="VPA0519"
     CDS             complement(525907..526794)
                     /locus_tag="VP_RS17715"
                     /old_locus_tag="VPA0519"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017791059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005482673.1"
                     /translation="MDWIQSVQSYIRVIEEGSFNAAARKLNTTSSAISKRIQWLEDKI
                     GVQLLKRTTRSISQTEAGALFYERAKVQLDSWQSVLDETRSVNQSPAGLLKIGATLAV
                     GSKFLVHYLDDFLEKYPDITLQLTTTLPGQLPELSLDLFISRHLEQLNSLSFKATPLF
                     EHKAQFYAAPSYLEKYGTPQNVEELTKHNILIWGEKPAREIKTNRGKRMSLSGNFATT
                     NPEALFHGAKRGMGILMTNNVMIKDDLKSGALVPILPDVTADEATVYAYYPKLDYQHT
                     RTQLFLDYLKSRLEEEKRI"
     gene            526902..528095
                     /locus_tag="VP_RS17720"
                     /old_locus_tag="VPA0520"
     CDS             526902..528095
                     /locus_tag="VP_RS17720"
                     /old_locus_tag="VPA0520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug effflux MFS transporter"
                     /protein_id="WP_005482745.1"
                     /translation="MRKTPLLLAMMIIATGQVGVSIYLPSLPLIGHDLNLPQPSIQSL
                     VTLFLVGFGVSQLFYGPLSDAIGRRPVFILGQSICLIGTVICIVFGDNISALEAGRLL
                     QGLGAGSASVLGRSVLRDSYDGMQLTKALSYISVTASVMPIVAPLFGGWIAYHFSWQA
                     VFVFVLLYLLAIFILGYLVLPETLPYPKRKFEVRQVMVNYFYLLTNKQVIGSASYNWL
                     SYLSGLVTLSLYPFLMQQELGLTAADYGSLMIIPSAGLLMGSLVLNLINNRYKAQQIL
                     LMSFAIVALSGCLLLVTPFTVASLLVAFTCLSFAQGMSFPVSISLLLSPHKQQAGAVS
                     ALSGSIQMCLAGLFGGYLVEKWVTDQHQLGIFYLFIALISCIVLVVSQYRRAPRQTAQ
                     PEASS"
     gene            528305..528652
                     /locus_tag="VP_RS17725"
                     /old_locus_tag="VPA0521"
     CDS             528305..528652
                     /locus_tag="VP_RS17725"
                     /old_locus_tag="VPA0521"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004731829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005461912.1"
                     /translation="MQQNEFETLVKEITLQENMPKALELLKACEEEEVAQAAESLTGQ
                     FGLAEVDGEKRIYHITLQEDESGVEQEYVEHVMNEGDNMIKFAAWFFETFFEIKQKDT
                     YMAAGKTYQQPKR"
     gene            complement(529006..529620)
                     /locus_tag="VP_RS17730"
                     /old_locus_tag="VPA0524"
     CDS             complement(529006..529620)
                     /locus_tag="VP_RS17730"
                     /old_locus_tag="VPA0524"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004731823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="WP_005482721.1"
                     /translation="MTQPIKITLYRWAGNWGPFKVNIPCGECTLTKDILVDTFANELA
                     DVPVELEVKDWLSHWWEPLKVGAWHAPILLVEGKVVSQGEALNRGVLVQSVISEWVKR
                     DELKGNIVYGKATCPYCVKTKQLLDDAGIKYEYHDVVKDSAALYRMIPEVKAIIGEKT
                     PVTVPQIWLEGKYVGGADNLEKWLAAKGLDKVPNNVVEIPSQSA"
     gene            complement(529665..530522)
                     /locus_tag="VP_RS17735"
                     /old_locus_tag="VPA0525"
     CDS             complement(529665..530522)
                     /locus_tag="VP_RS17735"
                     /old_locus_tag="VPA0525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005375542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_005491704.1"
                     /translation="MLTAGLAFAIVNSFAQIASIHFGVSSTTFALFQYAIALFVILPY
                     LRTLGIRRSLRTQHFGWHAFRIFLSVIGIQLWLWALAYPVPIWQGIALLMTSPLFATV
                     GSGLILKEKVGTARWLATLTGFIGAMIILEPWSDSFTWATLLPVGAAFFWAAYSLMVK
                     KMSVNDPPSTMVVYLLLLITPFNIVLAIPSFTMPSDWTIWLILLFAGALTALAQWAIV
                     KAYAVADASFVQPFDHAKLPLNVLAGWMVFGWVPPGRLWLGAAIIVASIAFITHWEAK
                     KTKLVERKI"
     gene            complement(530997..531968)
                     /locus_tag="VP_RS17740"
                     /old_locus_tag="VPA0526"
     CDS             complement(530997..531968)
                     /locus_tag="VP_RS17740"
                     /old_locus_tag="VPA0526"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005599942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_005482702.1"
                     /translation="MKKAALTTAILTALVSAPSFAATVYKNDGTELKVGGRVEFRGDF
                     IGSDGAEVEGSMEDQSRARLNLKGKTDIGNGMSAFGVYEAEQKTGKSEFKNRYMYAGV
                     NTDVGAFSVGRQDMAAVIISDMTDITEFSGVQQVIDSSSDKQDSVFAYRGEFDALQLQ
                     ATYQANSGDSQDKYGISGMYSLPMGLDLGLAYSGGDVDKSNSEDQILGGIAYSLDNLY
                     LAGTYSQGSLTDSEDFTAYELVASYKVATKVTLAALYTAQENDPDNGSKYDSVEGIEL
                     VGYYKLNSNFRTYLSYYINQLDEVKDATSGLVTEGEDTLRLGVRYDF"
     gene            532581..533630
                     /locus_tag="VP_RS17745"
                     /old_locus_tag="VPA0527"
     CDS             532581..533630
                     /locus_tag="VP_RS17745"
                     /old_locus_tag="VPA0527"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009696379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_005461922.1"
                     /translation="MNKKFLAAAIAAATFGTQAVAVELYNNDGTTFSIGGHVSVNLNG
                     SEQGDTDVGTNSPRINFTATQDLGNGFTADARGEWALNYLDGGENSFKTRLGYLGLTH
                     DTYGRAVGGTQWAPYYDVAGVADMPIAFANDFIYDDHGNLGTGRAEKMISYRNAIELG
                     EAGAINFGLGWQGSKDEFARDENNQIVGGADYDDRLQVALSYSIMGAKIGYTYNGGDI
                     NQGLRSESAESHLVSAAYGSYGQGLYLAAVYGSNENMNFDGKTRLAESDAYEALIAYA
                     LPNSLNLSINYEMVEGKELKGAKTETAREEMALQAEYNFTPKFVGYAGYQFDLNDAND
                     RKTDDKWALGARYYL"
     gene            533833..534447
                     /locus_tag="VP_RS17750"
                     /old_locus_tag="VPA0528"
     CDS             533833..534447
                     /locus_tag="VP_RS17750"
                     /old_locus_tag="VPA0528"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase family protein"
                     /protein_id="WP_005461913.1"
                     /translation="MSVIQVEEKKVEVGKVLCVGRNYVEHIHELDNAIPEQMVVFNKP
                     STSVSTILRSFHQEPLHYEAEICFLIKDGQYAAVGLGLDLTKRGLQSSLKKQGLPWER
                     AKAFDGSAVFSRFVPLEGIDIHDLNLELLINCVRVQKGHVQQMLYPPFAILDELSSYT
                     TLQDGDVVMTGTPQGVGEVHQGDVFLGRLKCGDVTLLEIEWVAD"
     gene            complement(534444..534755)
                     /locus_tag="VP_RS17755"
                     /old_locus_tag="VPA0529"
     CDS             complement(534444..534755)
                     /locus_tag="VP_RS17755"
                     /old_locus_tag="VPA0529"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011081517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AzlD domain-containing protein"
                     /protein_id="WP_005461993.1"
                     /translation="MIMLSILLMTLLVFTSRYLFLEPKLPLKLSTRTQKILNYASPAV
                     LTAIWAPIVFIPEGELSVSVQNPFLLAATLAALIAYLTKNVLLTTVVSMVAFLLLRIW
                     L"
     gene            complement(534755..535465)
                     /locus_tag="VP_RS17760"
                     /old_locus_tag="VPA0530"
     CDS             complement(534755..535465)
                     /locus_tag="VP_RS17760"
                     /old_locus_tag="VPA0530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AzlC family ABC transporter permease"
                     /protein_id="WP_005461994.1"
                     /translation="MDNTLPLQEESKATLFWQGTLAMMPLSIAVLPWGLLAGSFAIDT
                     GLHPLEGQALSAILFAGSAQLVAMGMIKAGAGLTTMLLTTFFITSRHFLYSVSMRSKI
                     APLPLKWRLSLGFLLTDELFAIAGHHSDEQFNRWYALGAGLSFYLFWNLATLTGIVAG
                     SLIPELNEMGLEFAVAATFIAIVVPTIKNAAVLSSVLVALVGSVALTYYQVEGSLMIS
                     SILAMLTGYFVEQVQEKR"
     gene            complement(535545..536372)
                     /locus_tag="VP_RS17765"
                     /old_locus_tag="VPA0531"
     CDS             complement(535545..536372)
                     /locus_tag="VP_RS17765"
                     /old_locus_tag="VPA0531"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005461998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_005461998.1"
                     /translation="MKEKNKEIATFKIAQELGGLELLDAKYEKQNFSRHSHEGYTIGV
                     IEKGAQQFFRTGGNHIAPQDSIILVNADEVHNGHSATEGGWEYKAMYPVPEQFQTLGQ
                     ELGSPNISLPYFPQPVVYDPELASQLRLVFETLEKSDNRLLRETLVYGTLIKLASKHS
                     THRAPLKESTKAQRQLQLVKEFLEDFPQTDVSLEELAKLAGLSPFHLLREFQKQFGFP
                     PHAYQIQQRLRMAKKLLKQGQRISDVAQECGFHDQSHLHRHFKKAIGVTPGQYLRFN"
     gene            536601..537233
                     /locus_tag="VP_RS17770"
                     /old_locus_tag="VPA0532"
     CDS             536601..537233
                     /locus_tag="VP_RS17770"
                     /old_locus_tag="VPA0532"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysE family translocator"
                     /protein_id="WP_005461971.1"
                     /translation="MIDLAVLPIYLTAVIALLLLPGPDMLLIASSSMSYGRKVGLFAS
                     LGNATSGLILTLLAAMGVSTLIAMSPVALKVLHLLGGAYLLKMGWDCLRAEASSAPEL
                     DQKNKMASTYYQRALMSNLLNPKALVFFVMFLPQFVSSNITASSGEQMLALGLLLNVL
                     GLLFNLLLVALAGTLGKGLLENEKFRTYQHKLMGLVFVILALWMLSSFVL"
     gene            537313..537735
                     /locus_tag="VP_RS17775"
                     /old_locus_tag="VPA0533"
     CDS             537313..537735
                     /locus_tag="VP_RS17775"
                     /old_locus_tag="VPA0533"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_005461900.1"
                     /translation="MKLEFCLNPEQADLDCVRDGIRSYNRKHLPEGEVNAVGCFAKDE
                     DGKIIGGLTGEMFKNTVFVEFLWVDAESRTSGLGSKLMAMLEQHVKPYGVTHIYLDTY
                     SFQALDFYLKLGFEKVGQYSGYPAEGIHKYFLQKEIAE"
     gene            complement(537839..539533)
                     /locus_tag="VP_RS17780"
                     /old_locus_tag="VPA0535"
     CDS             complement(537839..539533)
                     /locus_tag="VP_RS17780"
                     /old_locus_tag="VPA0535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011081512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-sugar mutase"
                     /protein_id="WP_005482641.1"
                     /translation="MTALITQWLARDPDPKTREELQHLVDTNNEQELSDRFGSRLAFG
                     TAGLRGKVGAGPNRMNRLVIQETATGLGHYLLEQVQDAASRGVVIGYDGRPDSKQFAH
                     DTASVLTALGIKVYLTYQVAATPIVAFGVRTMNAAAAVVVTASHNPPEYNGFKVYWEN
                     GAQIIPPHDSGIAAKIDEATTKPLPLMSLDDAKQQGLLVWLEDDYYQTYRKTMNENAL
                     LTPDSNTDISIAYTAMHGVGADMAETLLADAGFKKVASVAEQREPDGTFPTVNFPNPE
                     EAGAMDMVMALGKSVDADIACANDPDADRFAVAVKRPDGEYQMLTGDQVGSLFGDYLL
                     EQQPNSLVGNTIVSSRLLSSIAKAHGAEYYQTLTGFKWLTNVAMSQETEQHPFLFAYE
                     EALGYTVGNKVWDKDGLSAIVAFSQLTGKLKAQGKTLWDKLEALYRQHGFYFNAQRSI
                     ALDPNSPPIGDKLRANPPSEIAGKKVSVTEDLKTSVRTFEDGSEETIDLPASDVLIYH
                     LEDKSRVIVRPSGTEPKLKCYYEVISDFPADMSYEQAQQAAEAKMNALIDAHQKSL"
     gene            539864..541027
                     /gene="coxB"
                     /locus_tag="VP_RS17785"
                     /old_locus_tag="VPA0536"
     CDS             539864..541027
                     /gene="coxB"
                     /locus_tag="VP_RS17785"
                     /old_locus_tag="VPA0536"
                     /EC_number="1.9.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020335302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="WP_011106288.1"
                     /translation="MKRLATTLAIPLSVILITFSSYGWSKDNELNMTKGVTAISEQVY
                     ELHMLIFYICCAIALVVFGVMFYAIIRHRKSKGAVAAHFHESTKVEIIWTVIPIIILV
                     AMAIPATKTLVAMEDTSQSDITIQITGSQWKWHYSYFGEDVEFFSLLATSQKQIDGLE
                     MKGAHYLLEVDNPLVLPVNRKVRFLLTSDDVIHSWWVPDFAVKKDTIPGFINEAWTRI
                     DEPGVYRGQCAELCGRAHGFMPIVVHAMSEDEFDQWLSGKKEEIAMQKAAAQEALTQD
                     LSMDELMAQGEAIYSARCAVCHQANGEGIPGAFPSIKGSPVATGDVAEHIGVVVDGRA
                     GTAMQSFANQLSDQEIAAVITYQRNAWGNDTGDTVQAADVNAFKAQKSAKEEI"
     gene            541024..542661
                     /gene="ctaD"
                     /locus_tag="VP_RS17790"
                     /old_locus_tag="VPA0537"
     CDS             541024..542661
                     /gene="ctaD"
                     /locus_tag="VP_RS17790"
                     /old_locus_tag="VPA0537"
                     /EC_number="1.9.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009696372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="WP_005482647.1"
                     /translation="MSKPADKAVKSAPVEAHTAANATIALDDHDSHDAPKGIARWLYS
                     TNHKDIGTLYLWFSFTMFLTGGAMAMVIRAELFQPGLQLVDPQFFNQMTTVHGLVMVF
                     GAVMPAFTGLANWMIPMMIGAPDMALPRMNNLSFWILPFAFLILLSSLFLPGGAPNFG
                     WTFYAPLSTTYGPDSTALFVFSVHIMGISSIMGAINVIVTIVNMRAPGMTWFKLPMFV
                     WTWLITAFLLIAVMPVLAGAVTMVLTDKYFGTSFFDAAGGGDPVMFQHIFWFFGHPEV
                     YIMILPSFGIISAILPAFSGKKLFGYHSMVYATCSIALLSFLVWAHHMFTTGMPVFAE
                     LFFMYCTMLIAVPTGVKVFNWVATMWRGALTFETPMLFAIAFIVMFTIGGFSGLMLAI
                     VPADFQYHDTYFVVAHFHYVLVSGAVFSIMAASYYWLPKWTGNMYDHKLSLWHFWCSV
                     ISVNVLFFPMHFLGLAGMPRRIPDYAIQFADVNQIVSIGGFAFGLSQLIFLWVVIKCI
                     RGGEKASAKPWERAEGLEWTVPSPAPHHTFSTPPKVD"
     gene            542682..543221
                     /locus_tag="VP_RS17795"
                     /old_locus_tag="VPA0538"
     CDS             542682..543221
                     /locus_tag="VP_RS17795"
                     /old_locus_tag="VPA0538"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase assembly protein"
                     /protein_id="WP_005482726.1"
                     /translation="MADKSSHKKLTIKLVLATFAMFGFGFALVPLYDVMCDALGINGK
                     TSDVAAIQPTGMQPDLSRTIRVEFMAHVNPDMPWEFKPKVISMNVHPGEVVQTEYLAF
                     NESGQRLVGQAVPSVSPGNGAAYFNKIECFCFTQQPLDGKQHAQMPLIFYIEPDLPDS
                     IHTLTLSYTLYKLPPPTGS"
     gene            543273..544157
                     /locus_tag="VP_RS17800"
                     /old_locus_tag="VPA0539"
     CDS             543273..544157
                     /locus_tag="VP_RS17800"
                     /old_locus_tag="VPA0539"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004745742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit 3"
                     /protein_id="WP_005482671.1"
                     /translation="MSNKPGTYYVPAQSSWPIIGAFALFLVAVGAGMTVQGTQSDGAV
                     GVVGRIVLSVGFLFLLYMLAGWFSNVITESLTGKYSAQITRSFRQGMSWFIFSEVMFF
                     GAFFGALFYARMVSVPWLGGADNNLMTNEVLWPSFEAMWPLTTTPSGESTQAMPWQGI
                     PLTNTIILLLSSITLHMAHISLEKNRRTALVVWLEITIVLAGFFLFYQAKEYIHAYQE
                     MGLTLQSGVYGNTFFMLTGFHGMHVCLGTIFLTVLLFRIAKDHFSPTNHFAFQAGSWY
                     WHFVDVVWLCLFVFVYVL"
     gene            complement(544166..544402)
                     /locus_tag="VP_RS17805"
                     /old_locus_tag="VPA0541"
     CDS             complement(544166..544402)
                     /locus_tag="VP_RS17805"
                     /old_locus_tag="VPA0541"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005452392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2909 domain-containing protein"
                     /protein_id="WP_005482739.1"
                     /translation="MSTVFLFKLTLVLLLLFIIFNLAKALIEMVREDPDNPDKPTKPM
                     SHYLGRRVMFSALVVILLLIALSSGWLAPNPRPY"
     gene            544350..545186
                     /locus_tag="VP_RS17810"
                     /old_locus_tag="VPA0540"
     CDS             544350..545186
                     /locus_tag="VP_RS17810"
                     /old_locus_tag="VPA0540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SURF1 family protein"
                     /protein_id="WP_011106290.1"
                     /translation="MKSSKRTSVNLNRNTVDIVPPVSSSWLSHKLWLSKRFGIAVCLT
                     VVVFSLLVKLGFWQLERGQEKQALEQAILARTDAPYQSLASVLDNNDWREESVIGVKV
                     QAEAKPEPLPVVLLDNQTFQGKVGYLAYQVVSVGQDPITLALLELGFVEGLRTRDSLP
                     TVTTLTSPTNVTGRLYRKSMNPLSSELMPEMGEGIRVQNLNISELNELLNVELMPAVL
                     QPDNLENWAYPFPWNPLPLTSAKHFGYAVQWFVMAGVFLLLTMVVCIRWFRKAASQGG
                     EA"
     gene            545183..545719
                     /locus_tag="VP_RS17815"
                     /old_locus_tag="VPA0542"
     CDS             545183..545719
                     /locus_tag="VP_RS17815"
                     /old_locus_tag="VPA0542"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012129743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482681.1"
                     /translation="MTSQVTKGRFVLIALICLFALPAIVAKLILAQGWYETGVTNRGK
                     LIEPYTTLAQLGQSAPSAVHGWQLAYVVPDSCDSQCQRQLYLLKQSHVALGKYQERVV
                     PVLWTSTTSDTIEMPMETMAMNENVAAKVQQGQVLIVDPLGQLVMSYTAEPNEDLVKL
                     SKDMLADLRKLLKLSRVG"
     gene            545730..546749
                     /locus_tag="VP_RS17820"
                     /old_locus_tag="VPA0543"
     CDS             545730..546749
                     /locus_tag="VP_RS17820"
                     /old_locus_tag="VPA0543"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005425977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="COX15/CtaA family protein"
                     /protein_id="WP_005462008.1"
                     /translation="MTLTKLVRLSLCLTLVVIMLGAYTRLSDAGLGCPDWPGCYGHFS
                     VPHHEDDVLRANINFPEREIEHEKAWLEMIHRYFAGTLGMVIFAITVIAIRTERVNPS
                     IPILLSFLVVGQAMLGMWTVTLKLMPVIVMLHLLGGFTLLALQAVFYCQLKARDNLYF
                     SPSSRSVRLFSVFSFLVVFSQVLLGGWTSSNYAALMCTTLPICEGDWMNYLDWKEAFS
                     FWQTGHDNYEFGVLEYPARMTIHVSHRIGAMVTAVVVLTYCVVLMKQDSHHSQKVGMW
                     LGMALACQITLGISNVVFQLPIYIAVAHNLGAAIMLSLICVSQFYLWQGKADWNYAVK
                     GVRYE"
     gene            546742..547650
                     /locus_tag="VP_RS17825"
                     /old_locus_tag="VPA0544"
     CDS             546742..547650
                     /locus_tag="VP_RS17825"
                     /old_locus_tag="VPA0544"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="WP_005482743.1"
                     /translation="MSKEIALTLDSRKRLGSTYLKLTKPKVVALMLVTAIVGMSLAPV
                     TDFPWIQASIGLIGIGLMAGSAAAFNHLIDRRIDARMARTHTRPLPSGDTNPLSVAIF
                     AVAIGVVGFVLLYAWVNELTAWMTFLSLLGYAVVYTMYLKRATPQNIVIAGIAGAMPP
                     LLGWTAVTGELHGNAWLLVMIIFIWTPPHFWALAIHRVEDYRKVDIPMLPVTHGIEYT
                     KTSILLYTVLLTLVCVMPVLVGMVGFIYLFSALLLNAGFIYHAWKLKFAPEPNSAIET
                     FKFSIYHLLALFVALLADHYIGMVLQ"
     gene            complement(547729..548202)
                     /locus_tag="VP_RS17830"
                     /old_locus_tag="VPA0545"
     CDS             complement(547729..548202)
                     /locus_tag="VP_RS17830"
                     /old_locus_tag="VPA0545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017043492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_005461979.1"
                     /translation="MSKFLFPIIIFVLAAFFIYRTWTNHKVADENFAKGQAFLLENAK
                     KEGVITTESGLQYLVLEKGTGDVHPTATSKVKVHYHGTLIDGTVFDSSVNRGEPITFG
                     LNQVIKGWQEGLQYMVVGEKIRLFVPSTLGYGKNGTGPIPPASVLIFDVELLEIQ"
     gene            complement(548216..548848)
                     /locus_tag="VP_RS17835"
                     /old_locus_tag="VPA0546"
     CDS             complement(548216..548848)
                     /locus_tag="VP_RS17835"
                     /old_locus_tag="VPA0546"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009704740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein DsbA/DsbL"
                     /protein_id="WP_005482658.1"
                     /translation="MFKTISKGVALFAAIAALSACDSGNSQPQQGKQYEVLPVSLQEY
                     NLAPLTEAFALTCGHCRSMEEFVPQIESLTEQKVEKMHVTFNESAQISAIIFYTAVMQ
                     LDATPDKAFMADLFAAVQMGADATAEERQQAVEKAFESRNLISPYHLDEAQQEKLFEY
                     ITKAESITTRGQINSVPAFIVNGKYQVITGGHDSVEAMAETINYLLKQPK"
     gene            549139..549765
                     /locus_tag="VP_RS17840"
                     /old_locus_tag="VPA0548"
     CDS             549139..549765
                     /locus_tag="VP_RS17840"
                     /old_locus_tag="VPA0548"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012129066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA family protein"
                     /protein_id="WP_005482692.1"
                     /translation="MKHWFFIVCGILSGCSSLNPDMVPGGNMLDTAPKTNTELRHPEW
                     GYASASHVSTAPRVNQTARAAEKKSNNVTSLEMFLDRHNIPHETIGGGHLMIRLKEQV
                     HFQTGSAQLSSNSQDWLRKLGHYLAGRTDVDVVIDGHADSTGAASFNDTLSEKRAREV
                     EKQMLASSIPRQRVFSRGFGEYVPQCSNATSSGKACNRRVELMLIVDE"
     gene            complement(549857..550216)
                     /locus_tag="VP_RS17845"
                     /old_locus_tag="VPA0549"
     CDS             complement(549857..550216)
                     /locus_tag="VP_RS17845"
                     /old_locus_tag="VPA0549"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004412166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="WP_005482613.1"
                     /translation="MKFIRWILGKVILLLNAVFSPRGIKRTNEAQSNVDDKAKQYALY
                     QFEACPFCVKVRRAMKRQSVNIELRDAKNDPTHRAELEQGGGRVKVPCLRIEKDGETQ
                     WLYESSDIVAYLEKEFA"
     gene            complement(550327..550869)
                     /locus_tag="VP_RS17850"
                     /old_locus_tag="VPA0550"
     CDS             complement(550327..550869)
                     /locus_tag="VP_RS17850"
                     /old_locus_tag="VPA0550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009704737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482688.1"
                     /translation="MTPLSELIKQMGIKKIPFVDEHKAAKKRWLKEQAPLFARVCENK
                     PATNPVLHLLGLLTKSHIEASALYEQHAHSTQQMQKVLADTLGDEQADKFTNQSAEDL
                     VLITHLWLFTQGYLNMDFSLAHDHAEQTQNTLQHELVIKRIDVDAFRTELMQSFYLGK
                     EANPTASNGFFGWLKRLFSS"
     gene            complement(550856..551401)
                     /locus_tag="VP_RS17855"
                     /old_locus_tag="VPA0551"
     CDS             complement(550856..551401)
                     /locus_tag="VP_RS17855"
                     /old_locus_tag="VPA0551"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YaeQ family protein"
                     /protein_id="WP_005482675.1"
                     /translation="MALKPTIYKFRIALSDMNNDYYDSKNLTIALHPSEKPQRMLARI
                     LAFCLNAQKDLEFTKGLSTTEEPDLWHVADDQSITHWIEIGEPEPDRIKKASRLAKQV
                     KVYTYNTKAPVWWEKMSGKFSMLPVSVESFDYDAIDMICQHLDRGTNLSVMITGTSIF
                     VDVNDQHVEVTVKELQSHDAP"
     gene            complement(551492..551701)
                     /locus_tag="VP_RS17860"
                     /old_locus_tag="VPA0552"
     CDS             complement(551492..551701)
                     /locus_tag="VP_RS17860"
                     /old_locus_tag="VPA0552"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005375625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="WP_005375625.1"
                     /translation="MSNTATGTVKWFNETKGFGFIQQENGPDVFAHFSAITGDGFRTL
                     VEGQKVEFVISQGQKGPQAEQIKVL"
     gene            552069..552362
                     /locus_tag="VP_RS17865"
                     /old_locus_tag="VPA0553"
     CDS             552069..552362
                     /locus_tag="VP_RS17865"
                     /old_locus_tag="VPA0553"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005487848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome alternative rescue factor ArfA"
                     /protein_id="WP_005482651.1"
                     /translation="MAKAKCNPQPNEFNKDTEFGRGEIKDNALKAVVTSQLFRTRVVK
                     AKKGKGSFNRKMKHRGKEPYSKFSPKWILNRAFFMLRVKELFDRKVSVQAYCP"
     gene            complement(552391..553734)
                     /locus_tag="VP_RS17870"
                     /old_locus_tag="VPA0554"
     CDS             complement(552391..553734)
                     /locus_tag="VP_RS17870"
                     /old_locus_tag="VPA0554"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing methyl-accepting
                     chemotaxis protein"
                     /protein_id="WP_005482593.1"
                     /translation="MFGLRTRNQEAESEYRRFIKGLSDSMAMIEFDTRGIILNANDLF
                     LSCVGYTREAIVGKHHSIFCDRGYVQSPRYQQFWDDLKMGKHKRGTFERLTSQRERLV
                     LEASYFPIESEHGQIEKVVKIASDVTQQRLESEQKEAILNALDLSLATIEFDREGYIL
                     TANQNFLKTLGYELSDVQGKHHKLFCFDDFYQENPGFWKDLAAGQFKSGQFLRRSASG
                     DKVYIEATYNPIFDPAGNVIKVVKFASDITDKVQRDLNISQAIADSSFIARNASEEAT
                     SNVCGAEHSLNEFRTMIEEVLRAVTACDDKVQELFKTSQQVTEIVKVIDSIASQTNLL
                     ALNAAIEAARAGEHGRGFAVVADEVRTLATRTSTSIDEINHIVLSNQSLTTETRSFIE
                     VINQGFLSSMSKLLEVDEFMKSIDEGSHLTVESISALRAIVNQDAHLHLNSASNG"
     gene            554210..555652
                     /locus_tag="VP_RS17875"
                     /old_locus_tag="VPA0556"
     CDS             554210..555652
                     /locus_tag="VP_RS17875"
                     /old_locus_tag="VPA0556"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011106293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor domain-containing diguanylate cyclase"
                     /protein_id="WP_011106293.1"
                     /translation="MASTSFSTYGYKCTRACTSLLLLWLAMCSYSFAHQTKVDTLIVT
                     NSKAWKPFSYVSQDGEPKGILIDFWREYAERNHVRVEFLLLDWEESLRAVKEGRADVH
                     AGLIYSEARDKYLDFGAVIMPIQTKLYVNKDMLAVDIKGVLTGEVELPIGLVKGSYEA
                     EFVRANYPRASLVEYLNNDAMIRAAVEKNILYFVADLQVANFHMATTPDAGMFVPTLN
                     LYSKDLRIATGEHSSIPVTKISHDFEKIIDSDKERILNRWSLVKTVYPIYLLPIAIFI
                     MVIATLYHIFALKRMVTLRTKQLTLANQQLLELTLTDPLTKLYNRRHLIERLATLSSL
                     QKNVTVMVFDIDDFKSINDKYGHLIGDQAIVAVADTAKSLTDERITLARIGGEEFALV
                     TASLSEKEAETLAKAICSCVYDRPVLLNGQAIHVSVSLGCAYYREFKGIINLHEADQL
                     MYCGKMNGKNCAMFKVIDKSKVEPLLRQVP"
     gene            555769..556515
                     /locus_tag="VP_RS17880"
                     /old_locus_tag="VPA0557"
     CDS             555769..556515
                     /locus_tag="VP_RS17880"
                     /old_locus_tag="VPA0557"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein-sorting protein"
                     /protein_id="WP_005482649.1"
                     /translation="MPKAVAVLFFLLFTSLSYAESAFDIVQKSDQAMRGKSSYSEATM
                     EIVRPDWTRSMTMKSWTKGTELSLVLVTAPAKDKGSASLKRHREMWNWVPSIERVIKI
                     APSMLSQSWMGSDFTNDDLINQSSIVVDYQHALLGNDSFEGDKVWVIEATAKPDAPVV
                     WNKVTLWISQSTYLQRKVEFYDEFDERVNVLTTYDVKELGGRKIATRMEMKPVDKPGN
                     KTIFTTHQAQFDFDINDDFFSQQQMKSLRD"
     gene            556556..557785
                     /locus_tag="VP_RS17885"
                     /old_locus_tag="VPA0558"
     CDS             556556..557785
                     /locus_tag="VP_RS17885"
                     /old_locus_tag="VPA0558"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006230206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_005482600.1"
                     /translation="MLIKLAWRNLWRQKRRTLLTATALALVLFLSLLTRAFQEGSYSS
                     NIKNAAKFYTGLIQLQNPEFGDSSSIDDALPQTDTFISASRANSNIDVILPRVESFAL
                     AAKGERSKGVMVLGVDPESENAYSHISDKLVQGEFIASGQNAVLVGGGLAQYLRLKIG
                     DELVLYGAGYRGQTAAGLYRVAGILHFPLQQLDSQLVYMPLDTAQTLYSLDKQVTAWV
                     LNTSNLRVLPSVIEQLKRDYGNSVAVKGWQELSPELSQQIALDKAGGIFLIYILYGIV
                     GFGLFATILMTTLERQREFAVMLATGMLRSKLIGLISIESLFIAIIGIVLGLIVSAPV
                     LGYFYFNPIEITGEAAQVMLESGFEPIVPVSLDPHLLLNQIIVVLIILSLCLVYPMIR
                     LLRLPIASGLKGGAHVD"
     gene            557775..559010
                     /locus_tag="VP_RS17890"
                     /old_locus_tag="VPA0559"
     CDS             557775..559010
                     /locus_tag="VP_RS17890"
                     /old_locus_tag="VPA0559"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017188862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_005482694.1"
                     /translation="MLIKLAWRNLWRNKLRTSIMLGAMVFGLMGVVTMIGFMNGLVDS
                     MIKNAIAWQTSHLQIHQSAYLVNPELKDTIPDSQSIVTTLDKHQSVKAVSERFLADGM
                     IASARSSRGIRINGIHLEQEQKITPLSEHIIDGYWLDEEGRNPILVSQKTAKRLKLRV
                     GSKVILTLSDINGDVSGAAFRVKGIFKTPSTTFDDGNVYVRKADLEKIAGIAGAHEIA
                     ILLNANDDDVLQNIVSFTRTLTDDGSGKPLTVRTWLEIQPLLSTMMSSMDISNQVMLV
                     VFVLAMTLGIINIMLMSVFERTREFGVLMAVGMQQHKIRILITLETMFLGLTGCALGL
                     FGSAAMIKLLSVTGLSLGGLADGLGAYGVDTLLYPRVSFYEYQMIIVAIFMASLFAAL
                     YPARQILKHRPADAMGEKT"
     gene            559010..559723
                     /locus_tag="VP_RS17895"
                     /old_locus_tag="VPA0560"
     CDS             559010..559723
                     /locus_tag="VP_RS17895"
                     /old_locus_tag="VPA0560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005433467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_005482754.1"
                     /translation="MTIKLERLTKTYNPDSDFPVHAVQHVDLEIKQGEFVAIMGPSGS
                     GKTTLLNMLGGIDAPTSGSVEIDGCLISEMSEKELIAYRRDNIGFIFQDYSLLPVLTA
                     LENVEFVMQLQGKTERECRERAMSLLEQVGLAQQMHKRPSKMSGGQQQRVAVARALAP
                     KPRFVMADEPTANLDAKSTSELLDIMEQLSEQEGTTFIFSTHDPRVIKRAHRIIVFED
                     GRLARDFANIGSTAEKFHA"
     gene            559716..560933
                     /locus_tag="VP_RS17900"
                     /old_locus_tag="VPA0561"
     CDS             559716..560933
                     /locus_tag="VP_RS17900"
                     /old_locus_tag="VPA0561"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482679.1"
                     /translation="MHSGLHIRFSPPWMVVVSQALSLSLLGFFSFCAVANIPGLQPQK
                     SWDFDGYIKYMATYSMPDDQSNTLDHLLHNRLNFEYRFSPNWRVNVGLRNRALWGDAL
                     DIPQYPELVALDNGYFDLSKNWREDDVILNSQFDRLYVSWKSDDWSASVGRFRINWSM
                     NTIWNPNDVYNAYSIYDFDYEERAGTDAIMVSKKLGFADGLDLVFSPSQASGQNSASL
                     RYFSNVSGWDYQIIAGRARTDYILGAGFATDVYDAGLRGELTWFDPIDAEYQGEPTHN
                     NTVASLEADYSFGGVRNWMTRGAWLFISKPQDANSALAYLNLPLNAKTLSFTKNTFYA
                     DVSFDLTALNRFTLSASYYDDGSYFAGLSSNYSLATDWQLLTVLQRFSGSGDSLFGET
                     PATLLFANIRYSF"
     gene            561078..563078
                     /locus_tag="VP_RS17905"
                     /old_locus_tag="VPA0562"
     CDS             561078..563078
                     /locus_tag="VP_RS17905"
                     /old_locus_tag="VPA0562"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005453714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_005482598.1"
                     /translation="MNLTISGKLQLSFVLLAVVFIASAIFTYRNINIVEQHASSLLSS
                     DLPTVDTSRGIQQSVQASLSSIRAYMLLGSDEAESLRLSQEVQSIMASTDDALPTLQA
                     LISESDFQSIHQQWEAMKVSLSQLIELSHSAENLPAHNLFINEAAPIAEVALDQIQSL
                     INEESGNEMGGERKRLFKVYADSYTSLANALSALRDFLLYGQQTHLEKYQDLIKFHNQ
                     SVAEIDAKLDMLSDNDQSLWSLFKEMQQMYFPLADQVITLRQSDEWNKANLLMANELL
                     PAANALNQSLETIVLAQQAKANQSGIGISQSIKNVLTSMLVAALLVVIAAIAISKYMG
                     NTIGRRVQRLSKRAKIIASGDVSQPPLNVVGKDELADLTSSINRMNESLAGIVAGVNG
                     KANQVDTSMGALLESAQVTSNNVEQQQSNISEMGRQLEEIAFAASNTLDQANQSVQKL
                     SDSKDEIEQGRDALEQNKATMESLHSSIESASTQVTQLSKESEAIGRVTEVIEGLAEQ
                     TNLLALNAAIEAARAGEQGRGFAVVADEVRMLATRTTQSTTEINGIINAIQRSTHTVV
                     QEIEHSQSLAEQGAEHIDNAVTRLVSTTEQIGSLNEQMAELAAAAEQQSHATQSINGL
                     MAGITQSVEMVASNSQHASETSLQVKQEVTELNQQMAMFKTA"
     gene            563295..563774
                     /locus_tag="VP_RS17910"
                     /old_locus_tag="VPA0563"
     CDS             563295..563774
                     /locus_tag="VP_RS17910"
                     /old_locus_tag="VPA0563"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005433302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA starvation/stationary phase protection
                     protein"
                     /protein_id="WP_005461991.1"
                     /translation="MSKQVSLIGLDRQQSEQLAQQLNQLLAHYQVLYMNTRGYHWNIK
                     GHQFFELHVKFEEIYTDLQTKIDELAERILTLGYTPAHAFSHYLESSEIKEHQNATAG
                     EECVKGLVDGFGVLLVKQREILQNAGEADDEGTAALMGDYIREQEKLMWMLNAYLQG"
     gene            complement(563886..564494)
                     /locus_tag="VP_RS17915"
                     /old_locus_tag="VPA0564"
     CDS             complement(563886..564494)
                     /locus_tag="VP_RS17915"
                     /old_locus_tag="VPA0564"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005461958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_005482630.1"
                     /translation="MIPFPLELERIKAVIFDLDNTLVSSDMNFQDLRQQLGCPQTEDL
                     LDFVERIDHPHHKEHAHNVIFDHEISDAEQSSPMIGCHELLNYLEKKTIKTAIVTRNC
                     LIATQRKLEHNQITVEQVITRECYPPKPDPLSLQVLAKEWRLMPNEVLYVGDFLYDLQ
                     AAYNAQMPSCLVHHGITEQFQNSASLAVRELSDLLAYFESAH"
     gene            complement(564628..565704)
                     /locus_tag="VP_RS17920"
                     /old_locus_tag="VPA0565"
     CDS             complement(564628..565704)
                     /locus_tag="VP_RS17920"
                     /old_locus_tag="VPA0565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005391136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PQQ-dependent sugar dehydrogenase"
                     /protein_id="WP_005482589.1"
                     /translation="MRIVTIALLACLSFSLHAAQYHADEVANGFQVPWGIEFIDSQRV
                     VVNEKNGTISLLNVMTGQRQKIHTVQNVNTSGQAGLLDVALAPNTDKKNPQLYFTYSK
                     RTQKGNTVALATATLNGEQLTGWKDLFIADAITDTGRHFGSRIAFIDGKIYFTIGDRG
                     ERDNGQNTQTHAGSILRLNLDGTVPTDNPFTSSKAKPEIWSFGHRNPQGLFYDKETDQ
                     LWSIEHGPRGGDEINLIKKGANYGWARVSQGKEYWGPLDVGEAKSLPGMEDPKLVYIP
                     SIAPSNMVLYRGDKYSELDGKILVGALKLTHINVVGINDGKLTESQRLLEKLGERIRD
                     ITISPDGYIYFSTDSGKIFRLTEQ"
     gene            complement(565869..567017)
                     /gene="yiaY"
                     /locus_tag="VP_RS17925"
                     /old_locus_tag="VPA0566"
     CDS             complement(565869..567017)
                     /gene="yiaY"
                     /locus_tag="VP_RS17925"
                     /old_locus_tag="VPA0566"
                     /EC_number="1.1.1.103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019274417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-threonine dehydrogenase"
                     /protein_id="WP_005482586.1"
                     /translation="MTSTFFIPTVNLMGAGCLKDAANSIQSQGFKKGLIVTDKILNQI
                     GVVKQVQDLLTERGVATVVFDGTQPNPTITNVNDGLALLKENECDFVISLGGGSPHDC
                     AKGIALVASNGGKIGDYEGVDQSAKPMLPLIAINTTAGTASEMTRFCIITDEERHIKM
                     AIVDKHTTPLISVNDPELMLAKPASLTAATGMDALTHAIEAYVSIAATPITDAVAIKA
                     IELIQAHLRTAVKNGENLEAREQMAYAQFMAGMAFNNASLGYVHAMAHQLGGFYDLPH
                     GVCNAILLPHVQRYNAQVCPERLRDVAKAMGVDVEGMSAEHGAAAAIDAIVALAKDVG
                     IPAGIKELGAKLEDIPTLADNALKDACGFTNPKQATHEEISAIFEAAM"
     gene            complement(567352..568002)
                     /gene="elbB"
                     /locus_tag="VP_RS17930"
                     /old_locus_tag="VPA0567"
     CDS             complement(567352..568002)
                     /gene="elbB"
                     /locus_tag="VP_RS17930"
                     /old_locus_tag="VPA0567"
                     /EC_number="4.2.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004748742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenoid biosynthesis glyoxalase ElbB"
                     /protein_id="WP_005482741.1"
                     /translation="MKKVAVILSGSGVYDGSELHEAVLALHAIEKAGATWHCFAPNID
                     QLHVINHLTGEEMDEPRNVLVEAARIARGNIEDVARLNVEDFDALLLPGGFGAAKNLT
                     DFAVSGAECSINTHVAQACRAFANANKPAGYLCIAPVIIPMIYEHGVKGTIGNDDATA
                     AAFHQMGGEHVECNVDEYVFDEKHNVLSTPAYMLAQNISQAASGIDKLVSKLVEIA"
     gene            complement(568015..568170)
                     /locus_tag="VP_RS23655"
     CDS             complement(568015..568170)
                     /locus_tag="VP_RS23655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005453721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482607.1"
                     /translation="MKHFLPSSVMLTPFVVRYYDEEDDDQEIVETKANAQSQYPNIKE
                     QQTEISD"
     gene            568291..569193
                     /gene="yddG"
                     /locus_tag="VP_RS17935"
                     /old_locus_tag="VPA0569"
     CDS             568291..569193
                     /gene="yddG"
                     /locus_tag="VP_RS17935"
                     /old_locus_tag="VPA0569"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012129085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid DMT transporter YddG"
                     /protein_id="WP_005482638.1"
                     /translation="MKSVQFRFTLYGCIAILSWSCLLGIARLVTESLGPVGGAAMLYS
                     LSSIFLLIVVGIPKLSYFSPKYLIVGGAMFVCYEIFLALALGYSNSRAQAIEVSIVNY
                     LWPALTVLFAVLGSNKKPNWLLYPAVTLAFIGVAWTVSGDNGLSPTQIISNVSSNPLV
                     YFMAFTGAVIWAVYCNLTQRQQSKHNAITLFFIATAVSLWVKYAFADEPTMTFSWSAL
                     GYLFASAALMAGGYGLWNIAIVGGNMVFLATLSYFTPIFSALFSSLILGVTLSNSFWQ
                     GVVMVTVGSLLCWLVTKEKREAAG"
     gene            complement(569384..569950)
                     /locus_tag="VP_RS17940"
                     /old_locus_tag="VPA0570"
     CDS             complement(569384..569950)
                     /locus_tag="VP_RS17940"
                     /old_locus_tag="VPA0570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482595.1"
                     /translation="MIINYALTTAPYSNDIESCINVMTASMFALVDQGEETEVATCDF
                     YIVDLSRASSTISCHKLLNINASIAHFIQILDDDYLLKESIAKRNETMRWGICPEPDR
                     LIVIHELKVKKEHRGNKYSKALIEDFIERFTSIYDIIGLKALPLEDRSEESVEALKSY
                     YSKIGFKDVGIDDLMLWPALEEPNWNEA"
