GenomeNet

Database: RefSeq
Entry: NC_004691
LinkDB: NC_004691
Original site: NC_004691 
LOCUS       NC_004691              20063 bp    DNA     circular PLN 08-NOV-2017
DEFINITION  Candida glabrata mitochondrion, complete genome.
ACCESSION   NC_004691
VERSION     NC_004691.1
DBLINK      Project: 12376
            BioProject: PRJNA12376
KEYWORDS    RefSeq.
SOURCE      mitochondrion [Candida] glabrata CBS 138
  ORGANISM  [Candida] glabrata CBS 138
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1  (bases 1 to 20063)
  AUTHORS   Koszul,R., Malpertuy,A., Frangeul,L., Bouchier,C., Wincker,P.,
            Thierry,A., Duthoy,S., Ferris,S., Hennequin,C. and Dujon,B.
  TITLE     The complete mitochondrial genome sequence of the pathogenic yeast
            Candida (Torulopsis) glabrata
  JOURNAL   FEBS Lett. 534 (1-3), 39-48 (2003)
   PUBMED   12527359
REFERENCE   2  (bases 1 to 20063)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-OCT-2006) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 20063)
  AUTHORS   Frangeul,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-OCT-2002) L. Frangeul, Institut Pasteur, Unit de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AJ511533.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..20063
                     /organism="[Candida] glabrata CBS 138"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /strain="ATCC 2001"
                     /type_material="type material of Candida glabrata"
                     /db_xref="taxon:284593"
     gene            13..86
                     /gene="tRNA-Met1"
                     /locus_tag="CaglfMt15"
                     /db_xref="GeneID:807006"
     tRNA            13..86
                     /gene="tRNA-Met1"
                     /locus_tag="CaglfMt15"
                     /product="tRNA-Met"
                     /db_xref="GeneID:807006"
     gene            181..1200
                     /gene="var1"
                     /locus_tag="CaglfMp02"
                     /db_xref="GeneID:807019"
     CDS             181..1200
                     /gene="var1"
                     /locus_tag="CaglfMp02"
                     /codon_start=1
                     /transl_table=3
                     /product="mitochondrial ribosomal protein VAR1"
                     /protein_id="NP_818776.1"
                     /db_xref="GeneID:807019"
                     /translation="MKLMKLLKLNINNNNNNKLLLKNLLLLMNKNRLMNKLSNNNKYL
                     SELNNKGNSLQHLNNMNNWKLQNYNYNKNNTINNYINSKLINKLLYKLMSLKNNKIII
                     SKPLYKINMNVINIRFYYYNMNNYNYNNNIYYINMINKLMNRLNINMNNLSNILSYYY
                     NKKVIIEPIKLKYLYNNNEIMTKYISLLDNNKYNNGLLMEYQRTLNNIMPKLNDHNIS
                     MNYINNINNINKLKYNNILLNNNNNINNIYNNININNNMNLLMFKYLIGWSIMLKGRL
                     NKNISRISTTYLNNGTFNNKKYLWGNLNNNFKLNYINSNNNIYNYNNINKNGKYNIKV
                     KLNYI"
     misc_feature    274..1197
                     /gene="var1"
                     /locus_tag="CaglfMp02"
                     /note="Mitochondrial ribosomal protein (VAR1); Region:
                     VAR1; pfam05316"
                     /db_xref="CDD:283074"
     gene            1558..1643
                     /gene="tRNA-Tyr"
                     /locus_tag="CaglfMt16"
                     /db_xref="GeneID:807017"
     tRNA            1558..1643
                     /gene="tRNA-Tyr"
                     /locus_tag="CaglfMt16"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:807017"
     gene            1661..1732
                     /gene="tRNA-Asn"
                     /locus_tag="CaglfMt17"
                     /db_xref="GeneID:806994"
     tRNA            1661..1732
                     /gene="tRNA-Asn"
                     /locus_tag="CaglfMt17"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:806994"
     gene            1752..1823
                     /gene="tRNA-Ala"
                     /locus_tag="CaglfMt18"
                     /db_xref="GeneID:806997"
     tRNA            1752..1823
                     /gene="tRNA-Ala"
                     /locus_tag="CaglfMt18"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:806997"
     gene            1858..1930