     gene            570480..570809
                     /locus_tag="VP_RS17945"
     CDS             570480..570809
                     /locus_tag="VP_RS17945"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_021454608.1"
                     /translation="MFGFFKRKALKKRAFNLYKELVFGRLYEGNRFGLNAEDLCKTTG
                     LNLFSTLNLIYRLIATGLVEEYELVDVVCYRAVNVPIYLDDTSPPSIITDYVKRAIGR
                     VDFKGLA"
     gene            571148..571333
                     /locus_tag="VP_RS17950"
     CDS             571148..571333
                     /locus_tag="VP_RS17950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005461987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482677.1"
                     /translation="MAIALIHRLIDNELVEKYGFKDDVSYRAANIPSHLDKTSAPMSI
                     FQYVNRSIGRVDFKDLA"
     gene            complement(571441..572337)
                     /locus_tag="VP_RS17955"
                     /old_locus_tag="VPA0572"
     CDS             complement(571441..572337)
                     /locus_tag="VP_RS17955"
                     /old_locus_tag="VPA0572"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005391129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation diffusion facilitator family transporter"
                     /protein_id="WP_005462012.1"
                     /translation="MCDRTSKNENRILTISALLASGFAAGGMVLGLLVGSIVIVFDGV
                     YSLVSLLLTLLSLAASSYISKPSKSVFPFGKAVLEPIVIAIKAAVILVVVCFSLYSAI
                     SALMTGGREVDTSIATIFGLVNVIGCGYAWWFMAKKSRRFSSGLIDAEKKQWQMDTLL
                     SVAVTVGFIAAWLVSLTPFAHYAVYADPMMMLLMGFYFLKVPFDMLCGALRELLMMTP
                     SKELCQVVGNDVLEIEKVSDHQLKLAGITKVGQELRVNIDLHVDDDMIELDTLEQTRK
                     QLTTRLSKHRFKLQLNLNVANC"
     gene            complement(572513..573391)
                     /locus_tag="VP_RS17960"
                     /old_locus_tag="VPA0573"
     CDS             complement(572513..573391)
                     /locus_tag="VP_RS17960"
                     /old_locus_tag="VPA0573"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004411430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005461877.1"
                     /translation="MNLTQVEAFCTIAECGSVSEAARQLDCNRTKLSMSIKALEKELD
                     VELFTRTGNQLTLSEAGKAIYKDCEYLLVTAQRIRKTCAQISEGFNAEVWVARDDSLP
                     DDLWQELSHRLNNRFPSTTFNLILASSGDLANLVSTHQVDFAFGVDYERIDDPHIVYK
                     PLGKIRMMSVCSVDHRLSKMRRVSDEDLRSQMQALMVYLNEKDNPGLQPFSTRYIGFS
                     SFDYMLNTILEEDAWGVLPEPLIRHYLRQQKLAVIKHTYGLTQEDYCMFAPNGQIEHP
                     AMTWLADKLSEYLFDF"
     gene            573617..574192
                     /locus_tag="VP_RS17965"
                     /old_locus_tag="VPA0574"
     CDS             573617..574192
                     /locus_tag="VP_RS17965"
                     /old_locus_tag="VPA0574"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009696080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_005461928.1"
                     /translation="MAQDWDGLAKNWESNPATEQFAQSVFAQLQQLTQLDGIKVLDFG
                     CGTGQLSQLLSPLVKDIVALDASEAMIEELDKKELLNVEPVVDALSRGLVAQHPAFRG
                     QFDLVVASSVLAFVDDVESSLDIAHSLLNEGGYFVHFDWVAESEQDGFTLSRSENALS
                     NAGFVDVEAKKVFDITSDGQIMSVLMGVGRR"
     gene            complement(574250..576220)
                     /locus_tag="VP_RS17970"
                     /old_locus_tag="VPA0575"
     CDS             complement(574250..576220)
                     /locus_tag="VP_RS17970"
                     /old_locus_tag="VPA0575"
                     /EC_number="6.2.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetoacetate--CoA ligase"
                     /protein_id="WP_005462006.1"
                     /translation="MRESNKVWQPSESRIAEANITQFIEHINRQGFDLKNYADLHQWS
                     LDHNEQFWQEVWLFCDVIGNAGETVKSQAESKWQQPVLNRDLCWFPDAHINYAENLLS
                     FAYQKPHELAIWFENERDERQTYTWQQLCDEVSSVQQWLRDCGIKQGDVVAGYLPHLP
                     QTVIAMLATTSLGATWTSTSPDFGVESVLERFGQVKPKILFTCDGYTFNGKTFDMAEK
                     NQHISDHLDGLKQVCQISYLKPHIFECDVCTQDWQNVLNQYSPEPLTYTRVNFNDPLF
                     VLYSSGTTGKPKCIVHSVGGTILNHVKEHQLHCDIQPNDRVFYYTTCGWMMWNWHVSA
                     LASGACLVIFDGSPVYPSHKVLWNLAQNADVTLFGTSAKYLEALEKAQFSPKRADAFP
                     ALKTICSTGSVLYPEQFNYVYEHLKEDIHLASIAGGTDICGCFVLGNPISPVYRGECQ
                     SAGLGVDVQVFNPQGHSVVGERGELVCTNSLPNFPSGFWRDSGERYHRAYWDKFDNVW
                     HHGDDVEKSEVGGFVFYGRSDTTLNPGGVRIGTAEIYQQVNAIDGIVDSIAVGKEVDR
                     NEQIWLFVQLESQDELDDELIGSIKAQLKSACSPRHVPSAIFAISDIPKTRSGKLVEL
                     AVKQVVNGRQVENLGAIANPEILQEIQTAISA"
     gene            576442..577236
                     /locus_tag="VP_RS17975"
                     /old_locus_tag="VPA0576"
     CDS             576442..577236
                     /locus_tag="VP_RS17975"
                     /old_locus_tag="VPA0576"
                     /EC_number="1.14.16.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017070189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanine 4-monooxygenase"
                     /protein_id="WP_005482734.1"
                     /translation="MTQYRSKPVSQDGRVEWSREEDAIWSDLVTRQMSVIKERACDAY
                     LRGLELLNLPQDRVPQLPEINRVLMETTGWQVEPVPALIDFDRFFNLLGNKRFPVATF
                     LRTREEFDYLQEPDFFHEIFGHCAMLTHPEFAAFTEHYGQLGQAATPKQRAYLARLYW
                     FTVEFGLVKEGTKTKIYGGGILSSPGETIYALESESAIRESFDLQTVLRTPYRIDIMQ
                     PKYYVIDDFSQLFQISQLNLLKQADLAIEAGLLPPLFEPKEPAHAE"
     gene            577226..577564
                     /locus_tag="VP_RS17980"
                     /old_locus_tag="VPA0577"
     CDS             577226..577564
                     /locus_tag="VP_RS17980"
                     /old_locus_tag="VPA0577"
                     /EC_number="4.2.1.96"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008216867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4a-hydroxytetrahydrobiopterin dehydratase"
                     /protein_id="WP_005482617.1"
                     /translation="MLNEQKCEACSFDAIALTKEEQQSLLLQLSDWHLIERDDIPQLE
                     KVYKFKNFKQAWAFSNKIAELAEEEFHHPSILLEWGKVTVTWWSHSIKGLHKNDFICA
                     SKCDALVLSE"
     gene            complement(577731..579500)
                     /locus_tag="VP_RS17985"
                     /old_locus_tag="VPA0579"
     CDS             complement(577731..579500)
                     /locus_tag="VP_RS17985"
                     /old_locus_tag="VPA0579"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005453740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482618.1"
                     /translation="MTTPIKAIGAMALSTLAIACSSQQNDVIASFSAQCKPISSPAVG
                     ETSIQGLTFVGSSIADAPFDTSAAEIVNYDACTDKLYVVNAQAKRVDVLSLNESSAPS
                     QTDFIDLTDAGTSAGIEIGAANSVAVFNGLVAVAIENNNKQEDGLIALYRSDDLSLIT
                     TFKIGALPDMVGFSKDGRYIATANEGEPNSDYSIDPEGSVTLVDLSKGINNADVTQIG
                     FGEFDGVRSDELPKAVRISGPNASIAQDLEPEYLTFADNGKIYVALQENNAMTIIDPQ
                     NHSVEKIVALGEKSWSNSKLDASNKDKIIGNLKSYPQLVGLYMPDTLDSYSVNGQTYI
                     VSANEGDGREYGFKTTQAECDQAGFKWDEDDYQGTPDYTNVKGSCLSHIDEVRGKKLK
                     VTTDHPLAEALKDNKQLARLKVIKPNHTLNAEENVQAFGARSFSIWNENGELVFDSGD
                     DFATVALLNEGKYFNSTNDSNSSGDDRSDDKGIEPEAIEVAKINGRYYAFIGLERQGG
                     IMVYDITEPKQAQFLHYVNHRDYTQPVCTLVEDGECANDTYNPKAGDLAPESINYFAR
                     NGQHFIAVGNEVSGTTSVFRIEI"
     gene            579712..580056
                     /locus_tag="VP_RS17990"
                     /old_locus_tag="VPA0580"
     CDS             579712..580056
                     /locus_tag="VP_RS17990"
                     /old_locus_tag="VPA0580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009696084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HopJ type III effector protein"
                     /protein_id="WP_021451084.1"
                     /translation="MELQQFLDALASSPEKIEFETTMAVIEDNYDFTPAAFTNGNTQN
                     DANENNGSCKIFAFGLLNALDKEATLACFGRFYREDVLLHPENNDHQNIRNFMVTGWE
                     GIQFETSALTAK"
     gene            complement(580098..580406)
                     /locus_tag="VP_RS17995"
                     /old_locus_tag="VPA0581"
     CDS             complement(580098..580406)
                     /locus_tag="VP_RS17995"
                     /old_locus_tag="VPA0581"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009386342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine-rich CWC family protein"
                     /protein_id="WP_011106302.1"
                     /translation="MTSPCRAACKNNAGICSGCHRTMDEIIQWKDKTELQRETIIEQI
                     TGEDSTHSCPECDSQAHCDIAAGKETCWCFGIEPRDLPKPESDQLCLCRKCLEKKPVA
                     "
     gene            580580..580795
                     /locus_tag="VP_RS18000"
                     /old_locus_tag="VPA0582"
     CDS             580580..580795
                     /locus_tag="VP_RS18000"
                     /old_locus_tag="VPA0582"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017054579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3820 family protein"
                     /protein_id="WP_005375557.1"
                     /translation="MLEKENLIKLARMQMPFGKYAGRVLIDLPEEYLLWFDKKGWPSG
                     ELGDLLKLCLALKIEGLDSVVKPLKRM"
     gene            581065..582315
                     /locus_tag="VP_RS18005"
                     /old_locus_tag="VPA0583"
     CDS             581065..582315
                     /locus_tag="VP_RS18005"
                     /old_locus_tag="VPA0583"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006069437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_005462089.1"
                     /translation="MTDKTQQATFADLGLIPTLVERLEALEYNQPTPIQSHAIPHVLD
                     GRDMIGGANTGSGKTAAFSLPILQKILQQGESNDRRGNFVSHLILVPTRELASQVAYN
                     VKSYSYHLRDKIKTVAVFGGVSVNPQMLALRGGCDIIVATPGRLLDLVSSNAIKLDQV
                     KTLVLDEADRMLSLGFTEELNKILALLPEKKQTLLFSATFPEKVTALAQHLLNDPVEV
                     QLQSAEASTLVQRVFSVNKGEKTAVLAHLIKQHQWRQTLIFVNAKNACNHLAQKLSKR
                     GITAEVFHGDKGQGARTRVLDGFKSGEIQVLIATDIAARGLDIEKLPVVINFDLPRSP
                     ADYMHRIGRSGRAGEVGLGLSLIDYDDYHHFKVIEKKNKFQLEREQVEGFEVEDDQSE
                     AYFLPMKPRAKPAGTGKKKKKRNQ"
     gene            complement(582464..582877)
                     /locus_tag="VP_RS18010"
                     /old_locus_tag="VPA0584"
     CDS             complement(582464..582877)
                     /locus_tag="VP_RS18010"
                     /old_locus_tag="VPA0584"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005391068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VF530 family DNA-binding protein"
                     /protein_id="WP_005462112.1"
                     /translation="MMTDEERIELQQNNPLHGLKLETMLQELVDFYGWDILDTAMRFN
                     CFNTKPSIASSVKYLKKTEWAREKLENFYLYRFKRMPRASEEEYNLPPRARTFPHGLE
                     PKEPMPLTVDSILNSQAKAASSFKKRSSRGRPTRR"
     gene            complement(583108..584331)
                     /gene="trpB"
                     /locus_tag="VP_RS18015"
                     /old_locus_tag="VPA0585"
     CDS             complement(583108..584331)
                     /gene="trpB"
                     /locus_tag="VP_RS18015"
                     /old_locus_tag="VPA0585"
                     /EC_number="4.2.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017821092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="WP_005482634.1"
                     /translation="MKNSFDHNMPNNEGYFGEYGGSFVPPELEQIMRDINAAYEECCQ
                     DPEFKDELARLYKHFVGRPSPIFHAANLSKKYGADIYLKREDLNHTGAHKINHCLGEA
                     ILAKKMGKKKLIAETGAGQHGVALATAAALVGLECDIYMGEVDIAKEHPNVVRMRILG
                     ANVIPATHGRKTLKEAVDAAFEAYLKDPETQLYAIGSVVGPHPFPKMVRDFQSIIGNE
                     ARVQFKEMTGKLPNNLVACVGGGSNAMGLFSAFLEDENVAIHGVEPAGRSLDKVGEHA
                     ATLTLGEPGIMHGFKSYMLKDEQGEPQEVHSVASGLDYPSVGPQHSYLKDIGRVNYGS
                     INDDEAIDAFFELSREEGIIPAIESSHAVAYAIKLAQQGESGSILVNLSGRGDKDIDF
                     VVENYGAKYGIESLI"
     gene            complement(584812..585060)
                     /locus_tag="VP_RS18020"
                     /old_locus_tag="VPA0586"
     CDS             complement(584812..585060)
                     /locus_tag="VP_RS18020"
                     /old_locus_tag="VPA0586"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005433595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005462100.1"
                     /translation="MNIDNHVIESLEELEAFLHLVESGALGLEGVTGVALATTNTDGR
                     PFVAVLGDKHQLLLGRWVSQHVYDNGKDIVRNGSARKH"
     gene            585302..585940
                     /gene="pcp"
                     /locus_tag="VP_RS18025"
                     /old_locus_tag="VPA0587"
     CDS             585302..585940
                     /gene="pcp"
                     /locus_tag="VP_RS18025"
                     /old_locus_tag="VPA0587"
                     /EC_number="3.4.19.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005598245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyroglutamyl-peptidase I"
                     /protein_id="WP_005482616.1"
                     /translation="MKKVLITGFEPFGGDAINPALEAVKRLEETSLDGGIIVTCQVPV
                     TRFESISAVIDAIEAYQPDCVITVGQAAGRAAITPERVAINVDDFRIPDNGGNQPIDE
                     PIIEQGPDAYFSSLPIKRIAQTLHESGIPCQVSNSAGTFVCNHLFYGVQHYLRDKSIR
                     HGFVHIPLLPEQATDGNHPSMSLDMIVAGLKLVAQVVIDHESDVVVSGGQIC"
     gene            586122..586385
                     /locus_tag="VP_RS18030"
                     /old_locus_tag="VPA0588"
     CDS             586122..586385
                     /locus_tag="VP_RS18030"
                     /old_locus_tag="VPA0588"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012129104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005462091.1"
                     /translation="MKSNKSKAIALISVVVFALAIAALKFENTLGILPILVAIIAFFT
                     CVIHTSMYLSNVKRAEAVSHSDYSQNSNRHTLNQDISERDKKR"
     gene            586449..587435
                     /locus_tag="VP_RS18035"
                     /old_locus_tag="VPA0589"
     CDS             586449..587435
                     /locus_tag="VP_RS18035"
                     /old_locus_tag="VPA0589"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_005482750.1"
                     /translation="MSNRVPTNILTGFLGVGKTTTILNLLKNKPENENWAVLVNEFGE
                     IGIDGALMTDQGALIKEVPGGCMCCTAGVPMSVGITALLRQKPDRLLIEPTGLGHPKQ
                     VIATLTSEQYLPYVDLKATIALVDPRNLSDEKYTSNQNFVDQLDSADVVIGSKVDLCS
                     SHDIDVFNDWVTDQTPAKVFSKLIHNGELPIEVLDIERVHGSASSHIETHHHEHAHQE
                     PQFQLPPGEAFIRKENKGQGYFSCGWLFGAEYKFDFDKLFSMLSDLTAERVKAVVNTN
                     QGCYAFNVANRVVSVNEISLEGFESRLEVIDSQLLPWDELEQILLQLAGVEG"
     gene            587620..588912
                     /locus_tag="VP_RS18040"
                     /old_locus_tag="VPA0590"
     CDS             587620..588912
                     /locus_tag="VP_RS18040"
                     /old_locus_tag="VPA0590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009696017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_005482719.1"
                     /translation="MSFSSQGFAPEVVKALAECGYEKLTPIQQKAIPMARKGHDIFAT
                     AQTGTGKTAAFSLPMIQQLLDSGRTASRKTARALILAPTRELAEQIADNIKAYTKYTD
                     LSVVAVFGGRKMSSQVSALENGVDILVATPGRLEEHIEQGNVSVANLEFLVFDEADRI
                     LDMGFIHAVRKIMLDVDTDPQIMMFSATTSSQLNLLAKDILRKPKRIEVERANTTAHT
                     VAHVLYPVDQERKTELLSELIGRKNWQQVLVFVNYKETANDVVKELKLDGIKAVVCHG
                     DRAQSARRRALEEFKTGKVRVMVATDVAARGLDIEDLPHVVNYDMPFLAEDYVHRIGR
                     TGRAGKQGHAVSFVNRDEELTVVQVENLIQQRIRRIELAGYEPKQRESYIEKLNSKPA
                     FKNRQGRRNNPNQSATDQGSAERRLAMVKRLKARRGTN"
     gene            complement(589003..592023)
                     /locus_tag="VP_RS18045"
                     /old_locus_tag="VPA0591"
     CDS             complement(589003..592023)
                     /locus_tag="VP_RS18045"
                     /old_locus_tag="VPA0591"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482602.1"
                     /translation="MMRLYCVIATAMLMPLTAQATVYDVAKPSELNQICSTHSSFDIQ
                     RTDTTFFCHGKIVLPAGDSIISSSPENEVILEAHQGIVLEGNNRIGEPNKRISLRSLS
                     VELKVNNAQASSIEDYQNKHTVIYGDLLSAYPTKLHNVLIDGDIELTGSTLHIDGKYN
                     TIIGKILTHSTTDIFNTNVCGTIESKGHQLHLKTNNPFQQHFVVGDIVAHSSLLIDDM
                     AVYGTTESKGASAALNGSFYAKDTAIKYFQTLNFNQGVGSQVCGEIQQTPGSSHPHSV
                     TGKYSQFCGVGQSRCDYSSSICPSTATPPPECSMLPPSNDDLGLTVTPSDDMALMCGD
                     DLPQFTAITTNNDEVVSAPVMAMLSDPDLFTLEVVKGKPTSTENQFQSNDNGELVVRV
                     VPNDIDKIALDANYYLTFTMVGDSAKEQTVNFMFTPFMFEAYSNERRTLNEIRVIAGK
                     PENVHTRLLACASTGEPVVASNYNGKPKVVHPLIKPLGGSEGDFSYSAEFKDGLSEHG
                     LITNESGLFEVTLSDQFECKGFSECPDDGTVEVTGKFNVYSRPWTLAICENQNTLPSG
                     TSEQGDKFIAAGEHFSLTVKPVIWQKGGSISDPINSSAYCDALVTTNFMHDGAPAASV
                     VLSSEQHSPLNTANQTSTLLKSNYALTQGHQSAKNHRFVFNGLYWAEVGSLKVKANLD
                     STYFGMKVNEGYRHIGRFYPKYFKVQSQDWTYPKSQGFVYMNQPFEKVTYDVVALNAN
                     KEDVKNYAHFAPSLQQHFYLGELGGYQDRFVPPAPQKAEWKRIGDASIGQFVIEKAST
                     NATCHNSPCWEKDKTKGQYPDGPFNRGANSKSSKIGLVTTHVVDEVNFFDGGEILTKQ
                     PDIRFGRLNFKDVGGNQGMKIKVPLDVEVWQNGRFVTNFDDNSTTANGAYYTSTPIWS
                     NAPVNNAQLSGVAKMSVGRTNDIIASQIDAAREQIQFSLNLDHSGNQLPWLKYDWETS
                     TPEEENPPTIVTFGIHRGNDRIIYRGEPNMLGLN"
     gene            complement(592324..593163)
                     /locus_tag="VP_RS18050"
                     /old_locus_tag="VPA0592"
     CDS             complement(592324..593163)
                     /locus_tag="VP_RS18050"
                     /old_locus_tag="VPA0592"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005452218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginase family protein"
                     /protein_id="WP_005482584.1"
                     /translation="MLSFFKRYKFHHTPKQPHHYPFSFMTVCEHLAPMSKGAFELADQ
                     SLENASEWLYQQHDHATAANFGHFSHSKLESGEFQEALSLSLSRHSIPVLVSNCTEAI
                     LSMLPVVVSYRDEVGIVNIGHKMSLKPTLEPRMGSAFHFALSRYQNVRLFFAGVSEQD
                     TKQETLEYAEDQGCDWVTDREFTFRHRNHVKQQISNYLDHCDQIIVTIDLGSLSTKNN
                     LEGTPSLDIQMVLRTLRLCLVSGKVKAIQLVGDRDRLVYSRQTKAILEELYQMAPLLD
                     HAA"
     gene            complement(593170..593904)
                     /locus_tag="VP_RS18055"
                     /old_locus_tag="VPA0593"
     CDS             complement(593170..593904)
                     /locus_tag="VP_RS18055"
                     /old_locus_tag="VPA0593"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000005052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_005482748.1"
                     /translation="MTLNKANANQVNEKALQLLMQVAVSQFPVSAKTLSEQLNVPLSS
                     LYRHLKLLKEWNLIEESVHDKTFVVGPAALLLMHSYETAQHGLDMVETILARLVQQTG
                     EMAAYMVPSGYRALCVRQKESMQALRCSFVQGQSQPLLRGASSKVMLAFMPQSRCEKI
                     LRYFSQDHRLDEWEEELATIRKNGYAVSTSEIDPGVSGISAPVMKGSKLVGAVSVMAP
                     AHRVEKDKQRIILHVLQAARALPPER"
     gene            594239..595705
                     /locus_tag="VP_RS18060"
                     /old_locus_tag="VPA0594"
     CDS             594239..595705
                     /locus_tag="VP_RS18060"
                     /old_locus_tag="VPA0594"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_005482723.1"
                     /translation="MLNKMLLKKAAIFFLPLPLVFAEVLYLAHESVQSNLDHLLEKNI
                     QIADEILFQIETENRTALIHPERCEQLQQNLMFERDIDEMLIVKGDEIICSSKLGHLS
                     KPLSEYLTFRPNHALTFGQINGLDEPLLLVVTQGQQTYKAITIIDRDYFGATIGFNND
                     LRLKRSALFIHDDVVPAGASRKGTNPIAFNESKVFEYQALAEASDLFVEQKLISYIIY
                     SVPIIAMIYLCLYALNKFVDPQRNLLAELKKALKKNELTLYYQPQIDVESGRVFGYEA
                     LIRWEHQQKGFIAPDEFVPAAEQNGLVSLLTDYVLEKAADDFSKLTLTHPVHLGVNVP
                     PGYLVGSHVIRKLQLIHRKLSENNVSLGIEITERQLINGEARKHIAALRVHGIDVLID
                     DFGTGQTSLAFLQHMKIDYLKIDKCFVETIGIQSVSASVLNAIVHFADELQVKLIAEG
                     VETPAQAEHLKNMGVQYHQGYLYSKPLPYSLLAQQPIS"
     gene            complement(595719..597173)
                     /gene="modF"
                     /locus_tag="VP_RS18065"
                     /old_locus_tag="VPA0595"
     CDS             complement(595719..597173)
                     /gene="modF"
                     /locus_tag="VP_RS18065"
                     /old_locus_tag="VPA0595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter ATP-binding protein
                     ModF"
                     /protein_id="WP_005482730.1"
                     /translation="MAIRFSQLAVQGHTTTLSIDEWAIDNNDSWGIFSAEGDIGSLLG
                     DLLCGELKPTQGTLDLGELKVAQVSLSEQQRLLERELEKDDTDFLDRIDQGSTVYALI
                     FECCQDAATTERLLEELDLHHLKQSGFRVLSTGETRRVMLARALATQPDLVLLDNPFV
                     GLDVAHRASLATYLRSLSQSVQMLITFSRESDVPEWIDHVALFNAGSLDSTMNKESWD
                     NHPIIEQIKSQSQKQSEEMMGLIRRHQHSTHFDDPIFELKNGQVEYTEKRIFTDLNWR
                     IDKGQHWQVKGPNGCGKSTLLGLIFGDHPQCYSNDIHIFGKKRGSGESIWEIKQHIGM
                     VSSALHLQYRVNCSALEVILSGFYDSIGLYNQPSRKEIDVAKEWLDILHMRHYEKTSF
                     KQLEYGQQRLLLIARAIVKQPTLLILDEPYQGLDFLGRRLVKNTLELIARENLSQLLY
                     VSHYQEDSLESIKNDLEFVFDDEAQCYRAQIHHW"
     gene            597426..598976
                     /locus_tag="VP_RS18070"
                     /old_locus_tag="VPA0596"
     CDS             597426..598976
                     /locus_tag="VP_RS18070"
                     /old_locus_tag="VPA0596"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005595591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_005482737.1"
                     /translation="MSEKEYDYPASYSLVSITDPSSYIKYASAHFNEVAGFEEGELIG
                     KPHNVVRHPDMPKQAFKDLWSHLKAGKHWMGMVKNRRKNGGYYWVDAFASPIKYNGEI
                     VEYQSVRFKPERIYVKRAEKAYAKLRNDKKPLQLYLPRTRLWMRAAFFLFISNFLGLL
                     LLGMNQSPMVAFSAAALLSALSIYMLTRPIEKLAKQARQDFNNPLMEYIYCGKVNDLA
                     EIELAMKMRKQFANALLGRVGVSVKDSCEETKTNADSAADNSERVTENLSAQKIEIDS
                     VATAVNEMQASSSEISHNAQATADATLKAQNTMTDSRNVIDNVNHSVLDLVGELGEIS
                     KVVMRLNQQTDQIGTVIEVINGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTL
                     AKRTQESTTEIKSAIESIQHGSKSAVSALEKGNEMSTGTVTLLGTALESIQQLESLIQ
                     DVVERNQQIAVAIEEQVYVTDEINENIQSLNLKYSESYDLMTETNQMNSRVQNCTNEL
                     SDMIKKFA"
     gene            599034..599207
                     /locus_tag="VP_RS23660"
     CDS             599034..599207
                     /locus_tag="VP_RS23660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005462086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005482667.1"
                     /translation="MVTQNTNFSPEQPKHEKDEQQNVAIVEFNSSVLSRQSTDFLTHE
                     ELKMLEAVIGIAF"
     gene            complement(599320..600183)
                     /locus_tag="VP_RS18075"
                     /old_locus_tag="VPA0599"
     CDS             complement(599320..600183)
                     /locus_tag="VP_RS18075"
                     /old_locus_tag="VPA0599"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005482636.1"
                     /translation="MSKAIDLNLINTFIVVTECLSYTKAADKLGVTQPAISASIKRLE
                     RTTNTKLFTKRGRNIELTSTAQKWLPQLQQALSVIDSVITQPAPYNVYCSNIYPAQQS
                     KLENVFFHESTLSENHLFSLLYSNEADLLLGDIESREASIIVEDVCREPCVVICRNGH
                     PRINEHISTEMLSDEKHCVLASKWSFDTEFEKHLGLIVKSNNIDSIASNYLGILTHVA
                     QSDCIGVIPLSLAKKWGKTFNIKLFTSPFGACFIQYQIAYHQRKVNCKRHGAMRALIK
                     SKVLEGQQRII"
     gene            complement(600277..602646)
                     /locus_tag="VP_RS18080"
                     /old_locus_tag="VPA0600"
     CDS             complement(600277..602646)
                     /locus_tag="VP_RS18080"
                     /old_locus_tag="VPA0600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011626115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="WP_005482632.1"
                     /translation="MDILKTTVTITGALAPCLVAAGTVDRTKLPIPDIEPQTYTQLDV
                     RDVQRPEPTRRIAAPKDAPNVLVILLDDVGFSQSSLFGGAVDMPTLDALAKQGLIYNQ
                     FHTTGVSSATRTALLTGRNHHQNNMGSIAETSTAFPGNTSVRPNYIAALPKILKYNGY
                     STAMFGKNHEIPAWETGPAGNQTLWPSEVGFDKFYGFFGGETDQFQPVLIDGNTRIKT
                     PRKKNYHFTADMTDQTIKWLNLQHSYNADQPFFAYYAPGAAHAPHQAPREWIDKFKGK
                     FSMGWDKLRQESFERQKKLGIIPQDTVLPPMPDFVPRWDSLSSDEKRVFERQMEVYAG
                     FLAHTDHEIGRVIDTLKKNGEFDNTLIFYIVGDNGASAEGNRNGSFNSLAFYNLITED
                     PNRVLENIDKLGGPDSFPHYASGWAVAGDSPFTWTKGMSSDFGGTRNGMVVSWPAGID
                     NKGQPLRDQWSHVVDIAPTVLEAANLPVPKEVDGVEQIPMAGVSFTNTFKETKAQTRH
                     KPQYFELGGNRAIYHEGWLARVTHWALTEGSTKFRDLQDDKWELYDTTKDFSLANDLA
                     KSNPQKLEELKKLFDKEAEKNHVYPIDDRTMERVNAEIAGRPDALFGKKSLTLYEGAR
                     GIPENSFLNIKNKSFDIVADISTDNASKTNGVIIAQGGNFGGWTLYVKNGVPTFEYNW
                     LTYEYTKVSGSKLKEGKNEIKVAFRYDENGQGGKGNAAGRGKGGNVYLYVNDKLVEKK
                     LIPNTNSRLFSLDDGVGIGEDEGGAVSKDYQAPFEFNQKIEQVTTSIVQ"
     gene            complement(602654..603892)
                     /locus_tag="VP_RS18085"
                     /old_locus_tag="VPA0601"
     CDS             complement(602654..603892)
                     /locus_tag="VP_RS18085"
                     /old_locus_tag="VPA0601"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011622836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic sulfatase maturase"
                     /protein_id="WP_021451086.1"
                     /translation="MAGLHTTVKVVGSKCNYDCQYCFYLEKDLLLKSKKSMNIETLET
                     YIKNYISSQDTPIVEFAWHGGEPTLIGIDFFEKAVEFQKQYANEKLIKNTIQTNGSKL
                     NSDWCRFFRENNFLVGLSLDGPEWLQEKYRTKQGKSAFKESFSALKLLQKMNVEYNVL
                     ACVTKEYCKHAEAIYSFFRKNKVKHIQFSPLVESSPLETEQARGQHFGSNLIFSTDKH
                     HTDPQKYEPIAWSVDAKEYGRFLTDVFHLWVSQDVGKVFISNFEQALTQYLGNPSPNC
                     IHAKKCGSSYAVEANGDVYFCDHVAYPESKLGNVFETSLHEMSLNHELQFNKESRLSM
                     RCKQCQFLSLCNGGCPKHRYLSDTGEYENVLCDGYFYFFSSVQKYLQAMTTLLAHGYP
                     ASYVMQALDGPLILTPSNKR"
     gene            604028..604981
                     /locus_tag="VP_RS18090"
                     /old_locus_tag="VPA0602"
     CDS             604028..604981
                     /locus_tag="VP_RS18090"
                     /old_locus_tag="VPA0602"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005462114.1"
                     /translation="MIFNYNLLKPLALLLETKSITATANQMSTSASAVSRTLRSLREI
                     FQDELLTRKNGRMELTPKAISIRAKLNNIIHDIDELTEDMSFDPSTSDIKINIAMNSY
                     IAYWLAPEIIQYFSENAPNIELTIEDWNELTPDRINNHLVHFGIHYFPLNLNKNLVQR
                     KVGKDMSVMVCRKDHPINNESISLETIASYPLAIHLQKHWNERQDKLSRLLLSHGIDF
                     KVKLKTTHINVIINAVETTDLLFPCSIYIAEQLGEKFSYITSSDEVFLPLQEKEFGFI
                     YDKAYKNDPMIVWLHSTISKLMNDFLDVYNKKFDSRYEKSR"
     gene            complement(605006..605096)
                     /locus_tag="VP_RS18095"
                     /old_locus_tag="VPAt07"
     tRNA            complement(605006..605096)
                     /locus_tag="VP_RS18095"
                     /old_locus_tag="VPAt07"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(605060..605062),aa:Ser,seq:tga)
     gene            605426..606106
                     /locus_tag="VP_RS18100"
                     /old_locus_tag="VPA0603"
     CDS             605426..606106
                     /locus_tag="VP_RS18100"
                     /old_locus_tag="VPA0603"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017422777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC family dehydratase"
                     /protein_id="WP_005462115.1"
                     /translation="MKVTNLFKDKVDAISAHQSEFMNWMSPTLRDYWSDFLGKAQNSF
                     LFSNVRDHNQPAVNEEVAPQPAPIVLQPEAQKLYDELSGKIGEVIHTGDWVHVSQERI
                     NQFGAVTEDMQWIHTDPERASVESPFKTTIAHGFLTLALLPKLTDSVDADKPLFPTAK
                     LVVNLGLNQVRFPYPVKAGNNVRAVSTLTKVTPIKKGLEIEREIKVEIEGVRRPGAVV
                     VSVIQLHF"
     gene            complement(606160..606987)
                     /locus_tag="VP_RS18105"
                     /old_locus_tag="VPA0604"
     CDS             complement(606160..606987)
                     /locus_tag="VP_RS18105"
                     /old_locus_tag="VPA0604"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005452181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_005462121.1"
                     /translation="MLRFTVATLLAMAVSLPSAMAKEVNISGSTSVARVMDVLAEEYN
                     KTHPDNYIAVQGIGSSAGITMVNKGVVKLGMSSRYLTESEKGEDLNVFPIAYDGLAVV
                     VNRTNSVTNLSAQQLFDIYKGEIKNWKEVGGADQPIAVVTREASSGSRYSFESLLGLT
                     KIINDRLVSDISPNNLVVNSNSMVKTIVNHNTRAIGFISVGSVDLSVKAIQFNGIEPT
                     AANIANHKYKLARPFLVLYKVDSLDQAGKDFVAFLKSEAGQKTIADYGYIPVKNFNQ"
     gene            607244..607597
                     /locus_tag="VP_RS18110"
                     /old_locus_tag="VPA0605"
     CDS             607244..607597
                     /locus_tag="VP_RS18110"
                     /old_locus_tag="VPA0605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010643695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3024 domain-containing protein"
                     /protein_id="WP_005489200.1"
                     /translation="MSVSQMATSRLYKLVQILCSARNANLPVEQGKCLYEPIENGVEL
                     HHAHFLLDSQHSEYTSPIAKILFDSQTQLWRFYVPASRSEDIRWIPYKKLPHSHTLED
                     LLAELESDPQACFWE"
     gene            complement(607602..608405)
                     /locus_tag="VP_RS18115"
                     /old_locus_tag="VPA0606"
     CDS             complement(607602..608405)
                     /locus_tag="VP_RS18115"
                     /old_locus_tag="VPA0606"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_005489357.1"
                     /translation="MPNIEIIRFNHFTARKSERYTATHNGLYVVEEGALVVHQPNGEQ
                     FELQAGDFTLYNSSDLRSAEAIPGENGFKAVALVFDISLFCEFKKAHPGLHSEAEHRR
                     FYPFSPESNSEITQLKNTLLALASRNAPDYTQSHIAMALLSLMVEVQPDILSIIDDAS
                     SLTASQKAIKYIEKNIEKDITLEGLAEHMSMSIATLKRRLAAENLSFSQILKVKRINY
                     AATQLRVSQKSITEIAFESGFKSAAHFSTAFKSIYNITPKDFRNQVVRG"
     gene            complement(608477..610483)
                     /gene="rnb"
                     /locus_tag="VP_RS18120"
                     /old_locus_tag="VPA0607"
     CDS             complement(608477..610483)
                     /gene="rnb"
                     /locus_tag="VP_RS18120"
                     /old_locus_tag="VPA0607"
                     /EC_number="3.1.13.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exoribonuclease II"
                     /protein_id="WP_005489296.1"
                     /translation="MFQDNPLLAQLKQQIQENLPKKEGSIKATDKGFGFLEVDSKTSF
                     FIPPAYMKKCIHGDKVVAIIRTENEREVAEPQELIEQSLTRFIGRVKMFKGKLNVVPD
                     HPQLKKLSLKAKLKKGLKPDNFAEGDWVVAHLVRHPLKGDNTFFVEISEKITDADDKI
                     APWWVTLAQNDLPNSEPAGIENWELKDDADLERIEMTHVPFVTIDGESTKDMDDALYA
                     KKTESGDFELTIAIADPTAYITPEDEMDKVARERGYTIYLPGRNIPMLPRDLADNLCS
                     LIEGEIRPAICCTVTVSKDGVIGDDIKFFAANIKSHARLAYDHVSDWLENGNSDAWQP
                     SEEIATIVRDLYEFSLARAEWREKNAVVFPDRPDYRFELSEDNDVIAIHADMRRSANR
                     LVEESMITANICAGRTLREKFETGVFNTHAGLKPEKIEEVVQLVNPEGTLEFTAESIA
                     TLEGFAALRRWLAVQETSYLDNRIRKFQAYSEVGNQPLPHYAMGLDIYATWTSPIRKY
                     GDMINHRMLKAVILDKEPVQKPDDQVGEELALHRKHHKIAERNVSDWLYARTLADEPS
                     KQTCFTGEIFDINRAGARVRLLENGAAAFIPGALILDNKERIECNGDNGTISIDKEVV
                     YKLGDTLEIVLADVNQENRSLVAKPTQVFADQPAPQTEQTVSEE"
     gene            610863..612794
                     /locus_tag="VP_RS18125"
                     /old_locus_tag="VPA0608"
     CDS             610863..612794
                     /locus_tag="VP_RS18125"
                     /old_locus_tag="VPA0608"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017818708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_005483383.1"
                     /translation="MQDSVIQFSDLSLNDSILSALDGMGFVSPTPIQAAAIPHLLEGA
                     DALGKAQTGTGKTAAFSLPLLNKLDLDQRKPQAIVLAPTRELAIQVAAEMKNLGKNIK
                     GLKVLEIYGGASIVDQMRALKNGAHVVVGTPGRVQDLINRERLHLDEVNTFVLDEADE
                     MLNMGFVDDVTAIMEHAPESAQRVLFSATMPPMLKNIVERFLRDPVTVDVAGKNHTVD
                     KVQQQFWVVKGVEKDEAMSRLLETEETDASIVFVRTRQDTERLADWLSARGFKAAALH
                     GDIPQSLRERTVDHIKQGVIDILVATDVVARGLDVPRITHVFNYDIPFDVESYIHRIG
                     RTGRAGRKGKAILLVRTNQIRMLRTIERVTKSSMEEIQLPLRDQVAEARLNKLAAELE
                     AEKEHKALDKFAELVEKLQTSLEIDPAMLAAMLLKRQQGKRPLFYIGEDPMVEAIERD
                     KQRRKERREGGREGGRSFNNQDWDTYQLQVGREQGVQVKDIVGALANELGLGKGSIGA
                     IKLAQGHTFVQLPKAMTSEAASKLSKLRIRQQDVGAVVCDFDDFRESRGGRRDGGRRD
                     GGRREGGFRGNREGGNRGGERREGGRREGGFRGNRDGNREGNREGGERRFDRNRGGDH
                     RGNYRGERGHGRGRRTQDA"
     gene            complement(612869..614407)
                     /locus_tag="VP_RS18130"
                     /old_locus_tag="VPA0609"
     CDS             complement(612869..614407)
                     /locus_tag="VP_RS18130"
                     /old_locus_tag="VPA0609"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017190904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional diguanylate
                     cyclase/phosphodiesterase"
                     /protein_id="WP_021821499.1"
                     /translation="MTKNICSKTEVPGWTWLLMLISCFIFAYAAFLHAIMKKPVASLL
                     ETGVSLLLFGGSIFVVLVIKWSNDSILELHSVAEREKRNAVHDSLTGLPNRKYCFELI
                     DDRIQSGDPFSVILFDVVNFKQVNDAMGHFCGDQLLIQIGQRLQDKLKGSDKIFRVGG
                     DEFVILTSSACEKTGTELIESLDCALSARFHLDEFQVSSRVVFGISTYPYDAISNDLL
                     IKHADIAMYHAKRNGNLFAFYHDDMNVGAKYQLEISSRIQCALEKEEFQLYYQPLIDA
                     NTNLAVGFEAVIRWHDENGKTISPNDFIPIAERSNQVHNITMWVLGQVEKDLKTFIEK
                     GIKLPVHVNLSAKDLSSNLLFHRLEKLLENNPQFADLISLEITETMAIDRVVELNPLI
                     HQIKGLGIKISLDDFGTGYSSLSLLRDLPVDQIKIDRSFLCTANRTEGSRSIVENTIA
                     LAHGLGYSVVAEGVQDMDTLYFLRSRGCDIIQGYLFCPALPLNEVINWVNEHDDKQSH
                     TRRA"
     gene            614768..615961
                     /locus_tag="VP_RS18135"
                     /old_locus_tag="VPA0611"
     CDS             614768..615961
                     /locus_tag="VP_RS18135"
                     /old_locus_tag="VPA0611"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005440661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetate/propionate family kinase"
                     /protein_id="WP_005483382.1"
                     /translation="MSNSFVLVINSGSSSLKFAVIDSVSGDAVLSGLGECFGLSDARM
                     SWKFNGEKKEISIEGDDSHHKIAIGKLVGLTEELGLAQDIVAVGHRIVHGGEKFTKTV
                     RITEEVTQEIEKLADLAPLHNPAGAIGIRAAVEAFPSLPQFAVFDTAFHQTMPQRAFT
                     GAIAKELYTDFGIRRYGFHGTSHYFVSREAAKMINKPIEESSFISVHLGNGASVCAIN
                     NGESVDTSMGFTPLSGLMMGTRCGDLDPGIIEYLLKKGWSQEKVFNSLNKASGFLGVS
                     GLTSDARGILEAMEEGHEGAALAFQVFTYRVSKYIASYLAALDSFDGIIFTGGIGENS
                     MPIRREILKNLKLLGFVEDVKGNEDARFGNAGVIATSELLGAKALVIPTNEEWVIAQQ
                     SVELL"
     gene            616240..617553
                     /locus_tag="VP_RS18140"
                     /old_locus_tag="VPA0612"
     CDS             616240..617553
                     /locus_tag="VP_RS18140"
                     /old_locus_tag="VPA0612"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014205168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain S-box protein"
                     /protein_id="WP_005483370.1"
                     /translation="MFFNKSLQQENQRLKQELYSLQQIQQSLDEEMLRLTLDAKGNVT
                     SANQKFLQQLSLSDKDILAKHISDLVPSNVRNTDHFYRMKQSVQAKAFWNGAFQITKG
                     DGEEAWLRVVIQPVRNASDQVESFFVFASELTRTITTSREYEDMLNALSRSMAVIEFT
                     LDGTVLKANDNFLSTMGYKHEQIVGKHHRIFCLPEEANSSAYHDFWKRLASGQFVTDR
                     FKRVDQHGSVVWLEASYNPIHNDRGELYKVVKFATNITQQVLQEQSMAQAAQLANEVS
                     QETGTQTVQGRQVIGSTLEKMQTLSEQMQQANAAIEDLKAHSSKISELVNSISGIADQ
                     TNLLALNAAIEAARAGDHGRGFAVVADEVRQLAMRTNTTTDEIVSMVTENLERTNNAV
                     ALISQCQKEALDTLELSEKAGNVMNDIQDGASRVVEAVAQFNRTL"
     gene            617839..618717
                     /locus_tag="VP_RS18145"
                     /old_locus_tag="VPA0613"
     CDS             617839..618717
                     /locus_tag="VP_RS18145"
                     /old_locus_tag="VPA0613"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012129122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_005483368.1"
                     /translation="MFNSERKATVILVATTMIAALGWIFSKETIQGLPPFGFIGLRFT
                     IASLCLLPLCFRPLKAARLKDVLAASGVGLLLGGAVMTWIYAISISDTLGEGAFIMSL
                     SMLFVPIVAWVMFQQRPQRIFWISLPIAVIGLACLSLAGGWKQSASQLWFLGAALILA
                     LHFNVNSKYSQKLPVLLLTCVQLFSAGCLGLLVSFLMESRPEQVDSSIWWWFALSTLL
                     ATSLRYVMQTMGQKFVQAGNAALIMILEPVWTVVLSILWYGEVLTANKLVGCLLILFS
                     LVIYRTGGRFRFPKRA"
     gene            618743..619294
                     /locus_tag="VP_RS18150"
                     /old_locus_tag="VPA0614"
     CDS             618743..619294
                     /locus_tag="VP_RS18150"
                     /old_locus_tag="VPA0614"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_005483385.1"
                     /translation="MANTEHQETLDFLDKLSVCLYRAGISVFAIALLGLAALESQWLD
                     GMDGRYRAVFAVFAISGAMSASNIHVYSKSVRTIISWSGWIGVILMVCDPELNREWLA
                     LGFIFVTFSGIALKESFCFKVLGLKLVPTLLVVTTFALWFEQSTIVAISALLAGLIMA
                     YLSIAKWRMPLHFDIGIKANYEV"
     gene            complement(619330..620232)
                     /locus_tag="VP_RS18155"
                     /old_locus_tag="VPA0615"
     CDS             complement(619330..620232)
                     /locus_tag="VP_RS18155"
                     /old_locus_tag="VPA0615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005455732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylglutaryl-CoA lyase"
                     /protein_id="WP_005483384.1"
                     /translation="MTLPTNVTIVEVGPRDGLQNESPVSTRTKIRLIDLLSDTGLSHI
                     EAGSFVSPKWVPQMADSKEVMQNITRRASVTYSALTPNLQGLEQALDAGANQVAIFTS
                     ASEGFCQHNINCSIAKSLKRFEPLMVQADKYHVPVRGYLSCVVDCPYDGATSPTQVAN
                     ISQALIELGCYEVSLGDTIGTGTPNRIKEMLESVLARIPNQRLAVHFHDTWGQALANI
                     YQALSMGINTVDSSVAGLGGCPYAHGASGNVATEDVLYLCQGLGIETGVDLELLAKAG
                     WMISDELQRQPTSKVSQALRHRME"
     gene            complement(620229..621074)
                     /locus_tag="VP_RS18160"
                     /old_locus_tag="VPA0616"
     CDS             complement(620229..621074)
                     /locus_tag="VP_RS18160"
                     /old_locus_tag="VPA0616"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009704661.1"
                     /note="catalyzes the hydration of
                     gamma-carboxygeranoyl-CoA to
                     3-hydroxy-gamma-carboxygeranoyl-CoA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/isomerase family protein"
                     /protein_id="WP_005483374.1"
                     /translation="MQERQPSIVPNAQRHNDVLWQVDEFGVATLTLNRTKKHNAFDAC
                     MIDLIIHRLDYLALRTDVRCLVLRSNGKHFSSGADLAWMQSMANSTRKENLVDAQSLA
                     RLMETLDAFPQPTIAVVQGSAFGGALGLICCSDIAIASHSAQFCLSEVKLGLVPATIA
                     PYVMRAMGNRQARRYILSGEVIPAVKAQQFGIVHEVKEDDELESCVSEVVASLLLNSP
                     DAMRKAKALCEQCHQNPIDSQLIRYTSQLIADIRVSPQGQDGLQAFLEKRPPSWVLQP
                     DAEEE"
     gene            complement(621112..622716)
                     /locus_tag="VP_RS18165"
                     /old_locus_tag="VPA0617"
     CDS             complement(621112..622716)
                     /locus_tag="VP_RS18165"
                     /old_locus_tag="VPA0617"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014258159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="propionyl-CoA carboxylase subunit beta"
                     /protein_id="WP_005455777.1"
                     /translation="MAIIKSKTKPTDELFLSNQAAMEMLVEKLQKDIATIKLGGGERA
                     IAHQRQKGKLPVRERISHLLDDGSNFLEIGQFAAWQVYDESIPCAGVVAGIGMIEGVQ
                     CMVIANDPSVKGGTYYPLTVKKHLRAQEIAQRCQLPCVYLVDSGGANLPHQSDVFPDK
                     DHFGRIFFNQARMSAKGIPQIAVVMGLCTAGGAYVPAMADVSIMVKEQGTIFLAGPPL
                     VKAATGEVVTGEELGGADVHCRKSGVADYYAENDEHALDLAREAIANANRPKPPKSDS
                     AILPPRYDAEEMYGIVNANLRLSFDVREIIARIVDDSDFDEFKALYGRTLVCGFARIH
                     GQLIGIVANNGILFSDSSQKGAHFIELCAKRKTPLLFLQNITGFMVGKKVEEEGIAKH
                     GAKLVMAVACADVPKFTVIIGGSYGAGNYGMCGRAYDPTMMWMWPNARISVMGGEQAA
                     GVLTQVRKEINQRRGEEWSEQEEHTFKESIIDLYETQGHPYFASARLWDDGIIDPKET
                     RNVLAQALMAALNAPIPDSEFGIFRM"
     gene            complement(622751..623920)
                     /locus_tag="VP_RS18170"
                     /old_locus_tag="VPA0618"
     CDS             complement(622751..623920)
                     /locus_tag="VP_RS18170"
                     /old_locus_tag="VPA0618"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011221176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isovaleryl-CoA dehydrogenase"
                     /protein_id="WP_005483372.1"
                     /translation="MKTSYIPLNFGLGETIDMLRDHVNAFASEHIAPIAADIDHYNQF
                     PSHLWPLLGEMGLLGVTVSEEYGGAEMGYLAHVVAMEEISRASASVALSYGAHSNLCV
                     NQIFRNGTPTQREKYLPKLVDGSHIGALAMSEVNSGSDVVSMQLKAEDKGDHFLLNGT
                     KMWITNGPDADVVVVYAKTDADAGSRGITAFIVERSFTGFSDAQKLDKLGMRGSNTSE
                     LVFNNCKVPKENILGALNCGVEVLMSGLDYERVVLAAGPLGIMQACMDIVVPYVHERK
                     QFGKSIGEFQLVQGKLADMYSRMSAAKAYVYTVATACDRGECTRKDAAGVILYSAELA
                     TQIALDAIQLLGGNGYINEYATGRLLRDAKLYEIGAGTSEIRRMLIGRELFEESR"
     gene            complement(623999..624373)
                     /locus_tag="VP_RS18175"
                     /old_locus_tag="VPA0619"
     CDS             complement(623999..624373)
                     /locus_tag="VP_RS18175"
                     /old_locus_tag="VPA0619"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005455792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_005455792.1"
                     /translation="MEKYKISDLAKEFDITTRSIRFYEDVGLIEPERKGNMRVYQRRD
                     KIRLKLILRGKRLGFSLAEIRELFELYDMQQTDEQLLKMLNIIEEKQAVLQQQLNDIG
                     VVMGELNAAKERCLQTLKNNEK"
     gene            624632..625858
                     /locus_tag="VP_RS18180"
                     /old_locus_tag="VPA0620"
     CDS             624632..625858
                     /locus_tag="VP_RS18180"
                     /old_locus_tag="VPA0620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010643728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiolase family protein"
                     /protein_id="WP_005483348.1"
                     /translation="MGNDIWIVSAKRTPIGCFQGLLQPYSAPQLGAFAIQAAMKSLGE
                     NVLSETVIDEVLMGCVLPAGCGQAPARQAALGAGLPPSTGCTTINKVCGSGMKSIMLA
                     HDLIKAGTIRTAVAGGMESMTNAPYLLKEARNGMRLGHHSTYDHMFLDGLQDAYEGHL
                     MGVYAQQIANRLKFSREKMDEWATMSAKRALEAQERGLFDDEIAPIDIRTKTATTHLD
                     YDEHPRSIDLEKIPQLKPAFDKNGSVTAANSSAISDGAAALILMDEETARHQNLTPLA
                     IIKSHATHARKPDEFTLAPVYAIEQLLSQLDWSIDEIDLWEINEAFAVVTQIAVAELG
                     LDSSKVNIKGGACALGHPIGASGARILVTLIHSLRQLQALGIDGDASNKKVMRGVASL
                     CIGGGEATAIGIEIPL"
     gene            625888..627381
                     /locus_tag="VP_RS18185"
                     /old_locus_tag="VPA0621"
     CDS             625888..627381
                     /locus_tag="VP_RS18185"
                     /old_locus_tag="VPA0621"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005451594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA-acylating methylmalonate-semialdehyde
                     dehydrogenase"
                     /protein_id="WP_005483387.1"
                     /translation="MTRLVPLFIDGEFRESQTSDWVEVTNPATNDVIAYVPCSTNAEM
                     KAAIESAQTAFQSWKEVAVSERARLMLRYQHLLKAHHDEIATLLSHETGKIFADAKGD
                     VWRGIEVVEQAANIASNLMGETVENVATDIDSHSIIQPLGVCCGITPFNFPAMIPLWM
                     FPIAIASGNTFVLKPSEQVPLTSIRLAELFEEAGAPKGVLQIVHGRKDQVDFLLAHPD
                     IRAVSFVGSVPVAQYIYTTGTQYFKRVQAFAGAKNHMVVMPDANKEHVINNLVGSSVG
                     AAGQRCMAISVAVFVGESKVWIADLKQEMAKIHPGAWDDEDAAYGPLISEQAKQRVLG
                     LIELGKQQGAVCELDGSQCEVEGFPDGNWIGPTLFSGVTPNMSIYTQEIFGPVLVCIE
                     VETLQEAIELVNRNPYGNGTSIFTANGAAARKYQHEIQVGQVGINVPIPVPLPFFSFT
                     GWRGSFYGDLHAYGKQAVRFYTETKTVTARWFDDDIPTGPNLTIQLR"
     gene            627402..628556
                     /locus_tag="VP_RS18190"
                     /old_locus_tag="VPA0622"
     CDS             627402..628556
                     /locus_tag="VP_RS18190"
                     /old_locus_tag="VPA0622"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006230192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase family protein"
                     /protein_id="WP_005483354.1"
                     /translation="MDFELNEDQRAFADTAQQFSLERLAPMAAEWDEKQIFPKDVLRE
                     AGELGFLSLYTPEAHGGLGLSRLDASIVFEQLSMGCTSTTAFMTIHNMVSWMVASFAT
                     EDVGAKYCPKLVTGEWLGSYCLTEPNAGSDAASLSTTAHKKGDTYVLNGGKAFISGAG
                     ETDVLVVMARTGEAGAKGVSAFVVPAQADGISYGRKEPKMGWNSQPTRAVTFENVVIP
                     ASHLLGEEGQGFIFAMKGLDGGRINIATCSVGTAQQALNQATQYMQERKQFGKSLAQF
                     QALQFKLADMATELVAARQLVRYAASKLDRGDSDATTYCAMAKRFATDIGFQICDQAL
                     QIYGGYGYIKEYPMERYFRDVRVHQILEGTNEIMRLIIARRLLSETSALL"
     gene            628598..629383
                     /locus_tag="VP_RS18195"
                     /old_locus_tag="VPA0623"
     CDS             628598..629383
                     /locus_tag="VP_RS18195"
                     /old_locus_tag="VPA0623"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_005483360.1"
                     /translation="MPSMPKAIEHTIQNHVAMITMNNPPANTWTADSLHALKALVCTL
                     NQNKDVYALVITGSGDKFFSAGADLNLFADGDKARALEMARCFGEAFETLSEFRGVSI
                     AAINGYAMGGGLEVALACDIRVVEEQAILALPEAKVGLLPCAGGTQNLTALVGEGWAK
                     RMILCGEQISASLAKELGLAEELVPKGEALSKAIAMADSVANQSPSSVAACKILIQNM
                     RSAPLKHGLMKERELFLDLFDTEDQTEGVRAFLEKRPPNWKNQ"
     gene            629392..630528
                     /locus_tag="VP_RS18200"
                     /old_locus_tag="VPA0624"
     CDS             629392..630528
                     /locus_tag="VP_RS18200"
                     /old_locus_tag="VPA0624"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/isomerase family protein"
                     /protein_id="WP_005483393.1"
                     /translation="MVGTVTITEMDCVDGVHRIGVATLDNTPSLNALTFDMLLQLHDQ
                     LIKWQHDPHVVCVVLSGAGEKAFCAGGDVRAMYHVMHNESKEATVEFCTKYFALEYEC
                     DYLIHTYNKPIIGWGEGIVMGGGMGLFMGTSHKVVTPISRLAMPEINIGLYPDVGGTW
                     FLSQIDPEVGLFLGLTGALVNSSDAVTTGLADWLLLEEQYPTLLKELQKVPWGTSGAK
                     ELVSALLALLEEQIIDSKPTTQICPHLEQIKEACKGVDLNLIAQRIMAMEDSSPWIAG
                     AKETFSSGSPITAHICFRQVKEYHRLPLADCFRLELSLSVRCALLGEFEEGVRARLID
                     RDGEPNWMFKTVSEVDEDVIDLLFTSLWADAEHPLAKLGEQPLG"
     gene            630555..631457
                     /gene="mmsB"
                     /locus_tag="VP_RS18205"
                     /old_locus_tag="VPA0625"
     CDS             630555..631457
                     /gene="mmsB"
                     /locus_tag="VP_RS18205"
                     /old_locus_tag="VPA0625"
                     /EC_number="1.1.1.31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006960838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyisobutyrate dehydrogenase"
                     /protein_id="WP_005455759.1"
                     /translation="MSTIAFIGLGRMGNPMAQNLLASGFNVQIFDVDVEAAKQLVPFG
                     AVVASELEEVVDGASTVITMLPAGSHVRSVYLGDLHGGVGVMNLVAPNTLLIDCSTID
                     PDSARLVANEAANKRLLFVDAPVSGGVAGAKAATLTFIVGGSDEAFSKANAILQYMGK
                     NVFHAGKAGDGQMAKICNNLMLGILMSGTCEALNLGIDHGLDPKVLSNIMLQSSGRNW
                     ALELYNPCPGVMDSAPASHDYQPGFMSKLMLKDLGLGLDAALQTHSSVPMGALARNLY
                     AFHNSSGHGELDFSSLFEFYKNNK"
     gene            631533..632291
                     /locus_tag="VP_RS18210"
                     /old_locus_tag="VPA0626"
     CDS             631533..632291
                     /locus_tag="VP_RS18210"
                     /old_locus_tag="VPA0626"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006230188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_005483376.1"
                     /translation="MDIKNSVIAITGAGQGLGQMMAITLAQSGADLALLDVNETGLRE
                     TQSQCQMLSAKAFTYPVDVTNESDVEATFDAILQDFGQLNGLINNAGVLRDGLLVKAK
                     DGVINKMSLEQFNLVMNVNVTGTFLCGREAAVKMIESGSQGVIINISSVARAGNIGQT
                     NYSASKAAVATMATTWARELARYGIRAAAIAPGVVHTAMADQMKPEAIERLEKMIPVG
                     RMGEASEIAHAVKYILESDYFTGRVLEVDGGIRM"
     gene            632931..633812
                     /gene="cyoA"
                     /locus_tag="VP_RS18215"
                     /old_locus_tag="VPA0627"
     CDS             632931..633812
                     /gene="cyoA"
                     /locus_tag="VP_RS18215"
                     /old_locus_tag="VPA0627"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol oxidase subunit II"
                     /protein_id="WP_005455699.1"
                     /translation="MEASRYKRILSRGSLACVILLLSGCNSALLDPKGAIGVQEKELI
                     ITALLLMLIVVIPVILMTIYFAYRYRASNTDEEYAPEWSHSTKIEVVVWTIPIIIIAI
                     LATITWRSTHELEPSKPLVSDVKPMTIEVVSLDWKWLFIYPEENIATVNYVAFPKDVP
                     VTFKLTSDNIMNAFFIPRLGTQIYAMPGMVTKLNLIANHEGDYKGFASNYSGEGFSQM
                     KFTASAMPDRAAFLNWVQKVKASPDRIEDWEQYSSLAEPSVAAPVTLFSSVPPFLFSN
                     VVTQHPGSMNCLPENQG"
     gene            633817..635853
                     /gene="cyoB"
                     /locus_tag="VP_RS18220"
                     /old_locus_tag="VPA0628"
     CDS             633817..635853
                     /gene="cyoB"
                     /locus_tag="VP_RS18220"
                     /old_locus_tag="VPA0628"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020197250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase subunit I"
                     /protein_id="WP_005483356.1"
                     /translation="MFGRLTLDSIPYHEPIIIITLAIVALVGLAVVVAVTKAGKWQYL
                     WNEWFTSVDHKKLGFMYIAVAMLMLVRGFADAVMMRSQQLLSSAGEAGYLPPHHYDQI
                     FTAHGVIMIFFVAMPLVIGLMNIIVPLQIGARDVAFPYLNNLSFWLFVVGVILTNMSL
                     GLGEFGRTGWLAYPPLSGIEASPGVGVDYWIWALQISGVGTTLTGVNFFATILRMRTP
                     SMPMMKMPVFTWASLCANILIIISFPILTVTIALLTLDRYLGMHFFTNDLGGNVMMYV
                     NLIWAWGHPEVYILVLPIFGVFSEVTATFSRKKLFGYTSLVWATIVITILAFVVWLHH
                     FFTMGSGANVNAFFGIATMIISIPTGVKIFNWLFTMYKGRIRFTTPMMWTVGFLITFT
                     VGGMTGVLMAVPGADFVLHNSVFLIAHFHNVIIGGVVFGCFAAITYWFPKATGFTMNE
                     TWGKRAFYLWIVGFLMAFLPLYALGFMGMTRRLSQDINPEYFPLLAVAAAGTVVIALG
                     VLSQFIQIYVSIRDREQNRDLTGDPWGGRTLEWATSSPPPFYNFAHLPKGDVLDAFWY
                     QKQSGEFDPMKEVEYERIHMPKNTATGIYVSAWALVFGFAMIWYIWWLAAASLVGIVV
                     TCIQHSYNDDVDYYVEVEEIKAIEAARRAQLEEAKKGTVKDNENSDDLEVTYAN"
     gene            635843..636445
                     /gene="cyoC"
                     /locus_tag="VP_RS18225"
                     /old_locus_tag="VPA0629"
     CDS             635843..636445
                     /gene="cyoC"
                     /locus_tag="VP_RS18225"
                     /old_locus_tag="VPA0629"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006961884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase subunit III"
                     /protein_id="WP_005483335.1"
                     /translation="MQTNVAAHHNHDHHHDTNGNKLFGFWVYLMSDCVLFATLFATYA
                     VLSSNSIAGPTGKEIFELPFVFVETMLLLFSSITFGFGIIAMKRNDVAGLKRWMLVTF
                     ALGLGFICMEVYEFHHLIQEGYGPQTSAFLSAFFTLVGTHGLHVTFGLIWLAVAYHQL
                     STKGLNDNMAMRFNCLSLFWHFLDIVWICVFTIVYLMGVM"
     gene            636445..636756
                     /gene="cyoD"
                     /locus_tag="VP_RS18230"
                     /old_locus_tag="VPA0630"
     CDS             636445..636756
                     /gene="cyoD"
                     /locus_tag="VP_RS18230"
                     /old_locus_tag="VPA0630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010439794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase subunit IV"
                     /protein_id="WP_005483339.1"
                     /translation="MGQHVETSSSDYVKGFVASLILTVIPFYFVWAQTLPASATYVVM
                     FTCALVQIFVHFKYFLHMEAKTSDGRWNLVSLMFTAIVVLILIAGSIWIIYNMNVNMK
                     L"
     gene            636765..637631
                     /gene="cyoE"
                     /locus_tag="VP_RS18235"
                     /old_locus_tag="VPA0631"
     CDS             636765..637631
                     /gene="cyoE"
                     /locus_tag="VP_RS18235"
                     /old_locus_tag="VPA0631"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="WP_005483386.1"
                     /translation="MLKSYLSITKPGIIFGNLISVAAGFFLAAKSEPASLMLFLTTLA
                     GVGLVIASGCVVNNIFDRDIDQKMARTQNRETVKGNINIDVAFVYALAMLLLGTALLF
                     QLVNPLSAVVVLLGYVYYVFFYTMWYKRNSVYGTLVGSISGAVPPLVGYLAVTNFISL
                     EAILLFTMFCLWQMPHSYAIAMFRMQDYREAGIPVLPVKDGIHKAHRHMKAYVVAFGA
                     VSLGLFLLGEAGYEYLAVAAVVCLMWTKVTFRSIDESNYVVWSKSVFKVSLLVVMGIS
                     GVLGVELIPLAL"
     gene            638095..638610
                     /locus_tag="VP_RS18240"
                     /old_locus_tag="VPA0632"
     CDS             638095..638610
                     /locus_tag="VP_RS18240"
                     /old_locus_tag="VPA0632"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_024699312.1"
                     /translation="MKFIKLLALVLSFQCFAQSQELHLSQNVVLDVPLSKTILHTGNI
                     LIFKFGDSHISHEVLSPKEFFSPIDLTGVEKEFVRSLFKLTENSSFPQWLNAASNELS
                     ETLGITKDNKVIEVKGGLEILGFYDSESQSGQLFILDTSLIHHFTFLGSNELFKNLYQ
                     SIREKNNEFNN"
     gene            639189..640292
                     /locus_tag="VP_RS18245"
                     /old_locus_tag="VPA0634"
     CDS             639189..640292
                     /locus_tag="VP_RS18245"
                     /old_locus_tag="VPA0634"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavin oxidoreductase"
                     /protein_id="WP_005483378.1"
                     /translation="MSILFSEARIGSMTLKNRFVRSATWENMATEDGHMTAKLYDIYE
                     ELAKGEVGLIVTGYANIVEEEKPNAGMMGIYNDSFIEEYKKLTELVHQYDSKIVMQIA
                     YGGTKTTYNVGERVIFAPSDVPERGTNTQGKAMTKDEIDYIVKAFALASKRAQDAGFD
                     GVEIHAAHTYLINQFLSPYYNRREDEYGGSLENRMRLLLEIYSETRTLVGDAFPILVK
                     LTATEFFDGGLTFDETRIVCKKLEEVGVDAIIVSGNIHGKANELVGERFDGYTLQEEG
                     YFHEYGQVISQDIHIPVITVGGLRDIDAIENIADNTNIQFFAVSRPLLAEPQLIKRWK
                     EGNRAPVDCERCSKCRTKRGNFCVVYKNRNRRS"
     gene            640793..642178
                     /locus_tag="VP_RS18250"
                     /old_locus_tag="VPA0635"
     CDS             640793..642178
                     /locus_tag="VP_RS18250"
                     /old_locus_tag="VPA0635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005455770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding oxidoreductase"
                     /protein_id="WP_005483346.1"
                     /translation="MKSLENTTIEHFKSHFQGDVVLPTDSNYDEVRQIWNGMIDRKPS
                     LIARCKSADDVVMAVNFARDNGQLLSVRGGGHNIAGNAVCDNGVMIDLSLLTQVRVDE
                     NAKRAFVEPGCTLGDLDEASQKHGLATPVGINSTTGIAGLTLGGGFGWLSRKYGMTID
                     NLVSANVVTADGRQLLASETENEDLFWALRGGGGNFGIVTQFEFQLHPVGPEVLSGLI
                     VFPFDQAKSVITQFAKFTESAPEELSVWMVSRKAPPLPFLPESVHGKEVVVLAICYAG
                     DPSEGEKLIAPLRDFGDAHGEHVGVQPFAAWQQAFDPLLTPGARNYWKSHNFNSLSEG
                     VIDAAIEYAGKLPSPQCEIFIASLGCAASRPDPESMAYSSRDANYVLNVHGRWDSAED
                     DQACIAWARDFFTKTKPYASGGAYINFLTQDEAERTESAYGPTFARLQEVKKKFDPNN
                     LFRMNQNIKPE"
     gene            642512..643255
                     /gene="artP"
                     /locus_tag="VP_RS18255"
                     /old_locus_tag="VPA0636"
     CDS             642512..643255
                     /gene="artP"
                     /locus_tag="VP_RS18255"
                     /old_locus_tag="VPA0636"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017091671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine ABC transporter ATP-binding protein
                     ArtP"
                     /protein_id="WP_020480174.1"
                     /translation="MRYCSMSIQVSGINKSYGDTQVLHDVSFNCENGETLVLLGPSGA
                     GKSSLLRVLNLLEGADNGKLNIANDVFDFSAEIKEKQGLALRRKVGMVFQQYNLWPHM
                     TVMENLIEAPIKVSGMDKEEAKTQAMQILSTLHLADKADAWPMQLSGGQQQRVAIARA
                     LMMKPEVLLFDEPTAALDPEITNQVVKIIKDLSETGITQVVVTHEVDFAKKIASHVLY
                     LEKGHIVEHGTHDAFANPQTTQFADYLKH"
     gene            643344..644087
                     /locus_tag="VP_RS18260"
                     /old_locus_tag="VPA0637"
     CDS             643344..644087
                     /locus_tag="VP_RS18260"
                     /old_locus_tag="VPA0637"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020197270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_005483358.1"
                     /translation="MKKILLTSLIGLISANVAANAVAQDEIKFAMEATYAPFEYMDEN
                     NQIQGFDVDLANALCKEMDAKCSFHNQSFDSLIPALKFKRYDAAISAMDITEARLEQV
                     NFSNAYYDNSAAFVSIKDKVADQNALEGKRVGVQNGSTHQSYLIEQMPGVTSVPYSSY
                     QDAFIDMKNGRIDSVFGDTAVVAEWFKKEDNLAYVGERVTNPKYFGNGFGIAVNKGND
                     ELVNKLNTALEAVKANGEYDAIYNKYFGK"
     gene            644089..644778
                     /gene="artQ"
                     /locus_tag="VP_RS18265"
                     /old_locus_tag="VPA0638"
     CDS             644089..644778
                     /gene="artQ"
                     /locus_tag="VP_RS18265"
                     /old_locus_tag="VPA0638"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001964442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine ABC transporter permease ArtQ"
                     /protein_id="WP_005483395.1"
                     /translation="MAFTGYSLSLVQASWMTVQLAFTSLLVGLILAVVFASGEMARRA
                     FVKWPTTAFVTVVRGLPEILVVLFIYFGSTQVLFLITGDFIEVSPFLSGVVALSLIFA
                     SYASQTLRGALKAVGRGQREAASALGISQFHAFVRIVLPQAVRHALPGLTNQWLVLLK
                     DTALVSLIGVTDLLKQAQLTSAATHEAFTWYATAAAIYLVITLITQRAVKVIDKKFSI
                     QGMSMGQEANA"
     gene            644775..645443
                     /gene="artM"
                     /locus_tag="VP_RS18270"
                     /old_locus_tag="VPA0639"
     CDS             644775..645443
                     /gene="artM"
                     /locus_tag="VP_RS18270"
                     /old_locus_tag="VPA0639"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005455704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine ABC transporter permease ArtM"
                     /protein_id="WP_005455704.1"
                     /translation="MNEQHVWQMLDGLGTSLQLTAASLAVGCILALLMTLTLILRTPG
                     LHWVSRGIITLFTGTPLLVQIFLVYYGPGQFDAVRESVLWTWLSQPWFCAMLALALNT
                     AAYSTQLFKGAFNAIPSGQWQACRALGMNKSATLRVLLPYAIRRAVPAYSNEVILVFK
                     GTSLASTITIMDLMGYAQRINAQTYDTLMVFGVAGAFYLSVNGILTLIFRQVEKKALA
                     FETV"
     gene            645613..646185
                     /locus_tag="VP_RS18275"
                     /old_locus_tag="VPA0640"
     CDS             645613..646185
                     /locus_tag="VP_RS18275"
                     /old_locus_tag="VPA0640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005483331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase subunit beta"
                     /protein_id="WP_005483331.1"
                     /translation="MERRHFLALWTLMFAPFLKAESSMRPTPSQTEGPFYPVVKIPLR
                     QNLILKPDALIGKAITLQGKVLDVFGRPISGVKIEIWQCDGQGIYDHPNQPSQNKFDP
                     SFSGFGATVTEEDGRYFFQTLFPVPYSSRPPHIHVKLWRGDQELLTTQLYLKGQTGNE
                     WWGGKARDHLQFELINIDGRIVGTFDFVIV"
     gene            complement(646201..647034)
                     /locus_tag="VP_RS18280"
                     /old_locus_tag="VPA0641"
     CDS             complement(646201..647034)
                     /locus_tag="VP_RS18280"
                     /old_locus_tag="VPA0641"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005483391.1"
                     /translation="MDIDALRSFLAFVETGSFTRAAKQINRTQSAFSAQMRKLEDELH
                     VSLFEKEGRNLVLSEAGMSLRAHAEQLVSLHNQAVKQVKRYENKRPLRLGCPEDFNDS
                     LLPKVIRVLQQTEPTCSIQVYSEPSVTLREWLDEGKLDAAIVTRAPDSEEGYWLASDR
                     GVWISHPDFAIDESQPVPLALFQTDCKYHAAAINALTKRGTPYQLLACCNTSSAQRAI
                     VRSGMAIGAMGRISVTDDLKILEDLPPLPSVDIVLVTGVEPHPILDKECLSQLAELMP
                     C"
     gene            647163..647810
                     /locus_tag="VP_RS18285"
                     /old_locus_tag="VPA0642"
     CDS             647163..647810
                     /locus_tag="VP_RS18285"
                     /old_locus_tag="VPA0642"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004411236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase family protein"
                     /protein_id="WP_005483337.1"
                     /translation="MQLFIGNQNYSSWSLRAWLIFSQYDLKVDVTKLTLFTEDFYDKL
                     ASVTPTAKVPTLVDGEVTVWDSLAILEYVNEQYLQGKAWPSHVAYKAKARAISAEMHS
                     GFFDLRNELPMNCRARRKVDLSDGALKDIARIDAIWSEQMAKFPDAFLFGEWSIADAM
                     YAPVALRFETYGIELSQGAKAYQQKVLASHAVQKWLAEASQETDIVEEDEAGVEV"
     gene            complement(647878..649539)
                     /locus_tag="VP_RS18290"
                     /old_locus_tag="VPA0643"
     CDS             complement(647878..649539)
                     /locus_tag="VP_RS18290"
                     /old_locus_tag="VPA0643"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014258187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein-ubiquinone
                     oxidoreductase"
                     /protein_id="WP_005483341.1"
                     /translation="MERECMEFDVVIVGAGPAGLSAACRLAQLNQDREGEALSICVVE
                     KGSEVGAHILSGAVFETRALDELFPNWKEMGAPVSAPVQHDDFLYLTTELNHIRVPHF
                     LTPKPMHNDENNHVISLANLCRWLATQAEQLGVEVFPGFAAASVNYDESGAVTGITTS
                     DMGLDKNGQEKANFEPGIELKAKYTLFAEGCRGHLGKELIRHFDLDAGKQPQHYALGL
                     KEIWELPADAKDFTGNVIHSAGWPLSETNATGGGFLYHLENRQIAVGLIVDLNYRNPH
                     LSPFDEFQRFKHHPAIKKYIKGAQRIAYGARAIAKGGLSSLPKQQFPGGLLIGCDAGT
                     LNVAKIKGSHTAMKSGLLAAEAIHQALQDSRCEPDYQSRFEASWQYDELAETRNFGAN
                     LHKFGSLFGGALSTFEHNLWLPLIKKPIPWTVKDHSHDHEQLKPKNECPPIEYPKPDG
                     EISFDKPSSVFLSGTQHEENQPCHLVLTYPHIPIDVHLGLFDEPSQRYCPAGVYEVVE
                     IDGKVKFQINAANCVHCKTCDIKDPSQNITWKTPEGGGGPNYQNM"
     gene            complement(649774..650928)
                     /locus_tag="VP_RS18295"
                     /old_locus_tag="VPA0645"
     CDS             complement(649774..650928)
                     /locus_tag="VP_RS18295"
                     /old_locus_tag="VPA0645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxo acid dehydrogenase subunit E2"
                     /protein_id="WP_005483389.1"
                     /translation="MKTFNLPDLGEGLAESEIVKWHVNVGDMVKLDQVILTVETAKAT
                     VDVPAPYAGRIVSRHGEEGDVINIGALLLEIDESGAENTVSAEKRQTADAATVVGSVS
                     HQSHNVNVDDFWVGGSHNKSTDKLITALPSARLLAKKLGVDLKTMVGSGPSGLIVDAD
                     VYEEAGKQVPGTEVLKGARRTMVSTMAESHQNVAAVTITEEALLEDWLPNEDISIRLV
                     QAIVYACQQEPALNAWFDAETMTRCVHPTVNLGVAVDSRHGLYVPVLRHADEYEPQDV
                     RRWLDQTVKGIRDRKISREDLQHATITLSNFGAIGGIFATPVVSPPQVAIVGAGRIVD
                     RVVIRNGQAVAVKAMPLSITFDHRACTGGEAARFTKVLAEHLQRPSVTKS"
     gene            complement(650925..651908)
                     /locus_tag="VP_RS18300"
                     /old_locus_tag="VPA0646"
     CDS             complement(650925..651908)
                     /locus_tag="VP_RS18300"
                     /old_locus_tag="VPA0646"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020328275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ketoacid dehydrogenase subunit beta"
                     /protein_id="WP_005455773.1"
                     /translation="MAELTLVEAVNLALHHEMEHDPNVVVLGEDVGDNGGVFRATVGL
                     KQKYGLKRVIDTPLAEALIGGVAVGMATQGLRPVAEFQFQGFVFPAMEHLMCHAARMR
                     NRTRGRLTCPAVFRAPFGGGIHAPEHHSESIEALFAHTAGFKVVIPSSPQRAYGLLLA
                     AIRSNDPVMFFEPKRIYRTVKSEVIDNGEALPLDTCFTLRKGRDITLVTWGACVVESL
                     QAAQTLSSQGIEVEVIDLASIKPIDTATIFRSLEKTGRLLVVHEASKTCGVGSELLAR
                     TAEHAMCLLKAPPKRVTGMDTIMPYYRNEDYFMVQEEDIVIAARELVEDWK"
     gene            complement(651901..652995)
                     /gene="pdhA"
                     /locus_tag="VP_RS18305"
                     /old_locus_tag="VPA0647"
     CDS             complement(651901..652995)
                     /gene="pdhA"
                     /locus_tag="VP_RS18305"
                     /old_locus_tag="VPA0647"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011081422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase (acetyl-transferring) E1
                     component subunit alpha"
                     /protein_id="WP_005483380.1"
                     /translation="MNVQALPMHRFIDHDGNLVGQLPNWADIETLVGFYRDMVLTRTY
                     DQKAVALQRTGKLGTYPSHLGSEAIGIAVGRALKTDDVFVPYYRDMPAMWCRGIGMEK
                     NLQYWGGDERGSDFAPEGSPIPSRDLPFCVPIATQCTHAVGVASALKIQGNHEAALVM
                     CGDGGTSKGDFLESINCAGTWNIPLVFVVNNNQWAISVPRSLQCAAEFLSEKAKGAGI
                     PGITVDGNDVVAMYDATMTALERARKGKGATLIEAVSYRLSDHTTADDATRYRNADDV
                     QTAWQFEPVSRLKTFLINQGAWSDEQEQQWQSDCKEQVELAVERYLNLPQQAPETGFD
                     YLYESLPQELHAQRDELINKAMRMQGGKHG"
     gene            653681..654001
                     /locus_tag="VP_RS18310"
                     /old_locus_tag="VPA0648"
     CDS             653681..654001
                     /locus_tag="VP_RS18310"
                     /old_locus_tag="VPA0648"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011152302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DOPA 4,5-dioxygenase family protein"
                     /protein_id="WP_005455725.1"
                     /translation="MYHVHVYFPLQQLEKAQALNEIIRQERQDVLRVYPLVDRLVGPH
                     KMPMFEMHLESISEEFLAWLDTIRGDFSVLIHPVSERELRDHTESAIWLGRELGVFEE
                     KLEN"
     gene            654339..654965
                     /locus_tag="VP_RS18315"
                     /old_locus_tag="VPA0649"
     CDS             654339..654965
                     /locus_tag="VP_RS18315"
                     /old_locus_tag="VPA0649"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020197288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005483333.1"
                     /translation="MLTILLIALALYIFWLLFRNGPAFAERLPDHKRNWVGPTANQEE
                     WRGYCADVFQPFSSRTTFYAIAYFANYIAVANAISWSIVYEGNYPVMMSRFGSYFIVS
                     THDAMLVAGFVSLAFFIINWQLAMHCASLLSQYLVRILIINRTRFVAMSLVFSSYFAY
                     LLTIGIFWLFHDTYSIWQGLKLTPAFLLLALLLAVVLPAMKKETSESE"
     gene            655051..656403
                     /gene="yegD"
                     /locus_tag="VP_RS18320"
                     /old_locus_tag="VPA0650"
     CDS             655051..656403
                     /gene="yegD"
                     /locus_tag="VP_RS18320"
                     /old_locus_tag="VPA0650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005469106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_005483366.1"
                     /translation="MYIGFDYGTANCSVAKIESGKPVLLNLEGDSPFIPSTLAAPTRE
                     SVSEHLFRHRDIKPFDQVGEQVLCRAINLNREESIELEPEDIAFGQAALNRYLEDPRD
                     IYYVKSPKSFLGASGLRDVQLSFFEDLVCAMMDNIKAQAENHAQQSITDAVIGRPINF
                     HGRGGETANIQAENILLRAAKRAGFKNIEFQFEPVAAGLEYEATLSEDKRILVVDIGG
                     GTTDCSLIQMGPSWRGKADRTASLLAHSGQRVGGNDLDIALAFKQLMFPFGMDSKMES
                     GIVMPTTQFWNPIAINNVEAQNDFYSRENLAALKLLQKQAQEPEKLARLLEVYHESLG
                     YNIVRRAEEAKVALSDQTAYCTGINLLSELIEVDVQRDEMIEAIESPKNKMTALVTEA
                     VEQAGVKPDAIFMTGGSARSPILRDAVQTVLPNIPVVSGNYFGSVTAGLARWADVCFK
                     "
     gene            complement(656510..656983)
                     /locus_tag="VP_RS18325"
                     /old_locus_tag="VPA0652"
     CDS             complement(656510..656983)
                     /locus_tag="VP_RS18325"
                     /old_locus_tag="VPA0652"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005531538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper chaperone PCu(A)C"
                     /protein_id="WP_005483350.1"
                     /translation="MLKQMKIATLSLIALIASPMSLAHDYEAGKIHIDHPWSREAPPN
                     APVIGGFFQLTNHGDTEDALIAAESPIAGRVEIHTHTNEDGVMKMIKIDEVRVAAHET
                     VVFKPGSFHLMIFNPTQTLQEGDRFPMTLTFKNAGKIDVEMAVEKKGHMEKHMHH"
     gene            complement(657074..657535)
                     /locus_tag="VP_RS18330"
                     /old_locus_tag="VPA0654"
     CDS             complement(657074..657535)
                     /locus_tag="VP_RS18330"
                     /old_locus_tag="VPA0654"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005450125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005485973.1"
                     /translation="METTQIQPKKQRVAAIAVIFAVLFQLYLASTAALNPTQVHNKSW
                     LNKVQNEKVLLCTAEGFKWVDINTLIAANAQPSSEFIDNLKLHDGFQFECPLLQAVQF
                     FLLVAVGLYLATIQWLRRVKHALTPYHFAQCGRLVYQHIAPKQSPPCVFPA"
     gene            657915..658958
                     /locus_tag="VP_RS18335"
                     /old_locus_tag="VPA0655"
     CDS             657915..658958
                     /locus_tag="VP_RS18335"
                     /old_locus_tag="VPA0655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010452233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005489206.1"
                     /translation="MKYEQQIEFRYPKGRFAMVSVYTFTGAAILASTIFSLLLFLSID
                     DNPMMQALFGGLAIIFEAGKFYAWYEYGERRAHRNYGGAITALVFYSVLAAISIGGSI
                     GGINSATNSAQSHISVEQAKIEAFNRQIASIDKQIELNNIAAQKYIEMERIATGVTRI
                     QEQNKTLREEQQRLAMERDSLPPVTQGSVIGLIDSLANAFGTTSQQAQLWLVVFLSIL
                     LDFFAAFFVGLIGEEQRFRHYYRRYAGMTVASIRDIDPEPAGYLPHIKDEDEPAIEQK
                     IEEPEEPKTLLEQVSDALKTHQITCTKKAVAKQFRLSAEEVDKVFEELAELGLVGKKA
                     NHHYHWIGQAEAA"
     gene            659198..659878
                     /locus_tag="VP_RS18340"
                     /old_locus_tag="VPA0656"
     CDS             659198..659878
                     /locus_tag="VP_RS18340"
                     /old_locus_tag="VPA0656"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005595246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_005489362.1"
                     /translation="MKISPYPTGRFKNYLEQKSAAFRDLIYQCQVNTRYFDAGEAILR
                     QGEQLQYLYIVPVGRVSMSILAANGRRFQLGEANCDYHIYGEMEYFTQTPCQWNVVAD
                     EHMQVDVICIQKLTEALQQHPEMMVFFASALAEDYQDSMDIYTNRLLHPITYNIAYDL
                     LVRNQTDTLLGGFDKVNQEAERFGTSGRVYRRAVKDLIDKGLIAKTDNGLVILDEMAL
                     KAFIDSHE"
     gene            660042..660950
                     /locus_tag="VP_RS18345"
                     /old_locus_tag="VPA0657"
     CDS             660042..660950
                     /locus_tag="VP_RS18345"
                     /old_locus_tag="VPA0657"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005437792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="siderophore ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_005487329.1"
                     /translation="MKKLVSAAVFSLLTISPSFAANVVIDHYMGKTELEQSPKRVVVI
                     GFGPLDALDNFGIDPVAVSNASHLPSYLSKYSKENYTSAGSLFEPDFEAIYMQKPDLI
                     LVGPRGSAKYEELSEIAPTVVFAAKEGEGYWEGTQAQWRNIGKIFNIEDKVEQKIETL
                     DAQFKAIRDYNQTNNNDALTILSIGDNISAFGAKSRFGAIYNDFGFIETVKNIKTGTH
                     GDVISYEFIREADPKNILVIDRNSLHAKPSQDLRKSMDNDLVKATTAYKNQKITFLDV
                     DAWYLAMSGVTATEKMVNEIKNTVDL"
     gene            660973..661908
                     /locus_tag="VP_RS18350"
                     /old_locus_tag="VPA0658"
     CDS             660973..661908
                     /locus_tag="VP_RS18350"
                     /old_locus_tag="VPA0658"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000735133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_005482134.1"
                     /translation="MKKLLLTLVVLSTVSLFVGVADMTPQQLFSGDAKALELFFTSRI
                     PRLFAILLAGAGLSIAGLVMQQISQNRFAAPSTTGTIECAMLGYVMSVVFFGDGDHLW
                     LVFGISVLGTLTFVHFIQRIQFKSVVFVPLVGIIFGNVIESMTTFIAYKYDALQSLSA
                     WSVANFANILRGDFELLYIAVPMVILSYLFAARISAVGIGKDFAVNLGLNYQQVVTIG
                     VLLVSIMSASVVMIVGQLPFLGLIVPNLVSHFYGDNLKKNIPLTAMYGAILVLGCDLV
                     SRLIIFPHEMPISIVISILGGVVFIAMLLRGKQHA"
     gene            661901..662851
                     /locus_tag="VP_RS18355"
                     /old_locus_tag="VPA0659"
     CDS             661901..662851
                     /locus_tag="VP_RS18355"
                     /old_locus_tag="VPA0659"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017014885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron chelate uptake ABC transporter family
                     permease subunit"
                     /protein_id="WP_005482136.1"
                     /translation="MRDSTKIVLLGVIALVFAFLFIGIGLNADNYQYFLSRRVPKVLA
                     IVLAGVAIAQSSMVFQTITHNRILTPSIMGFDALYVLTQVLIVLLFGGLSTLVLNIYV
                     NFTIAACIMVAFSLLLFGFYFSKGSRNLITLLLVGLIFGQLFSNVASFFSLLMDPNTF
                     AFVQSKLYASFNNVKVNLVYFSAPMLILACWLLFRMHRTLDVFWLDQDNAKSLGVDVP
                     KVTRNVFILSAVLIAISTALVGPIMFFGLLVTNLSREMFHSYQHKTLLIGCSLLAISS
                     LLSGQWIIENVFNFETTLSVVINFLGGIYFLYLLLKNKVV"
     gene            662854..663609
                     /locus_tag="VP_RS18360"
                     /old_locus_tag="VPA0660"
     CDS             662854..663609
                     /locus_tag="VP_RS18360"
                     /old_locus_tag="VPA0660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004411586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_005482130.1"
                     /translation="MIVIEKLTKAFGSSKVVDSADTQFEKGKVTSIIGPNGAGKSTLL
                     SMASRLTERDGGSVIIDCKEIAEWDTKELAKRLAVLRQANSITMRFTVKELVSFGRFP
                     YSKGNLTKDDHAVIAQAIDYLDLQDIQDKYLDELSGGQRQLAFIAMVIAQDTDYVFLD
                     EPLNNLDIKHSLQIMKVIQRLAHDMNKAMVVVIHDINFAACYSDVILALKQGKVVASG
                     AVEEVIQATTLEDIYETPFNIIELNGKRMCTYH"
     gene            complement(663657..664043)
                     /gene="cueR"
                     /locus_tag="VP_RS18365"
                     /old_locus_tag="VPA0662"
     CDS             complement(663657..664043)
                     /gene="cueR"
                     /locus_tag="VP_RS18365"
                     /old_locus_tag="VPA0662"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011081098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cu(I)-responsive transcriptional regulator"
                     /protein_id="WP_005486235.1"
                     /translation="MNIGAVAKLTGLSSKSIRLYEDKGIISPPARSDSGYREYSDNHI
                     QELNLVSRAKNAGFSLQECKEFVQLAHNPNRKSSEVKERTMDKLREVEEKIAHLMEIK
                     KQLEGWVSACPGDAKSRCPIIDELTK"
     gene            complement(664251..665273)
                     /locus_tag="VP_RS18370"
                     /old_locus_tag="VPA0663"
     CDS             complement(664251..665273)