                     /gene="tRNA-Ile"
                     /locus_tag="CaglfMt19"
                     /db_xref="GeneID:806998"
     tRNA            1858..1930
                     /gene="tRNA-Ile"
                     /locus_tag="CaglfMt19"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:806998"
     gene            1936..2006
                     /gene="tRNA-Trp"
                     /locus_tag="CaglfMt20"
                     /db_xref="GeneID:807016"
     tRNA            1936..2006
                     /gene="tRNA-Trp"
                     /locus_tag="CaglfMt20"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:807016"
     gene            2016..5108
                     /gene="21S rRNA"
                     /locus_tag="CaglfMr13"
                     /db_xref="GeneID:807021"
     rRNA            2016..5108
                     /gene="21S rRNA"
                     /locus_tag="CaglfMr13"
                     /product="21S ribosomal RNA"
                     /db_xref="GeneID:807021"
     gene            5203..5275
                     /gene="tRNA-Thr2"
                     /locus_tag="CaglfMt21"
                     /db_xref="GeneID:807014"
     tRNA            5203..5275
                     /gene="tRNA-Thr2"
                     /locus_tag="CaglfMt21"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:807014"
     gene            5290..5362
                     /gene="tRNA-His"
                     /locus_tag="CaglfMt22"
                     /db_xref="GeneID:806991"
     tRNA            5290..5362
                     /gene="tRNA-His"
                     /locus_tag="CaglfMt22"
                     /product="tRNA-His"
                     /db_xref="GeneID:806991"
     gene            5366..5437
                     /gene="tRNA-Glu"
                     /locus_tag="CaglfMt23"
                     /db_xref="GeneID:806999"
     tRNA            5366..5437
                     /gene="tRNA-Glu"
                     /locus_tag="CaglfMt23"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:806999"
     gene            5672..6829
                     /gene="cyb"
                     /locus_tag="CaglfMp03"
                     /db_xref="GeneID:807003"
     CDS             5672..6829
                     /gene="cyb"
                     /locus_tag="CaglfMp03"
                     /codon_start=1
                     /transl_table=3
                     /product="cytochrome-b"
                     /protein_id="NP_818777.1"
                     /db_xref="GeneID:807003"
                     /translation="MAFRKSNVYLSLVNSYLIDSPQPSTINYWWNLGSLLGLCLVIQI
                     LTGIFMAMHYSSNIELAFSSVEHIMRDVQYGWLLRYMHANGASFFFICMYMHIAKGLY
                     YGSYRSPRVTVWIVGVIIFVLTMAAAFLGYCCVYGQMSHWGATVITNLFSAIPFVGQD
                     IVQWLWGGFSVSNPTIQRFFALHYLVPFIIAALVVMHFMALHVHGSSNPLGITGNMDR
                     IGMHGYFIFKDLITVFVFLIFFSLFVFFSPNTLGHPDNYIPGNPLVTPASIVPEWYLL
                     PFYAILRSIPDKLLGVITMFAAILVLLVLPITDRSVVRGNTFKVLSKFFFFLFIFNFL
                     LLGQIGQLHIEPPFVLMGQIATFLYFAYFIIIVPIISTIENVLFYIGRVNN"
     misc_feature    5699..6760
                     /gene="cyb"
                     /locus_tag="CaglfMp03"
                     /note="cytochrome b; Provisional; Region: CYTB; MTH00156"
                     /db_xref="CDD:214440"
     gene            6889..6959
                     /gene="tRNA-Met2"
                     /locus_tag="CaglfMt24"
                     /db_xref="GeneID:807007"
     tRNA            6889..6959
                     /gene="tRNA-Met2"
                     /locus_tag="CaglfMt24"
                     /product="tRNA-Met"
                     /db_xref="GeneID:807007"
     gene            6974..7200
                     /gene="rpm1"
                     /locus_tag="CaglfM01"
                     /db_xref="GeneID:807001"
     misc_RNA        6974..7200
                     /gene="rpm1"
                     /locus_tag="CaglfM01"
                     /product="RNase P RNA"
                     /db_xref="GeneID:807001"
     gene            7219..7290
                     /gene="tRNA-Pro"
                     /locus_tag="CaglfMt25"
                     /db_xref="GeneID:807008"
     tRNA            7219..7290
                     /gene="tRNA-Pro"
                     /locus_tag="CaglfMt25"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:807008"
     gene            7463..13056
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /db_xref="GeneID:807004"
     CDS             join(7463..7702,9163..9309,10505..11088,12423..13056)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /codon_start=1
                     /transl_table=3
                     /product="cytochrome-c oxidase subunit I"
                     /protein_id="NP_818778.1"
                     /db_xref="GeneID:807004"
                     /translation="MVQRWLYSTNAKDIAVLYFMIALFSGMAGTAMSMIIRLELAAPG
                     SQYLAGNNQLFNVLVVGHAVLMIFFLVMPALIGGFGNYMLPLMIGASDMAFPRLNNVG
                     FWLIVPALVCLVTSTLVEAGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLL
                     GSINFIVTTLNMRTNGMTMHKLPLFVWAIFITAFLLLLSLPVLSAGVTMLLLDRNFNT
                     SFFEVAGGGDPILYQHLFWFFGHPEVYILIIPGFGIISHIVSTYSKKPVFGEISMVYA
                     MASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIYGGSIRL
                     AVPMLYAIAFLFLFTIGGMTGVALANASLDVAFHDTYYVVGHFHYVLSMGAVFSTIAG
                     YYYWSPQILGLYYNEKLAQIQFWLIFVGANVTFMPMHFLGINGMPRRIPDYPDAFAGW
                     NYVASVGSFIAMISLVLFIYILYDQFVNGLTNKANNKSVLYTKSPDFVESNEIFNLNT
                     IKTSSIEFLLTSPPAVHSFNTPAVQS"
     misc_feature    join(7487..7702,9163..9309,10505..11088,12423..12915)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Cytochrome C oxidase subunit I. Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_I; cd01663"
                     /db_xref="CDD:238833"
     misc_feature    order(7487..7489,9193..9195,9205..9207,9211..9213,
                     9232..9234,10550..10552,10562..10564,10616..10618,
                     10628..10630,10688..10690,10709..10711,10718..10720,
                     10742..10744,10769..10777,10790..10795,10799..10801,
                     10829..10831,10940..10942,10949..10951,10958..10963,
                     10973..10975)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    join(7499..7702,9163..9309,10505..11088,12423..12831)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Cytochrome C and Quinol oxidase polypeptide I;
                     Region: COX1; pfam00115"
                     /db_xref="CDD:278541"
     misc_feature    order(7514..7516,9163..9165,9196..9198,9217..9219,
                     9226..9228,10586..10591,10607..10609,10619..10621)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(7532..7534,7544..7546,7553..7555,7565..7567,
                     9271..9276,12649..12651,12868..12870,12877..12879)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Subunit I/VIIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(7574..7576,7583..7588,12673..12675,12682..12687,
                     12784..12786,12838..12840)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Subunit I/IV interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(7628..7630,10799..10801,10910..10912,10919..10924,
                     10997..11005,11012..11014,11021..11023,11045..11047,
                     11069..11071,11078..11080,12433..12441,12475..12477,
                     12529..12534,12538..12540,12544..12558,12748..12753,
                     12763..12771,12796..12801)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(7646..7648,12583..12585,12595..12597,12721..12723,
                     12832..12834)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Low-spin heme (heme a) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(9265..9267,9274..9276)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Subunit I/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(10523..10525,10757..10768)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Subunit I/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(10688..10690,10709..10711,10829..10831,10940..10942,
                     10949..10951,10958..10963,10973..10975)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Dimer interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(10799..10801,10814..10819,12541..12543,12553..12558,