                     /locus_tag="VP_RS18370"
                     /old_locus_tag="VPA0663"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009695871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_162828791.1"
                     /translation="MRNRTSVMRKRQMQEVTAKRTKLGKIAMTQKLEATEKQFIVTQG
                     QPCQTQLAEGKFLSYQYNDQIFVHGGRCIELVDSNIVSTAHASLLITILLEGKLSFGY
                     DDLQFDLDASDTPQGVVVNLIHPANFRRSLIENNQINKINILVKPQWLEYRSEESCCS
                     TAFFETHQAFYHLELNQALTELATELTNRDTPHRFQDKLEIESLIYQILFHATQQMPQ
                     DFCPQNTNSYRDKITERHSDSRVENIVSYIETHLEQELSLEHIAEVFSMSVSNLQRRF
                     KQSLNMTVNGYIRYRRLEIARVHLERGLVSITEAAYEAGYHHPSNFTNAFKKVFGVPP
                     HEIVKE"
     gene            665354..667360
                     /locus_tag="VP_RS18375"
                     /old_locus_tag="VPA0664"
     CDS             665354..667360
                     /locus_tag="VP_RS18375"
                     /old_locus_tag="VPA0664"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="WP_005482128.1"
                     /translation="MESPACSSIKLSSLCLAVGMALANPVLAQESDSHFEEVVVWGTK
                     VSSNTESMFADDMSLKQADHMSDLLRDIPGVDVGGTHSVNQRITIRGLGETDLDIRLD
                     GASQHASMFHHIGNLTLNPDILKSADIQVGNNSVTQNGLGGSVYFETKDARDLLRYDE
                     TFGARVYGGFASNDNQQGSLTLYGLLSENVDAMVYGHYVTRDDFKDGNGDKTFGSAGD
                     VYNILAKLGYEFNDIHRFELSYDMYRDSGDYSPRPDMAGSANNGLSSKLLIPTDYDRD
                     TVTLSYELRGEKHQGNVTLYNTETEIKRDETVMAPRWPSNRLSKNTAKNQNLGLNAKF
                     QSDFALAQFDNRVTYGFDYMDKTSSSYYGSSKFMDESAVSTALFVEDQFFFSDAFFIT
                     AGLRFDDYKRKAETGTSNFDDVTWALAAEWAVTQDWTLFASSRSLFKGPELMETFIAY
                     QDVAYLDEGMKAETGQNTQGGLRFNKTLDKHFFGANVTVFQTNIDDYIADKYQDATQT
                     YLIYNIGDVEIKGFEASASYGYDKFNSKLSYSQSDTKNKNTGGPVAGGNGRSIDMGDS
                     IALTLDYQSDSLETIFGWTSMFVLEEDNVFDGQPAKDSYDVHNLYAQWVPSNVDGLSV
                     TFGIDNIFDEVYTSHASRSGTVRGFTLDDYEPGRNFKLSAAYQF"
     gene            667420..667701
                     /locus_tag="VP_RS18380"
     CDS             667420..667701
                     /locus_tag="VP_RS18380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017190701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2218 domain-containing protein"
                     /protein_id="WP_005482124.1"
                     /translation="MIKETTQIESEHASKYLVTLCRHFARKVPATWDEQSGLVTFPAG
                     KAEFSLNGLCLIIACEADSEKQLEQVKGIIESHVEMFSRRETLELDWIR"
     gene            complement(667768..668019)
                     /locus_tag="VP_RS18385"
                     /old_locus_tag="VPA0666"
     CDS             complement(667768..668019)
                     /locus_tag="VP_RS18385"
                     /old_locus_tag="VPA0666"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014234059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YgjV family protein"
                     /protein_id="WP_005454365.1"
                     /translation="MEMNMVEILGYAASIMVAISLTMKDIVKLRILNFIGCALFTAYG
                     LMIDSWPVVLTNGFIACVNVYFLAKMQQEKKSLEPEKAQ"
     gene            668887..687141
                     /locus_tag="VP_RS18390"
                     /old_locus_tag="VPA0668"
     CDS             668887..687141
                     /locus_tag="VP_RS18390"
                     /old_locus_tag="VPA0668"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005486252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="retention module-containing protein"
                     /protein_id="WP_005489282.1"
                     /translation="MSTQTVPQNAIVNAVKGEVLVLDLTGKIRVVSAGDALNTGDVIV
                     TENNASLDVLINNELYLVDQNCVACLPEPSSEQPETLVQTPVDGQIAFDPTAIDSANF
                     DANDVAAIQQAILEGADPTAILEATAAGGDASGSANAGYVTVEYNNPEMLASTFFETS
                     ATRTGVQDREETDDINVTIFADGGQSLESEVTEGSISLTTYPQSIATSVSVEAGDLPL
                     DPSSFVPSAASLESLLAELNTDIQSGGKAVEFSYDEAQNAIIGVQDGNEVLRIEIEAT
                     SLGRDIELEVTTTISQGIDHIASVDDGQVSIVGDRISIEFEMTGTDIGGNSIRTPIDF
                     VTTIIDGDNPAPQDISFENEESSSTRITGTFVEIGSDQLASVSFNQESLSQFDGLLTD
                     NQVTVATLSEDGSNITLTVAGTGEVVLSITLNTDGTYQFEQFKPLEQTNDSDTIALSL
                     PTTIVDFDQDTVSNTFVITIADGDNPVINNVTSLSLDESGVEQGSLQGIAITSGTGSI
                     SAAAGSDIIDHFEVEPTEFNVSGELQSQGQNVLLELTSDVNGVRTYEGYIELDGVRIT
                     VFDISIDSPYQGEYQFNLYEQLDHTGANDESLTFTIPVYAVDADGDRSSLTLGSNDAK
                     AAEIVIEVKDDAPSIDGVEALTVDEDDLASIGSDQNDSVSVDGKFTTTEGSDRVVSYQ
                     LDASTNPIDGLTSHGEAVELVETANADGSFTYTATANGNSVFTLVVNTDGSYNFTLEG
                     PIDHASGSDALTLNFPITATDFDGDTSTMVLPVTIQDDVPTIENVVPLTVDENDLITS
                     GGQSNALLVEGQFTTTQGSDGVVQYQLETGSDPLNGLTSNGQVITLAEVSNADGSFTY
                     TATANGNPVFTLQVNSDGSYSFELQGAVDHAPNSDTLTLDFSIIATDFDGDTSKITLP
                     VTIVDSLPVVKDFETISVDEDDLAGIGSDQNDPVSIDGQFTTTEGADRVVSYQLDSNA
                     TPVDGLTSQGVAATMTETANSDGSFTYTATAGTNPVFTLTVNPDGSYNFTLEGAIDHA
                     ANSDSLTLNFPITVTDFDGDTTSAVIPVTITDDQPTITNVEAISVDEDDLANIGSDQN
                     DSLTIDGQFTTTQGSDRVVSYQLDTSVDVVAGLTSQGNPVTLIETANPDGSFSYVAAA
                     DGNPVFTLVVKTDGSYNFTLEGPIDHAINSDELTLNFPIIATDFDGDTTSATIPVTIV
                     DDKPVITNVDAIQVDEDDLTGIGSDQSDALSINGQFAITQGSDGVVSYQLDSSADPVA
                     GLTSHGEAVDLVETANVDGSFTYTATANGNPVFTLVVNVDGSYNFTLEGPIDHASGSD
                     ELTLNFPIIATDFDGDTSSAVIPVTIVDDQPTITNVDAIMVDEDDLSGVGSAQDGVVS
                     IDGKFTTTEGSDRVVSYQLDSSTDPVAGLTSHGEAVVLVETANADGSFTYSATADGNP
                     VFTLIVNADGSYNFTLEGPIDHAINSDELTLNFPIIATDFDGDTSSAVIPVTIVDDQP
                     TITNVDAITVDEDDLTSIGSAQDGVVSTDGKFTTTEGSDRVVSYQLDGSTNPVAGLTS
                     HGEVVDLVETENADGSFTYTATADGNPVFTLVVNTDGSYNFTLEGPIDHVTGSDELTL
                     NFPIIATDFDGDTSSATIPVTIVDDQPTINDVQAITVDEDDLEQIGSAQDGSVSIDGH
                     FTTNQGSDGVVSYQLDASATPVDGLTSQGVAVTLSETANPEGSFTYTATAGTNPVFTL
                     TVNPDGSYNFTLEGPIDHASNSDELTLSFPIIATDFDGDSSVMVLPVTIQDDVPTIEN
                     VVPLTVDENNLITNGGQSNALLVEGQFITTQGSDGVVQYQLETGSDPLNGLTSNGQVI
                     TLVEVSNANGSFTYTATANGNSVFTLQVNNDGSYSFELQGAVDHAPNSDTLTLDFSII
                     ATDFDGDTSQVTLPVTIVDSLPVISAVDAINVDEDDLVNVGSDQNDPVSIDGKFTTTE
                     GADRVVSYQLDSNAKPVDGLTSQGNSVTLIETANPDGSFSYVATADGNPVFTLVVKTD
                     GSYNFTLEGPIDHAINSDELTLNFPIIATDFDGDTTSATIPVTIVDDKPIITSVDAIQ
                     VDEDDLTGIGSDQNDALSINGQFATTQGSDGVVSYQLDASADPVAGLTSHGEAVDLVE
                     TANADGSFTYTATANGNPVFTLVVNVDGSYNFTLEGPIDHASGSDELTLNFPIIATDF
                     DGDTSSAVIPVTIVDDQPTITNVDSITVDEDDLSGVGSAQDGVVSIDGKFTTTEGSDR
                     VVSYQLDSSTDLVAGLTSHGEAVVLVETANADGSFTYSATADGNPVFTLVVNVDGSYN
                     FTLEGPIDHAINSDELTLNFPIIATDFDGDTSSAVLPVTIVDDQPTITNVDAITVDEG
                     DLTIIGSAQDGVVSIDGKFTTTEGSDRVVSYQLDGSMNPVAGLTSHGEIVDLVETANA
                     DGSFTYTATANGNPVFTLVVNTDGSYNFTLEGPIDHVTGSDELTLNFPIIATDFDGDT
                     SSATIPVTIVDDQPTINNVQAITVDEDDLAQIGSAQDGSVSIDGHFTTNQGSDGVVSY
                     QLDASATPVDGLTSQGVAVTLSETANPDGSFTYTATAGTNPVFTLIVNPDGSYNFTLE
                     GPIDHAINSDELTLNFPIIATDFDGDTTSATIPVSIVDDQPVITNVAPITVDEDDLIN
                     IGSDQKDALSIDGKFTTTQGSDSVVSYQLDASAMPVDGLTSQGVAVTMTETANADGSF
                     TYTATAGANAVFTLVVKPDGSYNFTLEGTLDHPIGADELTLNFPIIATDFDGDTTSAT
                     IPVTIVDDRPTLDGIDANSVLTVDEDDLPTVGSDGNEPTSIIGKFVATEGADHIVEYH
                     IVDLNTPVQGLTSGGQSLILVEVSNSGGVSVYEAIIDGTTTPAFRVTLDVSDGSYKFE
                     LLEPLDHPTSNGQNDIVINLPIAATDFDGDVSNTLTLPITVVDDVPTIDGLAQGSEQT
                     VDEDDLPQGTDRAQDTIIGGTFDVTEGADQVTSIQLSDLTTPVSTLMSGGEAITLVLT
                     SSTGGVNVYQGITVNSQEVVFELTLNASNNSYEFDLRKALDHPDGNQQNNIIIELPIT
                     VTDGDGDVSPVFTLPITVVDDVPVVTNIDRLQVHEDDLPLGSDETKEPLTVSGQFEVT
                     SADGIDSFVLDLNSNLLPALTSGGESIAITQDATASTSDALVYVGKTAGGDTIFTLTL
                     HQDGRYDFELSGALDHATNSDDLTINLPIVITDGDNDSVNATLPVTILDDKPTIEAIR
                     PGSHLSIDEDDIPNKGSDGQGDHIIGGHFDVVDGADSIVSFQLEDLVLPVAGLTSAGQ
                     PLELVEYSNANGVIEYRAYVQGTTDIVFKLTLNAGEDRYQFELFAQLDHPNGNGENEL
                     VIDFPVNATDFDGDVSNTISLPITVVDDVPSITGVDNSSQLTIDEDDLPAGSDTSGLR
                     VLDGHFNVVAGADEIVSYHVSDLAGAVAGLQSNGQDVELRLVSEADGVSTYEAVIVGT
                     NTQIFTLTLDAKDNSYQFELVGPVDHPAGLGENSLTLDIPISVTDFDGDTSASVNLPI
                     TIVDDVPEIKTATPLFLDEDDLPSGSELSKDSLAASGSFDSVEGADTIVSYQLDLSGN
                     PISGVTSGGQAVMLVQTGVNNNNYTYQGQTPDGKSVFTLVLNADGTYKFTLEGVLDHG
                     VQGEDLLTLNLPVFATDVDGDTAGINLPVTITDDIPTIYDSSITRVEGQGTRTVQLFQ
                     DPVEGDLNYGADGSELTSFSADDSGIYFKQNGIDMTTVDLNGSNQTVFVHKTLNGVDT
                     EIGRLIVRTDGSISFRPNDDLDHTDAASIDFTVHVTATDGDGDTSTADLDISVTDRNA
                     QIDTSSVLSFEDKGRDGSILGTDNANTQDNLSGLDTTPAKVDLVINLHDLDRNESLGD
                     ITIRDASTHNGTFYYRNVNGEYIELTPVNGSVVLDGSNVIQSFNGEFVTLENLYFVPD
                     RHFATGDSGIDPRIRVEILNNGVSDHIINGRLNIQVESVADIATWTANSTFNYTVDED
                     GNNVSLNISAQTQDSSNPESIVYELVFTQGEGNATLVYSDGSAIAQTGGVYLVDASRI
                     GDVQVDPIDNFSGEIKIDVTAITTESVNPLTGKETARSETETIVIDVSPVADAGSFTV
                     NRINIFEDNARTQDTVDPVTDHDPLQLSEVISMKPSADMDGSEELFVRISNFSIDGVT
                     LVWLDGANPSQIVEVTDGNGNVLYYEIPESQLTNVEVLPPLHSNDDFTFNVEGIVKDN
                     ASLSTGSAQDVLSLGNKTVIVDVKGVADIPIVELNDKSGIWQEFDDGNVRGVQTFVDE
                     NDQVDISFSILSGEFKDNPNDHSETVTVLLSNIPDGVEIFDNDGNSVDLTFVGYDGNN
                     QPIYEANITQANINSGIVIKPEASSTENIHITATTIVTENDGHTRTSTGEIRVIVGPV
                     IDARNNYTVVSEGDEDTRFNIDWKPTTSQSPDADEFFSEVTISGFPPSCTVFVDGVAQ
                     TLVAGTLTLTPQANESEQDFSARVTQSGYVQVELEQDSSTDFDLSTTLTVKEIDHEYV
                     DAANPGQGIAEAVITGSVHVQVNPVVEPEDTSGAIGDQTRLLVTESNGTAIDVVKSDA
                     QGAIDFTINTSAGGQVGANIIKYQEFDASSDEVVTELVVQLHTTDPAILNQLVIIGAL
                     NEGDGRWTIIDEENFCIKAPSGLDLTPNDDTDNGDNGGLSQIGLTIYARVNDLGEDSV
                     EKDATEIRQTDVVLEFPTVLTPQTSVAAEIDVTDDVQIEGSEDNFVDLGAQLTSKIDV
                     INPDGVEDVLTIIIDPSSPGIPPGLIITGTDVDFINGKYVFQADIDSSGNIVGLEDLT
                     MRVAEDYAGDFVLPVRFVTKDTGSADEKSSTELIPVQILPVADVPSSAGDQPLDRNIT
                     PDVTVDITGTLGLDANKQPVDDLNNDVPTADGVGYEDGLIQLNLNVDFADGFNNTLGG
                     RETLTNIKLTLNDTTQGEFVDSNGNSLGTSIEFNEADILAGALDNVLFKPSENYPVGG
                     GQNTVKINIEGEITDVAVFDQSTLINPGDNVDVRTFTDDVTFEVTPVVDDIVITGTDP
                     SQPIVVTGDEDTLISLNQSGTGVTISLTDDDGSESFVSLKLTGIPNDFVVESNSSDYI
                     VKNAGNGEWSIQVKDLTQTSIDLSDIQIKPPKHFSGEVEIGISVFIQEELLKVPTERN
                     SNFTLVVNPIGDDVDVNPDTQVSGNEGEYITINVNALVVDNKESIGDGANYQENDPET
                     LRVEISNVPDGASLSLPDGTTFVDQGSGVFVLEINAQDLDQIVFNSGDRNDNSWAGSL
                     HFKVQAVDTGLDGSQSLGNAEEFDVSVDVTAVNDRPDFVNVVDVETPEDNALLLNSFG
                     ISDVDAVLDNPNAEYVLNIAVDSGYLALNANVISKYGLTVQGDGTGAVELKGSVADLN
                     AAIAEGLIEFNPDLNFFGDVTVNITVDDQGNEGIVISGVDDTLSTNSSSFVIDVTAVN
                     DAPETSPVTLTSIGEDSGVFAISASDLLVNATDVENDNLTVSNVQLVDPSSGSLAFNS
                     ATGNWEFTPAPGYNGPVELTYDITDDGTTNGVSDPKTVSGSASFEVFDVNDAPQTSEV
                     TLSSIEEDSGAVSITASELLANATDPENDNLAVSNVTLADPSAGTITQISATEWRFEP
                     SANFNGDVSFVYDITDDGTTNGAPDPITISGSAVMNVQAVNDAPEIDGSLVTSTIFES
                     AGQKISGITIADVDFTGIHENEIMTISLSTSEGDVSVIAPSGSGVTQGVGLAGETVLM
                     GTLSQLNAVLTSTAPNVGVFVDASDVNSSAISLTVTADDNGIYYENSTGTSLQTTETF
                     DINVTPVADKPTLAFDANFNYIQRITASQSASFQGVALVGIIAALTDLDEVLALEVTG
                     VPRGATLTSDATTSSISFDSATSTWTVPADEIDTLHIDNVRQGDHDITLTAVSTESNG
                     DQAFSDPIDISINVTSNNRDIDVSSETEDNLLLGSDRGISLIGGAGDDRIIGGDGDDI
                     LIGGLGSDILTGGGGNDIFKWTQDTVDEGAVDTITDFTLNEDTIDLKDVIADLNDPMA
                     GIDELLAHIQADYDATTDNVSLSITTDANVHQTIVVENLGQAIDFNGLSSNEIVESLL
                     NRGVIDNG"
     gene            complement(687256..687555)
                     /locus_tag="VP_RS18395"
                     /old_locus_tag="VPA0669"
     CDS             complement(687256..687555)
                     /locus_tag="VP_RS18395"
                     /old_locus_tag="VPA0669"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005477585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005477585.1"
                     /translation="MPVSGIHSGQQIMQLSHKMADKAAHEIQQTFAKGGEDLSFNKVE
                     LAKNVAFAANPSLAAHATVIEPLIEVTQAASYNRIGASVVEKNNEVIGSLLDIHV"
     gene            complement(687637..687834)
                     /locus_tag="VP_RS18400"
                     /old_locus_tag="VPA0670"
     CDS             complement(687637..687834)
                     /locus_tag="VP_RS18400"
                     /old_locus_tag="VPA0670"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_017448124.1"
                     /translation="MKDKPEYSEDTEMKAQQFKELKKKLGDLTASQLKTLQGEISMTL
                     NKKEKPLLSTEEREMLSKLFV"
     gene            complement(688087..690240)
                     /gene="yccS"
                     /locus_tag="VP_RS18405"
                     /old_locus_tag="VPA0671"
     CDS             complement(688087..690240)
                     /gene="yccS"
                     /locus_tag="VP_RS18405"
                     /old_locus_tag="VPA0671"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013867904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR01666 family membrane protein"
                     /protein_id="WP_005454352.1"
                     /translation="MQAASKFRLYWANKTINYSILILITLLGVVIPAWYFGQNTLITP
                     LILGVIAAALAESDDSFMGRIKALILTFICFAVAAFSIEILFHTPWLFATGLFISTFG
                     FIMLGAIGPKYASIAFGSLLIAIYTMLGAHESTNIWFQPLLLLTGAAWYYFMSMIWQM
                     FWPLQPVQLSLANVFLALANYLDAKAKLFHPVTNLAPQPMRIEAARLNAATVTALNAC
                     KATLLTRSKRGHVDGPSDRFLNIYFIAQDIHERVSSSHYRYQDLATEFERSDVLFRFK
                     YLLETQAQACRDIAQAIQLGNEYTHTDESILALAELQNSLAYLEEQQQGHWKRLLMQL
                     TYLFNNLATVEKQLNNINNPDAERLEEDTLADTNPHTLKAMWQRISANLHKDSMLFRH
                     ALRMSIALTIGYGIIQLFDIDRGYWILLTTLFVCQPNYSATRQKLTARVIGTLAGLLI
                     GVPLLTFFPSQESQLVFIVVSGVMFFAFRMNNYGYATGFITLLVLFLFNQLGEGYAVV
                     LPRLADTLIGCALAVAAVMFILPDWQSRRLHKVMSDAIDANKQYLDQIIGQYRIGKKD
                     NLSYRIARRQAHNNDATLTSAISTMLAEPGKYRAAVDESFRFLTLNHAMLSYISALGA
                     HRTRIEDESIHKLVLDAHRCIHQHLDVLHQQLHQHCEECDLSNIDDAGLEQRLNEWRD
                     EDDSSARMVLQQLHLIYRMLPELHSLASKFAVRVN"
     gene            690698..692767
                     /gene="helD"
                     /locus_tag="VP_RS18410"
                     /old_locus_tag="VPA0672"
     CDS             690698..692767
                     /gene="helD"
                     /locus_tag="VP_RS18410"
                     /old_locus_tag="VPA0672"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009704157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase IV"
                     /protein_id="WP_005477569.1"
                     /translation="MQLTATSKAQFFIQNEYYHVEIKENSVLLSSIGSEEHIPFTVWN
                     GKVNVKRGLFWSSLQFFAHEQDGKQQSWLVQGLPWPQCRKFALEAVRQYQDWHNTQCR
                     KLAEYLPKWEEELYQLKHLPAYLSHSQVMAWVEKLNQELAEIKTSLDEAKMRMPNRMG
                     EIEPWLVDTSHTLGERNHEWLENERPNWEVLFNRIESSPLNLSQQYAVLLNDDHNLVL
                     AGAGSGKTSVLTARVAYLLQSHQAQAEELLMLAFGRDAAKEMKERLVDKVGLAAEGVR
                     VNTFHQLGLYILNQVEQQPVEISPLALDDNQRTAWCVDWLKKHWMTPTNFKRWQKHLD
                     KWPIAYLKGDDELGSHSENPKLIAWLDSQLSHLAAVGLTKKQVQEKLVDHQDYTRLNS
                     ELALCWPCFSAWQKMLKESNQVDFPTMISRATDYVNKGKFVSPWRFVMVDEYQDISPD
                     RLALIEALCESTEKQPGATLFAVGDDWQAIYQFAGADVDLITGFKERFAHSTVHHLDT
                     TYRFNNQIGDVANTFVQQNPSQLPKTLNSHKQRKQKSVHTAPSNQVEKILDQLNQQAK
                     QTKSVLLLGRNHYHKPDLYDDWLRRFPNLDIRFMTCHASKGREADFVIILAVDEGQFP
                     AKKKQIHIDGALTESKDKFPYAEERRLFYVAVTRAKEKVWITHTGAGSAFVQELVSGD
                     YPIVTSR"
     gene            complement(692846..693301)
                     /locus_tag="VP_RS18415"
                     /old_locus_tag="VPA0673"
     CDS             complement(692846..693301)
                     /locus_tag="VP_RS18415"
                     /old_locus_tag="VPA0673"
                     /EC_number="4.2.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005599385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylglyoxal synthase"
                     /protein_id="WP_005454351.1"
                     /translation="MQKTTRTMPAHKHVALVAHDNCKPELLRWVKENKEKLQRHFLYA
                     TGTTGHMLSKETGLAIKSMISGPMGGDQQLGALISEGKIDVLVFFWDPLNAVPHDPDV
                     KALLRIASVWNIPVATNRATAKFLFDSPLLEQEVDIEVPDYEAYLAERM"
     gene            complement(693365..694369)
                     /gene="torT"
                     /locus_tag="VP_RS18420"
                     /old_locus_tag="VPA0674"
     CDS             complement(693365..694369)
                     /gene="torT"
                     /locus_tag="VP_RS18420"
                     /old_locus_tag="VPA0674"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005431808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TMAO reductase system periplasmic protein TorT"
                     /protein_id="WP_005477549.1"
                     /translation="MVINQRSIRTIFKHSVLAASLCASLPSVAAEKICAIYPHLKDSY
                     WLSVNYGMVSEAEKQGVNLRVLEAGGYPNKSRQEQQLALCTQWGANAIILGTVDPHAY
                     EHNLKSWVGNTPVFATVNQLDLDEEQSTLLKGEVGVDWYWMGYEAGKYLAERHPKGSG
                     KTNIALLLGPRTRGGTKPVTTGFYEAIKNSDIHIVDSFWADNDKELQRNLVQRVIDMG
                     NIDYIVGSAVAIEAAISELRSADKTHDIGLVSVYLSHGVYRGLLRNKVLFAPTDKMVQ
                     QGRLSVMQAAHYLRHQPYEKQASPIIKPLTPKTLHDDTIEESLSPSEYRPTFSIKAVD
                     "
     gene            694458..697424
                     /gene="torS"
                     /locus_tag="VP_RS18425"
                     /old_locus_tag="VPA0675"
     CDS             694458..697424
                     /gene="torS"
                     /locus_tag="VP_RS18425"
                     /old_locus_tag="VPA0675"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005447216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TMAO reductase system sensor histidine
                     kinase/response regulator TorS"
                     /protein_id="WP_005477577.1"
                     /translation="MLLATASIGRKLLLSFIAMAMLVMLSALIGVSGFSLVAKTERNV
                     VDAAIPAMIEARQVSELSTRIISSVQMLSNAQNEQERKEAGRVLFEQLESLLTHIKEL
                     GGESFDSKLLDALESNVQNVINNLAELGVTVERKLWLAKEIDTRVEEMRLLSEELEQL
                     TRTQVQNTSTIAVANVTHIYDLLEANKKDQVYQALDALVEVDLDLTERLHELHLLAFK
                     MLNQIEEARTLTNVDRIQQIQTAFENNLKIMKRRVLAVEDPTRSKQMSQLLTELGKRQ
                     VVFTILLQQYENNEQSQQLMQKTLELFSELNSTVNKLVDDSNKTTTFAVDQLTNTLKF
                     AQWSLTVISIVGLIVVVLILWRVVYVSVVKRLAEYSAALLSVAQGNLAVELEVKGKDE
                     LAHMGQAIITARNTAQALKVVAEGEAKAKRELEEHKEHLEELIEQRTSQLRQANLRLN
                     EEVVNHAQARNEAEQASRAKSAFLATMSHEIRTPMNGVLGTARLLMDSGLNPIQKRYA
                     EIINRSGKTLLAILNDVLDYSKIEAGHLEIRRLGFDLHQMVEDTFQLMNSRAQEKQLL
                     FSYHIESDVSRYWKGDVTRISQVLNNLVGNAIKFTEDGEIDIYVSLNPEDESQVLFEV
                     SDTGIGISKKDQKTLFDAFTQAEGGLNQIGGTGLGLAISKRIVEAMGGVLEVDSEEGE
                     GSRFWFSIPLEESEPVEIGVVASARCKVKAKVLLVEDNEVNRVVAEGFLQSMGHQVVM
                     AEDGLQAERIIDKQDFDIALVDINLPDCDGTDLIQRLKRIERNKPGDKALSPTPMIAV
                     SAHVFAEEVERYLAAGFDGYLPKPVEKEALATLIQDVLDGKQLLLPQSGECLPLSETS
                     DTNLTIENQVEQDHQQREEPEMVIINPSVIQSDMKILGREKMLHIIDLFRNTSADVLG
                     QLVESAEKNDSLAVKNLAHKLKGSAGSLGLTALMNTCQSIEIAAEPLDTYNAQQGLLD
                     EQVATSVNALDELMAE"
     gene            complement(697493..697684)
                     /locus_tag="VP_RS18430"
                     /old_locus_tag="VPA0676"
     CDS             complement(697493..697684)
                     /locus_tag="VP_RS18430"
                     /old_locus_tag="VPA0676"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005447215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005454225.1"
                     /translation="MGIRDNIAALEQQIYVACSEGDYETVNMLEHQLEYLRGKVEHPL
                     DDDPYALDTRFEWEDDMTK"
     gene            complement(697703..700057)
                     /locus_tag="VP_RS18435"
                     /old_locus_tag="VPA0677"
     CDS             complement(697703..700057)
                     /locus_tag="VP_RS18435"
                     /old_locus_tag="VPA0677"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006879631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid cis/trans isomerase"
                     /protein_id="WP_021451094.1"
                     /translation="MNLRLIFILCIASLFAGCATYAGLNFDQLFGPQLVRERTASVET
                     PQADFFQREVKPIVDNRCVVCHACYDAPCQLKLSSVEGIDRGASKALVYEGTRLTAAA
                     PTRLFEDAETTQEWRDAGFHPVLNERDQSMAANLEAGLIARLLQQKERHPLPDQVQLE
                     GFDFSIDREQTCPTIEEYEQYEKDNPNWGMPFGMPNLTNSEYHTLMTWLENGAIMNMH
                     TPISDQEQAKINQYETLLNHSDLKNQLMSRYIYEHLFLSHLYFSELSEKPRFFTLVRS
                     ATPPGQPVKRISTRRPYDDPGVERVYYRIIPEQGTIVDKTHMPFALNKQRISNWKKWF
                     IEADYSVTQLPSYEPEVAANPMTAFIDMPVKSRFKFMLDNAQNTIMAYIKGPVCRGQL
                     ALNVINDRFWVFFLDPDKADIPEVNEFYRSQADNLKLPAEQESNTLPVTNWVKYARQQ
                     ARYLEAKSEFTNNWFKHGENLSTDVIWDGNGTNPNAALTVFRHFDSASVVQGLVGEQP
                     KTVWILDYALLERIHYLLVAGFDVYGNFGHQLMTRMFMDFLRLEGESNFVTLLPADMR
                     HQLQSSWYQDQSPQLSDFLQRNVKPFNQPTSVVYKTDDPKTELLNMMRKRLSPVLLPR
                     YEITDTALSDKTEKELKRIGQVRGEGLQTVPQITMLMVRSKSGKDELFTLLHNNAHTN
                     ISSLFDEESNRDFANDDMTIVRGVVGSYPAAFFSLKENQVKEFVDQFSAIQNEADYVK
                     LLDSFAIRRSSEKFWPFSDRIHNWYRTNQPIEFGLLDYNRFENR"
     gene            complement(700147..700569)
                     /locus_tag="VP_RS18440"
                     /old_locus_tag="VPA0678"
     CDS             complement(700147..700569)
                     /locus_tag="VP_RS18440"
                     /old_locus_tag="VPA0678"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /protein_id="WP_005477587.1"
                     /translation="MVRNFIINLDINVSDQATLSVLPTLTSDCQDCGHSSSADHVLTL
                     DKYTQSVTIQSQPKKTDIQLTPIQFELLRTLIQHQDKVLTKPFLYQTVLQRPFTEHDR
                     ALDMHISRMRKRLIAEGMPPDQIQTIHRKGYLFKSINR"
     gene            700792..702339
                     /locus_tag="VP_RS18445"
                     /old_locus_tag="VPA0679"
     CDS             700792..702339
                     /locus_tag="VP_RS18445"
                     /old_locus_tag="VPA0679"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="WP_005454070.1"
                     /translation="MNFRKNTLVLTMLATAAPIAAQAASKPNMLVIMGDDIGYGNISA
                     YNQGMLGYNTPNIDRIAQEGALFTAYYAQQSCTAGRSTFITGQMPIRTGLTKVGLPGA
                     EQGLQPQDITMATALKDMGYATGQFGKNHLGDKDEMLPTNHGFDEFMGNLYHLNAEEE
                     PENPDYPKDPAFRKNFGPRGVIHSYADGKIEDTGPLTRKRMETVDQETLDAAMNFMER
                     QVKANKPFFLWYNATRMHIWTHVKEENRTTGLGEYADGMVEHDNMVGELLDKLDDLKV
                     ADNTIVIYTTDNGPMNATWPDAAFGPFRGEKNTGWEGGFRVPAMVRWPGHIAPNTKLN
                     DIFAGEDWFPTLLSAAGNNTIKQDLLKGYKSSSADRTYKNHLDGYNQMNYLMGKDKES
                     ARDEFFYWSDDGDLLAMRDKRFKLHFKIQEHEGWDVWTKEFTNLRIPMIFDLKVDPLE
                     KGDQGFGYETWQFNHVFLLVPAQAKVAKVLKSFKEFPPRQEIPSFSVDKVMEQMKNLS
                     KVQQAKG"
     gene            702649..704196
                     /locus_tag="VP_RS18450"
                     /old_locus_tag="VPA0680"
     CDS             702649..704196
                     /locus_tag="VP_RS18450"
                     /old_locus_tag="VPA0680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="WP_005454162.1"
                     /translation="MTAKYGVKRRLAILAAALIGATSSSIAAEKPNILVIWGDDIGQS
                     NLSAYTFGLMGYKTPNIDSIAKEGMMFTDYYGEQSCTAGRSTFITGQTVLRTGLSKVG
                     LPGADLGLKAEDATIAEMLKPMGYMTGQFGKNHLGDKDEHLPTNHGFDEFFGNLYHLN
                     AEEEPENVDYPKDPEFRKKFGPRGVIRSYADGKIEDTGPLTRKRMETVDEETLDAALD
                     FMDRAVKAKKPFFVWWNATRMHFRTHVKPDNQGKTGISTYADGMVEHDNHVGQLLKKV
                     DDLGIKDNTIVFYSTDNGPHMNSWPDAGTTPFRGEKNTNWEGAYRVPAMVRWPGKIKA
                     GSVSNDIMHHMDWMPTFVAAAGDDNIKEKLLKGYSAGDKKFKVHLDGYNFLPYLTGKE
                     EKAPREEIFYFSDDGDLTALRYNKWKLVFMEQRAKGTLRIWAEPFTKLRVPKIFNLRM
                     DPYEVADVTSNTYYDWMLDRAYMLVPAQTYVGRFLETFKEFPPRQKAASFSLDQVMEK
                     LQENPNK"
     gene            704356..706671
                     /locus_tag="VP_RS18455"
                     /old_locus_tag="VPA0681"
     CDS             704356..706671
                     /locus_tag="VP_RS18455"
                     /old_locus_tag="VPA0681"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="WP_005477586.1"
                     /translation="MTQWASWKQAIVSLAMLVSFSLFGQQNVQTPPEVVQARFIGNET
                     CIDCHQVEVEAWQGSHHDMAMRHADSESVLGNFDNQAVEHQGKANRFYRKGDEYWVNI
                     QGPDGQWHDYKISYTFGWVPLQQYMVEFDDGRIQLIPFAWDSRSVEQGGQRWFHLYPD
                     TTTTDEFYWTNTGQNWNFMCADCHSTNLKKNYDAQSNTYQTTWSEINVSCEACHGPAS
                     LHVEMAKQAKQNGMPIATANHYGFSRDLSAAVKEWVYKEGHSTLQPKDIVPTNQVQTC
                     AQCHSRRTQLNEEADHVKGAFLDKYRLSLITPELYYHDGQIYDEDYVYGSFLQSAMAE
                     KGVTCTNCHDPHSAQLKIPEEAVCAQCHVASDYLPENHTFHQANTEASKCTTCHMPET
                     TYMQVDPRRDHSWHVPRPDLSKHINTPNVCTACHDDKDAKWADEQIGQWFPKSKYRNT
                     QHFSVAFYADAIGHRGGSDALAYTAQDSSISDIIRASALERMAGNTGQNTLVALARAV
                     KHENEMIRLGAVAGSAGYDFSDRWQILQPLLSDPVLSVRTEAAAALVSHYGEMNPLQR
                     ERIQKPLDEYMDIQRFNADRGFGRTNLANVYRSLGEASKAIELYQQAIDIEPYFENSY
                     VNLADMYRRQGDEAKAVQILNAGMKAQPKSSSLPYSAGLALLRQGNSKQANQYLKQAA
                     ESAKDNAQYWYVYGLALEKSDVLEASKALNKAFEVGGDPRHLYAQCEVLARNYRQGGV
                     AFAFEQCTKQLGAHAPEEVIQQLKATVTTKK"
     gene            complement(706658..707527)
                     /locus_tag="VP_RS18460"
                     /old_locus_tag="VPA0682"
     CDS             complement(706658..707527)
                     /locus_tag="VP_RS18460"
                     /old_locus_tag="VPA0682"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005388131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011106324.1"
                     /translation="MSNVMDLNLIQTFLVVAEFQSYTKAAEQLGLTQPAVSAAIKRLE
                     QVVDKQLFVKKGRGITLTSAAYQLLPQFEQAVSIIDNAIMEKKHFEVCCSEILLHIMS
                     PIKNAIFYESPPEKYILFELLRQQKVDLVIDTVVTKDAAFVMEEAYEEKAVIICREQH
                     PRIQGTLSKEQFYDETHCLFSGKWNNMSGFEQLAQETILERKVDLVTSSLAGMALYVA
                     QRDCLGLVSQSFANKWSKALKLQVLPCPISICTIPYKFVYHKRELNNPAHIALRERIK
                     THLAAAHYEPISL"
     gene            707657..709183
                     /locus_tag="VP_RS18465"
                     /old_locus_tag="VPA0683"
     CDS             707657..709183
                     /locus_tag="VP_RS18465"
                     /old_locus_tag="VPA0683"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005486512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="WP_005454209.1"
                     /translation="MKNATKTSSKKLVLNACTLALGAASAVAHAADKPNILVIFGDDV
                     GYWNLSTYNQGMMAYNTPNIDSIAKEGAKFTNFYAQQSSTAGRSAFITGQMPKRTGLS
                     KVGLPGAPEGISEKDPTIATMLKQMGYATGQFGKNHLGDRDEHLPTNHGFDEFFGNLY
                     HLNAEEEPENVDYPKDPEFKKKFGPRGVIHSYADGKIEDTGPLTRKRMETVDGEFLEA
                     AETFIDKQVKADKPFFVWFNTTRMHNFTHVPEEYQGKTGAGFYADGVKQHDDQIGELL
                     KKVKDLGVDDNTIIVYTTDNGPMVDLWPDAGMTPFRSEKNTGWEGSFRVPALIKWPGH
                     IKAGETFNGMMSLEDFFPTLVAAAGDTKVKDELLKGKKVGKMNYKVHLDGYNQLPYIT
                     GKSDKSARNEFVYWSDDGDLVALRYGKYKYHFMIQENETGMDVWRKPFTKLRVPLIFD
                     LSIDPFERGDQGMGYSRWMYERSFLMMPAVEKVKEVMGTFKEFPPRMEAGSFVPKSSK
                     "
     gene            709298..710599
                     /locus_tag="VP_RS18470"
                     /old_locus_tag="VPA0684"
     CDS             709298..710599
                     /locus_tag="VP_RS18470"
                     /old_locus_tag="VPA0684"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005390118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic sulfatase maturase"
                     /protein_id="WP_011106325.1"
                     /translation="MSKISPRHSTTMPIVPLKTASKAPVSGAYDRRFHVMAKPGGAKC
                     NIDCQYCFYLHKENLLHQEKQPKMDDATLEAFVKSYIESQDGEEIVFSWQGGEPTLLG
                     LDYFRNVVALQKKHQPKGVRIENDLQTNGILLNDEWCAFLKEHNFLVGLSIDGPRELH
                     DKYRKTRSGKPTFDLVMKAVDKLQAHGVKFNALVTVNRHNAKYPLEVYRFLTQELGVT
                     YIQFAPVVEANDFQTTAPQFWNEQMIPTKGSDLAKPGHLMSVVTDWSVDPEDWGRFLM
                     ATFEEWVNNDLGRVLVNLFETAVAQVMGKPSQLCVTAEFCGKGLAIEHNGDVFSCDHY
                     VYPEYKLANIHEHSLNDMAFSTRQYTFGMAKRESLPTYCKQCPYLPYCWGECPKNRLI
                     KTPNGEAGLNYLCSGIKMFFDYALPMLVGLAQLLQSEEPQR"
     gene            710685..711668
                     /locus_tag="VP_RS18475"
                     /old_locus_tag="VPA0685"
     CDS             710685..711668
                     /locus_tag="VP_RS18475"
                     /old_locus_tag="VPA0685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019825004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MoxR family ATPase"
                     /protein_id="WP_005376549.1"
                     /translation="MNHAQQAIKELIEQTEKSVIGQSHVVRALVIGLLTNGHILLEGL
                     PGTAKTRSVKSLANLLNTSFGRIQFTPDLLPSDVTGTEVYQELDGKPQLHFQPGPIFN
                     SIVLADEVNRAPAKVQAALLEAMAEGTITVGDKTHVLPDLFMVLATQNPVEQEGTYPL
                     PEAQMDRFIMKVTVDYPEDDAERDIIRLVRSEELGAETSSEIITPKHIEPDVVLEARR
                     QLPNIVVSDLVENYIVALVMATRKPERYADSNLAKWIEIGSSPRASIALDKCARAYAW
                     MQGRDHVTPDDVRAMVPSVLGHRFSLTYDALADGVDHQRVVQELLDCVEIG"
     gene            711681..712643
                     /locus_tag="VP_RS18480"
                     /old_locus_tag="VPA0686"
     CDS             711681..712643
                     /locus_tag="VP_RS18480"
                     /old_locus_tag="VPA0686"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017088119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF58 domain-containing protein"
                     /protein_id="WP_005477595.1"
                     /translation="MAKPTLAPKSQGMDPRLYCDYARLVRLQAQAESFSLLPHLKAGS
                     VLSGRHNSLFRGRGLNFEELRHYQLGDDIRNLDWKVTMRTGKPHVRSYTEEKDRNVIV
                     CVDQRSAMFFASTQVMKSVVAAEIAAMCGWRVLKDGDRVGFVIASQQALFHSKAQRSQ
                     NDLLAQLKRLAKANQSLNVDSRDGEKVTFSQWIELIKRMKLKQSTLIFISDWSDCEEH
                     HLDHLKQLQQHNDVLAVMVSDPLEQALPDDLAKSKWVVGDGQYQLNLDSKAKVEAASA
                     KLEARTSLQRQSLSQLMAMKHLPHIELDTTGEHIKQFQKLVGGR"
     gene            712644..713222
                     /locus_tag="VP_RS18485"
                     /old_locus_tag="VPA0687"
     CDS             712644..713222
                     /locus_tag="VP_RS18485"
                     /old_locus_tag="VPA0687"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005477551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4381 domain-containing protein"
                     /protein_id="WP_005477551.1"
                     /translation="MSGLPTPPSTYILRELHDVAVPPSVSWYPQTIGWKILAAVALIA
                     LVYVAYRLAQQWWCNRYRQEALLTISQIKPSDKGMPKALFSVLKIVLIHVDSRNAKLF
                     DTAFLRKLDALYPQTGDSQANSQVVFNDELSKRWLQSIVDPSVMLTNEERVTLIARAK
                     NWVSEHRCDAQKNAAKKSPLLKRKANQGGQHE"
     gene            713215..714285
                     /locus_tag="VP_RS18490"
                     /old_locus_tag="VPA0688"
     CDS             713215..714285
                     /locus_tag="VP_RS18490"
                     /old_locus_tag="VPA0688"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VWA domain-containing protein"
                     /protein_id="WP_005477545.1"
                     /translation="MNDLLASLTGLSGFEFAHPMWFLILPLPLVVYYLVPAYRTKQMA
                     IKVPFFSQLVEAIGETPSEGASQLTPSWWQRATLILSWLLVVCAMAKPTVLGEPQVRE
                     SLGRDVMVVVDLSGSMAEPDFTSRTGEKISRLDAAKEVLTEFVQSRKGDRLGLVLFGD
                     AAFVQTPFTADQKVWLELLNQTDVAMAGQSTHLGDAIGLAIKVFEQSDKSRGALEQDQ
                     NREKVAIVLTDGNDTGSFVEPIDAAKVAKAKGVRVHVIAMGDPETIGETALDMDTIHR
                     IAKESGGEAFEALNRDELSAAYDEIGKLEPQLYESTTYRPKQSLHHYLMALVVIMHLL
                     AFSVATLKRRAATRSSLGESDV"
     gene            714278..716008
                     /locus_tag="VP_RS18495"
                     /old_locus_tag="VPA0689"
     CDS             714278..716008
                     /locus_tag="VP_RS18495"
                     /old_locus_tag="VPA0689"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017448136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VWA domain-containing protein"
                     /protein_id="WP_005477597.1"
                     /translation="MFDSLSWTQFFTQFHFIRPLWLLALIPMFFLVWLRWREESKPSW
                     KDILPGHLRNALTIGERGWRKQLPLKLLMLIVLIAIVICAGPTWQRESSPFGEDKASL
                     LVVLDNSDSMLQKDLPPSRLERSKQKVRDLLAARKGGKTGLVVFAGSAHVAMPVTQDS
                     KVFDPFLAAITPEIMPVKGKLAEKALPLIDQQLQGQPGSTVLLVSDGVNPATIKQYQA
                     YFAGKPYQLLILAAGNTDIVSNNPMDLDSLQKLASQTNGRLVEVTVDNSDIEQLNRYV
                     ERNMQLNGESSMPWKDMGYQLLFPIALIMMLWFRKGWLVQWCVIAMVSGTLLMPTSAM
                     AENISVKAEQPQVVQKVTTFDKVAQWWWDLWLTPDQQGQRLFNQQAYLEAAKHFVDPL
                     RKGTAYYYASEFELARSAFLEMQNDPSEEVRDYGLYNAASALARQREYLAARDLLKSL
                     ASKPTLNESLRPDVEHNLKVIAGIVDEINQMSESQAGTEQEASTELGDNPQTAEGADE
                     QTSAELMIKETLSADDILGSQELAEKWLKRVEADPKYFLRAKFQIQLRSPTTASSTTT
                     TENNTEEAAQ"
     gene            716008..717321
                     /locus_tag="VP_RS18500"
                     /old_locus_tag="VPA0690"
     CDS             716008..717321
                     /locus_tag="VP_RS18500"
                     /old_locus_tag="VPA0690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017821551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BatD family protein"
                     /protein_id="WP_031778795.1"
                     /translation="MMNVHRVTSFALPVRIVAWLVVCLSLFVSRHVFAQDIYDLQRNH
                     GVELQAWVGQQPTAGEKRKTPSFSVNEQVILTIEVATPRWFTGGTRIGSIEMPNVIAK
                     QRNQLATNFTEHKGGQTWSRQRWEVTLYPQASGDFVIPPVAVGVQVSAPDGEKVSGTL
                     YTQPIKFKTVLPSGLLSDDTPWFSATHVDVKQEWETSTESLKVGDAITRKITISAQDS
                     LSVLLPDLLKGESTIRYQAYPQPHRLTDTQTRGDYQSTRTEESVYVIQQGGELTLPDY
                     EFRWWNSKTQQVETVVLEGKTFAAKHTLKSFIKTYFAWIVSTLVFLGFVTVSLVAIKR
                     YYRNKPTPAWLTFHRLLKAKRWSEARTVLYKQLRLNTAELEMTKADSSESWQKSASRM
                     QNGENSAHLMKSMWRKIQTKQQRFKFRIPRALPELDKVIGRDGNE"
     gene            717371..717796
                     /locus_tag="VP_RS18505"
                     /old_locus_tag="VPA0691"
     CDS             717371..717796
                     /locus_tag="VP_RS18505"
                     /old_locus_tag="VPA0691"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017079591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin-specific deaminase"
                     /protein_id="WP_005477591.1"
                     /translation="MSQEFMRRALEVSKNALPECQPNPPVGCVLVKDNQIVSEGHTQA
                     IGGNHAEVEALNAYQGSLESVTAYVTLEPCSFVGRTPACAVTLVKSGIGKVVVAMLDP
                     DPRNSGRGIEILKQAGIEVEIGLCSEEVSEFLTPYLGKS"
     gene            717970..718875
                     /locus_tag="VP_RS18510"
                     /old_locus_tag="VPA0692"
     CDS             717970..718875
                     /locus_tag="VP_RS18510"
                     /old_locus_tag="VPA0692"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015727837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005454286.1"
                     /translation="MKPTDLNLIPIFIAIYEERNLSRAAARLDITQPAVSKALARLRD
                     IYDEPLFHRSSSGVEPTSFAVDIYPAMVAAIKNFTSTLSASVEFDPKVSNRIFSIACV
                     SILSYELLPQLMKQIHELAPNIALEVHPLFTEDYESDLRLQRYDLIIDLAPRGRTVLK
                     VEPVITERLMVVCNKDHPRIAESISQEQFFEEEHVAVSQWQSRKSMLSAEDIVDLDKR
                     KIMYRAAGALEMLPVICGSEYIGLMPESMIKLFSNTYHVKALPFPFDVTTYDLCTIWH
                     PSRTNESAHQWLRAQIKHAGKVIKK"
     gene            718885..719784
                     /gene="yegS"
                     /locus_tag="VP_RS18515"
                     /old_locus_tag="VPA0693"
     CDS             718885..719784
                     /gene="yegS"
                     /locus_tag="VP_RS18515"
                     /old_locus_tag="VPA0693"
                     /EC_number="2.7.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020197459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid kinase YegS"
                     /protein_id="WP_005477542.1"
                     /translation="MKTIRAILNGKKAGNPELRDAIMKMRDRGVDVQVRVTWESQDMP
                     RLVKEAVTDGIERIVVAGGDGTVNEAASALIHIDHESRPELAIIPLGTANDFATANHI
                     PDSIADALTLAVEGQALSVDCVKANDRCFINVAAAGFGAEVTAETPVELKNFLGGGAY
                     TLTGVVKALGFKPYDGSITIEGGRYDGEMLLGAFCNSRLAGGGQQLAPNAMIDDGLMD
                     LTLVRPFLPHELPKVIEEINNPSEKGEFVKHTRASWLEIDFPNPLPLNLDGEPYHSRK
                     IRFEVQPKSLKLVLPKDCPCVTH"
     gene            complement(719919..720254)
                     /locus_tag="VP_RS18520"
                     /old_locus_tag="VPA0694"
     CDS             complement(719919..720254)
                     /locus_tag="VP_RS18520"
                     /old_locus_tag="VPA0694"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009385373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YgiW/YdeI family stress tolerance OB fold
                     protein"
                     /protein_id="WP_005454158.1"
                     /translation="MKKMILASMFALLSSSAFAAFNGPEVSVINTVKDAQNATEDSAV
                     MLTGHIIQSLGNETYLFKDSTGEIEVEIDNEEWMGLDVTPNDKVAIRGEIDSEWTTMQ
                     IDVDTIQKL"
     gene            complement(720270..720917)
                     /locus_tag="VP_RS18525"
                     /old_locus_tag="VPA0695"
     CDS             complement(720270..720917)
                     /locus_tag="VP_RS18525"