                     12763..12765)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(10838..10840,10985..10990,12577..12579)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Binuclear center (heme a3/CuB) [ion binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(10838..10840,10850..10852,10883..10885,10985..10990,
                     11063..11065,11072..11074)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(10988..10990,12553..12558,12763..12768)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    11003..11005
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Subunit I/VIb interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    12436..12438
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Subunit I/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(12580..12582,12763..12768)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Electron transfer pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(12676..12678,12847..12849)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Subunit I/VIIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(12784..12786,12796..12798)
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
                     /note="Subunit I/VIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     exon            7463..7702
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
     gene            7703..8818
                     /gene="i-Cg1I"
                     /locus_tag="CaglfMp05"
                     /db_xref="GeneID:807025"
     CDS             <7703..8818
                     /gene="i-Cg1I"
                     /locus_tag="CaglfMp05"
                     /note="intronic ORF;
                     coordinates start arbitrarily at the first codon in phase
                     with the stop codon of the intronic ORF"
                     /codon_start=1
                     /transl_table=3
                     /product="I-Cg1I protein"
                     /protein_id="NP_818779.1"
                     /db_xref="GeneID:807025"
                     /translation="KMNTYNNYYIKYNYNNNKLYNYNKLYNNNNSKRYINNNKLYIMN
                     MKRYMSLYNKDKLYIMNMKRDMSLYNKDKLGPYLSGLIEGNGTIWVPEYNNKTKPLIN
                     IIFHIMNKPLADYLCNMLNIGKVYDRSNKGKYCIWQLTKIEDLYIFINLINGYLRTPK
                     YETLIKLINWMNMYIDNNKLNNNNNNINYIKYKSIDNSLLMNNGWLSGFSDMNSNFIM
                     MMNKKRTNNMIKLNYNLEIKQLYKNNNNNFNYYNLMMNIANLFNNNLLIKMKNMKLKN
                     NNYKTYYLYNISINNNMNNLLLVNNYYMKYPLLSIKYLNYMNWSNLLLNIHNNNNSFT
                     NINSINLYNKLIINNNNINRIINNYNWKHLNNNYYMK"
     misc_feature    7934..8215
                     /gene="i-Cg1I"
                     /locus_tag="CaglfMp05"
                     /note="LAGLIDADG endonuclease; Region: LAGLIDADG_1;
                     pfam00961"
                     /db_xref="CDD:279328"
     exon            9163..9308
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
     gene            9310..10443
                     /gene="i-Cg1II"
                     /locus_tag="CaglfMp06"
                     /db_xref="GeneID:807020"
     CDS             <9310..10443
                     /gene="i-Cg1II"
                     /locus_tag="CaglfMp06"
                     /note="intronic ORF;
                     coordinates start arbitrarily at the first codon in phase
                     with the stop of the intronic ORF"
                     /codon_start=1
                     /transl_table=3
                     /product="I-Cg1II protein"
                     /protein_id="NP_818780.1"
                     /db_xref="GeneID:807020"
                     /translation="FMMCSYKMSTDAWKTLYFLSLYNKMYLLKYLIYYNNNNNKLVKM
                     FNIMGWYASMLYYNMYNNNMFQRTNVTKLIHTNNMKMNNMKMNNLNMNEWLVGMTDSN
                     GMFNIYINNNNKIIFTYKISLMINNIQLLYKIKNYLKIGSINYTNNMVMYTINNNNDL
                     LNIILPIFDKYKLLTSKRFNYLLFKKCLLINNNNNFNQLLKINLINNIINNNNNNKYN
                     NNYISDSWYNIYKNYKNININNMKMMNNMLENNLLMINKIMTKSWLIGYMETKSSFKL
                     IKKDNKIIHYFNINMMKLDYIVMYSIKLLLNININMNNYKLETFDNKSIEYIINYLKF
                     NNHKSRLLGMKSYEYTIWKRSYYKYKNNNKKLLIIKMLLDKNI"
     misc_feature    9592..9870
                     /gene="i-Cg1II"
                     /locus_tag="CaglfMp06"
                     /note="LAGLIDADG endonuclease; Region: LAGLIDADG_1;
                     pfam00961"
                     /db_xref="CDD:279328"
     exon            10504..11088
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
     gene            11090..11929
                     /gene="i-Cg1III"
                     /locus_tag="CaglfMp07"
                     /db_xref="GeneID:807002"
     CDS             <11090..11929
                     /gene="i-Cg1III"
                     /locus_tag="CaglfMp07"
                     /note="intronic ORF;
                     coordinates start arbitrarily at the first codon in phase
                     with the stop of the intronic ORF"
                     /codon_start=1
                     /transl_table=3
                     /product="I-Cg1III protein"
                     /protein_id="NP_818781.1"
                     /db_xref="GeneID:807002"
                     /translation="IYPFSKDNMLIMNNYFNNIFYTTYNYYNKYNNNNNKYYIINNNI
                     KDLVIYGTNLESNVNKPNFTKDIMNMMNIPNNLLYIIVGILLMDGQINYSSKKNLDNK
                     NIIDINCKFKLKLSMKNKEYLIYVYKLLEHYCISMPKLKKDMMRGKEYLKLEFYTRSL
                     PCFTLLRKHFYKGRMKIVPNDLYDLLNYESLAHMIMCNSSFIKNKGIYLNMTSFTLKE
                     MIFIMNIFIIKFNLNCTLHKLNNNYIIYIKFKSIKLLYNNIKNYITPSMKYKFYYKLK
                     LLK"
     misc_feature    11321..11854
                     /gene="i-Cg1III"
                     /locus_tag="CaglfMp07"
                     /note="LAGLIDADG DNA endonuclease family; Region:
                     LAGLIDADG_2; pfam03161"
                     /db_xref="CDD:281195"
     exon            12423..13056
                     /gene="cox1"
                     /locus_tag="CaglfMp04"
     gene            13275..13421
                     /gene="atp8"
                     /locus_tag="CaglfMp08"
                     /db_xref="GeneID:807005"
     CDS             13275..13421
                     /gene="atp8"
                     /locus_tag="CaglfMp08"
                     /codon_start=1
                     /transl_table=3
                     /product="ATP synthase subunit 8"
                     /protein_id="NP_818782.1"
                     /db_xref="GeneID:807005"
                     /translation="MPQLIPFYFMNQLTYGLLLITVLLILFSQFFLPMILRLYVSRLF
                     ISKL"
     misc_feature    13275..13418
                     /gene="atp8"
                     /locus_tag="CaglfMp08"
                     /note="Fungal ATP synthase protein 8 (A6L); Region:
                     Fun_ATP-synt_8; pfam05933"
                     /db_xref="CDD:283561"
     gene            13614..14396
                     /gene="atp6"
                     /locus_tag="CaglfMp09"
                     /db_xref="GeneID:807015"
     CDS             13614..14396
                     /gene="atp6"
                     /locus_tag="CaglfMp09"
                     /codon_start=1
                     /transl_table=3
                     /product="ATP synthase subunit 6"
                     /protein_id="NP_818783.1"
                     /db_xref="GeneID:807015"
                     /translation="MQNTLLRTYINSPLEQFEVKTFLGLNTPFIDLSGLNITTFTLYT
                     IIVLLVVSSLYVLSNNNNKIIGSRWLLSQEVIYDTILNMVKGQIKGKDWGYYFPFIYT
                     LFMFILISNLISMIPYSYALTAQFVFIISLSMIIWLGITILSLFKHGWVFFSLFVPSG
                     TALPLVPLLVVIELLSYVARAFSLGLRLSANIFSGHLLMAILAGLTMTFVQINIFTLI
                     LGFIPLAIILIIMCLEFGIAIIQAYVFSILASSYLKDGLYLH"
     misc_feature    13704..14384
                     /gene="atp6"
                     /locus_tag="CaglfMp09"
                     /note="ATP synthase subunit 6 (eukaryotes),also subunit A
                     (prokaryotes); Region: ATP_synt_6_or_A; TIGR01131"
                     /db_xref="CDD:273458"
     gene            14631..14861
                     /gene="atp9"
                     /locus_tag="CaglfMp10"
                     /db_xref="GeneID:807026"
     CDS             14631..14861
                     /gene="atp9"
                     /locus_tag="CaglfMp10"