                     /old_locus_tag="VPA0695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009385372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin family protein"
                     /protein_id="WP_005477593.1"
                     /translation="MNKTLLALLVTCSVSVSAAPYVGLEYGLGTTDHDLEPHFSADNV
                     TLNPELEDGIFSGFVGYAFNDNWALELGYSQFDLDDSRSKNLGIKPIDGKDYHHEMDW
                     DASIKAKQVSLAPVFSYALNDKWTTKFKAGLTYTQYDAKVSKHQEYELVANDDVEMTN
                     TLFHSAEKNNEFGAMFSVGAEYQVFPKLTIGANAKYQLDSYANTASFNVGTTYYF"
     gene            complement(721095..722078)
                     /locus_tag="VP_RS18530"
                     /old_locus_tag="VPA0697"
     CDS             complement(721095..722078)
                     /locus_tag="VP_RS18530"
                     /old_locus_tag="VPA0697"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase-like hydrolase"
                     /protein_id="WP_005477561.1"
                     /translation="MNKIHLCTLAVLTSLSFSSLAKDCDANLLPSWKDSDSKTAIVNF
                     VEQSTDSSKATFIPVSDRIAVFDNDGTLWSEKPIYFQIAFALDQIKALAKTHPEWKTQ
                     EPFKSVIENDLEKVFAGGKESLLQIMKVTHSGMTVEEYQQSVEQWLAAAKDKRFGKAY
                     NDLTFKPMREMLTYLQENNFKTYIVSGGGVDFMRVWAPEAYNIPEEQIIGSALKYEYS
                     FNDGQPKVMKLGELLTLDDKEVKVENIQYIIGKKPVLAVGNSDGDQAMMQWATSQPNS
                     MAMIVHHTDEAREWKYDRQSDVGRLDKALDEANERDNWQLIDMKNDWCAVY"
     gene            722457..723779
                     /locus_tag="VP_RS18535"
                     /old_locus_tag="VPA0698"
     CDS             722457..723779
                     /locus_tag="VP_RS18535"
                     /old_locus_tag="VPA0698"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010429281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic sulfatase maturase"
                     /protein_id="WP_005477554.1"
                     /translation="MQITQSPQFNGKASKRLHVMAKPIGAACNIDCTYCYYLSKQDLL
                     EYKKGCSPMMDEATLEAYIKQYIEGQNTPEIVFSWQGGEPTMLGLDYFKKIVEFQAKY
                     QPAGVKISNDLQTNGTLLNDEWCEFLSENHFLVGLSIDGPEMLHNAYRTNRAGRGTFK
                     QVMNAVELLHKHQVNFATLTCVNNLTSRNPLEVYRFLRDEVRSPQMQFIPIVEQKTFR
                     TTAPQKWLPQEQLKQGDKRLIPGHKDSVMEPWCVADEAWGNFLIAIFDEWIKNDIGKV
                     FVQYFEASVEAWMGRANPLCTLGEVCGKGLAMEPNGDVFACDHYVYPEYKIGNIHHDK
                     LDELAYSKEQQKFGFAKSRLLTQQCRDCEYQFACYGECPKNRFIRTRDGEPGLNYLCA
                     GWKKFFAHADKAMAYILRATGNVVAHGKYSDSVVRQESEQRPVFETKF"
     gene            723867..724916
                     /locus_tag="VP_RS18540"
                     /old_locus_tag="VPA0699"
     CDS             723867..724916
                     /locus_tag="VP_RS18540"
                     /old_locus_tag="VPA0699"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="WP_021451835.1"
                     /translation="MLSKSLLAVTLGAVINHSVMAQTPTEQTQALPTAAEQVQQPTPQ
                     HVISKLAYQAQDQKLPTEQRVQALRELGNYPNQNALVAVARGLQDKDAAIREAAIVGA
                     QPYAIENRWRMVEPLLKDESSSVRIAAALNLVRDYSVLTEAQRPAIEKPVDELLASLK
                     SGTDNNTQLLLADVYRWHENWQQADDIYQGLLSKMPENPDVWLNLADNYRAQQREQEA
                     IDTLDKAIERLPDNAALHYSKSLTLVRLNDKEQAANEIEKAANMAKNNSYFWYLNGVL
                     QEEFSVDKAVKSFEQAYLISGAPEQLYAVCDIYIRYDNPKTDECLAELEKVAPSYVID
                     QLKQKRALTSAKPKS"
     gene            complement(724913..726550)
                     /locus_tag="VP_RS18545"
                     /old_locus_tag="VPA0700"
     CDS             complement(724913..726550)
                     /locus_tag="VP_RS18545"
                     /old_locus_tag="VPA0700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005477565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VRR-NUC domain-containing protein"
                     /protein_id="WP_005477565.1"
                     /translation="MESPIELAPDYYLENFFKLTHHAVTWYSDLLTEEEHAWLCSFDS
                     LNKHAQCLLVRLYSRKGCWFRSDKLNYQEIPLIDAALAELGGQDFISLSPPLSHQEVA
                     ANLLTKPEISALYPELPKSLKKDALVERLSNTEFDRVEQLEFTIVRLNSAHMIDVLLT
                     LFFANTHQDLSQFVLDDLGLHQFEQYQLSKVRRFFNSREQIDRLIELSQLANLYWQFD
                     RKDKANLDLLIEAMPHPVHHPYVDRKREHMLNDIARDYERIDELETALSLFGQTQLTP
                     SRERRARIYDKLNHDDLFSDIVTEMLHSPIDVSELEVAQKLEQRLKRKQGEKVPRVTK
                     PTCMEYRVELDLSQQRVELASKAHFESLGWSVFYAENALLNALLGLTFWDAIFAPIEG
                     AFINAYQHRPLDLYHSDFVAKRQALIDEAFAQLKLGNTQAILTKYDEKFGISNPFVQW
                     SLIGKELLEQSLNTIPTRTLLELFKVQLSDLKLYRNGMPDLIAFRDNEFEWIEVKGPG
                     DKLQDNQWRWIKEFSRLNVPFAVCYVTARKEDEKRVD"
     gene            complement(726618..727850)
                     /locus_tag="VP_RS18550"
                     /old_locus_tag="VPA0701"
     CDS             complement(726618..727850)
                     /locus_tag="VP_RS18550"
                     /old_locus_tag="VPA0701"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004745674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OFA family MFS transporter"
                     /protein_id="WP_005486542.1"
                     /translation="MSKIDKAMRILLAGFCINLCLGILYAWSVFNKALVTESGWSAAE
                     ASAPYATATITFSICLLVAGILQDRMGPRMILILGTVLTGLGMIASGFVDSPLMLNIT
                     FGVITGAGIGFGYACLSPSAMKWFHASKKGMVNGIIAAGFGLAAIYLAPVTSALIDSM
                     GIQTSFMVLGVGILAIAVPLAATINNPPADYTPAEPKVKEGQAPKAVKKSDDLTWKAM
                     LKTPQFYSLWIMYAFAASVGLMIIGNITTIASVQANLPNAVYLASILAVFNSGGRVAA
                     GMLADKIGGVRTLLLAFVLQGVNMVLFATFDSEFTLIIGTAIAAVGYGTLLAVFPTLT
                     AEFYGLKNYGTNYGVLYTAWGIGGAIGAAVVGFSMTNGDGYTLAYTISSAMMAVCIVL
                     AFITKPLSEAKVAQLKNA"
     gene            728426..728782
                     /locus_tag="VP_RS18555"
                     /old_locus_tag="VPA0703"
     CDS             728426..728782
                     /locus_tag="VP_RS18555"
                     /old_locus_tag="VPA0703"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009704179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005454342.1"
                     /translation="MKLFLLLMASVSAGVASADHIHSFMLGLSIASLAVGSCYFFAFR
                     SSRFPQLALFLLICGMLSKLTITVVGVMWGMSAQLITSPIVFALSYLFFSLAVTYLWF
                     SYRESITQIPERFKAA"
     gene            complement(728937..730790)
                     /locus_tag="VP_RS18560"
                     /old_locus_tag="VPA0704"
     CDS             complement(728937..730790)
                     /locus_tag="VP_RS18560"
                     /old_locus_tag="VPA0704"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005486566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M48 family metallopeptidase"
                     /protein_id="WP_005489375.1"
                     /translation="MDFFHHQDTARQRTGLLVMLFTLAVLAITGLVSVISIGIYFYFT
                     GEPFTTQSIISYCLLSFVGVLLVVSISSFIRLSELNANGGRGVAESIGGKLISTDTSN
                     AKHRQLLNVVEEMSIASGIPVPPVYVMAEEHGINAFAAGMSIDDAVIGVTQGALDAFS
                     RDELQGVIAHEFSHILNGDMRLNTRLIGALFGITCIAHFGHLILDNSNSTRHVSRSSS
                     DSNKGFAVIILIAIVCLVLGWLGTLFGNMIKAAISRQREFLADASAVQFTRNDQGIAG
                     ALKKIGSNVQGSTLNTKASDEMSHMMFGQSKLSGFSGLFATHPPLDERIRRIEPNWDG
                     SYAQHSHAQNTAFDNEQVSGFAVGGGSPASQSASPSEQLSETGQQLISQLPPELVDIA
                     REPYSARFIAFALIFDGSDIQREMIKSYVPLASQSTLLPWLDYDLPLHLRFPLLELAL
                     PALKSLSEAQKISLCKVLRELSETDNQYSLAEWCVINLLEKQLLASFGFIKQHKSLKQ
                     LEESVFWLLRELAWVSHSQADKAQRAYHCALAHLGFPEVKLEPANSNWHLSRAALELL
                     LQLKPNDRRMFVKACRLAIESDGEITVAEGEIYRVIACFLEVPEPPLTISG"
     gene            complement(730790..731380)
                     /locus_tag="VP_RS18565"
                     /old_locus_tag="VPA0705"
     CDS             complement(730790..731380)
                     /locus_tag="VP_RS18565"
                     /old_locus_tag="VPA0705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017422746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LemA family protein"
                     /protein_id="WP_005477566.1"
                     /translation="MTALIVFIVIVLLVVVYAISIYNKLVTLRNRFKNSFAQIEVQLK
                     RRYDLIPNLVNTAKGYMDHEKETFERVIQARNQAIAGLKAASDAPDSNAAISQLSQAE
                     GMLQNALGKLNVVVEAYPELKANETMSQLQEELTSTENKVAFARQAFNDAVTSYNTYK
                     QTFPPVIFANTFGFQDGKLLEFADTEAIQEAPKVAF"
     gene            complement(731610..732977)
                     /gene="dcuC"
                     /locus_tag="VP_RS18570"
                     /old_locus_tag="VPA0706"
     CDS             complement(731610..732977)
                     /gene="dcuC"
                     /locus_tag="VP_RS18570"
                     /old_locus_tag="VPA0706"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017633046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic C4-dicarboxylate transporter DcuC"
                     /protein_id="WP_005454288.1"
                     /translation="MLELLIGLVVTIAVGYFIVKGYKAAGVLLTAGISLLLMTGFLGH
                     DVLPSSITSTGNMVTDSLEYVKYMLQYRGGGLGMQIMLLCGFASYMTHIGANNVVVKQ
                     FSKPLSVIKSPYVLLVAAYIVACLMSLAVSSATGLGVLLMATLFPMMVAMGISRPAAV
                     AVCASPAAIILSPTSGDVVIAAEKSGLALDVFAVQTVLPVSICAIVVMAAAAFFWNKY
                     LDKKENTPMEKIDVSEIKADAPAFYAALPFLPIIGVFLFNGRTIPGLSLDIYTIVVGS
                     IFLGALIHYVVNKFDGKKALEDLDSCYAGMADAFKGVVMLLVAAGVFAQGLMSIGAID
                     NLLHLADNAGAGGVALMLILTGLTVAAAIATGSGNAPFYAFVELAPSLAAKMGINPAF
                     LIIPMLQASNLGRTISPVSGVIVATSGMANISPFEVVKRTSVPVLAGLLTVIIGTMVL
                     VPMTA"
     gene            complement(733331..734455)
                     /locus_tag="VP_RS18575"
                     /old_locus_tag="VPA0707"
     CDS             complement(733331..734455)
                     /locus_tag="VP_RS18575"
                     /old_locus_tag="VPA0707"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017030767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase"
                     /protein_id="WP_005454080.1"
                     /translation="MNQNKPPFIWLNILIFSASFVLTFIVMPWYAYHYGLGWEHLIWG
                     ILAFSFTNLSITAGYHRLWSHKTYEAHPVLRAIFAIGGAFSLQNSALHWSSDHRVHHK
                     HVDNNDKDPYSAKRGFWYSHIGWMLRDYNKSKENEYTNCRDLKRDSIVMWQHNYYVPL
                     ALLTNIGFPVALGLIYGDVWGMLLVVGAARLFLSHHTTFFINSLAHVWGKQTFTDKNT
                     ARDNGVLAFFTFGEGYHNFHHIFENDYRNGVYWWHYDPTKWLIKSCSWLGLTSKLRTT
                     STFRIEKARATQLLKKAKEKLESKPNAQTVLDQLQQEFDALVHHMQEYYEARKELLGE
                     KTANVVKKYECSVSKLKYQQLKTEFERQQRSWNLMIRRYA"
     gene            734727..735275
                     /locus_tag="VP_RS18580"
                     /old_locus_tag="VPA0708"
     CDS             734727..735275
                     /locus_tag="VP_RS18580"
                     /old_locus_tag="VPA0708"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012129598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_005481267.1"
                     /translation="MELRLAEYKDYERIAQLHADSWKRHYRGILTNTYLDSEAIDDKL
                     LIWQTRLTNPPFNQHIVLAEEGGLLLGFVCVFGNHDFERGTFIDALHVDDSYRGRGIG
                     KQLLLAVAEWQQQYFKDSGLYLEVVSQNTSAISFYQHIGGQECQERTWRAPGGTEVME
                     KVFRWSNAQALVSGIEENVIYS"
     gene            complement(735361..735978)
                     /locus_tag="VP_RS18585"
                     /old_locus_tag="VPA0709"
     CDS             complement(735361..735978)
                     /locus_tag="VP_RS18585"
                     /old_locus_tag="VPA0709"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005447139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family phosphatase"
                     /protein_id="WP_005481262.1"
                     /translation="MESSQIKNVVFDVGNVLVRWSPPEIVRLTFGHSVDAEQMAKRLF
                     SNKIWLDLNKGLISEEEAIHRYQQELDLTAEECCCFFYYVKQTQIQLFGSVELLQKVK
                     QAGYGVYALTDNVVEIVEHLKSTYNFWPLFDGAIVSAEVELLKPQPEIYQALLSRYDL
                     NPSETVFLDDMPYNVEGAKQVGMAAIQFENASQCESELKEMGLSF"
     gene            736298..738346
                     /locus_tag="VP_RS18590"
                     /old_locus_tag="VPA0710"
     CDS             736298..738346
                     /locus_tag="VP_RS18590"
                     /old_locus_tag="VPA0710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017089334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hybrid sensor histidine kinase/response
                     regulator"
                     /protein_id="WP_011106329.1"
                     /translation="MDSIRKVYEYAEPNLTLVGWMGFIGFPLYYFVWDFMFPQSYENL
                     PLRLFCSALFFGIIFRNRLSSSWRKYVHVYYQITITTCLPFFFFYMLLMNDWSNVWVM
                     SFMSAIFLHILLVHVTRVMFAQTFAGIGLATFFAWIAKGFHLDITMDWTHVPIFLFIY
                     VFGNMFYFRNQVEHEAKVSLAKSFGAGIAHEMRNPLSGLCTSIDVIQSVLPNKKAMGE
                     KDQYVMSGEDVTLLREVSEDAMNIIHSGNETIDLLLTSIDENRVSRSSFKRYSAQSVV
                     EKAIESFSYKRSTDRFAISFDARSEFDFLGSDTLLKYVMYNLFKNAFHHRSSDEFHIH
                     VSMQSNDTANQIVVTDNGSGIAPDVIRHIFQDFYTTGKSGSYGLGLPFCKKVMRSFGG
                     NIKCISQPGEWSQFTLTFPPITSDTVTEIKDELTKMKSILLVSNQDIIVQKMADISRF
                     MGFDVTVLDVKSVFKKKEYEFEFDLIFVDVESLDVLENQLDRIESLLSFTEARVVYLF
                     EHKPAQRAKKVGHDPIWVETQAWLLNTKATIERLLYDSTYISSTLPSAPLDKSIKRTI
                     MVVDDNESLRKFTAMLLEKQGFEVVQKEDGQQALDTLEKENIDLILMDIEMPIMDGVE
                     ASRRIRNSEKPYASVPIIAHTGDSSPVTLDKIGSSGMSDFIVKPADKNRLFDKIANWI
                     "
     gene            complement(738424..739605)
                     /locus_tag="VP_RS18595"
                     /old_locus_tag="VPA0711"
     CDS             complement(738424..739605)
                     /locus_tag="VP_RS18595"
                     /old_locus_tag="VPA0711"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004734845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quorum-sensing autoinducer synthase"
                     /protein_id="WP_005481314.1"
                     /translation="MCTKNETKPLPSFIEERLNFHIQDLIKSNENQKHLVLGKRPSEN
                     AVVMQSNDYLSLSHNELIQKAHRDAISERDDNVVMSAIFLQDDQSKPAFEHQLATFVG
                     MESCLLSQSGWAANIGLLQTICAPNLPVYIDFFAHMSLWEGARTAGAQIHPFMHNNMN
                     HLRKQIQRHGAGIIVVDSVYSTIGTIAPLRAIYEMAKEFDCGLVVDESHSLGTHGPEG
                     SGLLQKLGLTQMVDFVTVSLAKTFAYRAGAILGPNKLAQSLPFVAYPAIFSSTVLPQE
                     VVRLEKTLEVIKAADDKRECLFKRAKELAIGLKRIGFNIRSESQIIALECGSERNTER
                     VRDFLEERDVFGAVFCRPATGRNKNIIRFSVNADMTAQQVDHVLSACQEAFDHPDLEF
                     V"
     gene            complement(739959..740903)
                     /gene="ylqF"
                     /locus_tag="VP_RS18600"
                     /old_locus_tag="VPA0712"
     CDS             complement(739959..740903)
                     /gene="ylqF"
                     /locus_tag="VP_RS18600"
                     /old_locus_tag="VPA0712"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017052798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome biogenesis GTPase YlqF"
                     /protein_id="WP_005454328.1"
                     /translation="MVNNSIQWFPGHMHKARKEIEEAIPQVDVIIEVLDARIPFSSEN
                     PMISKIRGEKPVVKVLNKRDLADPELTQLWIDHLEKEQNVKAMAITTSEPQEVHKIME
                     LCRKLAPHREEVGKNIRTMIMGIPNVGKSTIINTLAGRTIAVTGNQPAVTRRQQRINL
                     QNGIVLSDTPGILWPKVENPHSGFRLAATGAVKDTAMEYDEVAFYTVEYLAAHYPERL
                     KERYQIEELPESDIEIMEEIGRRRGALRAGGRVDLHKVSEILLHELRQGTLGQITLEL
                     PEMITQELIEVEIETARKEEEKAKRKEERRKRYLRNKR"
     gene            complement(741193..741930)
                     /locus_tag="VP_RS18605"
                     /old_locus_tag="VPA0713"
     CDS             complement(741193..741930)
                     /locus_tag="VP_RS18605"
                     /old_locus_tag="VPA0713"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005489273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_005481296.1"
                     /translation="MKRNMPYLPSFKLTDFDIKTLVQPILCPRSQEIQYYETLSKIST
                     FAQSNINNDVFFSIIDNTFIQTLALQQIRFSLEKYPHQLHSFNIKLSCLADEDFVREL
                     LSFHGAKFALEISELDCYTESKEIRENLSVLQANNIEIWLDDYHRNNKLANMSLGNIL
                     WDRIKIDKSFLKHADQESIQALEYFLAPFCLHGLIFEGAEYIEHHKMLKTSQSLTQGY
                     YYFRPSPINSLDSKPRVAESIKLSYAG"
     gene            complement(742110..744311)
                     /locus_tag="VP_RS18610"
                     /old_locus_tag="VPA0714"
     CDS             complement(742110..744311)
                     /locus_tag="VP_RS18610"
                     /old_locus_tag="VPA0714"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005481315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="collagenase"
                     /protein_id="WP_005481315.1"
                     /translation="MLGVLTGCGGDDSSGGVKTVPVADVDSTVDDDTDTDTDTDTDTD
                     DSTVDDDSTKDDDTTDDDTVVDDDTELFPHKGKCTVEDFTVDRVNIESRVANSDYECM
                     RTWFSPSLEQADVVFSTMSMSRITGGLKKAIEAYKGTKEQAQQIYYLGEFIKAAYKNR
                     HDTFAKKLQPFSSELSADIANTIQQFLRSPYALTEGREQQEALASMLIVVDSIRQLAI
                     AAPDVFAILDSFSADKSDSYYYRKAINNIFVAMAGHSQTKAFYDVIESDSSYIHRLSG
                     FITNNEWAIGTDSEQLLGNAARELARLVKTEDAETRKVVVDTLDSLLKRYPLGGKSDR
                     IWVGIAEMVDAYASDYLEQLGLSNSKSVLKQRIMTFSYDCRGPARILAQEMTEAQAIT
                     SCETLNLKEDDFHQTVNTGYQPVADDHSDSVDVIVFKTKSDYSTYSSFLFDNTTNNGG
                     QFLERDPSKQGNVPRFVAYQNGWDDDFSILNLEHEYVHYLDGRFNQYGDFHDTMREGN
                     IVWWLEGFAEYMYYKEGYNAALVLGKEKTHTLADVFSTNYSDGLNRVYRWGYLAVRFM
                     IEKHPEDVTELLGYSRTGQYKEWVKLLERLGPAYNTEFHSWLDEVTKDIDDSDISQPK
                     PKEKPKKIELNTSIQVSGKKFSETLFFVDVSESYNQLEVSISGTGDADLYACYDKVCH
                     YFEYEWSNYTHGSNETISIPKNEDGSIKMGQYYFSISGREEFDVELSVVAK"
     gene            744613..747612
                     /locus_tag="VP_RS18615"
                     /old_locus_tag="VPA0715"
     CDS             744613..747612
                     /locus_tag="VP_RS18615"
                     /old_locus_tag="VPA0715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M6 family metalloprotease domain-containing
                     protein"
                     /protein_id="WP_031778794.1"
                     /translation="MVSFAHANTLPAPTWHQFQLNDGSKKELKLYGDQESFWYQDREG
                     IIYVYDEETGWFYGNHEIVDGRFVVTSLGVEAKLEMTQAVRELLKERVTPTSSLLPSE
                     HVYPMNEPYLEQTPIRALNATNEPTHQPLLVVQVSFNNQDFVNDFTNVIFGDNQQSVK
                     DYFSKNSYGRYIVEPAKETEGTANDGVIDLTLDIAHPNCHSKNDATCDSKLNEAFKAA
                     YDKLDRYVDLSTYDLNNDDKITPDELSVMFVFAGYDKSAGSVNTPYIWPHRYSHNAIE
                     IDGKTIRDYCLFADFQGDHQSTMGVIAHELGHLMLGLPDLYSYKHSGSVGQWGLMGGG
                     SWASKQGDTYAGETPVNMLAWSKEAAGFIKPKVIEASGSSTIETRQGEGVVYLDPYLK
                     QQGPRAYFENRRKTEYDRALSGEGLLITAVSIDNRFNDTGPMQVQVFQADGLDELQTR
                     GWSDQGDVFPGSSNVVTISDDTTPSLKLITGGRETNISINDIASTDQSSTLRASIPSS
                     TNKSAWITSLSRTYVYEDSRNNTIGFGLENNDGYQSLVGFYLFAKPILPNSEMRYRMF
                     KYELTTNRWGNASINVDTQVEVSSGVIPTFGGRVMFASPFDIDEGEQLLVIELENAKP
                     EYSYSFLDAYLSNGEKKKQFYGNASSYKTSGLSEGRGRNYPFAALLEKPQAKPSITVE
                     TDSVTVLSGESITIDVLANDHSSDANSTLKLDKITSKPSIGSAEISGQKIHYSVPVSD
                     IPEQRAVMKYQVSDDFGTTAEGEVVITINSPVITANSLQYKALEDTPLELNLHQQQGL
                     EKGDTIVIKKPPMHGKIDGNTYQSKENYFGNDQFEFSIMKENGRESNTAMAVITVEAV
                     NDEPIFAVEASRKEGLSNEKVTLSVLSLKDVDSTDHSFKWRQVSGTKAQFATTDTASV
                     EVTLPKVSEKSEKLTFEVAVNDNDGAIITKSVVTVVKQEVVVENDPGKSEEGGSMGLW
                     VTLCMMLISLRTKVNNLYRFVIRNDIW"
     gene            747659..748642
                     /locus_tag="VP_RS18620"
                     /old_locus_tag="VPA0716"
     CDS             747659..748642
                     /locus_tag="VP_RS18620"
                     /old_locus_tag="VPA0716"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_005454316.1"
                     /translation="MKETNKKNLRVVALAPTGRYFASIISSLEILETAAEFAEFQGFM
                     THVVTPNNRPLIGRGGISVQPTAQWQSFDFTNILIIGSIGDPLESLDNIDPALFDWIR
                     ELHLKGSKIVAIDTGIFVVAKAGLLQQNKAVMHSYFAHLFGELFPEIMLMTEQKALID
                     GNVYLSSGPYSHSSVMLEIVEEYFGKHTRNLGNQFLSTIESSGNSHSYCDVFRYMQHR
                     DELILKIQKWILTTDLDIVSISDLANEACLSERQLKRRFKEATSISPLKFIQLGRLSF
                     AKELLRSTKLSIDEVASRSGYVDTQFFRQIFKRENDCSPLEYRKRNQVKAE"
     gene            749250..750158
                     /locus_tag="VP_RS18625"
                     /old_locus_tag="VPA0717"
     CDS             749250..750158
                     /locus_tag="VP_RS18625"
                     /old_locus_tag="VPA0717"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005445982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005454057.1"
                     /translation="MKANKRTIDVKYLRTFSHVARHRSFTAAAESLYLTQPAVSQHIK
                     KLECTIGAEVFDRKDGFNLTKHGQILLSYTDRTMSLYDQLFDELAQVDMFDRYSIAIS
                     DSFAPELVAKVISSFRVYNDVELAITSYSDMNCVDKDNHDLVFAIGDTTSVEGRVFPL
                     NREQYILACDCAVKPEECYPERIVFCNTLTRRDAEVLLDSSGVDISKVKHWLTTSSSR
                     LMINELQAANTFVICPSWTLGDYKCSQYPLSKYIEMYVWCNDSAAKKIDQERLRSLIT
                     ETFRLTSKGVVGRPPTGRLLTSCEVM"
     gene            complement(750211..750654)
                     /locus_tag="VP_RS18630"
                     /old_locus_tag="VPA0718"
     CDS             complement(750211..750654)
                     /locus_tag="VP_RS18630"
                     /old_locus_tag="VPA0718"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011106333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin peptidase"
                     /protein_id="WP_011106333.1"
                     /translation="MNYINFALWLTCLVNVLLIFYGDIRYRIVKHRFLLIIFITSLLS
                     LFFTPEPLTQLAVSTSVFICFFILWLINIVGGGDVKLIGVLFLGVNDEYMLAAIVAIG
                     LLGGIQILVMWLMSVYRKKTPFENGIPYTIPIGISGLFFFYMSLI"
     gene            750849..751103
                     /locus_tag="VP_RS18635"
                     /old_locus_tag="VPA0719"
     CDS             750849..751103
                     /locus_tag="VP_RS18635"
                     /old_locus_tag="VPA0719"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009697504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Flp family type IVb pilin"
                     /protein_id="WP_005481274.1"
                     /translation="MLLNINSKLRNIRNKFKSDKRGVTAVEYAIIAVAMSSIILFVFK
                     DGTLKTTLNDAMGKISTSMDSANSAGGSGSKGGTADGKQG"
     gene            751162..751914
                     /locus_tag="VP_RS18640"
                     /old_locus_tag="VPA0720"
     CDS             751162..751914
                     /locus_tag="VP_RS18640"
                     /old_locus_tag="VPA0720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005445977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005481305.1"
                     /translation="MSRALIFVFVAITMFLAFFYVSDFFDQPEPVAVVENEVFVQVAF
                     VNRTVNKADPVNIDAIDIREFSESEAKQHSYTPYTSIKIESGALWAKDVTEGTQLTSN
                     LVSNPGEKDYMYLSLKKDQVPYYYLSQGSSIVEALPIQPGDRVSFVATTSSQSNLLES
                     GYSDIDSLTSNVIIDGALVLQAMNVSEDDSSNEDYGLIIALTVKQVLKLEMAQKIGAI
                     TLVPAKMVHKYLSVKSSDLIEHRFGVRQLRGN"
     gene            751917..753260
                     /locus_tag="VP_RS18645"
                     /old_locus_tag="VPA0721"
     CDS             751917..753260
                     /locus_tag="VP_RS18645"
                     /old_locus_tag="VPA0721"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein GspD"
                     /protein_id="WP_005454128.1"
                     /translation="MFNKNILLVTLGVALLLPASVSAGELLSLDKGAAKTINVKRNID
                     TVFVADTQIADYKVIANGKLVIYGIGRGATSIIAYDRAGNEIYNAEVVVNKSLRLLKQ
                     TIIARYPDEDIKLTNIGEQIVIDGVVSSEEIKDKVYRHVGEMLKKSKQRNTFELSGAN
                     GESVDPLDYTATYVFEDIINNLKVLTTDQINVKLTVAEVSSSFLTELGVSYAETNGKS
                     IGGAGQFVNKILDFTAEDIVAVISASGNDSIGQVLAEPNLSVISGESASFLVGGEIPI
                     TVRDNDGISVTYKEYGVKLSMVAKVTDSENIRLSLLPEVSSIDKTNGVNSGLVSVPSL
                     RTRKAQTTVQLKDGQSFVLAGLLTSEEQESLAKIPYLGDIPILGALFSKTNTERRKTE
                     LIIVATVNLVDPVKETDIKLPKFERTSDLERLLKLDLSKVDDEELENTIKAGGFN"
     gene            753260..753709
                     /locus_tag="VP_RS18650"
                     /old_locus_tag="VPA0722"
     CDS             753260..753709
                     /locus_tag="VP_RS18650"
                     /old_locus_tag="VPA0722"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005445974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005454289.1"
                     /translation="MKANLLLVVSVLLTGCSVSVTPNKTTVDTIVETFEFRVTNKDVA
                     MDKSVNFVNQINSQYPKSTFAINYDTEESQFVDGFVKEIKAKGVNKLRYTLNANSEGK
                     GVKIVAKYHKIQEQACGAVSFNTLKNHPFGCSLEYNRRLSMTNPVVE"
     gene            753713..754912
                     /locus_tag="VP_RS18655"
                     /old_locus_tag="VPA0723"
     CDS             753713..754912
                     /locus_tag="VP_RS18655"
                     /old_locus_tag="VPA0723"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005445972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_005454059.1"
                     /translation="MDLDNLFKTTSSSKDKKNNTIDLVVSDDMAFLQAIDELYAIEGF
                     ASPLKVDDIDDESWHKTSAEIKHVVLDLRDCGELVSEVAEISSRLDVSISLIVLSNTD
                     SILMRDKVLSLGANYILWDPELDGLLGALKESGKDTFSPTVKKKSRIAKRVLMLGSKG
                     GVGVSTISAFLSHSLSQQASLKTLLVEHDTLALNSDIFLGLKGLKAQQNSIDLNQSEL
                     DAAIAGSYVHPIKDKLDFLALEKNIACISDHADSLFRISNELVDQYNFIIDSLPLNAI
                     NELTSEDINERYNRIFVVCEPSVASLRAYHSIKKKLGKAEHRIIFSMTRSQKDYMMPL
                     QGAKEKIKAKDTIDFVYEANLEKLIIQQGIHNTAKIKFTPAIANMVNSLTGKKVKVQK
                     KFAWFKK"
     gene            754909..756174
                     /locus_tag="VP_RS18660"
                     /old_locus_tag="VPA0724"
     CDS             754909..756174
                     /locus_tag="VP_RS18660"
                     /old_locus_tag="VPA0724"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006880185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CpaF family protein"
                     /protein_id="WP_005481288.1"
                     /translation="MNHLKEVYIDIRDEIFDALDAASLVDVEPLELESQLKDSVNILI
                     EKKQLQISSLKRLDLVKALLDELKGLGPLQALVDNDDISDIMINGPSDIFIEINGKVE
                     KSPIQFVNEKQLNTIAKRIASNVGRRIDESKPLCDARLEDGSRVNIVIPPLAIDGTSI
                     SIRKFKEQKIKLENLVQFGALSVEMAKLLSIASHCKCNILISGGTGSGKTTLLNALSG
                     FIGSGERIVTIEDAAELQLQQPHIVRLETRQASVEGTGEITARDLVINALRMRPDRII
                     VGECRGGEAFEMLQAMNTGHDGSMSTLHANTPRDAIARVESMVMMATASLPLEAIRRT
                     IVSAVDLIVQVRRLHDGSRKILFISEIVGLEGDSVVMEDIFRFENNGIGDEGKISGEF
                     RTPGLSKRSVIYERAKFFGLDGALQELFS"
     gene            756171..757085
                     /locus_tag="VP_RS18665"
                     /old_locus_tag="VPA0725"
     CDS             756171..757085
                     /locus_tag="VP_RS18665"
                     /old_locus_tag="VPA0725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005445968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system F family protein"
                     /protein_id="WP_005481326.1"
                     /translation="MMLIVISLWVAVALFLFIGHVKRQKELTSIIEQSNTFEGVTGSR
                     AVIDSESFDVSYKKKVKDKFKQLKKLLSPNAGLKLVGFFAASSIAVYCVNDWFFMFEY
                     WKVLLALEPILFVMFILKLSGIQAQRFKDNFPDALNILSGALSSGQSIVHAFEYVGTQ
                     LDNEVGEEFKKMSERLLIGEDPDDVLARSAASFPYVEYFFFAATIRINLSRGGQLKDV
                     INRINRIMFEARAIEKKKNALTSEARASAKIIAALPVIFIMILKVTSPENYNFVMFEE
                     GGKPIFYYVLVSEAIGFFFIYMILRGVR"
     gene            757085..757951
                     /locus_tag="VP_RS18670"
                     /old_locus_tag="VPA0726"
     CDS             757085..757951
                     /locus_tag="VP_RS18670"
                     /old_locus_tag="VPA0726"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009697509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system F family protein"
                     /protein_id="WP_005481282.1"
                     /translation="MVDIKLIFLALGLIISLSAAYYSLKVFDKTKANISTKKIIDSTQ
                     EKTPFVDKLSLHLSRLSFNKEETKNNLVRAGIHSEFIAQAYYLLKIIPLVFCLAFIGY
                     SYIQGEMEFSSAFISFSLSMLVCLIAPDMYISSRGNANVRHVSSRLPFLLDLMNVCVH
                     TGMTLEASLDYLSNELKTVDENLAYVVKKTSERAKIVGLDRALTEFYDLVPTTEAQSF
                     VMTLTQSLKYGSSVGAVLASLASDIREINMLELEEKIGKMGAKMSIPMIAFIMIPIVV
                     LIAAPGIMRMLG"
     gene            757951..759039
                     /locus_tag="VP_RS18675"
                     /old_locus_tag="VPA0727"
     CDS             757951..759039
                     /locus_tag="VP_RS18675"
                     /old_locus_tag="VPA0727"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017190206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="WP_005481253.1"
                     /translation="MNIKNYFSLLVLLFLSGCSTINQELVTKEKLLTNSGQTEQLIEF
                     YKANLVEVPSYKIKLINLYLDNKDQKSAELYINTLEKKDLKDPDIIYILAKLEYLKSN
                     YDASERYLEEYLDNGGPEGDYYLLKGKILARKKDYDGAISHFNDSKKNGASDREANNN
                     IAVVMMLQGRPEPAMELLYGLFAANPNDEKVRSNLLLASTRSNRPDVALEVLKHDSSE
                     QEARVKLKKLMKSVKPLSKKIDTKVPPKQVAKSKEKKNMEMDTKSVDLKPKYVARSVL
                     DPQNLRPKAPSIYRIQVLATYKVIPSDYLNYLKGNYGKVYSYTHGLWKRYCVGEFSDI
                     DDAKKFLENMNIKGAFVVDYTKKRYVEL"
     gene            759036..759578
                     /locus_tag="VP_RS18680"
                     /old_locus_tag="VPA0728"
     CDS             759036..759578
                     /locus_tag="VP_RS18680"
                     /old_locus_tag="VPA0728"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein"
                     /protein_id="WP_005481299.1"
                     /translation="MIKFQKGSLTVEVAMGLPVLIMVLFTWFDLSVLTYSMGVTDHAL
                     TTAVMSSKKQGSSSNSEKVDYQDVVKTKLETSGGALWSKVVDHSSVSASVYYFKNLSD
                     FVQCNRSGQALDDCPNVKKGDAVANSVNMPIAIYQLSFTYHPLFNFVMPSMSINREMV
                     AVQEYERCTFKLGEEITCGG"
     gene            759568..760146
                     /locus_tag="VP_RS18685"
                     /old_locus_tag="VPA0729"
     CDS             759568..760146
                     /locus_tag="VP_RS18685"
                     /old_locus_tag="VPA0729"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005445960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein TadF"
                     /protein_id="WP_005498630.1"
                     /translation="MVAKSKQTGAFIVELALVLLFFGSIIAMHINYTIAVNKKGQLDR
                     VVYSIVSVISERRQLFANELNICGENGRHCEAQVNNAFYMAKGMLKRTLPDFDASELG
                     MRITELSLEEKDTKLVTFTNFKGKTEDCNFPDLKEITVAEAKKLLPLTTQNRRLPLYH
                     VSLCYKTPFNIIGVMRGEPIKVVTSSYSFARI"
     gene            760148..761533
                     /locus_tag="VP_RS18690"
                     /old_locus_tag="VPA0730"
     CDS             760148..761533
                     /locus_tag="VP_RS18690"
                     /old_locus_tag="VPA0730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005445959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VWA domain-containing protein"
                     /protein_id="WP_005454199.1"
                     /translation="MKGFTKQKGVAGIIFVSFLPILIITFSFSVGYTQRLLAHSKIEE
                     AAEVASLALIASPGKDNKDDQDYAQRIVDLYITDNISDIEISVSTKKCEYKDGCVQRN
                     NELSPFADFTVVATAEHDSWISHNEIGVEPKFKVSGDSITRKYLPQPVDIYFILDTSQ
                     SMSNPWYGERNKTQMQVVKDTITRVVKELENFKTGPDKKSRVALLTYNAYNAKFDKGA
                     GRVKLYDYASEFSHTEASFESIVDKMFDKSVVEQKPHYASDYNKSQDIPLTDKYQEFI
                     DILNSNKVMPARGGGTQSWLGLIAAAKEADKVKKEDRNPEQVFIILSDGADTDVQFPM
                     GLNRNRSYRDKYDVVTKYYVDQYDGRTYYYQVYDKFLKSLVGEHGLCESLKKRISSKE
                     NKFQSEHAKLEGEKTKVTMGVIGVNYNVQKDDGFGECVGEKNIYHAKNGKDVYKYILN
                     LINEETGRLKD"
     gene            761535..762098
                     /locus_tag="VP_RS18695"
                     /old_locus_tag="VPA0731"
     CDS             761535..762098
                     /locus_tag="VP_RS18695"
                     /old_locus_tag="VPA0731"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009697512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA family protein"
                     /protein_id="WP_005459729.1"
                     /translation="MKKLIPFAIIFTSNVALANCINQSENYVTSKVLKSSDTKITQVD
                     GKLASVINEDLSIVQDEKIEKVEATNATESCTFDKNSMSLVLHYDTNEHYLTNVHKQA
                     ISKYLELVNEDKRILVEGHTDDVGSQAYNKSLSLRRASTASKYLKKDLGLGNRIVEKA
                     FGESAPICKVNENKLSGCNRRVVLTIE"
     gene            762237..762779
                     /locus_tag="VP_RS18700"
                     /old_locus_tag="VPA0732"
     CDS             762237..762779
                     /locus_tag="VP_RS18700"
                     /old_locus_tag="VPA0732"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005498636.1"
                     /translation="MKCKHIFVSIFLFFGNAYHSYAEVEKPAMSAQLEEYVYNPRILK
                     DVSDTLLGIDLNKNNIRDDVDKVVNHLEVTEADKEFMLRYIQYATSILSYDFAKDRLE
                     NPLIASELYKELNYINSCYKESGVDGKDLYDSINALNVLMFNTDARIIAYLHYEKYLD
                     IRNTYELLSYDCKNKKYHQV"
     gene            complement(762953..763807)
                     /locus_tag="VP_RS18705"
                     /old_locus_tag="VPA0733"
     CDS             complement(762953..763807)
                     /locus_tag="VP_RS18705"
                     /old_locus_tag="VPA0733"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005454263.1"
                     /translation="MTNKKLDLNLIQTFLIAAEYQSYTKAAEHLGVTQPAVSASIRRL
                     EALIEYQLFTKVGRSISLTSRGQNLLPKLRQALCMVENALSTSPQFKVYCSEVFSGSL
                     SSINNVSVHEAVATKNLLLELLHQQKIALVIDSIKSDDSTLVNEVIHEEPNVVVCRKT
                     HPRINGQINTKQFFKEKHCVLTEEWAVNQTTNHNQYLNNVQVETVASSLSGVVLNVIE
                     SDNIAIIPHSFAMKWKEQLDLQVIDLPIESNLVTYHFIYHKREKNNLHHKRIRNNIKE
                     TLKPFYKS"
     gene            complement(763975..764973)
                     /locus_tag="VP_RS18710"
                     /old_locus_tag="VPA0734"
     CDS             complement(763975..764973)
                     /locus_tag="VP_RS18710"
                     /old_locus_tag="VPA0734"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005486504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005481319.1"
                     /translation="MQTRVRLTPPERNRMKNKDKNKKPLHNLDLNLLKIFRVVSEEKK
                     TVAAAKRLNITQPAVSRAMARLREHFNDPLFVRTRYGLKPTDKGQLLSDSLPKIMDDL
                     SNLILELDEFSPESSSANIKIAINGFFGVSFPAKLHLKLLDIAPNITIETESWSSNTI
                     SKLINGELDLGINYPLNNVPKELQTKHLATDEFQILARDAHPLSDQAIDCNDLSLYPI
                     VTAIVPDWNENRTLIECWAERENIETETAFRSSSILSLLEVISETDALFPTSAFLSRK
                     HLSGLKSLSLSPQLKASFKGESQDIYLYMHYRHRNSPIYKWLIPIIESTLSSINDN"
     gene            765164..766615
                     /locus_tag="VP_RS18715"
                     /old_locus_tag="VPA0735"
     CDS             765164..766615
                     /locus_tag="VP_RS18715"
                     /old_locus_tag="VPA0735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1254 domain-containing protein"
                     /protein_id="WP_005454305.1"
                     /translation="MKKRILAVAVTSMLLSASVFAQETVVPSRVGDLKFESDFPTQET
                     MKNMLNEMDFQRATQAYLWGIPASSIMEWLNVSRNDFKFEEGQMGFFNTLKQKQGIIT
                     ANFTTPYVIGTWNLEKTGPLIINLPEAKMAGMMLDVHQRVLSDLSLLGPDKGKGGKYL
                     IVPPGEKYKDLNPKGYYVIRPKTNVVYGGIRILEPDVDRVVKQVVPNITTQPYADGKL
                     GRKIPVAQVPEIDWTHIPKDGLEYWKTIHQIIQENPVEERDRFVMAQLKFLGIEKGKP
                     FNPTEEQKKILLEASKVGRAMAQSNDYTKRFTQPYWKGTNWKDAISVSLDQRSENYDE
                     LDERAAWFYEAITVSRGMKSTIPGFGQRYLVTYQDSDGNWLSGEHTYKLHVPANVPAS
                     NFWSTTVYDENNRLMIINDAGSPDISSRKNLKVNSDGSIDVYYGPKPVKGYENNWVQT
                     NPGEGWFTYFRFYGPTEKMFDKSWTMGDIELVK"
     gene            767025..770690
                     /locus_tag="VP_RS18720"
                     /old_locus_tag="VPA0736"
     CDS             767025..770690
                     /locus_tag="VP_RS18720"
                     /old_locus_tag="VPA0736"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="WP_005454237.1"
                     /translation="MFSILRKIIILTATVTSLAVSFNALAKENTKDSIVVGVITQNDS
                     SNSVVDSVGPFYGINLDYLSNIAKVLGLNLELRAYQHIPPLLNDVENGVIDGAVGFSK
                     TPEREKRFLFSKPFFSSTIAAWYRDASYKDRDIRDIKWVCVEGSVYCDNLTSQGIDNI
                     IYVKTRLEAFDDVRRGKANALIYTYVGITEYLDANDIVKGIVDIPNWLQEEEVSFIAS
                     LDNQKLIDNIDKILEWEQSGKNIRSVASKNPYHINDKLLVAYRRNHKSNLTITYSSSD
                     EAYPFLYRDSHTGKLDGFFPDFIDLIQSRTGLAFSYVKPTSSLSNGLTAFDADIVPVS
                     YVGPVPKSDWLITKPFMHSNYVSIQAEESERDKSSPEKAGILLSLKKQGLVHLGVWQQ
                     DRFDRYDDLKQLLTDLKSGVLDVAYIPDDVVHSMIAQDQVDGLVINEQDVLTFSNAFA
                     VAKHNTQLQHMLNSIIETIDSNEIEKLLRSHRSFNLVYGYDDEQMAKFFLAGAVAFSL
                     MFAAAYFILAHLRLKVKLAELNANNEEAEKQWLMGIIQEINSLVFIHGEDNQLEMSNC
                     ANYKSKQCQECKLKSCSTNAPLVNNSDELATVIGGQRISEEVASAGCELGIKHVYRER
                     KTIASPSGKKKFVLTVIQDITQQKEREQALIDAQKEAQTAVRARENFLATMSHELRTP
                     LSAAHGILDLLNRQVTADSNRELIAQAMRSLNHLNVLVDEVLDYSKLEAGQLTVAPAK
                     TDLLKTLCDVFRSFEPRALAKGLDYKVTIKPFSDAFIEIDALRLVQITTNLLSNAVKF
                     TAEGEIGISVILHEKQLILKVADTGIGMTDGQLEGILNPFVQADDSITRKYGGTGLGL
                     SIVDRLIDCMGGVLCIDSQFGLGTTITVKLPIERCDSEPEVRLNWTYSEALPLSIRQW
                     CDAWKMQPATLARSMANLYAAQDNEAGFDGVMLRDDREILGSLTLRELQYPDALFNLL
                     SQTQQETKLDELKSEEVSWILGTVLVAEDNPINQSVISMQLRELGIEPVIVNNGREAW
                     EYINQDENVVLLLTDFHMPEMDGYELIKHVRASGFKSLPIIGVTAEDARLASERTQDI
                     GIDDVLYKPYDLNKLKTVLVPFIGKKEKTRLPDWIKRFKTQDAKEIARVFSQSMAMDI
                     ENLQAAPTERDKKRVIHGIKGAVGAIGISMLTELCIEAERVTAAEFDRRAAELILRIE
                     QEIDNIDYWAEMNEYTA"
     gene            770674..771840
                     /locus_tag="VP_RS18725"
                     /old_locus_tag="VPA0737"
     CDS             770674..771840
                     /locus_tag="VP_RS18725"
                     /old_locus_tag="VPA0737"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005376519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing response regulator"
                     /protein_id="WP_005454249.1"
                     /translation="MNTQLNVMVIDDHPLQTTILTQILNRYCAQVTSFNGVDDAIQCA
                     QRQHFDVIFCDIQMPGKDGIDMMEMLDQIQYQGQVVLVSAMELTIISAVRAMCEGFSF
                     EVLGKLPKPYDENQVVELLSLMKGEKTKKATFIQPIEVQDQEFLFALGEGRVKNYYQP
                     LVDAQSGEVLGYEALARWSHPIYGVLSPYHFLPIVERCHLSAELFQAVLNNAIYDIKH
                     RGLTQKVSINVDHENLEDPEFSHRFLQQCLENEIEPSQITIEITERDTFQTSASLYKN
                     LLKLRMNGVTVSIDDFGTGSSTFEKLAQLPFNELKIDRSFVQGVECDMKKRNIVVAIC
                     ALAKSLNIRLVAEGIEDEVTLQVMREYGIDLCQGFYIDKPMPLEAITILNERYE"
     gene            771833..772429
                     /locus_tag="VP_RS18730"
                     /old_locus_tag="VPA0738"
     CDS             771833..772429
                     /locus_tag="VP_RS18730"
                     /old_locus_tag="VPA0738"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005481323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_005481323.1"
                     /translation="MNKMNCLIFDDHPLVCVAIKSLLKELGMTNEVFTATSAKSAFKT
                     LKESNIELLILDVNLADCDGFDFYKRIKSHGYEGKVIFFSAETSQMYSQMAFRSGADG
                     YVCKSENHDILKDAIEAVVKGYTFFKFKQVANEVREMPQLSSRESAVMKYLLQGKSNR
                     DIASVLSISDKTVSTYKRRVLDKFNVKNIVELTRVAGT"
     gene            772439..773809
                     /locus_tag="VP_RS18735"
                     /old_locus_tag="VPA0739"
     CDS             772439..773809
                     /locus_tag="VP_RS18735"
                     /old_locus_tag="VPA0739"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005481251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_005481251.1"
                     /translation="MTFKSIALSFFVATLLFATSTMMIGAVLISYEVKQFNTYANNLA
                     KIKQKVILMGLLTEAKLEQYKGLSVDEVEAQTEFSFQDAIYSLSPYEKLNYVEAVARK
                     SLHQAEAYLSNAFNRQNAIMYFRSYTGSKLILERPIKALEGVKATFDVDWCKSNYSCV
                     LAAWKEQLTDRVLFSLPFKTTYSDDMAISIMSPVYFQGELVGEFSEQLYLSSLYNEGK
                     AVDVQISNGNKQMVIYFSGYPWPSFAYTQSFVADNNNLIVYMYPFSKVMVDYSFLFVI
                     FFLATLAYYNKAHESKESKLRLATALTNVTKDDLTGLLNRRVFKDSEFKRRLKTAPYS
                     VIAIDGDRIKRINDRYGHHVGDEVIEIIADAMRKVFRTSDYLVRTGGDEFIAILPGCS
                     ISQSSMLAKKLRSFVKDNRLKTLDIEVSVSTGVAANESHESLQDVIVRADEDLYEMKK
                     RRQHSQ"
     gene            773969..774856
                     /locus_tag="VP_RS18740"
                     /old_locus_tag="VPA0740"
     CDS             773969..774856
                     /locus_tag="VP_RS18740"
                     /old_locus_tag="VPA0740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005449401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005489294.1"
                     /translation="MNKDLDLNLLKILVLLDKHRQLKPVAKAMGKSEASISKYLARLR
                     LQLNDELFIRHPHHMEPTDYLKRQLPKIADALEKLETCLISGEFEPENYEKDITVCLP
                     QTAQYSFGHLLAMDLMELFPKAHISVATITEYTVEEIILGKVDAQLHYFNDDLPKSVH
                     QKFIGYAPAVVVVPEELGITTLEEAAQLPFIMLEIIGWKEKEQLAKRAMESHGMVINR
                     IAALDNVSSVLKLIKKKSAATVLLEYQAPIEGYNFIRVPESYYPNGWPKIVVQMKQSH
                     RHDAMHQLLTGAIAKYMSA"
     gene            complement(774867..775475)
                     /locus_tag="VP_RS18745"
                     /old_locus_tag="VPA0741"
     CDS             complement(774867..775475)
                     /locus_tag="VP_RS18745"
                     /old_locus_tag="VPA0741"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_005454317.1"
                     /translation="MNNVLIIDDQPLYSEALASLVENAINTAEVIQTTDSAEVMELVR
                     SQRIDLIILDVVLGDRDGMRLAKNILATGYRGRLLFVSSRDYSSLSKAAYEMGANGFL
                     NKNEARETIADAIVSVSRGYSMFKSTHTPSSGDVTLSNREAMVFHYLAQGYSNKKISE
                     QLSLSAKTISTYKTRILKKYHADSLIELLHTIPQSENIQFCR"
     gene            complement(775468..775632)
                     /locus_tag="VP_RS23665"
     CDS             complement(775468..775632)
                     /locus_tag="VP_RS23665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005454149.1"
                     /translation="MAAANIPKNKTLIFIFGKSHFPSSQQGFSYNPTHPIELLPDSVL
                     VEILDEVHFE"
     gene            complement(775706..777337)
                     /locus_tag="VP_RS18750"
                     /old_locus_tag="VPA0743"
     CDS             complement(775706..777337)
                     /locus_tag="VP_RS18750"
                     /old_locus_tag="VPA0743"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_005454192.1"
                     /translation="MSFDRNLCKVLVADDSRLVTSSVTAILRQLDLSDIYYAYKPFEV
                     INLCKQMHFDLVICDYNFQTQLNGFQLLEELKHAQILPAHTTFVFLTGENDHKIVRSI
                     VDCDPDDYLLKPFNHTFFRNRLLSAMKRRSVLLPIYEKLREMDFEGVIEATDTLLPFH
                     PEYSKLIRRYRAHAMVQNKQFSSARSEYEKLLKEDNFDWIKTALANTLIETDNLEKAQ
                     EVLESLSSKKENPYYHDEMSNMAVLSEDIPKAIKHLKQSTMLLDAGSERELVITNLSL
                     ASESYDDAVTYIKRYYEKNENTFRGGIFTKLNFVRCHLYRSLNAPSNQCFENLLFGLN
                     PLIGEIEKNSQFKAQFALIDAHIALIRGDLKAAISQVRAVLASNQLSHFYDLYHLCVL
                     LERCSFLSEMKSMLPRARRAIAEAQHPSIFRSQVHMLKSLEMRLQESQTKIEQIRRQI
                     TAQKSISTSAITPHFDRYFQLHDLLPHSKKICLAIVRLASLRPFEYRGEYAIYRKLEH
                     CDRVIRNLCDNRELQSIKYNNMYQYAKQNITVSNG"
     gene            complement(777433..777714)
                     /locus_tag="VP_RS18755"
                     /old_locus_tag="VPA0744"
     CDS             complement(777433..777714)
                     /locus_tag="VP_RS18755"
                     /old_locus_tag="VPA0744"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005486510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hpt domain-containing protein"
                     /protein_id="WP_005454063.1"
                     /translation="MQHHMATVYLETMTEDLEVLKAHLHEPKHPLQTVHKIKGGLAQI
                     GLEHIHQSALLTEQLCRSDSPLYQTALEKLITDLELSVNDVQHWVTQHT"
     gene            778317..779291
                     /locus_tag="VP_RS18760"
                     /old_locus_tag="VPA0746"
     CDS             778317..779291
                     /locus_tag="VP_RS18760"
                     /old_locus_tag="VPA0746"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005481272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheV"
                     /protein_id="WP_005481272.1"
                     /translation="MSNVTSTILTESGTNELEIIEFHLEKQLPDGSTKTCYYGINVAK
                     VREVIRVPETTDYPNAQPHMIGVFSSRDVLTPLVDLAGWLGVPTRQDLERKFVIVTDF
                     NKMTNGFLIDSISRIHRISWNDVESPSQFLEAGEQDCVVAVVRKDGNLIMILDFEKII
                     ADINPELSMEKYDVKVDKSVDLNQRMVGKRNAKTIMVVDDSAFIRSLIQDTLASSGYN
                     VITCKDGGEAHEKLMSLIEVAKEEQLPVRELLDAVVTDVEMPRMDGMHLVKRLRETEA
                     FRQMPIIMFSSLMSEDNRAKALSLGANDTITKPEIGRMVNMMDKYVFA"
     gene            complement(779358..779894)
                     /locus_tag="VP_RS18765"
                     /old_locus_tag="VPA0747"
     CDS             complement(779358..779894)
                     /locus_tag="VP_RS18765"
                     /old_locus_tag="VPA0747"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011152267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilin MshA"
                     /protein_id="WP_011106342.1"
                     /translation="MKKQTGFTLIELVVVIVILGTLAVTAAPRFLNLQNDAREARLEG
                     MKGAIASALGIGYGKMAIVGLEHYPYISNKHTDAGSGKGPESLPFPGCNLNGSKSCTF
                     RYGYPDADETSLAVLVAELDNQYGTSDWKVTQSQEKIEVVISARDDKNSSLTQCGILY
                     APPTTSNESYKLEILPCP"
     gene            780272..780994
                     /locus_tag="VP_RS18770"
                     /old_locus_tag="VPA0749"
     CDS             780272..780994
                     /locus_tag="VP_RS18770"
                     /old_locus_tag="VPA0749"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005441319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite exporter TauE/SafE family protein"
                     /protein_id="WP_005454206.1"
                     /translation="MEFDSVNLLAMGLIFLGSFVQTAIGFGLAIVAVPLLILWAPEYV
                     PAPICLVALFISIMNALKHRSSVEIGGLKMALIGRVPGSIAGGFMLFFVSTQALTLWI
                     GLLVLFAVIVSVLPFRIEPTPQRMTLAGFFSGLFGTSSAIGGPPMALLLQHQEANQLR
                     GNLSAFFVFSSIISLVVQIPAGFFTLHHLVITIPLLPAAGLGYWLAMKTTQSLPKEKI
                     RFGVLLLCFVSGFTAVVQGLNL"
     gene            781083..781988
                     /gene="rarD"
                     /locus_tag="VP_RS18775"
                     /old_locus_tag="VPA0750"
     CDS             781083..781988
                     /gene="rarD"
                     /locus_tag="VP_RS18775"
                     /old_locus_tag="VPA0750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005449393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter RarD"
                     /protein_id="WP_005481255.1"
                     /translation="MNHRHYGNFMAALSFVIWGLLPVYYRFLHNAAMDELLAWRIIGS
                     VPVGILIVYAVTRHWPNWSQVWRDKKSLWYTFVASSLMCISWSAFTWALTHHRVIDAS
                     LGFFIGPLVSVALGVFVLGDKLSKGQLIAILLATCGVLYQVFQYGQLPFVALTMGLFF
                     ALYGLYKKKINYDWSTTLFIEALVLAPFALGYLLFKQWTTGELASSVDTTTLLLYFGS
                     APITILPLIFYSIAIRITNLSTVGLMQYIEPSLQFILAVVFFGELFDDVKAVTFAFIW
                     VGLLLTIFEGVAKGIKRKKLANHSV"
     gene            782192..782578
                     /locus_tag="VP_RS18780"
                     /old_locus_tag="VPA0752"
     CDS             782192..782578
                     /locus_tag="VP_RS18780"
                     /old_locus_tag="VPA0752"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006960062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MAPEG family protein"
                     /protein_id="WP_005454090.1"
                     /translation="MITALYASILALLLVWLAFQVIKQRRLNKVAYADGGVEALQIAR
                     SAQSNASEYIPITLILMALLEFNGAAPIWIHLTGIIFVIGRIIHARGILQESFKGRVK
                     GMQLTFLVIVSLVVLNMFYFPYGKLW"
     gene            782967..783506
                     /locus_tag="VP_RS18785"
                     /old_locus_tag="VPA0753"
     CDS             782967..783506
                     /locus_tag="VP_RS18785"
                     /old_locus_tag="VPA0753"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005441328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase PAP2 family protein"
                     /protein_id="WP_020835216.1"
                     /translation="MKKTIRVVGVASLLCCQSVNAMSEKDWDVLTDIGTYGLVATAAA
                     VPAYKGDWEGFWQAGLSIGTASGVGLIGKKTIDEERPDKSDNDSFPSNHTANAFASAT
                     NLYLRYGWEAGLPAYSMAALVGVGRVEAKKHYWRDVLAGAAIGTLSAYIFTDAYDENV
                     QLVPWVTSEDAGISITYRW"
     gene            complement(783582..784949)
                     /locus_tag="VP_RS18790"
                     /old_locus_tag="VPA0754"
     CDS             complement(783582..784949)
                     /locus_tag="VP_RS18790"
                     /old_locus_tag="VPA0754"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017422744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase family
                     protein"
                     /protein_id="WP_005481245.1"
                     /translation="MKTIKTSLALLIGAALLTGCNDDDTKYVNVQPTEVKIATYNLSF
                     DRATFEALVNEMQIEPAQQAALVTAYLDGSIAAEDKTTAEKVIQIRNVAAIIQKNRPD
                     VLMMAEYNNDGTGEDKAALEGFQKNYLSVAQSLDGAGEEANLEPIEYPYAESYSTNTG
                     LLSDFDLDNNGTAGQMPGDAWGFGMYHGQYAFALMSKYKIDTANTRTFQEFKWKDLEG
                     AKIPTITICDGSQKIPDNMKCGDEWYSAEEWAQVRLSSKNHVDAPIIIPTSNGNEVVH
                     LLMSHPTPPVFDPGKNQAQNAAEVEFWHHYIQGKEFFYDDAGKQGGLASGAKFVMMGD
                     QNLDPVAGDGISSIMQELHSDPLVNQDVMNGNLYPTSFGAAEHAVEKSSTHPYPNRIT
                     STFGLGVDYALPSANLKVVDSGVYWSASYEEGRKLFNDSRIGKYGNGKDVSSDHRMIW
                     IKAQF"
     gene            785300..787405
                     /locus_tag="VP_RS18795"
                     /old_locus_tag="VPA0755"
     CDS             785300..787405
                     /locus_tag="VP_RS18795"
                     /old_locus_tag="VPA0755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017188987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M4 family metallopeptidase"
                     /protein_id="WP_005481254.1"
                     /translation="MDLGSKYQRKLVVGFVLVSPLLVSPSLSAAQLERLEPNHGRVVS
                     LEKQNLAATQNVAKALGLKPGNNVQKLKANQDKNGDVHVRYQQTYKGIPIWGKQIVLH
                     RDKQGKIKRFGGTLVHDIGQDISNTTPQLSLERIRSKVQKPYLDVGYHIEDQQQGLRI
                     YIDDKDVAHLAYEIQFFADSEQALNPTRPTYLVDAKSGEVLLQYEGLAHAEADGPGGN
                     QKIGFYEYGKEYDPLLVQQSGSTCIMDTPNIVQTINLDGRTSGSVHTFNCPTNTVKEI
                     NGAYSPLNDAHYFGKVVYDMYKDWLNTAPLTFQLQMRVHYRKRYENAFWNGSSMTFGD
                     GASYFYPLVSLDVSAHEVSHGFTEQNSNLIYSGQSGGINEAFSDMAGEAAEFYSRGSN
                     DWKVGFDIRKSPTGALRYMDNPPLDGRSIDHASQYVSGMDVHYSSGVFNKAFYLLAVD
                     YDWGTENTFKAFAHANQNYWTPSATFDSAAAGVLAAAQDLSLPASDVTAAFAQVGVST
                     DGGVVEPPSSACDAVSLSNGTSSNIESASTGQWHCFTIDVPANGSDLTITTAGSNGDA
                     DLYVKLGSAPSLSNYDCRSISSNSNEVCSFATPSEGTWHIGVYAYSGISNVSVTASYT
                     EQEAPPPSGGVTTQSINNGKTWTAIVTGSGLHDGVWNNNPSDSCGNDSECSKSGIDKK
                     TGSVSFTLSDGQTFVILKP"
     gene            787560..787874
                     /locus_tag="VP_RS18800"
                     /old_locus_tag="VPA0756"
     CDS             787560..787874
                     /locus_tag="VP_RS18800"
                     /old_locus_tag="VPA0756"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000312384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux SMR transporter"
                     /protein_id="WP_005454078.1"
                     /translation="MAWGILFIAGLCEIAWAVGLKYSQGFTKFGASAFTIVFMLLSFW
                     LLGIALRTLPLGIAYGVWVGIGAIGTAIVGIYLFNEPATLIKALSLLMIVAGIAGLKI
                     SA"
     gene            complement(787957..788862)
                     /locus_tag="VP_RS18805"
                     /old_locus_tag="VPA0757"
     CDS             complement(787957..788862)
                     /locus_tag="VP_RS18805"
                     /old_locus_tag="VPA0757"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_005454103.1"
                     /translation="MSNSLNTMVPIGVRFMVLSAFGFALMSATVKHVSLHGIPVFEIV
                     AARALVSLVISYLDVKRKRISVWGNNKPLLLARGAVGTFALMCVYYSVTTLPLAEATI
                     FQYIHPVFTALLAVIFLKERIQPTTFICIALCLLGVYVMVRPETGVESAQTLPMFSVM
                     IAILGAFGSSIAYVIVRKLSQTEDSSVIIFYFPLVALPTSILFMGDNFVMPDLYLTCM
                     LVLVGVFTQIGQLGLTKAMQTQQAGKASAYSYVQIVFSVLLGIVFFGELPSLWTYIGG
                     ALIVAGALINVFGHHLRLPFIKRSA"
     gene            789046..789504
                     /locus_tag="VP_RS18810"
                     /old_locus_tag="VPA0758"
     CDS             789046..789504
                     /locus_tag="VP_RS18810"
                     /old_locus_tag="VPA0758"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX domain-containing protein"
                     /protein_id="WP_005454164.1"
                     /translation="MIPIQATHVSGVVISRIDGVDKILLLKRVKGGYWCHVAGGVEAG
                     ETGWQTILRELKEETQIDHVELHKADFLEQFYEAKENRILVIPCFVLFCPPNQPVVLN
                     EEHTEYRWCSLEEAKQLTPFANQHHLYDHVWQYYVDVESLTPYTLIEQNS"
     gene            789522..790007
                     /locus_tag="VP_RS18815"
                     /old_locus_tag="VPA0759"
     CDS             789522..790007
                     /locus_tag="VP_RS18815"
                     /old_locus_tag="VPA0759"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_005454093.1"
                     /translation="MTHKISVRAAQKQDSATILRFVKELARYEHLEHEVKASVEDVDR
                     AIFGEDSTTHAVICYVNEEPIGFAVYFFNYSTWLGKNGLYLEDLYVSSEYRNVGAGKA
                     LLKHLANIAVDRGCGRFEWAVLDWNQPAIDFYQSIGAEPQDEWKIYRLAGDALQRFAK
                     G"
     gene            790013..790585
                     /locus_tag="VP_RS18820"
                     /old_locus_tag="VPA0760"
     CDS             790013..790585
                     /locus_tag="VP_RS18820"
                     /old_locus_tag="VPA0760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_005454340.1"
                     /translation="MGDSMYPHDYQGNGSQARFSVSERVSIEPLTTKHATVLLEVVNT
                     YRNSLSGYLPWTDFVTNRREAVNYISQRVNSKALDAHWCAIYFDEQFTGVIGIKGVDS
                     HTHVTEIGYWLANNGRGHRVIDQVLAVLIPFLKQKGHAQFIQFHCMEDNIASINIAER
                     AGATLKEYVDHEFETLDRSQRLGIYELRLT"
     gene            790711..792123
                     /locus_tag="VP_RS18825"
                     /old_locus_tag="VPA0761"
     CDS             790711..792123
                     /locus_tag="VP_RS18825"
                     /old_locus_tag="VPA0761"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010452131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coniferyl aldehyde dehydrogenase"
                     /protein_id="WP_005454152.1"
                     /translation="MNAIAEVDVDNSLQQSLDRLKAAYVAEPYPSLDERKQRLIMLKQ
                     ALIANKQALVEALSDDFGYRSEFDTAMTDVLPTVSHINYTLKRLKKWCKPSKRESGLL
                     LAPSKVTVQYQPLGVVGIISPWNFPVILSLAPLVTALAAGNRVMMKLSEFTPKTNKVI
                     VNICHELSEYVEVFEGEADVAQAFSQLPFDHLLFTGSTNVGRAVAKAAAENLTPVTLE
                     LGGKSPVIITEDADMKKTVDAILFGKCINAGQICVAPDYAFVPQERIEEFITLFLKRF
                     EKLYLKSNKNQKLTHIINQRQYERLTALLEDAKTQGASLHTVEASPQEERLLYPHLVT
                     NVSADMRIMQEEIFGPLLPIKPYKSLEEAIDYINQHQRPLALYVMSDDKSTIKHIVRN
                     THSGGVGINDTVLHVGAEDAPFGGIGQSGIGHYHGVEGFRTFSHAKTVLHTPKWLPRT
                     GALMRRRAMAIKAIQKIFVR"
     gene            complement(792191..793594)
                     /locus_tag="VP_RS18830"
                     /old_locus_tag="VPA0762"
     CDS             complement(792191..793594)
                     /locus_tag="VP_RS18830"
                     /old_locus_tag="VPA0762"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011081088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anion permease"
                     /protein_id="WP_005454276.1"
                     /translation="MNSSQMKMILLVAIGCILWFIPTPEGLTDQAWQMMAIFVTTVLS
                     LILAPLPLGAMALMGLTLATLLGVLPIKTALTGFAHPTIWMIAAAFFISRGFITTGFG
                     RRVGYWFISKLGHNSLGLAYGLVLTDLLFAPATPSTTARCGGIISPLFRSVASAYDSD
                     PEKGTENRIGAFLVQCIFQCNAITCAMFLTSMAGNPLAANFAKEQGVEITWAGWATAA
                     IVPGLLCLFLIPLVMYMVFPPELKKTPEMREIARQKLAEMGKMTRDELMVCITFIGMV
                     SLWVLGPTLGIHATVTALLGLVFLLLTHTITWDAVLGEKEAWHTITWFAVLVMMAAQL
                     NKLGFISWFSESMAESLSGFGWVTTIVVLLLVYYYSHYLMASAMAHISAMYSAFLAIA
                     ISAGAPPMLAAIVLGIFSNLYMSTTHYSSGPAPILFGAGFHTLQNWWKIGFIFSLIVI
                     PIFVFVGGAWWKLLGLW"
     gene            793925..795442
                     /locus_tag="VP_RS18835"
                     /old_locus_tag="VPA0763"
     CDS             793925..795442
                     /locus_tag="VP_RS18835"
                     /old_locus_tag="VPA0763"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015727794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_021451843.1"
                     /translation="MLLGMLSWWSYSAHQLDDILTHQISLRAQVQSQQLSQLSSLIAA
                     VGSGSASKTSEIINAVQAVSDADFITVSDRAGIRLAHPVAERVGLPVLGGDIERALEN
                     GESYLSYGVGSLGPSVRYISPIFSNEGDVIGMIKVGYLIDTLDLWTSERLLPLISFGI
                     IAVAICIWLSWKFSRYVRTQMQELEPWQLKQALKTHQGVLQATYEGLVAINSEGSLYL
                     INDSARAMLNYHQELGNVFTDGIDNPESFSLKGDDYINGLIRVNGKNLVMNRVTLRTS
                     TGEPYGAVFSLRDQNEMHVLSEKISQVTQYMENMRVARHEYQNKLSTISGLLQMGAYD
                     KALSVCLSQAKASQSQLDSLHALNSRPALSALILAKASKANELGVALSIDCQSDLSAL
                     SRRLSEEQLCGLIGNLAQNALEAVKGQENGHVHIGISESACEYTIQVSNNGPLLESEF
                     DVLCELGFTTKQNKADHGVGMYLVRSIVEQGNGHMELDSDEQETAFTIYFPKELG"
     gene            795439..796116
                     /locus_tag="VP_RS18840"
                     /old_locus_tag="VPA0764"
     CDS             795439..796116
                     /locus_tag="VP_RS18840"
                     /old_locus_tag="VPA0764"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005395226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_005395226.1"
                     /translation="MIKVVIVEDDPNIAELHHHFIEQVEQYQVVGIAGSIHIAQQLVT
                     HTKPDLVIVDNYLPDGQGVELVYQWLESDQKPECILVTAANDASTVQKAHRFGAFDYL
                     VKPVDYSRLTESLLRFAKVKNHMRSQESFRQSQLDDLFHLGKGTPTDLAGLDPFMFRQ
                     VVDLFTHVHVEHTALSVSESLTISKSTARRYLDKAVEQGELVAFLEHGKVGRPTRVYR
                     NKLVSES"
     gene            complement(796194..796673)
                     /locus_tag="VP_RS18845"
                     /old_locus_tag="VPA0766"
     CDS             complement(796194..796673)
                     /locus_tag="VP_RS18845"
                     /old_locus_tag="VPA0766"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019274335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YbaK/EbsC family protein"
                     /protein_id="WP_005486498.1"
                     /translation="MTIATRLDEYLTEHNIHFQTVNHSHSHSSLQSGVAAGVPLMNIA
                     KGVILEDHEGRHMMAVLPANNKISLSRLNDEFNATFHLVKERMVYRLFTDCEHGAIPP
                     IGSPYHMSTVCDERLANLEHVYLEAGDHETLIKLDRKAFKDLMNDCKYLRFSSEVLH"
     gene            796831..798372
                     /locus_tag="VP_RS18850"
                     /old_locus_tag="VPA0765"
     CDS             796831..798372
                     /locus_tag="VP_RS18850"
                     /old_locus_tag="VPA0765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017069635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDGSH iron-sulfur domain-containing protein"
                     /protein_id="WP_011106349.1"
                     /translation="MSKPIIADNKPIKVELKAGQEYYFCRCGRSKKQPYCDGSHSGTG
                     MKPMSFTAEKDEDAYLCQCKHTANAPFCDGTHKRFTAEQVGKEGPDQKREKSEKLAAA
                     NTQEEPTLEFIHQLAREGLSKLGHHGPMAAMGVPRHLLPHWDAIQIMVAQMATQPLLE
                     DVPVSTELIVGPNARKPLKLAIPLLVSDMSFGALSEEAKIALAKGAELAGTGICSGEG
                     GMLPEEQAANSRYFYELASAKFGYDESKLLKVQAFHFKGGQGAKTGTGGHLPANKNVG
                     KISQVRGIPEGQPAISPPTFTDLHTTHDFRKFADRVRGITGGIPIGFKLSANHIEQDI
                     QFALDASADYIILDGRGGGTGAAPTMFRDHISVPTIPALARARKYLDEKGASDRVTLI
                     ITGGLRVPMDFVKALALGADGVAIANSAMQSIGCVAARICNTNNCPAGIATQNADLRQ
                     RLDIEKSSQQLKNFFESSVELMQVMARACGHDSLSQFNVRDLATWDQNMARLSGVKYS
                     GVNPI"
     gene            798566..800740
                     /gene="katG"
                     /locus_tag="VP_RS18855"
                     /old_locus_tag="VPA0768"
     CDS             798566..800740
                     /gene="katG"
                     /locus_tag="VP_RS18855"
                     /old_locus_tag="VPA0768"
                     /EC_number="1.11.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005481286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase/peroxidase HPI"
                     /protein_id="WP_005481286.1"
                     /translation="MSNTNGGSVGKCPVMHGGQTSTDKSVMDWWPNALNLDILHQHDS
                     KTNPFGPDFNYKEELKKLDVDALKQDLKDLMTNSQVWWPADWGHYGGLMIRMAWHAAG
                     SYRIADGRGGAATGNQRFAPLNSWPDNANLDKARRLLWPIKRKYGNKLSWADLIILAG
                     NMAYESMGFKTFGFGFGREDIWHPEKDTYWGSEQEWLAPSGAKNSRYSGERDLENPLA
                     AVMMGLIYVNPEGVDGNPDPLKTAQDMRVTFARMAMNDEETVALTAGGHTVGKCHGNG
                     DAANLGPDPEGADVHEQGLGWMNHKTRGIGRDTVTSGLEGAWTTHPTQWDNGYFYLLF
                     KYDWELKKSPAGAWQWEPIDIEEQDKPVDVEDGSKRYNPIMTDADMALKMDPEYRKIS
                     ERFQQDPAYFEDMFARAWFKLTHRDMGPKSCYLGPDVPSEDLIWQDPTPAGKTDYNVD
                     LVKGKIEASGLSIADLVATAWDSARTYRGSDRRGGANGARIRLAPQKDWQGNEPERLS
                     RVLAVLESIAAEEGCSVADAIVLAGNVGIELAARAAGHDVSVPFAPGRGDASQDMTDV
                     ESFEVLEPVADGFRNWLKKDYVVKPEELLLDRAQLMGLTAPEMTVLIGGLRVLGSNYG
                     GSKDGVFTDRVGTLSNDFFVNLTDMAYTWKPAGENQYEIRDRKTDQVKWTATRVDLVF
                     GSNSILRSYAEVYAQDDNQEKFIHDFVAAWTKVMNADRFDLQ"
     gene            800902..801354
                     /locus_tag="VP_RS18860"
                     /old_locus_tag="VPA0769"
     CDS             800902..801354
                     /locus_tag="VP_RS18860"
                     /old_locus_tag="VPA0769"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005376498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2384 domain-containing protein"
                     /protein_id="WP_005481265.1"
                     /translation="MATAALKSFKPKQPHKANFWFMLGIEDAETGRTDAVHKGFEPKV
                     YRNIVERVKLSQNEFQNVTLIPVSTIKRRLKNDERFNTQESDAIYRLAMLLKLATELF
                     DDEERALEWMKENVYGLGGKRPLDMVSTTVDFEIVKDLIGRLEHGVFS"
     gene            801356..801826
                     /locus_tag="VP_RS18865"
                     /old_locus_tag="VPA0770"
     CDS             801356..801826
                     /locus_tag="VP_RS18865"
                     /old_locus_tag="VPA0770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005426935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RES family NAD+ phosphorylase"
                     /protein_id="WP_005454240.1"
                     /translation="MKLYRLTQKKFADTPFSPIGAKLFGGRWNSKGTEALYFSESESL
                     CSLEVFVHVNNDPAITKLYDLYRIEMPEYLIATLDEEDLPVTWRAIPASESTQYIGDQ
                     FLNDPHPEFAALQVPSTISPRDKNYVVNPNHPKMKEIIKKAEKLDFAFDPRIFK"
     gene            complement(801905..803755)
                     /locus_tag="VP_RS18870"
                     /old_locus_tag="VPA0771"
     CDS             complement(801905..803755)
                     /locus_tag="VP_RS18870"
                     /old_locus_tag="VPA0771"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005376496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_005481301.1"
                     /translation="MTYRAEVDGLRAIAVTLVILFHSGVEQFAGGFIGVDVFFVISGY
                     LITTIVINDLENQKFSLGDFYERRIRRILPLLLVVIAVSYLMSWWLFLPQAHKDVGQL
                     AVSSILSSSNILLYLKGHNYFGLEDQANPLFHTWSLGVEEQYYIVIPLLLMLLARGKN
                     AFYLTFFIAVFALSLMAIVYTSNDPDFAFYMIFSRAWELATGSLLALVMRKAQVQSND
                     TLATIGIVLILASALLFEKSQDGAGITLLVPVIGSALVILFASKDNVCGKLLSLKWVV
                     FVGLISYSLYLWHIPLFVFYRYMLDATQDVNISLYIAALFVLSYFTWRFVEKPFRSRK
                     AMSMRTVSAVVVLLTLPLLTFGVIGHQNGGFPERSAFFEAMRINNGYGLDCNGNTDVN
                     DVCSSAPQPTIAVLGNSHSMVYVKRLSEVTPTGVVQLTQDSCAVGYVDILEAAGSISC
                     RQFFKQAVDTILRTPSIRRVVISSNFNKELSQADYEASLTGLLNELEGKEVVVFGPTP
                     SAPFAVGECLWKARLFGEQEESVCDFSPKRHHPQNVAKLVNYFDRFEHVEFVDLTDAI
                     CRNGVCRMKVGANNAMYTDDSHLSYKGAELVLGHYHNSTNETQQFTYDRQ"
     gene            803997..804272
                     /locus_tag="VP_RS18875"
                     /old_locus_tag="VPA0772"
     CDS             803997..804272
                     /locus_tag="VP_RS18875"
                     /old_locus_tag="VPA0772"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012129260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005454233.1"
                     /translation="MTENTIQEKIASFTCIEEALNYFEIEFDSRFIENNRTELVKRFN
                     GYLILTKPDDWFSGRRALKNAYCKVQRSLLSKTTRSACRGCTSCQRR"
     gene            complement(804393..805493)
                     /locus_tag="VP_RS18880"
                     /old_locus_tag="VPA0773"
     CDS             complement(804393..805493)
                     /locus_tag="VP_RS18880"
                     /old_locus_tag="VPA0773"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017017089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkene reductase"
                     /protein_id="WP_005481291.1"
                     /translation="MTDALFQPIQLGSLSLKNRIVMPPMTRSRASQPGNVANDMMATY
                     YAQRAEAGLIVAEGTQISPMGQGYAWTPGIYSPEQIAGWKKVTDAVHEKGGVIFAQLW
                     HVGRVTHPDNIGGEQPISSSALKAENVKVFIDNGTDEPGFVDVVEPREMTKQDIKNVI
                     EEYRQAALNAIKAGFDGVELHAANGYLVNQFIDSEANNRTDEYGGSIENRLRFLGEVV
                     EAMTQAIGAERVGVRLAPFTSLNGTVDSTPVDTYTAAAALLDKLNVVYIHIAEVDWDD
                     APDTPHDFKTAVRKAYKGTLIYAGRYNAEKAQHAIESGLADMIGFGRPFVANPDLPSR
                     IKHGYPLAEHDPATLFGGGEKGLVDYPAYHAG"
     gene            complement(805505..805891)
                     /gene="gloA"
                     /locus_tag="VP_RS18885"
                     /old_locus_tag="VPA0774"
     CDS             complement(805505..805891)
                     /gene="gloA"
                     /locus_tag="VP_RS18885"
                     /old_locus_tag="VPA0774"
                     /EC_number="4.4.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactoylglutathione lyase"
                     /protein_id="WP_005481322.1"
                     /translation="MKFLHTMIRVVDLDKSIEFYTKVLGMSVLDRFENQEYRYSLVFV
                     GSPDQPDGATIELTYNWDTGSYDLGNAFGHMALGCEDIYAACEKIKALGGNVTREPGP
                     MKGGETHIAFIKDPDGYPIELIQTKQ"
     gene            806103..806531
                     /locus_tag="VP_RS18890"
                     /old_locus_tag="VPA0775"
     CDS             806103..806531
                     /locus_tag="VP_RS18890"
                     /old_locus_tag="VPA0775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005395206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PaaI family thioesterase"
                     /protein_id="WP_005454293.1"
                     /translation="MSANSHFHSTHESHYQCAVCSSIDANPNSLAVNYQCLADSSVVG
                     EFHVLPRHQGYTDLLHGGIASSLLDGAMTHCLLFRDIQALTAQLDVRYHAPIELDEHV
                     TITAHCEGERRGIYQLVAQLLVNNEVRVTAKGKFIRPKEA"
     gene            806558..806947
                     /locus_tag="VP_RS18895"
                     /old_locus_tag="VPA0776"
     CDS             806558..806947
                     /locus_tag="VP_RS18895"
                     /old_locus_tag="VPA0776"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide pyrophosphohydrolase"
                     /protein_id="WP_005454084.1"
                     /translation="MKKFDELYAIATRKSQYDQTNTWFKGVETYLEAIGKEVDEVREE
                     IREDRLCHLEDELGDVLWNYLNVLKTLEREKGIDPEKVLERACTKYEQRVSVIESGRS
                     WDEVKQQQKQALNAEHEAAQLETMKSQ"
     gene            complement(806993..807868)
                     /locus_tag="VP_RS18900"
                     /old_locus_tag="VPA0777"
     CDS             complement(806993..807868)
                     /locus_tag="VP_RS18900"
                     /old_locus_tag="VPA0777"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_005454207.1"
                     /translation="MAPVFFLTQQAALPSRKVLRKVIQFATALAQPIVVLVEDHRRSE
                     DHAFAHFLSFNSDHIEKRQAEFEAWTSKFIDFVIELCGEEEVETPTLSYEHFKGSHWI
                     AQVAKRLVDHTDLLLVGHFNKHNIQTLLTELAKNDCDLLLLSERSWPSHANMLCAIDP
                     LHRGDAKSVVDKAIVSRGSKLEKTLSGKMTLVYCRYVAPYLSRYRAEILSNQKAGITD
                     FITAQKLTRVPLLLPEGNPETALPKAVKQSQAAILIMGACKRSMSSQFWSGSTVDTLL
                     DQPPCDLLLVNSTKD"
     gene            808081..809427
                     /locus_tag="VP_RS18905"
                     /old_locus_tag="VPA0778"
     CDS             808081..809427
                     /locus_tag="VP_RS18905"
                     /old_locus_tag="VPA0778"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006742292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="WP_005454041.1"
                     /translation="MMIDSSQLQINRKVPHLLAEIIKAIESTEDLSFLKDYQEAQIAN
                     ILESVNIAYRKRVIEAVPPEKYWTVLNLLRYDTAKHIHQSLNKELQHERLAYITDSEL
                     IIFADFLPTEFVDEYLIDQSEESVAHIQQALSYEDNKVGRYAEPHFLVANPKNSVGGI
                     KTELLKRGQSPVRLIIVRDVGGVIGTIEPQILLLHENHTKLTDLTVVTPILEDIQTIQ
                     SVSKQVSIDGGAHWFPIMAGGKIMGVLSMATIAITLRELSLQAVVAENVRSEEDLFTP
                     LTVATRLRALWLVINLLTAFVASAIIGIFDNVVEQVVALAILMPVVASMGGIAGSQTL
                     AVAIRGIALNHLHQSNLKLLVNKELKIATINGLIMGLVIAGVVYMVFDSWPLALIICC
                     AIFLNSLAAAASGTLIPFTLKKFNIDPAVAGSVVLTTVTDVVGFFAFLGLGAIFLI"
     gene            809698..810234
                     /locus_tag="VP_RS18910"
                     /old_locus_tag="VPA0779"
     CDS             809698..810234
                     /locus_tag="VP_RS18910"
                     /old_locus_tag="VPA0779"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017111235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_021451042.1"
                     /translation="MNKLIVFTGGPGAGKTSVIEQLKTQGFICAPETGRHVIQMQVAN
                     HGSALPWNDKQAFRDEMTKEEVSNYRSFNVRQGDVFFDRSIVDVYGYSKLEQLPISHE
                     LITHCQTLRYHSQVFIFPPWASIFSNDEERKQDFSEAVATYQQMVDAYHKFGYQLIEV
                     PKMSVEDRVAFILGSVIE"
     gene            810348..811793
                     /locus_tag="VP_RS18915"
                     /old_locus_tag="VPA0780"
     CDS             810348..811793
                     /locus_tag="VP_RS18915"
                     /old_locus_tag="VPA0780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005376480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005478449.1"
                     /translation="MSFKYLTLLLATTSMNSFADVDLPSGDDWLNHVTNGLAPYWVME
                     SAHGQPVGNFPTFRCDNGVILDPQKPCEELNKGWIRPHFDREYTRMKSRQTYAYGVLF
                     HLTGDKQALELAKKGAYYLIDHLQDEKNGGFVSFTRSGKPGMEWQQRTSQDQAYALVG
                     LAMYYYLTQDPKVEQALIDQQAFIFKQYRRSDDRGLAWVLKDGDGESEKQQELVAQLD
                     QINGYLLLTAPLLPEPAQAKWKQDLQWLTQVMLDNYHSEKEQRFYGAIHHKAVMMPDA
                     KHNDFGHTIKAYWMTYLTGQLLENSNWTEFGFKGMKHTLKQAQYQQNFEQVKALFSPE
                     WQSKWTQESIPAWQSRPHKHYSSSWEWAELDQAAMTVSLVDGSMKETLQYTLPTFMDV
                     WVDHQYGGVGLNPKSTKAFHWGNGYHQFEHALVGYLYAQQMAKQSAKLYYARPAESKM
                     PLNPYYFNADIKALSSQSDGVTTATFTNIRP"
     gene            811894..812145
                     /locus_tag="VP_RS18920"
                     /old_locus_tag="VPA0781"
     CDS             811894..812145
                     /locus_tag="VP_RS18920"
                     /old_locus_tag="VPA0781"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005398555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2999 family protein"
                     /protein_id="WP_005395194.1"
                     /translation="MNPILAMLKENNISDEQINELFQALTQNPLAAMATISQLGLPQD
                     QLQALMAQVMQNPVLIKEAVEELGLDFSKVVEAKAKLQQ"
     gene            812460..812789
                     /locus_tag="VP_RS18925"
                     /old_locus_tag="VPA0782"
     CDS             812460..812789
                     /locus_tag="VP_RS18925"
                     /old_locus_tag="VPA0782"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005478428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YceK/YidQ family lipoprotein"
                     /protein_id="WP_005478428.1"
                     /translation="MKINIFKKLQVVFLVVSASLMVGCSSIDAHAGGGYGKPFSGTAL
                     SVARQPCYLRADITSIALYPLSLIDIPLSLATDVVFLPVDLIMVATPTTSYGGVVSLG
                     CPSGSMI"
     gene            813068..813280
                     /locus_tag="VP_RS18930"
     CDS             813068..813280
                     /locus_tag="VP_RS18930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005478456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005478456.1"
                     /translation="MLLWNLSSLVVFSLILMFLGISIFELIAELGWFSIIIVVLTLIT
                     VCLAYFIFKSGEKMAIKVLLKAQKGA"
     gene            813501..814007
                     /locus_tag="VP_RS18935"
                     /old_locus_tag="VPA0784"
     CDS             813501..814007
                     /locus_tag="VP_RS18935"
                     /old_locus_tag="VPA0784"
                     /EC_number="3.5.1.88"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004746466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_005395192.1"
                     /translation="MAVLEILSIPDPRLKVKAEKVTDVSTIQTLIDDMLETLYATGNG
                     IGLASTQVGRKEAVVVIDISDERNDPLILVNPEVVSGENKALGQEGCLSVPEYYADVE
                     RYTSVVVSALDRDGNPITIESDEFLAIVMQHEIDHLSGNLFIDYLSPLKQKMAMKKVK
                     KYVKAQAK"
     gene            complement(814071..814478)
                     /locus_tag="VP_RS18940"
                     /old_locus_tag="VPA0785"
     CDS             complement(814071..814478)
                     /locus_tag="VP_RS18940"
                     /old_locus_tag="VPA0785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006742286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_015313174.1"
                     /translation="MDIAEVVIKSGLPTSTLRYYEQLGLIRSIGRNGLRRQYSPEVLN
                     KLNLISLGRIAGISLNEMAEMLNHSEGSKPYIDRDLLAKKALEIDEQITRLKAVRDSL
                     NHVASCPHESHMDCSSFQRLMKVVKRYVPKKPR"
     gene            814563..815066
                     /locus_tag="VP_RS18945"
                     /old_locus_tag="VPA0786"
     CDS             814563..815066
                     /locus_tag="VP_RS18945"
                     /old_locus_tag="VPA0786"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005478430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2938 domain-containing protein"
                     /protein_id="WP_005478430.1"
                     /translation="MLFLIGLQAALIGIGATLIMDLWAWLQRRVFGIPSLNYALVARW
                     VLCMPKGKLVHAPIMSTDPMPGEKALGWFLHYAIGVVFALAHIAVFGHHWLVEPSLTP
                     GLITGAVTLVFPFLVIQPCLGFGFAASKTPTPWKARFLSTLAHLAYGLGLFITAFAIK
                     GVSQYFM"
     gene            815301..816329
                     /locus_tag="VP_RS18950"
                     /old_locus_tag="VPA0788"
     CDS             815301..816329
                     /locus_tag="VP_RS18950"
                     /old_locus_tag="VPA0788"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017820977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase A"
                     /protein_id="WP_005478421.1"
                     /translation="MASKATGISILSLLVAPVAMGETASAYDLCLLETIKKSNGEETI
                     ESIRKQCELDTVTSTASVESTTKESEEPQESLIDKRLESEKQTAFEPFSLVAHRINYI
                     LPFTYSDRVNKRAYADTKYGDELRKEEAEFQISFKVPMNYDDLLFDGDGLFFGMTLKS
                     FWQVYTGDASRPFRETNYRPELFYFTPTSWQPLGGSTWLGFGIEHESNGQRQELSRSW
                     NRVYTNLTFAKDNFVASIQPWWRIPEDEKTFPNDPKGDDNPDIEDYMGHFELTSAYKW
                     DDYELTFLGRENFKTHKGYAEIGLLFPIWGKVRGYAQYSTGYGKSLIDYDHNQQRIGV
                     GIAINGVL"
     gene            816424..816882
                     /locus_tag="VP_RS18955"
                     /old_locus_tag="VPA0789"
     CDS             816424..816882
                     /locus_tag="VP_RS18955"
                     /old_locus_tag="VPA0789"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009699017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005454292.1"
                     /translation="MLRDYTFDCLVTMPRHELEEFSARMISKMVPEDVMNELFTFDQE
                     EVDSEDRMLSARLDAMLRMTAIALSEIQQAFDDSDNAKQNSERMTRLVLWHFYAISFH
                     LEEAITLETHCELVEKLLENTPSDVFAWVKTLTELLHTYAEINAKENPQD"
     gene            817214..818218
                     /locus_tag="VP_RS18960"
                     /old_locus_tag="VPA0790"
     CDS             817214..818218
                     /locus_tag="VP_RS18960"
                     /old_locus_tag="VPA0790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="WP_005478452.1"
                     /translation="MDPLTQGLLGAALPQSASNKRHIVAAGVLGVAAGMAPDLDVLIR
                     SSSDPLLFLEYHRHFTHSLLFIPFGSFLCALVLYPLFAKRRGLNFQQSWFYCALGYST
                     HALLDACTSYGTQLFWPINNTRYAWNTISVIDPAFSLPILILLLFAALKRNRSYARVA
                     FLWSLAYLTLGVIQRDRAEAAGWKIVQERQHSAVQLKAKPTFGNLLVWKVIYETEDNY
                     YVDAVRVGRSIKIYPGESTPKLSVKTQFPWLDPQSQQAKDIERFRWFSNGFVVQDPDD
                     EMRIVDVRYSIVPNQINALWGINLSPKASADEHVEYTAHRGSTAEDRQTFLNMLTDFD
                     "
     gene            complement(818258..818650)
                     /locus_tag="VP_RS18965"
                     /old_locus_tag="VPA0791"
     CDS             complement(818258..818650)
                     /locus_tag="VP_RS18965"
                     /old_locus_tag="VPA0791"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005440702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005478422.1"
                     /translation="MNSEAKQLFYHLCQQYDALSQDLESRAFPEFSETITHPLGHCFV
                     RCPVGSQRFSIVAVNFSPSVRGQGVLTAFIDYIKSHPYHYQGVEVAIIENKSLAKRLL
                     SLGWKYKSLFSKIFFANKPTLVKDFQSA"
     gene            complement(818952..820712)
                     /locus_tag="VP_RS18970"
                     /old_locus_tag="VPA0792"
     CDS             complement(818952..820712)
                     /locus_tag="VP_RS18970"
                     /old_locus_tag="VPA0792"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein/permease"
                     /protein_id="WP_005478447.1"
                     /translation="MSRKNNKNLSILLKLNTFIAPYKWRVAAALVALVATASLTLSVG
                     YGVRILIDQGFAQQSLQELTNAIQFIVGVTLCIAIGTFFRFYLVSSVGERVSADIRLA
                     VFNHVITLHPSYFETNSSGDIMSRLTTDTTLLQSIIGSSFSMAMRSALMCFGAIIMLF
                     ATNVKLTLIVLASVPLVLVPILFYGRRVRALSRQSQDSMSDVGSYAGEAIEHIKTVQS
                     FSSEPYERAAFAVEVEKAYEVGRQRVKQRAILISGVIVIVFSAIAGMLWIGGSDVIHG
                     KMSAGDLAAFVFYAIMVASSTATISEVMGELQRAAGATERLIEILQVESDIKAPSNHL
                     PVRSDMSAEVSFKSVNFNYPSRPNQPAVKGLNLTAEQGKVLALAGPSGAGKTTLFELL
                     QRFYDPQQGQVLFGGEDIRQFDPNELRRQMALVPQQPALFSHDVFHNIRYGNPEATDE
                     QVIEAAKKAHAHEFIEKLPEGYYSFLGERGVRLSGGQKQRIAIARAILKDPKILLLDE
                     ATSALDSESEHHVQQALEALMKGRTTLIIAHRLSTIQHADKIAVLDNGELVDVGNHQS
                     LMQSCELYQRLVALQFKHLE"
     gene            complement(820886..821500)
                     /locus_tag="VP_RS18975"
                     /old_locus_tag="VPA0793"
     CDS             complement(820886..821500)
                     /locus_tag="VP_RS18975"
                     /old_locus_tag="VPA0793"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017791282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5' exonuclease"
                     /protein_id="WP_005478451.1"
                     /translation="MPQANSVVVLDFETTGLSPTLGDRAIEIGAVKLVDGEVVDSFQQ
                     LMNPGFRVSSFIENYTGITNNMLRTAPSCEEVMASFSEFIDGENLIAHNASFDKRFLD
                     AELERINCGYSGEFACSLLVARRLIQDAPSHKLGELVRYKNIDNDGVFHRALADAQMT
                     AKLWLLMVEGLENSGIVKPSFQLMQTVSKTAKGKVDLLLAKSRA"
     gene            complement(821655..822560)
                     /locus_tag="VP_RS18980"
                     /old_locus_tag="VPA0794"
     CDS             complement(821655..822560)
                     /locus_tag="VP_RS18980"
                     /old_locus_tag="VPA0794"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_021451039.1"
                     /translation="MLEKIDQQWLKSFHCVYENNSFKRAAEFLSLPTSNVSRHIALLE
                     EQLDVRLFDRTTRRICATDAGEQLYLRTQPLLDKLNDALEEVTRHSREVMGQLNVVMP
                     DSPELAKAVVSFCAQYLAISLNCETNLSPKEDLLDGFDVIVSFHRGKLEDSNWIAKEI
                     KRWPSVVVASPKLLHTRQRPFKITDLKHVPCISSFTALKGTPWVFRNSEGELITQRVQ
                     SAFKVNSGKLAKSGALAGFGFAILPVEFCHEEIESGDLEVIELEYEPEDLVLYAFYAS
                     RKHLAKKIPAFIEHLKRQANNETSG"
     gene            822670..823539
                     /locus_tag="VP_RS18985"
                     /old_locus_tag="VPA0795"
     CDS             822670..823539
                     /locus_tag="VP_RS18985"
                     /old_locus_tag="VPA0795"
                     /EC_number="6.4.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005533218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase carboxyltransferase
                     subunit beta"
                     /protein_id="WP_005454231.1"
                     /translation="MSWLEKLLDKKNIINTRKASIPEGVWTKCPSCDQVLYRIALKEN
                     LEVCPKCQHHLRMSARHRLDGFLDKGERIELASEYEPKDLLNFKDKKRYKERLALSQK
                     STGEKDALVVMKGELLGLPIVACAFEFSFMAGSMGSVVGARFVDAVDTAIEENCGLVC
                     FSACGGARMQESLMALMQMAKTSAALERLSNARLPYISVLTDQTFGGVSASLAMLGDI
                     NIGEPEARIGFAGRRVIEQTVREKLPDGFQQSEFLLEHGALDMIVQRHDMRERIGGLI
                     AKLTNTSIRLEVK"
     gene            823684..824760
                     /locus_tag="VP_RS18990"
                     /old_locus_tag="VPA0796"
     CDS             823684..824760
                     /locus_tag="VP_RS18990"
                     /old_locus_tag="VPA0796"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005478461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine aldolase"
                     /protein_id="WP_005478461.1"
                     /translation="MSTHLKQLCHTHLPGNKEDSPAEHFAKMAKWCEENKVNHDVYGE
                     GETIHAFEQKVADLLGYEAGLFVVTGTMTQPTVLEIVTRQKRNPIVAMHASSHIPEHE
                     KQGYQLQHRFSVLPVGNVYQTWKLEDLTAWPDEIAAVLYELPMREIGGQLPSWQELEE
                     IKAYCAEKDIHLHMEGARLWETAAYYQKEYREIAAGFDTTYVSLYKGINGMGGSMLLG
                     SKAFIELASMWMKRQGGNLYHRTPYVVSAAMQFDERLAQLPDLFERTKQIYKIIDEFP
                     SLAVRPTQPQANMLHLILPFSCEKLKELQHIFATEKGIWFGNPQVTAHPHQSIVEWYV
                     GDYLLNLGDEELRSFFNQLLGGKA"
     gene            824843..825103
                     /locus_tag="VP_RS18995"
                     /old_locus_tag="VPA0797"
     CDS             824843..825103
                     /locus_tag="VP_RS18995"
                     /old_locus_tag="VPA0797"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005376453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF5062 family protein"
                     /protein_id="WP_005376453.1"
                     /translation="MSKSSKLHNEDKLVKKALEIGGKMAKLQGFDLPQSPQPLRVKAI
                     YLFLVDAKQITPLPESKLDGASIKHRLAVWIHSALPDNDPLK"
     gene            825327..825821
                     /locus_tag="VP_RS19000"
                     /old_locus_tag="VPA0798"
     CDS             825327..825821
                     /locus_tag="VP_RS19000"
                     /old_locus_tag="VPA0798"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006231607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YcxB family protein"
                     /protein_id="WP_005478450.1"
                     /translation="MSKDFEFTTEYTLDKPFFAECYDQTSQPVKFPQAYLKGILFLIF
                     GVVLLEFELLPNGYVGWFFIVLSVIEACSVYFKRTWWLWRQTISSSRGNKVVFEVNAD
                     SVRYKSGKIDRSLAWSEIDQLEQTDLGFILHLGKQRQYISKSCLNEEVIAFMVEQHAG
                     SKAS"
     gene            complement(826042..826707)
                     /locus_tag="VP_RS19005"
                     /old_locus_tag="VPA0799"
     CDS             complement(826042..826707)
                     /locus_tag="VP_RS19005"
                     /old_locus_tag="VPA0799"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="WP_005454174.1"
                     /translation="MFNVVRTYPEPPSIAKNEYNKDDVLKKLRPMFFDKCYLCERDDI
                     QDVEVEHFIPHIKNTALKYNWENLYYSCSRCNGIKSSTHINLLDCANRFYDVGAMVKC
                     LMPSTPDGDVEVSATSATPCIQTANTVTLLEACYNLDNTALREISRETLMEDMWDHYT
                     ELLNARQVLRKKRSGHTEKKNAKEIIEVMLDVEYPFSIFWRYYYLNDSFLVQHYPQLR
                     VGF"
     gene            complement(826712..827941)
                     /locus_tag="VP_RS19010"
                     /old_locus_tag="VPA0800"
     CDS             complement(826712..827941)
                     /locus_tag="VP_RS19010"
                     /old_locus_tag="VPA0800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005478434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_005478434.1"
                     /translation="MIESIDFKLIGTSDKRVITNLNGKNLIITGENGCGKTRFLRQLH
                     QYLQQFFKRQIQSKESIQQQLNYHQTQLENTSVSHQTYNYFVEHVQSYTKQLERISNE
                     SMDISDSDALFELVNNNQFILRFFEANRLANNIAGNGQIESISNVKQAGKSQNFEQDS
                     SNQFEKYLVSYYNYGSHVIARENNPEKEQQINAWFEKVQNDLRDLFEDHGLILQYNPE
                     EQAFYIHQEGKDPYRFNNLSSGYSSILSIYADLLMKVELRDIPAEDITGFVLIDEIDA
                     HLHVSIQRKIFSFFDKAFPKIQFIVTTHSPFVVQSVNDSIIYDLSKLEPLEDLSMYSY
                     ESILKGLLGVESTSDILNKRLDEMAEIINQEPVNTEKLQELIDSIEPYEGQLNARSRA
                     FLLLGKNALLDSTDGEG"
     gene            complement(828140..831004)
                     /gene="gcvP"
                     /locus_tag="VP_RS19015"
                     /old_locus_tag="VPA0801"
     CDS             complement(828140..831004)
                     /gene="gcvP"
                     /locus_tag="VP_RS19015"
                     /old_locus_tag="VPA0801"
                     /EC_number="1.4.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017189009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminomethyl-transferring glycine dehydrogenase"
                     /protein_id="WP_005478418.1"
                     /translation="MTELLQSLSTQNEFVGRHNGPKLSDQQKMLEAINAVSLDALISE
                     TVPANIRLEQPMTLAEAKSEADMLATMKQFAKQNQVKRTFIGQGYYNTFTPNVILRNV
                     LENPGWYTAYTPYQPEISQGRLESLLNFQQMVIDLTGMEIANASLLDEATAAAEAMTL
                     CKRAGKSKSNVFFVADDVHPQTIEVVKTRAKFIGFEVLVGSLESLPEQDVFGALVQYP
                     STTGEVRDLTDIIAKAQANKTLVTVATDLLACTLLKPAGEMGADVAIGSAQRFGVPMG
                     YGGPHAAFMATRDKHKRTMPGRVIGVSIDAKGNQALRMAMQTREQHIRREKATSNICT
                     AQALLANMASFYAVYHGAEGLRTIARRTHHMTAILAAGLTKGGFELAHNSFFDTITIN
                     TGEKTQDLYTKALAADINLRVLPGKLGISLDETTTVADVEALFAIFGVKEDVTALSTE
                     VAGNEFAAIPEALRRTSEYLTHPVFNTYHSETQMMRYLKQLENKDFSLTHGMIPLGSC
                     TMKLNAAAEMIPITWPEFGSIHPFAPAEQAAGYAALAKDLKEKLCEITGYDAFSLQPN
                     SGASGEYAGLIAIQRYHESRGEGHRNVCLIPSSAHGTNPATASMVSMKVVVVKCDDEG
                     NIDIDDLAAKIEKHKDNLSSIMITYPSTHGVYEEKVKEVCEMVHAAGGQVYLDGANMN
                     AQVGLTSPGFIGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPGHIENGVEG
                     EDFAVSAADFGSASILPISWAYIAMMGEAGLSNATKVAILNANYVMERLRPHYPVLYR
                     GKNGRVAHECIIDIRPLKEETGISEEDIAKRLMDYGFHAPTMSFPVAGTLMVEPTESE
                     DLAELNRFCDAMISIREEMTKVKNGEWPLENNPLVNAPHTQVDLSAEEWDRPYSRELG
                     CFPSKATKSWKYWPTVNRVDNVYGDRNLICSCPSIDNYED"
     gene            complement(831133..831513)
                     /gene="gcvH"
                     /locus_tag="VP_RS19020"
                     /old_locus_tag="VPA0802"
     CDS             complement(831133..831513)
                     /gene="gcvH"
                     /locus_tag="VP_RS19020"
                     /old_locus_tag="VPA0802"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006878513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein GcvH"
                     /protein_id="WP_005454126.1"
                     /translation="MDKTLKFTDSHEWVRDNGDGTVTIGISEHAQEMLGDVVFVDLPD
                     VEDEVEAGESFSLVESVKAASDIYSPVTGEVVEINEELEDSPELINEEPYEGGWIVKV
                     KLSDPSELDDLKDAEEYLSSIEEE"
     gene            complement(831565..832860)
                     /locus_tag="VP_RS19025"
                     /old_locus_tag="VPA0803"
     CDS             complement(831565..832860)
                     /locus_tag="VP_RS19025"
                     /old_locus_tag="VPA0803"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020197066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="WP_005478453.1"
                     /translation="MNKSYPNHSLENFFSTNLSATDDAVFAGIQAEFTRQNEQIELIA
                     SENIVSKAVMQAQGTCLTNKYAEGYPGRRYYGGCEHVDTVEAIAIERAKKLFNCEYAN
                     VQPHSGAQANGAVKLALLQPGDTILGMSLDAGGHLTHGARPALSGKWFNAVQYGVDRE
                     TLEINYDDVRALALEHKPKMIIAGGSAIPRTIDFAKFREIADEVNAILMVDMAHIAGL
                     IATGAHPSPLPHAHVVTTTTHKTLRGPRGGMILTNHEDIIKKINSAVFPGLQGGPLMH
                     VIAAKAVAFGEALGPEFKTYIDSVINNAKVLAEVLQTRGCDIVTGGTDTHLMLVDLRP
                     KGLKGNKAEEALERAGITCNKNGIPFDTEKPMITSGIRLGTPAGTSRGFGAEEFKLIG
                     NWIGDVLDGLVNNPEGDAIVEKRVRKEVKELCSRFPLYQ"
     gene            833236..833859
                     /locus_tag="VP_RS19030"
                     /old_locus_tag="VPA0804"
     CDS             833236..833859
                     /locus_tag="VP_RS19030"
                     /old_locus_tag="VPA0804"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008216960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_005478414.1"
                     /translation="MAESIYDEYPSMTLAKEQNDQNIEPLKLGQRIKDIRSKLGITLE
                     EASQRTGLARSTLSKIENEQISPTFQAMQKLALGLQIDMPQLFEPPRKKVATGRRDIT
                     KKSEGKPHPTQTYEHELLATQLSNKKMMPFKSQIRARSFDEYKDWVCHDGEEFLLILS
                     GEVMFYSEFYEPVVLSEGDSVYYDANMGHMLTSVSEEDAQILWVTAK"
     gene            834120..835238
                     /gene="gcvT"
                     /locus_tag="VP_RS19035"
                     /old_locus_tag="VPA0805"
     CDS             834120..835238
                     /gene="gcvT"
                     /locus_tag="VP_RS19035"
                     /old_locus_tag="VPA0805"
                     /EC_number="2.1.2.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009599481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system aminomethyltransferase
                     GcvT"
                     /protein_id="WP_005478448.1"
                     /translation="MTQELLKTPLHALHVEVGAKMVPFAGYDMPVQYPLGVKKEHLHT
                     RDAAGLFDVSHMGQLRLIGEGAAAFLETLVPVDIVDLESGKQRYAFFTNEEGGIMDDL
                     MVANLGDHLFVVVNAACKEQDIAHLKAHLPSGVELEVIEDRALLAIQGPQAATVLARF
                     APEVADMLFMDIRKVEILGAECIVSRSGYTGEDGYEISVPADKAEELARKLTAEEEVE
                     WIGLGARDSLRLECGLCLYGHDLDTTTTPVEASLLWGIQKVRRVGGEREGGFPGADII
                     LKQIETKDVARKRVGLVGQTKAPVREGVELFDADGAKIGIVTSGTAGPNAGKPVSMGY
                     VRADLAAIGTELFAEVRGKMLPMTVEKMPFVPQRYYRG"
     gene            complement(835311..836036)
                     /gene="vdeR"
                     /locus_tag="VP_RS19040"
                     /old_locus_tag="VPA0806"
     CDS             complement(835311..836036)
                     /gene="vdeR"
                     /locus_tag="VP_RS19040"
                     /old_locus_tag="VPA0806"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005478460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux transporter transcriptional repressor
                     VdeR"
                     /protein_id="WP_005478460.1"
                     /translation="MNVRKQGRRSAEAAEQTKCLILKVAADMFCELGYERVSLRNISE
                     KAGVSHSLIRHHFGSKEKIWQAVSDAMDEFLQNYMAGLINEMPENTPSNRKIYLFMVR
                     MLAFALVNPHPVQMIADSIRQDDNALFDYFLKSKDEFAEIFTSIFAQYNSEFPEAQFD
                     QWESKWQMLIFAHGAVSLAPMMQETWPDIADNREQLLIKHWELFNTIMATQFRIAKED
                     MIHPSKLEDIVIDMCCTIDEAVN"
     gene            836187..837272
                     /gene="vmeT"
                     /locus_tag="VP_RS19045"
                     /old_locus_tag="VPA0807"
     CDS             836187..837272
                     /gene="vmeT"
                     /locus_tag="VP_RS19045"
                     /old_locus_tag="VPA0807"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011106358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter periplasmic
                     adaptor subunit VmeT"
                     /protein_id="WP_011106358.1"
                     /translation="MEKPVRKQTIKHTLIGAVVTLSLSTLLTGCNKAISEPAEPLIKP
                     VKLLAVKDLTVDDSDAFLARIDATYRAQLSFQVSGEVEKLLVRMGQGVEKGEVLATLD
                     PKDLQLALDAAQAQYALAKTQWERAKSLYGKKLISTDSYDQKETQYKAALASFEQAKT
                     DLSYTKIQAPFDGVVSYTYVKPYQVVGEKQEILNLIDNTTLDVSFTLPVSYAESVSLS
                     ALKNAEMWVTMDSEPSKRIPGKFKEISTQPNIDTNSYEAIVTITRPTDRNLLTGMTGQ
                     VHIAKQNKSNAMTLPTSAWVNKQEKQGEVWVMDSSTQQVSKVTLSLNESGAIESGLDN
                     NDYVVIAGVERLVEGQVVKAWIREEGI"
     gene            837272..838333
                     /gene="vmeU"
                     /locus_tag="VP_RS19050"
                     /old_locus_tag="VPA0808"
     CDS             837272..838333
                     /gene="vmeU"
                     /locus_tag="VP_RS19050"
                     /old_locus_tag="VPA0808"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005478445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter periplasmic
                     adaptor subunit VmeU"
                     /protein_id="WP_005478445.1"
                     /translation="MKHSLFAVSAIALAVLTGCQSDSQNVAEQPLYVSTISVDAPVKS
                     QYRAFKGLVVPAEQTPMAFRRAGEIQHVLVKAGDVVKEGQMIAKLDDSKEKQAVNDAE
                     AQYTLAIRQLKRGEELHGRQMISKAELDELTANKELAEANFYNATNQLNYTRLFAPFA
                     GKVSDVFKERFERVAIGEPVLNLYQNDVVYVRIELSDNVLAMVNPTAQNMSYKPRATF
                     SGIPTTYALDYLEHTSEPNSETQTYEMYLTMPQPEQEILPGTSVSVMVDMIKAGITSI
                     DGYNIPMTALQAGNDDNEFFVWKMNGDAVTKVPVAISQVNGEGAIVSSGITQGDVLVN
                     SNLRKLREGKHVDVVEKEQ"
     gene            838333..841392
                     /gene="vmeV"
                     /locus_tag="VP_RS19055"
                     /old_locus_tag="VPA0809"
     CDS             838333..841392
                     /gene="vmeV"
                     /locus_tag="VP_RS19055"
                     /old_locus_tag="VPA0809"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005478455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter permease
                     subunit VmeV"
                     /protein_id="WP_005478455.1"
                     /translation="MNIAEYSIKNKVISWLFIVILAIGGVTSFLELGRLEDPAFTIKD
                     AMIVATYPGATSKEVEEELTYPLEKEIRKLPYIDRITSTSSNGMSQIMVSMKMDYGPD
                     ELPQIWDEMRRKINDLQPTLPQGVQSLQIIDDFGDVYGVMLMLTGDDYDYVELKRYAD
                     HLRREIELVDGVGKVDIAGDQQEMLFVEISLDRLASLNLDMNVVSGLLNQQNNVVSAG
                     EVMVNGESLVIRPSGTLNTVQALENLIIHGRDTGNLIRLKDVATITRGIQEKPGNMIL
                     FNGKKAINIGISFASGVNVVEVGERLNAELSSLESIKPAGLDMSYFYNQAQEVDDSVK
                     AFVISLAEAVAIVIIVLLFTMGLRSGVIIGVVLLLTVFGTFILMNYNNIELHRISLGA
                     LIIALGMLVDNAIVVVEGILVGLKKGRTKVQAAVDIVKQTQWPLLGATVIAITAFAPI
                     GLSQDATGEFMGSLFWVLCFSLFLSWVTAITLTPFLADLLLKEEEKDKNGEDEDPYKG
                     WLFVVFGALLKFSLRFRWMTVAAMVALLVGAVIAFGNVKQQFFPPSNTPMFYVDMWMP
                     EGTDIRQTIKQAEKVESYIRQQDDIDFVSVSIGQGLQRFALTYQPEKSYEAYAQFQVR
                     TTDRDNMFKLLHKLDDNLAKTFDEPTFQFKLMEFGPSPASKIEARITGPDPKVLRELA
                     VQVEDILHTDPGARNIRHDWRERTKELVPVFNESKARRLGISKEDLSSTLQMAFGGST
                     FGVLRDGTHTLPIMMRLPEAERVDFESLQNVKIWSPSLQTYIPVDQIIDGVELDWSEP
                     LIQRRDRKRTLTVLADHDVLSDDTAASLFARVQPKVMALHIPEGYEITWGGEYESSKD
                     AQEGLFGSLPMGYLLMFIITILLFNSIKKPLVIWFTVPLSIIGVAFGLLTTNMPFSFT
                     AFLGLLSLSGMILKNGIVLLDQINLELESGKDPYLAIVDSAISRVRPVSMAALTTILG
                     MIPLVFDAFFGSMAITIMAGLGFATVLTLIVVPVMFAILFRIKPTTA"
     gene            complement(841461..842036)
                     /locus_tag="VP_RS19060"
                     /old_locus_tag="VPA0810"
     CDS             complement(841461..842036)
                     /locus_tag="VP_RS19060"
                     /old_locus_tag="VPA0810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin family protein"
                     /protein_id="WP_005454197.1"
                     /translation="MKKAVLLLAAVSAFAQANQTDVEKKDVSGFYLGGGIGVTTVYDD
                     SVWPYAVNLDSNDSTYKLFGGYQFNRIVAIEAQYTRYGDIFDKFEDAPRTMVKPENIA
                     LMANLGYTFDSGWRPFATVGLGRTELDFGSSSKAETSFRAGVGGEYSPKAIENLNFRI
                     AYEVDTFVIDETYDDLTIMLGSLYAGVSYKF"
     gene            complement(842345..844078)
                     /gene="fruA"
                     /locus_tag="VP_RS19065"
                     /old_locus_tag="VPA0811"
     CDS             complement(842345..844078)
                     /gene="fruA"
                     /locus_tag="VP_RS19065"
                     /old_locus_tag="VPA0811"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017189018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIBC"
                     /protein_id="WP_005478462.1"
                     /translation="MNIAIITACPSGVANSILAAGLLEQAVAKLGWNAKIECQSSVIA
                     PTPLTDADIEQADAIVIAANTTVDTSRFVGKKVYQAEISAVAKDATAFLTTAVESAAT
                     LEQATTVEAPVESASATKKIVAITACPTGVAHTFMAAEALEEEGKRRGHQIKVETRGS
                     VGAKNQLTDQEIADADLVIIAADIEVPLDRFNGKKMYRTKTGPALKKTAEEMDKAFEQ
                     ATIYQHSGAASSASATDEKKGAYKHLMTGVSHMLPVVVAGGLIIALSFVFGIEAFKEE
                     GTLAAALMTIGGGSAFALMIPVLAGYIAFSIADRPGLAPGLVGGMLASSTGAGFLGGI
                     AAGFIAGYAAKLLADKVKLPQSMEALKPILIIPFVATLFTGLVMIYIVGGPVSGIMNG
                     LTDFLNNMGSDSAVLLGIILGAMMCFDLGGPVNKAAYAFGVGLLASQTYAPMAAIMAA
                     GMVPALGMGLATFLAKNKFEPNEREAGKASFVLGLCFISEGAIPFAAKDPMRVIPSCM
                     AGGALTGALSMLFGAKLMAPHGGLFVLLIPNAISPVLMYLVAIAAGTAVTGFTYAFLK
                     NKADAKQEVAA"
     gene            complement(844098..845072)
                     /gene="pfkB"
                     /locus_tag="VP_RS19070"
                     /old_locus_tag="VPA0812"
     CDS             complement(844098..845072)
                     /gene="pfkB"
                     /locus_tag="VP_RS19070"
                     /old_locus_tag="VPA0812"
                     /EC_number="2.7.1.56"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004742773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-phosphofructokinase"
                     /protein_id="WP_005478454.1"
                     /translation="MTALKTNKVVTITLNPALDLTGSLDALKVGSVSLVEQSSLHAAG
                     KGVNVAKVLSDLGADVTVTGFLGKDNPELFHQLFTEIGVKNEFVEVEGATRINVKLVE
                     ADGQVSDINFPGVQVTAEEIARFEETLFRLADTHDYFVLAGSLPGGITAEQCAAWIEK
                     LHQQGKKVLFDSSKAALRAGIDAHPWLIKPNDEELSDFVGEHLETPEQCQVAAQTLSN
                     KGIENIVVSMGADGVMWLNQSEWLRAQPPRMNVVSTVGAGDTLVAGLCWGHMQVMPKH
                     DLLRFATALSALAVSQVGVGLTSQEELENIKLQTQVSELYPNTNLDKN"
     gene            complement(845084..846214)
                     /gene="fruB"
                     /locus_tag="VP_RS19075"
                     /old_locus_tag="VPA0813"
     CDS             complement(845084..846214)
                     /gene="fruB"
                     /locus_tag="VP_RS19075"
                     /old_locus_tag="VPA0813"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017634190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fused PTS fructose transporter subunit IIA/HPr
                     protein"
                     /protein_id="WP_005478424.1"
                     /translation="MLKLNKNDITLSQSAADKFAAIKNIAQSLTDKGLVEQGYVEGML
                     NRENQNSTFLGNGIAIPHGTTDTRSMVKTTGVAVHHFPKGVDWGDGNKVFVAIGIAAK
                     SDEHLGILKQLTKVLGADGVEERLRDAKSEEDIIALLHGDVQLEADFDASLIQLLFPA
                     SDMVQMSAVAGGLLKNTGCAGAEFVADLVTKAPTHLGNGLWLVGSDKHVSRTGVSFVS
                     TANDCEYEGQKVRALVAFAACNNAHQSILNNLSKIVFNNEQNKLLDASAEQILALFKG
                     EEVAAPAEDGNVAVFKIKNAHGLHARPGAMLVAEAKKFESNIRVANLDGDGKAVNAKS
                     LMKVIALGVKHGHQLQFSAEGPDAAQALESIGNAIASGLGEG"
     gene            846579..847559
                     /gene="cra"
                     /locus_tag="VP_RS19080"
                     /old_locus_tag="VPA0814"
     CDS             846579..847559
                     /gene="cra"
                     /locus_tag="VP_RS19080"
                     /old_locus_tag="VPA0814"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014234292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catabolite repressor/activator"
                     /protein_id="WP_005454171.1"
                     /translation="MTLDEIAKLAGVSKTTASYVINGKAQKYRISEKTQKKVMAVVDE
                     YNYKPDHAASSLRAGNSRSFGLIIPDLENTSYARLAKLIEQNSRKAGYQILIGCSDDD
                     PETEKKVAEALISRRIDALFVASGMPSANEYYLKLQNSGTPVIALDRPMDDEHFCCVI
                     SEDFDAAFELTESVLSPEIKTIGLIGALQDLQVSKERELGFRSACQKDDTAMTVGYGL
                     HFSREEGKKVLDKWVQADSLPDAIVTTSYTLLEGVLDVMLEKPELMSQVRLATFGDNR
                     LLDFLPVKINSLPQQFELIADSAMELALNASAKRYKPGVELIPRKIVKRQ"
     gene            complement(847567..848520)
                     /locus_tag="VP_RS19085"
                     /old_locus_tag="VPA0815"
     CDS             complement(847567..848520)
                     /locus_tag="VP_RS19085"
                     /old_locus_tag="VPA0815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010649345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase family
                     protein"
                     /protein_id="WP_005478417.1"
                     /translation="MSQPSRITFVTANLFNFVAPPNAYYDFENIYSQEQWRDKLAWTQ
                     NQLEKLEPDIIGLQEVFSIEETRAYFLSLGFPYFATVDTPKIEDEYIYSRPVVAIASR
                     FPIEDVKRVEFDSNSLTPFGVNEAPDFSRKPIYAQVVHPVLGHIAIYVTHLKSQRPAD
                     TETPEPSSRVMARWLSTQQRGWEAAMLRDAMQAQYRAHPIPTVLMGDMNQPISKESVN
                     NVLTETFSDSVTELQLKDGWNLQTGSSLEVRPATHYHFSTGNVLDYILLSQEFDTHSD
                     ISVAEVIDYQVLEQHLINPSYEKDKNASDHAFVSLTVEVKL"
     gene            848747..849286
                     /locus_tag="VP_RS19090"
                     /old_locus_tag="VPA0817"
     CDS             848747..849286
                     /locus_tag="VP_RS19090"
                     /old_locus_tag="VPA0817"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010649343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding S4 domain-containing protein"
                     /protein_id="WP_005478472.1"
                     /translation="MTQDYDHEEYLEGDEIEIEAIGIDVDAHPIELYKLFKIANLVSG
                     GGEAKHIIEEGYVAVNGELETRKRRKMYDGDFFEFNQEYYVVVCDAPVTEPETAEQKA
                     EKKAKKEAQSTRKEKSRQSKPPKAKGTGPKSTGRKAAHKERKAQKEALTQSAKKGKKE
                     DKPQATRDPKSGRNSIDFF"
     gene            complement(849413..850231)
                     /locus_tag="VP_RS19095"
                     /old_locus_tag="VPA0818"
     CDS             complement(849413..850231)
                     /locus_tag="VP_RS19095"
                     /old_locus_tag="VPA0818"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_005479128.1"
                     /translation="MELKKQSDYEQYIRQDGLGEYYVVINQFTFHSVYQPIFDKHQRV
                     IGMEALLRIHGADGVQIRPDIFLSNASIDPYFRLCVEFLSRAMHIRNFARHFAGTPIK
                     LFLNVMPQTLLTLTKDMGFKDNGLLYKRLADLGMTPSDVVFEVVEESCGDTDLLIKAV
                     QLMRANGFIFAIDDFGAQHSDIARVQQLCPDIIKIDRSYLLDYCAGDTFSIRSAVDLA
                     ATMGAKVIIEGVEENNQLQAMRQLELDYYQGFYLGKPSAIHHWTEYATCQCTVH"
     gene            complement(850324..851244)
                     /locus_tag="VP_RS19100"
                     /old_locus_tag="VPA0819"
     CDS             complement(850324..851244)
                     /locus_tag="VP_RS19100"
                     /old_locus_tag="VPA0819"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017189021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_005479152.1"
                     /translation="MGEQTTTRTAPTKANTGSFLVQFNALDWVLLIICGICGVWLYHR
                     SSVGVHYLWQWKEAFELLFTPRSDGGLPYFFQGLISTLRLSIWGISFALVLGTLLGLA
                     RFSRSVWLRTPANAFIQLVRNIPPLVFVFIFYFFISNQLIPLLGLEDLLRNYNGEPNA
                     LQSFLFGPSNLWENLASGVLCVGLLSSAYIAEVVRAGLQSIDQGQWEAADSLGLSRWV
                     KYRFVIAPQVLKAITPALAGQTISLVKDTSIVSLISIQEMTFVGTEMANSSGYIFEIW
                     LIVGFSYFLICFGLSLIFRYIEKKSESISN"
     gene            complement(851326..852147)
                     /locus_tag="VP_RS19105"
                     /old_locus_tag="VPA0820"
     CDS             complement(851326..852147)
                     /locus_tag="VP_RS19105"
                     /old_locus_tag="VPA0820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009385996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="WP_005479113.1"
                     /translation="MKLFKATITALLGLAIAMPTLAKEEAATTPNIDQIKERGTLRVG
                     MSTFVPWAMRNKQGELIGFEIDVAKRLAEDSGLKVEFVPTAWDGIIPALLAKKFDVII
                     GGMSVTPERSKSVLFTEPYSHSGVQVAANKELASGFSEFSDFDSRRVKIAARRGAFTV
                     QVARETFPKAKILQFDDDAQAFQEVLNGNAHAVIASSPKPEHETVKHSDKLFLPFSER
                     LSKGNEAFAVRLGEEDKKAFFNKWIEERTQDGWLKQRYEYWFSTLDWQDQVAQGQ"
     gene            complement(852157..852954)
                     /locus_tag="VP_RS19110"
                     /old_locus_tag="VPA0821"
     CDS             complement(852157..852954)
                     /locus_tag="VP_RS19110"
                     /old_locus_tag="VPA0821"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005530801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_005479143.1"
                     /translation="MIVRVIKPVLQALLQMMLLFIAIVWVLDSGADAMGYQWQWERVP
                     DYIAFYEDGEWWPAELIDGLLVTLNISAISLFFTLVLGLVTALLRLSDSKVGNVIGTT
                     YVEVIRNTPLLVQIYLLYFVFGPVIGLDRFSTAVLALSLFQGAYTAEIFRAGLNSIPK
                     GQFEAAQTLGLSPFYTYKDVILPQVLQRTLPPLTNEVVSLIKNSSIVSVMAIFDLTTQ
                     ARNIVSETAMPFEIWFTVAAIYLALTLSLSGLSAWLEHKLGASWRKL"
     gene            complement(852954..853688)
                     /locus_tag="VP_RS19115"
                     /old_locus_tag="VPA0822"
     CDS             complement(852954..853688)
                     /locus_tag="VP_RS19115"
                     /old_locus_tag="VPA0822"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017820955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_005479122.1"
                     /translation="MKENTPVVEFSNVNKWYGDYHALKDINFSVHSGEIVVVCGPSGS
                     GKSTLIRCINHLESIQEGQLYVFDQPSHAQSLKPGKIGMVFQHFHLFPHLTVLENLTL
                     APIRTLKLSKQEAEKRARHYLKRVNIEEQASKYPIQLSGGQQQRVAIARSLCMEPDLL
                     LFDEPTSALDPEMINEVLDVMVELAQSGMTMICVTHEMGFAKKVANRVVFMDEGQIVE
                     MNSPTALFETPQHPRTQAFLNQILSY"
     gene            complement(853898..855376)
                     /gene="pyk"
                     /locus_tag="VP_RS19120"
                     /old_locus_tag="VPA0823"
     CDS             complement(853898..855376)
                     /gene="pyk"
                     /locus_tag="VP_RS19120"
                     /old_locus_tag="VPA0823"
                     /EC_number="2.7.1.40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005397636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate kinase"
                     /protein_id="WP_005479141.1"
                     /translation="MCKTKIVATLGPASESRETLTKLIRAGANVVRLNFSHGTAQEHI
                     ARANLVREIAAELDTYVGVLVDLQGPKIRISCFENGAVLLNQGDVFTLSGTLDAQSGT
                     QEMVGLDYPELIQDVNEGDILLLDDGRIQLKVSQLHRDEQWIKTTVLNSGKLSNRKGI
                     NLLGGGLSAPALTAKDIQDIDTAAKLRADFLAISFPRNAQDIEYARSLAQKAGCHAKI
                     VAKVERAEVVETKEAMDDVIKASDIIMVARGDLGVEIGDARLPMVQKSLINRSKHWGK
                     PVITATQMLESMIENPLPTRAEVLDVANAIIDGTDAVMLSAESAAGKYPIEAVEAMVR
                     IAQGAEHELECNHDCWDTLQHLCSNPGKSFALSSMISASRVHQDLGVAILTQHGETPL
                     LMSRCQSKTKIWALSDNPALLAQMTILRGVEPLYFKAAESHVDLAPQLVECLRQKANE
                     AHISSILMTQLDSIEGMGEINACRLLSLNVSSHMKPAEEIAA"
     gene            complement(855511..856890)
                     /locus_tag="VP_RS19125"
                     /old_locus_tag="VPA0824"
     CDS             complement(855511..856890)
                     /locus_tag="VP_RS19125"
                     /old_locus_tag="VPA0824"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005397635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_005479116.1"
                     /translation="MFNFFKTRPDLPLSDGSKEEMQARFKRYQWHVFLGLVFGYAVFY
                     VVRMSLGVVKKPMLDAGIVTIEELGIMGSAFFFTYAFGKFSNGFLSDYANIGRFMSFS
                     LLLSGITAVFMGLNTTAFFFVLLWGLNGWFQSVGSAPSCVSLFQWFSPKQRGSRYSIW
                     GGSRNIGEGITWILTASLVSYFGWRAGFIGAGIAAIAAAICMFFILKDRPQTYGLPDS
                     ATAFDEEPEIKKKNDPQATRRAQMFILKQPTVWLIAAACAAMYISRYAMSSWAVLYLQ
                     EAKGYSLIDAGFAMSTYPIAGLAGAILSGIISDKVFNSNRHIPTLLYGLANIGGMCLM
                     FFGPDNRIVDAVALGMIGFAIGGLVVFLAGLTACDLMPKNAVGAVKGFIGLFSYIAAS
                     GQELASASLIKITEVDGVTKYDFAQAQYFWLAAGVISLLLALTVWNAKKVVDIDPVEE
                     KELEARPSH"
     gene            857178..858464
                     /locus_tag="VP_RS19130"
                     /old_locus_tag="VPA0825"
     CDS             857178..858464
                     /locus_tag="VP_RS19130"
                     /old_locus_tag="VPA0825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_005479109.1"
                     /translation="MADFKQFGRRLLLGAALYAPLTMAAEKELVILTTFSQAPITALV
                     DDFTQHYPDAEVRVVHRRTQSSLQLLSKSYMKDIDLVLSSSPFLMQELSNEHRLADMS
                     SRVQVPKWLSPYLLPNNDQVVAFGYSGAGIVWNKDYLAANHLPEPKRFQDLTNPLYFG
                     HVTMSTPSRSGTTQLMVESVLSQYGWQEGWRILLNVGANLATISSRSFGVADYIAKGK
                     FGIGPTIDSYALIAQRKFDYVGFAYDQDFTLMPTYIAQINRGKSDKLAESFIAHLLSK
                     EVQEQMESSTFSKTALDDTARYGGENPVLDLEQVMPREALINLIFDTAITKRLPELQD
                     AWLSLIKLNRLADGKAEKQRSLQAIEKQLFELPLSKAQATEIAQKLLTMDKDSEVGMT
                     HYQALLAEFSHELGRAMSEKLDNVNQQLAQWRGKEK"
     gene            858443..860818
                     /locus_tag="VP_RS19135"
                     /old_locus_tag="VPA0826"
     CDS             858443..860818
                     /locus_tag="VP_RS19135"
                     /old_locus_tag="VPA0826"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017034973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011106362.1"
                     /translation="MAREREVVLYPKYKTIGARLIAAFACSTLLLTVVCLVAWATWNS
                     LDNQVRLLLEDSVPKYNASYFLESKTSEINRRVEALQAVDNKVQLTEQAMQVNEQLAS
                     ISTVLKSNKMSSEFYQLLESEAGLASLLEKYVDMISTRIDQTRRVDQLMEQINWLHQD
                     IRSELKPVRQEVHWQIERVNDSKEIQNLLVQLSTLQRVIDIESAVYDMAIDVAGASMP
                     EQVDNGMKVIHFRLMDLQESSTTLMNQPTSIAYKQLLQELVVVLSPEGAFDKQLMSLV
                     TLNGDIQKIQEQIALSMEAIHQQIGELVSTADQTFKQVKSETAERVSYGNHVLIVCFS
                     LSIMTSMFLTYYFINRRIVARLIGLGDSIDAIIKNDLSHPIVVDGNDEIGRLSEKLIE
                     YGEKVQEIQRTNALSLINNTTASLITSDLNGVVESANLSARKLLKLGEVNESYPIWEY
                     FPESCREQLKKVFDGSHLWIELGKIHVTLSLGDEKPKYVRFDIRPFAHGAEYKLIMTI
                     TDVTHQEMTTRTLESRVLEKTQDLLLKNQQLENEIEERIRTEDNLKKTQDELIQAAKM
                     AVVGQTMTSLAHELNQPLNAMSTYLYSARMFLEQESPEKVGESITHIEGLATRMSKII
                     NSLRQFARKPEGEREVKFVSVHEVAEQASTIVNTRAKRQQIIIENQLPDDVKVQGDML
                     ALEQVFINVLVNSCDALMESTRDEQKRIQMALVERTSQTTLIAISDNGIGFGEEIVQR
                     IFQPFVSTKEVGLGLGMNICKSLIEKHKGSIYLASSLEKGAMVVLELPNEQ"
     gene            860808..862076
                     /locus_tag="VP_RS19140"
                     /old_locus_tag="VPA0827"
     CDS             860808..862076
                     /locus_tag="VP_RS19140"
                     /old_locus_tag="VPA0827"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015313207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_005479108.1"
                     /translation="MSNNPYSVLLVDDDQDVLDSYSYLMNISSIKSKAINDPTQALQY
                     VSPEWAGVVILDMYMPQMHGLELLRMIKNVDERIPVIVITGHGDIPMAVDAVKQGACE
                     FLEKPINPAELLTLVKQQLETRSSQVELQLQAEKSISRSLIGKSAHMEQIRKLVAQYA
                     LLDTHVVVYGESGTGRHSVAGLIKDMMSKSEETEYGSFALSANTTMDSIDDAIDKQQS
                     CLLVLENLPELPEEGQRHLAQLLLARERCGKKNLRVVTIFDSEPEEYITKNQLLPELY
                     YLLNQGVVHVQPLRQRPDDIVTIFHYFLKLSCKKLGKTLPNVDSSYLALLRGYPWPGN
                     IRELRNIAELYAIGIVKLTGKERIYSQNEIQLPLDDLVDDFEKQLIEDALFLHSGRIT
                     DAANHLQIPRKKLYLRMKKHGIEKGNYKSR"
     gene            complement(862168..862824)
                     /locus_tag="VP_RS19145"
                     /old_locus_tag="VPA0828"
     CDS             complement(862168..862824)
                     /locus_tag="VP_RS19145"
                     /old_locus_tag="VPA0828"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005479123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysoplasmalogenase"
                     /protein_id="WP_005479123.1"
                     /translation="MWLVVVVLAFIHIISVRKGPKWLFYVSKPLPVLVMIGILLNSPA
                     SQLPYTQWILVGLSLSLLGDLLLMLPRDKFIIGLSLFCSAHLSYSYGFSLMSAWHFTP
                     WLPIALFGLGICFYWLFRPDLGKERIPVAIYILVLMTMCWMAIEYYLSGKTQSSSFAV
                     LGSFIFIISGTVLAFERFGGYSVFSRQVVMVTYYSAQTLMAMSVIAIVIRYPYLTVIS
                     "
     gene            complement(863125..864273)
                     /locus_tag="VP_RS19150"
                     /old_locus_tag="VPA0829"
     CDS             complement(863125..864273)
                     /locus_tag="VP_RS19150"
                     /old_locus_tag="VPA0829"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005397625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-containing alcohol dehydrogenase"
                     /protein_id="WP_005479145.1"
                     /translation="MNFSYVNPTKIFFGQQQIAAIKDAIPADQKVLVIYGGGSIKKNG
                     VYDQVAEALTGHEWSEFSGVEPNPTKETLDKAVAIVKDQNIDFILAVGGGSVIDGSKY
                     VAAASKYDGDGWDIMIGKHQVTEATPLAAILTLPATGSESNMGAVITKAETQDKLPFM
                     SPAVQPKFAVLDPDVMKTLPERQLINGIVDAWVHVCEQYITLPTDAMVQDGYAETLLK
                     TLKMLGEQFAERDDDKWRANLMWSANQALNGLIGSGVPHDWATHMIGHELTALWGVDH
                     ARSLAIIQPSLLRNQMQFKRAKLEQMGRNVFGLESGDDLAERTIEAIEAFYHQLGVAT
                     QLDNYGESREQAIDAIIDQLNKHGMTVLGENQAITLERSREILELAVS"
     gene            864478..865359
                     /locus_tag="VP_RS19155"
                     /old_locus_tag="VPA0830"
     CDS             864478..865359
                     /locus_tag="VP_RS19155"
                     /old_locus_tag="VPA0830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009704480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_005479133.1"
                     /translation="MNTLAETMQRYVEKHDLHNLEGIKQTAIEGVWFYRSSKGNNRQP
                     FVYQSGIIVLGQGHKNIHIGQTPVQYGPDDYLVVGVPMPLECEAFATNNEPLLGISID
                     ISPTLLHKLVKKLEAQKFSNICEDSKRCGLKSVRMNDAMLDACKRLMKALCNDLDVAI
                     LGESLLEEIVYRTLVSKEGYVLFELAHQEGSYARVAKALNRVHAEYHEQLNVQTLAEE
                     ANMSVSAFHQAFRSVTLESPLQYIKKVRLNKARDLIQLEGKRVNDAARLVGYSSPSQF
                     SREYKRHFNETPRSTKA"
     gene            865637..868801
                     /locus_tag="VP_RS19160"
                     /old_locus_tag="VPA0832"
     CDS             865637..868801
                     /locus_tag="VP_RS19160"
                     /old_locus_tag="VPA0832"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase C-terminal domain-containing protein"
                     /protein_id="WP_005479129.1"
                     /translation="MHLKNGKAVKSVFTLSTLTASCLLAFNSYAAVDCAPLEVWDSSK
                     VYNGGDQVQHEGNAYKARYWTQNNNPAQAGQWGEWESLGACDGTGPVDPPQNEIPTVT
                     LTAPSASASITAGEVVNLAADAADTDGTISKVEFFVDGALVGQSTSAPFIASWTATEG
                     VHEFSTKSYDDAGAVSTASSVTLTIASVQPGNEAPTVDVALSATSIELGGTVTLTANA
                     ADADGSIAKVDFYVAGALAGTATAAPYTLDVTPSKAGALAVYAKATDNAGASTDSAIA
                     TLTVNGGAVASNCRPDGLYQTTGVDVPYCSIYDEEGREKMGADHPRRVIGYFTSWRAG
                     DDPQSTYLVKDIPWEQLTHINYAFVSIGSDGKVNVGDVNDPNNAATGKTWPGVEVDPT
                     LGFKGHFGALATYKQKHDVKTLISIGGWAETGGHFDANGDRVADGGFYTMTTNADGSI
                     NHAGIEKFAASAVEMMRKYKFDGLDIDYEYPTSMAGAGNPYDKDFMEPRRQYLWASYQ
                     ELMKVLREKLDAASAQDGTHYMLTIAAPSSGYLLRGMETFDVTKYLDYVNIMSYDLHG
                     AWNDHVGHNAALFDTGKDSELAQWNVYGTAAYGGIGYLNTDWAYHYFRGSMPAGRINI
                     GVPYYTRGWQGVTGGDNGLWGRAALPNQAECQPGTGEGEKNNCGNGAIGIDNMWHDLD
                     PQGREMGAGSNPMWHAKNLEKGIWGSYAQAYGLDPVNDPSDKLVGTYTRNYDSVAVAP
                     WLWNAEKGVFLSTEDKASIEVKADYVIDKEIGGIMFWELAGDYNCYVLDANGNRTAID
                     ATEQACAAGNGEYHMGNTMTKAIYDKFKSATPYGNKVATGPTPTEAVDITVSVGGFKV
                     GDQNYPINPKITFTNNTGQAIPGGTEFQFDIPVSAPDNAKDQSGGGLKVIASGHTRAN
                     NIGGLDGVMHRVSFSLPAWKDLPAGGTYELDMVYYLPISGPANYSVISGGKEFAFKFE
                     QPDLPIGDLNAGTGGGGTTEPGSCDTAGLVTYPNLPQTDWAGNPSHANQGDKVIHNGV
                     VYQANWWTASEPGSDGSWATVCNI"
     gene            complement(868910..870124)
                     /gene="glgC"
                     /locus_tag="VP_RS19165"
                     /old_locus_tag="VPA0833"
     CDS             complement(868910..870124)
                     /gene="glgC"
                     /locus_tag="VP_RS19165"
                     /old_locus_tag="VPA0833"
                     /EC_number="2.7.7.27"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015727884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate adenylyltransferase"
                     /protein_id="WP_005454156.1"
                     /translation="MQDALAVILAGGMGSRLSPLTDDRAKPAVPFGGKYRIIDFTLTN
                     CLNSGLRKILVLTQYKSHSLQKHLRDGWSIFNPELGEYITAVPPQMRKGGAWYEGTAD
                     AIYHNLWLLSRNDAKYVVVLSGDHIYRMDYAAMLEEHKEKGAKLTVACMDVPVKDASA
                     FGVMGIAENGLVKSFVEKPENPPTLPDDNAKSLASMGIYIFDMDVLKEALTEDAKLET
                     SSHDFGNDIIPKLIDTESVYAYKFCGSKGRVDKDCYWRDVGTIDSFYEANMDLLEPVP
                     PMNLYQSNWAIRTYEPQFPPARTVSSATGNEGIFINSIIATGVINSGGSVQHSIISSN
                     VRIQDSATVVDSIIFDDVEVGEGSQLVNCIVDKHVRIPPNTQIGINKVEDAKRFKISE
                     KGIVVIPESYQF"
     gene            complement(870481..872229)
                     /locus_tag="VP_RS19170"
                     /old_locus_tag="VPA0834"
     CDS             complement(870481..872229)
                     /locus_tag="VP_RS19170"
                     /old_locus_tag="VPA0834"
                     /EC_number="6.3.4.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017790878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate--tetrahydrofolate ligase"
                     /protein_id="WP_005479111.1"
                     /translation="MQSDIEICRNTPLSSIDVIAEKAGLLPEEFDTHGKYKAKVHPKC
                     LARLNDNQNGKLVLVTAITPTPLGEGKTVTTIGLAQGLAKLKQSVMACIRQPSMGPVF
                     GIKGGAAGGGYSQVAPMEELNLHLTGDIHAVTAAHNLASAALDARLFHEQREGYDAFE
                     ARTGLKALKIDVESITWKRVMDHNDRALRMVKIGLNEHGKTINGFERNEGFDISAASE
                     LMAIIALAKNLKDLRQRIGKIVVAYDLDGQPITTEDLQVAGAMAVTLKEAIAPTLMQT
                     LEGVPTLIHAGPFANIAHGNSSIIADEIALKLSRYTVTEAGFGSDMGFEKACNIKAAA
                     ANKAPDCVVIVATLRGLKANSGHYDLRPGMAIPDSIFSPDQAALVAGFENLKWHIKNV
                     HKYGIPAVVAINQFPQDCEQELTALQDLIHAFDPNVKVAISTAFAQGGEGTRDLAQYV
                     VDACEKTTNFRPLYQKHQSLQEKLMSVCEAGYGATNVEMSELATKQLAHFEKLGFNEL
                     AVCIAKTPLSVTTDSSVKGAPVGFTVPIRELRLCAGAGFVYALSGSVMTMPGLPDKPA
                     FMNLDLDEDGNIIGLS"
     gene            complement(872467..873771)
                     /locus_tag="VP_RS19175"
                     /old_locus_tag="VPA0835"
     CDS             complement(872467..873771)
                     /locus_tag="VP_RS19175"
                     /old_locus_tag="VPA0835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017046075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine/guanosine kinase"
                     /protein_id="WP_005454049.1"
                     /translation="MKFPGQRKSKHYFPTHARDPLVNQIRQAPKLYRPTIVGVGQTIV
                     DIEARVDDAFLEKYNLSKGHSLVLEESKADALYEELVEQGLITHQYPGDTIGNTLHNY
                     SVLADSKSVLLGVMSKNIQVGSFAYRYLCRTSSRMNLNHLQTVDGPIGRCYTLISQDG
                     ERTFAINEGHMNQLLPESIPEEVFEKASALVVSSYLMRGKEEDPMPKAVQRAIDFAKK
                     HDVPVVLTLGTKYVIEGNAEWWQEYIRENVSVVAMNEEEGAALTGEHDPLAAADKALE
                     WVDLVLCTAGPNGLYMAGYTDEKVKRETTHDILESSIEEFNKFEFSRAMRKEDCVNPM
                     KVYSHIGPYLGGPLEIKNTNGAGDAALSALLHDMAANSFHQKEVPTSEKHEVRCLTYS
                     SLSQICKYANRVSYEVLTQHSPRLSRALPEREDSLEETYWDR"
     gene            complement(873903..874376)
                     /locus_tag="VP_RS19180"
                     /old_locus_tag="VPA0836"
     CDS             complement(873903..874376)
                     /locus_tag="VP_RS19180"
                     /old_locus_tag="VPA0836"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005454218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CreA family protein"
                     /protein_id="WP_005454218.1"
                     /translation="MKKRLLALGLVTILAGCGNDEVGDVSLGMFTMKDIKLNTLVDPE
                     VPGVTCHVASIEADFSLADPSDSSISCRQTGEITPEMITKIDKSKSGEVVFKKSKSVF
                     FKSMKIRRIYDPENQTLMYLSYSTKETSGSFKHSLSTVPLWGTKAYIQPTEAKIN"
     gene            874647..875156
                     /locus_tag="VP_RS19185"
                     /old_locus_tag="VPA0838"
     CDS             874647..875156
                     /locus_tag="VP_RS19185"
                     /old_locus_tag="VPA0838"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005451712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005454066.1"
                     /translation="MNEQQLASIERKNAWLHDLVEVEFPTPESLKGRETYFQATNAQE
                     YQIVAKDSLLEGEANLQADDIFLVDFHRLTIMFSILQSQRWEEQYDQEMIVEYLTQII
                     LTPDFELYVGFKDGNPVGAAIASSYEGNTLISDVAVSQSLDKQQFSADIAKRLNSDHK
                     LCDTIIIES"
     gene            875227..876978
                     /locus_tag="VP_RS19190"
                     /old_locus_tag="VPA0839"
     CDS             875227..876978
                     /locus_tag="VP_RS19190"
                     /old_locus_tag="VPA0839"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HD domain-containing protein"
                     /protein_id="WP_005479131.1"
                     /translation="MVKRLARFLTLVLCIGTVAVQAEETNWELKRVLVLHSYDPSYQW
                     TNDIQAGIEKGFKQTDGEVKLSIEYLDAKRVHSEGYLQQMASYLRFKYRAYEFDGVII
                     SDDAAMRFVRNYFQNPKRNVPMVAIGINDKGSSLDTVSTNGSVIYEEDRVVENIALIN
                     RLRPRIKNLYYLADRSVTSELIYQRVKAEMNKFPRINLIEIRDASLQEAANQLSTVSA
                     NDAVLLTHYNTEGDSGKYHTYREVARAIGAKSRAPVFVMWELYLGEPGILGGFVNRSE
                     QFGYEAAEIMASKMGMSLTSAAHALAITEAVLDYKALTKYEISHYDIPKNAEILNAPP
                     PLFKVNLKTLLFTCGIIVLLSLVVVIQFMTIRQRKEIDKKNRKIVLLQKRTLNVQKEM
                     IHVLGEAIESRSGETGQHVKRVAKLSRRLAQLCGLTHREVEMIEIISPMHDVGKISVP
                     ESILDKPGALTSSEREIMKQHTIKGYELLNMKEGDITKLAAVVAHEHHEKWDGTGYPN
                     NLKGEDIHLFARIVAIADVFDALLTERCYKRAWTINEVVDWFKLEQGKHFDPILCQLL
                     LDNLDDFIEVRYMYPDA"
     gene            877162..877830
                     /locus_tag="VP_RS19195"
                     /old_locus_tag="VPA0841"
     CDS             877162..877830
                     /locus_tag="VP_RS19195"
                     /old_locus_tag="VPA0841"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010649317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-IA family hydrolase"
                     /protein_id="WP_005479135.1"
                     /translation="MAITNIKCVIFDCDGTLVDSERLCCQALVNVFNQHGAELTMEEC
                     VSHFKGGKLADILLDTKELMNINVPIDVLEPQYRTEVQKLFVRHLQPMDGAKRLIQFL
                     DSHNIEYCVASNGPKDKIEHALELTGLLDAFKGKVFSAFEANSWKPEPDLIMYSAMSM
                     GFLPSDCLYIDDTPKGVEAGLNAGIKTVQLFNGEAINRVDDDRVIRIQHLDELKEQLM
                     GCSV"
     gene            complement(878383..879813)
                     /locus_tag="VP_RS19200"
                     /old_locus_tag="VPA0842"
     CDS             complement(878383..879813)
                     /locus_tag="VP_RS19200"
                     /old_locus_tag="VPA0842"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005431599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_005479118.1"
                     /translation="MREVEFRTIDRLFIKMSINDKMWVIFLLFLVALTSVAGSRYLND
                     LHQFEQQSIANVQAKLDGIIEANPTDIYQITGISKANHQQKSLFADGVTTVYGTTSAG
                     ELVRLTEHAGNQYNALRSDALTSFLLSFLWVLPFAVFCYWVATFIGGALWVLYTTTEK
                     IGDGDLTSRLGFHPGRDEFGTIGCALDKSMDTLSELVNSVKESANTLSETSSAFEQDM
                     KLSETQITHQYQTLDSVATAMEEMTASAKEVSSISQQATMQSDQDAQKIETSRSRVQH
                     VIAEIETLSSYIEQASSSVTNLNENTTQINDVITTINAISEQTNLLALNAAIEAARAG
                     EQGRGFAVVADEVRTLASRTQQATVEIQAMIEKLQSESQNIASITGRTVKQAQTSSQL
                     IDEIGQDVTAIADSARSLMDMSIQISTSAEEQSAVANDIASELADIRTQSSTIREVAE
                     QSTVGVANLTKASVSLGEVLERYRTA"
     gene            880391..880987
                     /locus_tag="VP_RS19205"
                     /old_locus_tag="VPA0844"
     CDS             880391..880987
                     /locus_tag="VP_RS19205"
                     /old_locus_tag="VPA0844"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009696702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF479 domain-containing protein"
                     /protein_id="WP_005479149.1"
                     /translation="MNFLAHLHIADHCNSHFMGNLLGDFVKGDPSKLYDSDITNGIKL
                     HRFVDRITDHHPIVEECKPHFKGVARRFAPIALDMFWDHCLAKHWNDFHQESLDDFVE
                     FAFQKVDQDVHEPLPARFMLLHQRMWRGGWLQSYQDLSNIEFALHRMSQRSPRMADLT
                     TTFEVLDGEYAALESNFSELYQDVLRQSLEFHQQLSSS"
     gene            881066..882319
                     /locus_tag="VP_RS19210"
                     /old_locus_tag="VPA0845"
     CDS             881066..882319
                     /locus_tag="VP_RS19210"
                     /old_locus_tag="VPA0845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017819590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_005479127.1"
                     /translation="MSVNFADLGIEQQLVETLNNMNIVTPTPVQEKSIPHVLEGKDLL
                     AAAQTGTGKTAAFGLPIIQAVQQKKRNGTPHALILVPTRELAQQVFDNLTQYAEHTDL
                     RIVCVYGGTSIGVQKNKLEEGADILIATPGRLLDHLFNGNVNISKTGVLVLDEADRML
                     DMGFWPDLQRILRRLPNDKQIMLFSATFEKRIKTIAYKLMDSPVEVEVSPANTTAETV
                     KQMVYPVDKKRKRELLAYLIGSRNWQQVLVFTKTKQGSDELAKELKLDGIKAVSINGD
                     KSQGARQRALDEFKQGKVRALIATDVAARGLDIQELEQVVNFDMPFKAEDYVHRIGRT
                     GRAGKSGLAVSLMSRDEEYLLRAIETLLDQRLPQEWLEGFEPSLIEEVEPERDGGGRR
                     KSRSSEKRKLKAKLAIHKNRGKHRK"
     gene            complement(882359..883147)
                     /locus_tag="VP_RS19215"
                     /old_locus_tag="VPA0846"
     CDS             complement(882359..883147)
                     /locus_tag="VP_RS19215"
                     /old_locus_tag="VPA0846"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005441895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_005479139.1"
                     /translation="MMSISQLLGCISKQVDGQYIAQYEELTLRSVFQPIYKKDLSIIG
                     LEALVRISTADGSMIRPDLFFQSPSISEHVQLNVERLSRLIHIKNFGQSRYRNKKLFL
                     NVLPRAAEMLAKDLSYSHLLKQVICEADLCREQIVMELVELSAGDESFLYKATKELSD
                     GGFKLAIDDYGINASTIERVKCVRPDIIKMDRSLLLKYEDGDFSALIEALALAKELSS
                     KTVIEGIETEHQLNLMKKLGFDMYQGYLLAMPQTLEMYEEAKTA"
     gene            complement(883336..883968)
                     /locus_tag="VP_RS19220"
                     /old_locus_tag="VPA0847"
     CDS             complement(883336..883968)
                     /locus_tag="VP_RS19220"
                     /old_locus_tag="VPA0847"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017422876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005454376.1"
                     /translation="MLLDLVIQSVNDFQDDCLKLCEKHYPAVHNQGMSEHHLGLAFSR
                     RMEHTFRHFGYNSIVKPIEVLDAPDLPHHYRISSEIGTVWVLSHHMVSAGKSCRENLL
                     SSITEWQSEYGYALQPNDLLFLVCDHWISRSKTSRELLHWWMGELPDQINEYTEQGIT
                     LYTSESQLTQSLDTRFGISPCYIKFGHPLRRSNKQQLVRKYLQLYAVLQW"
     gene            884183..884425
                     /locus_tag="VP_RS19225"
                     /old_locus_tag="VPA0848"
     CDS             884183..884425
                     /locus_tag="VP_RS19225"
                     /old_locus_tag="VPA0848"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010649305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2164 domain-containing protein"
                     /protein_id="WP_005489304.1"
                     /translation="MIKLERAQKETLASAIQEYMQDELSIEIGQFDSEFLIDFITDKL
                     GAVYYNKGVEDAKAVIERRMLEMSDELYEIEQEVSI"
     gene            884600..885139
                     /locus_tag="VP_RS19230"
                     /old_locus_tag="VPA0849"
     CDS             884600..885139
                     /locus_tag="VP_RS19230"
                     /old_locus_tag="VPA0849"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009841235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b"
                     /protein_id="WP_005477057.1"
                     /translation="METLVKSYNLPARVMHWLSALCIIGLFAVGLWMVDLSYYSEWYR
                     TAPHYHRSVGILLAILTVGRIVWKHVTASPKVEGSRFEVVAAKAAHSVMYLLLLTIFV
                     SGYLISTSDGRGIEVFNWFTVPGAGELFSGQSDIAGEIHFYAAWAVILIAGLHAVAAL
                     KHHFIDKDNTLRKMLGASK"
     gene            885136..885705
                     /locus_tag="VP_RS19235"
                     /old_locus_tag="VPA0850"
     CDS             885136..885705
                     /locus_tag="VP_RS19235"
                     /old_locus_tag="VPA0850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006878055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YceI family protein"
                     /protein_id="WP_005477055.1"
                     /translation="MKKSLFATGLAIAMALPLGAQAADYVIDTKGAHASINFKVSHLG
                     YSFIKGRFNTFSGDFSFDEKNIADSKVNVVVDTTSLDSNHAERDKHIRSGDFIDAGKY
                     SEATFKSTKVVDKGNGKLDVTGDLTLHGVTKPITIEAEFVGAGNDPWGGERAGFVGTT
                     RLELADFDIPVMGSSSYVDMELHIEGVKK"
     gene            complement(885825..887276)
                     /gene="focA"
                     /locus_tag="VP_RS19240"
                     /old_locus_tag="VPA0851"
     CDS             complement(885825..887276)
                     /gene="focA"
                     /locus_tag="VP_RS19240"
                     /old_locus_tag="VPA0851"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019821166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate transporter FocA"
                     /protein_id="WP_005489212.1"
                     /translation="MAVTSSQTHQDFSPKEMMAEAEKFALSKANKTSSMTLGLAIMAG
                     AFIGLAFLFYITVTTGSANTGWGLSRLAGGIAFSMGLILIVICGGELFTSSVLSSISW
                     ANKQISFGKMLSIWGKVYIGNFIGAMFLLALVTAAGLYQMDAGQWGLNALNIAQHKLH
                     HTLLQAFALGVLCNLLVCLAIWLTFSSANAMTKALMTILPVAMFVSSGFEHCVANMFM
                     VPLGIVIANFAPESFWASVGVPASQYADLNVAHFISANLIPVTFGNIVGGAVLVGLAN
                     WCIYRRPELKAANVSSITNTTQLSSVKEITMKNASFVKDIMNPKPVTLSVEMPVAAAL
                     DTLLDNNLTSAPVVDLHNRLVGFFSAHDVMVELWCQDYIPVKDQKVVDLMSRDVVAID
                     ASDRLVDVVEFLCIDKEQLYPTSSMGIATRLTSLSLEERAKSMKVSKPQVLPVLENGQ
                     MVGVVTRQEVLKALRPVFGERLNLVEDKALETA"
     gene            887541..888446
                     /locus_tag="VP_RS19245"
                     /old_locus_tag="VPA0852"
     CDS             887541..888446
                     /locus_tag="VP_RS19245"
                     /old_locus_tag="VPA0852"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005395522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005498809.1"
                     /translation="MRYSLKQLAVFDAVADTGSVSQAADKLALTQSATSMSLAQLEKM
                     LGRPLFERQGKQMALTHWGMWLRPKAKRLLQDALQIEMGFYEQHLLSGEIRLGASQTP
                     AEHLVPDLISIIDNDFPEMRISLGVQSTKGVIDGVLDYKYDLGIIEGRCDDNRLHQEI
                     WCRDHLTVVAASHHPFARNPSVSLAQLEQAKWVLREHGSGTRKTFDSSIHHLIEDLDV
                     WREYEHVPVLRSLVANGQYLTCLPYLDVERYIEAGRLVALNVPDLKMERTLSFIWRAD
                     MAENPLVDCIKREGLRMMKGKPSVL"
     gene            888715..889197
                     /locus_tag="VP_RS19250"
                     /old_locus_tag="VPA0853"
     CDS             888715..889197
                     /locus_tag="VP_RS19250"
                     /old_locus_tag="VPA0853"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010649293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1097 domain-containing protein"
                     /protein_id="WP_005483841.1"
                     /translation="MTTLLAISITTGILSGVWGWIAISLGLLSWAGFLGCTSYFAAPT
                     SGLKGLATSLITNLTGVFWAMVIIYGSTYAGLEILGYVITAVVAFFMCIQAKQAWLAY
                     IPGTFIGSCATFAADGNWQLVVPSLVLGGVFGYLMKATGLWLHAKSTATSSSLAEQAQ
                     "
     gene            complement(889391..891025)
                     /locus_tag="VP_RS19255"
                     /old_locus_tag="VPA0854"
     CDS             complement(889391..891025)
                     /locus_tag="VP_RS19255"
                     /old_locus_tag="VPA0854"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005524618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent endonuclease"
                     /protein_id="WP_005489275.1"
                     /translation="MRLERIEISGFRGIKRLSLSFDELTTLIGENTWGKSSLLDALSI
                     ALPANGSLYEFELKDFHVDYSISHPQSQHIQIIVCFKAQDKHEANAGRYRRIKPAWCT
                     TEDGEHVIYYRISASRVDHDITTKYAFLDRDGKPKQIHHSEKLAVELMTLHPVIRLRD
                     SRRFPRPSHINGDSKNARIEKRINNTCRRLLAMPGHVNKGEIRSSLDAMKTLVEHYFA
                     FRSIGKGNPRKPRDGLFYTSPSSDKGLSQYLKETNDKQSRLLLMGLLSAYLQAKGPTD
                     LRRCARPILIIEDPEGRLHPTHLARAWSLLQLLPMQKILTTNSGSLLGSVPLYSIRRL
                     IRLSDKTIAKSLNTSKFGGDELRRIGFHIRFHRAGALFARCWLLVEGETEVWLFNELA
                     RQCGYDLAAEGVQIVEFAQSGLRSLIKVAKEFGIDWHVVTDGDPAGKKYAHTVRAQLG
                     HDQERHRLTELPDRDIEHFLYNHGFELFFKDMIKVPHDHPIPAKKVVNRVLKKHAKPD
                     LALAIVSHCEEKGMECIPVLLRWTLKRIVTMASGNT"
     gene            891297..893039
                     /locus_tag="VP_RS19260"
                     /old_locus_tag="VPA0855"
     CDS             891297..893039
                     /locus_tag="VP_RS19260"
                     /old_locus_tag="VPA0855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020196919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional metallophosphatase/5'-nucleotidase"
                     /protein_id="WP_005479759.1"
                     /translation="MKMNKNHKPVRIKLAHINDTHSYFEPTSLQLKLKINKDLILEPY
                     VSAGGFSRIATRVEQLRDDAQRQGQGMLFLHAGDCFQGTLYFSLFKGKANADLLNALN
                     IDAMALGNHELDMGNEPVALFCQRTNFPLLAGNWDLSNESKNKAHRLSDCNNVLSYQP
                     DSRSAQYLVKEFNGVKVAIFGLSIDKMSDIANPDADTPFMTAIETAKATVAQIHNDGI
                     KNIILLSHLGYEGDLELAEQVEGIGIIVGGHSHRLQGDFTAIGLGEDDPYGIKVNGTY
                     VVQAGFHALTMGHCVLEFDENGQATMLNGQNELLLGRRIFWDSTLNQQLDQGVFETAC
                     DFIHGQPNVVVCKKHPETQAILRDKYIPRVRALQSQVIAHVESKKRHVRIPDELGGSE
                     LAGAVARSFLHSLNKRGHNVQFAIHNAGGVRTSLNPGDITVADVAGRLLPFAVPIGFY
                     DVKGAVIRRALEGAINNALNNGVEGTGSGSYPYTYNLNFDYQADAPKGERIQRLEILD
                     GYRWVKVDDDAWYRGTSSAYTMKGKEGYEALLDMKGEGCVSNLSMADCFIELLTDEPN
                     CLNESHKLYSQQNR"
     gene            893561..894580
                     /locus_tag="VP_RS19265"
                     /old_locus_tag="VPA0856"
     CDS             893561..894580
                     /locus_tag="VP_RS19265"
                     /old_locus_tag="VPA0856"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005498819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TerC/Alx family metal homeostasis membrane
                     protein"
                     /protein_id="WP_005455383.1"
                     /translation="MSLIENTTQLSQSVLFQESLTMYGAFGLFTLVLVALDIYQTRGG
                     AITMQKAIVWSIFWFLLAFLFAGSILFFWDVYAPHSAYSNEKATVSFLTGYLLEKSLS
                     VDNLFVFAIIFAQYKVPEHLRPRALLWGVIGALVLRAIMIAVGAQLLAQYHWVLYLFA
                     AFLIWTGIKLARDKGEEEEVNPYPEQVIRKLLPVTDEYQGNHMFLKQAGKWVATPMLI
                     VVGVIAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSLYFVLQAMLDKFVYL
                     KPALSVIMMFIGVKMLLVGTEYEIPTIWSLTFLILVMTSAVVASVYKNKENSRSRVNI
                     TNQKY"
     gene            894860..895051
                     /locus_tag="VP_RS19270"
                     /old_locus_tag="VPA0857"
     CDS             894860..895051
                     /locus_tag="VP_RS19270"
                     /old_locus_tag="VPA0857"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000035884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479763.1"
                     /translation="MAQAMQMTNVALPTSMDKKTYAVSFKGLIAHLLDILFVDNSAPR
                     SYYAEDLSAHIQKDIGMYR"
     gene            complement(895211..895768)
                     /locus_tag="VP_RS19275"
                     /old_locus_tag="VPA0858"
     CDS             complement(895211..895768)
                     /locus_tag="VP_RS19275"
                     /old_locus_tag="VPA0858"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017111983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhnA domain-containing protein"
                     /protein_id="WP_005455388.1"
                     /translation="MSIEATLLARCESKCELCSSESPLTAYAVPPHGNVTVDTAIMVC
                     DKCHSEIEEPKDINHWRCLNESMWSQVPAVQVTAWRQLTRLNSESWAQDALDMMYMEE
                     EQKNWAMTGMSADDKTVDCNGTELKKGDDVTVIKDLPVKGTNQVIKQGTVIRGISLGD
                     DPKLISGKANGGQSMYVIAEYCRKK"
     gene            complement(896047..898455)
                     /locus_tag="VP_RS19280"
                     /old_locus_tag="VPA0859"
     CDS             complement(896047..898455)
                     /locus_tag="VP_RS19280"
                     /old_locus_tag="VPA0859"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005451751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase"
                     /protein_id="WP_005455369.1"
                     /translation="MKHTFKLSLLCSAILLAGCGDNTSSSGTTDKVTFESEVQALLDR
                     GTSISFTIQGANADVPAPSYLLMDTSDGTLGLPTNGDDALTNPRASMNTMDGWSTSMP
                     IVLNFNGDGFAPGMLASGVKVIKINQRLTEWDGKTNPIAKVLVQNQDYVVQANGKSLY
                     VQFADSLDESSEYIFAVTQDVTDVNGEPIGTSSSYAVAKSKQVKYESGDLASVQAVTE
                     AVEGIFGLAQVNPADIVYSSWFSTQSVGDTLAAVKGVTATGFATGANTLNTIYKNDTN
                     ENAVDLATAYTMVLGETQDFMTALDSDSDFNKYVSDLDAAKTAIKGLYVQSGASVNVT
                     QGQVRLPHYLEKGANWNMQPMVSAMPSLAKLNAALTDPAEQANMVQQLSSGVFASSPV
                     DVSKLATDPTEQLKLVGSKLYLNDGTQLDSERVITRYSPVPEVKSLENVEFLLFTPQN
                     GVAKDVVIYQHGITSAKENAYAFAFNMVQTGVAVIAIDLPIHGTRSLDEQRSANANVL
                     AYLNLSNLAVARDNLRQSVLDVLGLRASLVVSAQGGLLAGGPLQGFNPMTGSQVKMLG
                     HSLGGIVGTSAVAAANNTLGSPTADALYTFSAASIQNSGGQIGNLLLGSSDFGPQIKH
                     NLAYAASTDYKSYADAQCAQLDDKACYEVFEGLATPEQLAALSAGFSQFIYAAQTTLD
                     TVDPFTNAADLVASGTLTTPFLMTEVEGDKTVPNNVANAPFAGTEPLAKKLGLTEVNS
                     LNTAVAATSSFVQFNAIASHSTFASPSGTLADVNHHAEMQKENADFLMDNALSDVSDT
                     TVLK"
     gene            complement(898477..899718)
                     /locus_tag="VP_RS19285"
                     /old_locus_tag="VPA0860"
     CDS             complement(898477..899718)
                     /locus_tag="VP_RS19285"
                     /old_locus_tag="VPA0860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005531288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein transport protein"
                     /protein_id="WP_005455385.1"
                     /translation="MNKKHCSLLTISILFACNAHSAGFQVAEHSASGLGRAFSGEGAV
                     ADNASVLARNPAAMTLFKEAQFSGALSIVDPEVNVYDTLHKEQSDDVAPLQVVPAGYY
                     ISPINDNWAWGIGMFTTYGVATDYPDDISAGDMAGDTSLLSVNINPNIAYRINEKFSV
                     GGGINLVYAEAELTRHKGALAPLFGSGSSKSDNLIGMEGETFAWGWNVGALFELNENN
                     RFGFGYRSKVDLDFDDGEFSSYDSGIATAAKVDGRLKISLPSIIELSAFHQLNDQWAI
                     HYGWQQTDWSTFKELKATSNECKGGVCFFKPEKYEDNNRYSVGATYTLNTEWTFRAGL
                     AYDEQAGEATLSIPDSDRMWYSAGLTYAMNENLSFDAGFALVQSESGSFTETNAAGQE
                     IKFDSEGTAYISAVQMNYTFK"
     gene            900077..901139
                     /locus_tag="VP_RS19290"
                     /pseudo
     CDS             900077..901139
                     /locus_tag="VP_RS19290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011152085.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="site-2 protease family protein"
     gene            complement(901224..902024)
                     /locus_tag="VP_RS19295"
                     /old_locus_tag="VPA0861"
     CDS             complement(901224..902024)
                     /locus_tag="VP_RS19295"
                     /old_locus_tag="VPA0861"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017189035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M48 family metallopeptidase"
                     /protein_id="WP_031776752.1"
                     /translation="MEPLMKVWIKASALLTLAGLTACSASPTGRNQILMFSDQEMSSL
                     GAKSFDQMKKDIPISKDKKTNAYVQCVAKQITNAIPPQAGFKDWEVVVFDSDQVNAFA
                     LPGGKIGVYTGLLKVAKNQDQLATVIGHEVAHVLAEHSNERLSQSQLANAGLSLANVA
                     IGASEYKQYQQLTMAALGVGVQYGVILPYGRTQESEADIVGLEYMAKAGFNPNQSVDL
                     WKNMSAASGGAQPPEFFSTHPSHSTRIKDLQATINKLPKYNVKAPKCG"
     gene            902217..902651
                     /locus_tag="VP_RS19300"
                     /old_locus_tag="VPA0862"
     CDS             902217..902651
                     /locus_tag="VP_RS19300"
                     /old_locus_tag="VPA0862"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005455359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hotdog fold thioesterase"
                     /protein_id="WP_005455359.1"
                     /translation="MSIWKKPISLDILNATSRNTMMEHLQIEYTNFTDDSLSATMPVC
                     SFTHQPLGMLHGGASVVLAETLGSIAANFCVSEGNYCVGLDINANHVRAMRSGYVIGT
                     AKPIHLGVSTQVWQIEITDERDRLVCTSRLTIAVKQQKAKLA"
     gene            902694..902927
                     /locus_tag="VP_RS19305"
                     /old_locus_tag="VPA0863"
     CDS             902694..902927
                     /locus_tag="VP_RS19305"
                     /old_locus_tag="VPA0863"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012129396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3389 domain-containing protein"
                     /protein_id="WP_005455381.1"
                     /translation="MVIEFSLGKIIATQREIVIKLTGEAMVTLQAQTDALQLLGRGAN
                     VVLAHGAECKWSIKLDNEEQLIQLAQEIGIDIQ"
     gene            903007..904713
                     /locus_tag="VP_RS19310"
                     /old_locus_tag="VPA0864"
     CDS             903007..904713
                     /locus_tag="VP_RS19310"
                     /old_locus_tag="VPA0864"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017819601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SgrR family transcriptional regulator"
                     /protein_id="WP_005455375.1"
                     /translation="MSSPRLRVQFETLFEKFAGNDTEVQLEDITDALFCTRRNARIVL
                     NKLEEEGWIEWHPAAGRGKLSKLIFKRNRSDVSENLARRYLDEGKIGQALDALDNDAA
                     RLTQVIQGYLGLQHRQGEQVVRLPYYRPLAMLNPQKPMRRSEQHIARQVFSGLTRLDE
                     SEQLQPDLAHTWEALSDTHWRFYLRRGVRFHNGEPLTTDCVVESILALSGLNLFSHIQ
                     QVSSPQPWTVDIKLVRPDRYLPLALSESQAKVLLPQALRSEDFDRKPIGTGPFQVKVN
                     DDKRLILTAFDGYFGFRPLLGQVEVWVIDEAYSSMVYPSLSKPKMNKQASTDEVELDP
                     GCTFLLLNKNTGIAKDPRWAEFLSQTLNSHQIYAHVPQDKVIELGVLQAFGLKPGWID
                     LRPTSVGEVPQQGKSITVAYQKKHPMFPVIAKAIKHLLKPHSVDVEFIRYDTQPPNPE
                     EVDVWVKAMGIATNRNDALAGWLLDYSDIEKFSAGYDFSEWATLVDQWRAGIHADFPA
                     RELGRQLVKSCQVIPMFHCWLGVNKDHSGALQNAKCNALGWFDFSNVWVKPEIEDNGQ
                     AE"
     gene            904697..904948
                     /locus_tag="VP_RS19315"
     CDS             904697..904948
                     /locus_tag="VP_RS19315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010451836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005479768.1"
                     /translation="MAKPNKKQPSKTVEIYCAKCKAQLYKYRKGGKGALVKCFKERIV
                     EDYTQTPCFCPSCGQEFARDTLVRGTPAFKMIGGKVTMK"
     gene            904957..905289
                     /locus_tag="VP_RS19320"
     CDS             904957..905289
                     /locus_tag="VP_RS19320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017447568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="divalent-cation tolerance protein CutA"
                     /protein_id="WP_005455382.1"
                     /translation="MSQQNDCCMVLSTTNNEKNRDEIIKGLLEAQLAACIQTMPIESH
                     YVWKGEVCTDHEWLLIIKTRRELYELVEEKIENLHEYEVAQIVQVPIVDGFNPYLEWL
                     RESTLSRH"
     gene            complement(905251..905847)
                     /locus_tag="VP_RS19325"
                     /old_locus_tag="VPA0865"
     CDS             complement(905251..905847)
                     /locus_tag="VP_RS19325"
                     /old_locus_tag="VPA0865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010451832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2238 domain-containing protein"
                     /protein_id="WP_005455361.1"
                     /translation="MKSTSTLLGLTIFYAIVFLFSALEPSSRAVWFAEIIPAIGILIA
                     IWAISIRYQFSNTAYLLMFIWLCLHTIGAKYTFAEVPFDWFNNLIGSERNNFDRVAHF
                     AIGLYAYPIAEYLIRNKKFNPTFSCWFALFAIMSLAAGYEIIEWWYAELAGGDEGIAF
                     LGSQGDIWDAQKDMLCDTTGAILSLFLMSAQRRFAKPF"
     gene            906123..906962
                     /locus_tag="VP_RS19330"
                     /old_locus_tag="VPA0866"
     CDS             906123..906962
                     /locus_tag="VP_RS19330"
                     /old_locus_tag="VPA0866"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020329119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isopenicillin N synthase family oxygenase"
                     /protein_id="WP_005455357.1"
                     /translation="MKLETVDYLADDAAQQFVASLRETGFGVLKNHPIPQELVESIYK
                     NWHEFFCSEEKNDFQFNVETQDGYFPPSVSEVAKGHKVKDIKEYFHVYPWGQIPEQLK
                     AEILEYYERANAFAQELLGWVEEYAPKDVQEKFSIALSEMINNSDKTLLRVLHYPPMT
                     GEEEPGAIRAAAHEDINLLTVLPAANEPGLQVMSKDGEWIDVPCDFGNLIINIGDMLQ
                     EASGGYFPSTTHRVINPTGARQEKSRISLPLFLHPKPDTVLSERYTAHSYLMERLREL
                     GVI"
     gene            907095..907715
                     /locus_tag="VP_RS19335"
                     /old_locus_tag="VPA0867"
     CDS             907095..907715
                     /locus_tag="VP_RS19335"
                     /old_locus_tag="VPA0867"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005427209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DnaJ domain-containing protein"
                     /protein_id="WP_005455380.1"
                     /translation="MEDQYGVCDSSQSEIENPLLWPMLEILKRQPSGWKVHTLASKLS
                     ERGYINQLDPSPDKDLFKRNFLIMNALYQLQETLFPDSWLQVEAMDIMLMSALEASRN
                     SVDPNDPLRQYYLDWSHYEANEDEVRRLLNEFWTRYQRFVGGASEHNIDKAKALKLFD
                     LAGDVSRTEIRRQWRKLALRWHPDRENGDAERFRVLCEAWNVLRNG"
     gene            complement(907844..909499)
                     /locus_tag="VP_RS19340"
                     /old_locus_tag="VPA0868"
     CDS             complement(907844..909499)
                     /locus_tag="VP_RS19340"
                     /old_locus_tag="VPA0868"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004411692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-ATPase domain-containing protein"
                     /protein_id="WP_005479764.1"
                     /translation="MDQLTATLKKIEKQNYRAYQQIKGQYDFTDFTLFIDHVQGDPYA
                     SASRFRATRAWSLTGLEWLKDESPAFQRAARDFIARSFEQFAKQENTVSIALNGQTVL
                     DSTAVLFTEEGIELRFRVNLPAEGRSVLGKKANNILTFHLPKFIRRATLERELDKEAM
                     VKHCQVVEDQSALREQLEAHNLVAFVANGSVLPRIAGNCDLPMKEAVEFTAPESLQVT
                     LHAPNKGYVTGLGIPKGITLIVGGGFHGKSTLLNAIERSIYDHIPGDGREYIVTDQKA
                     MKIRAEDGRCVHHLNLSNYINHLPMGKDTADFSTQDASGSTSQAAWLQESIEAGATSL
                     LIDEDTSATNFMIRDERMQALVAKGDEPITPLVDRIGQLRDELDISTIIVMGGSGDYL
                     DVANTVIQMHDYQAVDVTEKAKQVIAQHPTQRHNESEESLQTFRPRALNRVALMNILT
                     DGKFRVSAKGKDSLRFGKEFTDLSALEQIESADEVNAIGWLWFQLAQLPGWCNNPAKE
                     IEEMLSGEWHASLPKQGDLAKPRTLDVMAALNRMRKSQFKPSH"
     gene            complement(909571..911481)
                     /locus_tag="VP_RS19345"
                     /old_locus_tag="VPA0869"
     CDS             complement(909571..911481)
                     /locus_tag="VP_RS19345"
                     /old_locus_tag="VPA0869"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005451769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF and EAL domain-containing protein"
                     /protein_id="WP_005479772.1"
                     /translation="MGRFQTLDYEIPESMQRSWQDIVNLLAQIADVPTTLIMRVHQNH
                     IEVNTSSDTQGNPYKAGDKEDLGHGLYCEHVIETKSQLVVPDALADEKWSNNPDIKLG
                     MLSYCGLPLFWPNGETFGTICMLDSKANEYSETYRQLLNTFKDSIEAQLAVVYQQYKL
                     LRLNSELKNRVENRTTDLAQLSFSLTQEIDRRKAAERQVNYQKTHDQGTGFLNRAALE
                     AVVEDTLQSLEHGHQSLIVINVGFSNARSIQTRYGFEAFDEILKEFRKRLGMNDSNYF
                     ITGRPSSNDLVLLLWGEDADSKLHNLLDKITNISVGNFYINDTEVHLHSYVGVVQAHR
                     SSSAKQLLQNACYAMLLCKESGEAYSYFCESHTHELNNHNQLESYLLQAVRNDDLMLY
                     FQPKVNPHTHKWIGAEALLRWRHPVLGDVSNEALIHMAEQNGLIFEVGSFVLRTAIDK
                     AKQWSELFDNFKVAVNVSPIQLQNVNFAEQVEHLLEAFHLPARFLELEVTESALIADE
                     VVARTTLKKLNKLGVTLSLDDFGTGYASFSYLKKYPFDAIKIDKSFVQQMEKSDDDRA
                     IICSIIHIAKKLELQVVIEGIESPQQEQFLIGEGCDIGQGFLYGKPMPCNEFEQSLFN
                     QRQIGGQYAYSS"
     gene            complement(911670..912869)
                     /locus_tag="VP_RS19350"
                     /old_locus_tag="VPA0870"
     CDS             complement(911670..912869)
                     /locus_tag="VP_RS19350"
                     /old_locus_tag="VPA0870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017790907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trans-2-enoyl-CoA reductase family protein"
                     /protein_id="WP_005455363.1"
                     /translation="MRIEPLIQGVVARSAHPYGCHASIKEQIEYVKKAPKIKSGPKRV
                     LIIGASSGFGLAARIALTFGGAEADTIGVSFERGPSEKGVGSAGWYNNIFFKQEATHA
                     GRTAINIVGDAFSDSVRNEVIEAIETYFEGEVDLVIYSLAAGVRPKPHSDTFWRSVIK
                     PIGESVTGASILLENDQWVETTLEPATEEEAEATIKVMGGEDWESWIDTLINTESVAQ
                     GCKTIAFSYMGPEVTHPIYLDGTLGRAKIDLHQTSHALNLKLANFDGGAYATVCKALV
                     TKASVFIPALSPYLLALYRVMKEKGTHERCIEQMQRLFTTKLYDQPKVPVDGERLIRI
                     DDLELDPQTQAEVSHLLEQMNTENFKECGDYQGFKDEFMKLNGFNFDDVDYSQDISLE
                     TLASLKP"
     gene            complement(912953..913555)
                     /locus_tag="VP_RS19355"
                     /old_locus_tag="VPA0872"
     CDS             complement(912953..913555)
                     /locus_tag="VP_RS19355"
                     /old_locus_tag="VPA0872"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005435140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylesterase"
                     /protein_id