                     /codon_start=1
                     /transl_table=3
                     /product="ATP synthase protein 9"
                     /protein_id="NP_818784.1"
                     /db_xref="GeneID:807026"
                     /translation="MQLALAAKYIGAGISTIGLIGAGIGIGIVFAALINGVSRNPSLK
                     DTLFSYSILGMALSEATGLFCLMISFMLLFAV"
     misc_feature    14634..14858
                     /gene="atp9"
                     /locus_tag="CaglfMp10"
                     /note="ATP synthase subunit C; Region: ATP-synt_C;
                     cl00466"
                     /db_xref="CDD:320987"
     gene            15384..16067
                     /gene="cox2"
                     /locus_tag="CaglfMp11"
                     /db_xref="GeneID:807024"
     CDS             15384..16067
                     /gene="cox2"
                     /locus_tag="CaglfMp11"
                     /note="last 27 amino acids are cut by a frameshift
                     according to other COX2 candida glabrata proteins"
                     /codon_start=1
                     /transl_table=3
                     /product="cytochrome-c oxidase subunit II"
                     /protein_id="NP_818785.1"
                     /db_xref="GeneID:807024"
                     /translation="MLNLLNTLFLNVISNDVPTPYGIYFQDSATPNQEGILELHDNIM
                     FYLFIILGLVSWMLFTIVKTYSKNPMAYKYIKHGQTIEIIWTMFPAVILLIIAFPSFI
                     LLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDNGETIEFESYVIPDDLLEEGQLRL
                     LDTDTSVVVPVDTHIRFVVTGADVIHDFAIPSLGIKVDANPGRLNQVSALIQREGVFY
                     GQCSELTRC"
     misc_feature    15450..16052
                     /gene="cox2"
                     /locus_tag="CaglfMp11"
                     /note="cytochrome c oxidase subunit II; Provisional;
                     Region: COX2; MTH00154"
                     /db_xref="CDD:214438"
     gene            16211..16282
                     /gene="tRNA-Phe"
                     /locus_tag="CaglfMt26"
                     /db_xref="GeneID:807018"
     tRNA            16211..16282
                     /gene="tRNA-Phe"
                     /locus_tag="CaglfMt26"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:807018"
     gene            16291..16364
                     /gene="tRNA-Thr1"
                     /locus_tag="CaglfMt27"
                     /db_xref="GeneID:807013"
     tRNA            16291..16364
                     /gene="tRNA-Thr1"
                     /locus_tag="CaglfMt27"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:807013"
     gene            16383..16454
                     /gene="tRNA-Cys"
                     /locus_tag="CaglfMt28"
                     /db_xref="GeneID:806993"
     tRNA            16383..16454
                     /gene="tRNA-Cys"
                     /locus_tag="CaglfMt28"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:806993"
     gene            16471..16543
                     /gene="tRNA-Val"
                     /locus_tag="CaglfMt29"
                     /db_xref="GeneID:807009"
     tRNA            16471..16543
                     /gene="tRNA-Val"
                     /locus_tag="CaglfMt29"
                     /product="tRNA-Val"
                     /db_xref="GeneID:807009"
     gene            16756..17565
                     /gene="cox3"
                     /locus_tag="CaglfMp12"
                     /db_xref="GeneID:807011"
     CDS             16756..17565
                     /gene="cox3"
                     /locus_tag="CaglfMp12"
                     /codon_start=1
                     /transl_table=3
                     /product="cytochrome-c oxidase subunit III"
                     /protein_id="NP_818786.1"
                     /db_xref="GeneID:807011"
                     /translation="MTHLERSRHQQYPYHMVLPSPWPMLLSFALLSLTLSLGLTMHGY
                     IGNMNLVYLALLVVTLTSVFWFRDVIAEATYLGDHTIAVRKGINLGFLLFVLSEVLIF
                     AGLFWAYFHSAMSPDIVLGASWPPVGIQAVQPTELPLLNTIILLSSGATITYSHHALI
                     CRNRNKALSGLFITIWLIIIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVM
                     LAVMLIICYWRMRTYQFTSTHHVGFETTILYCHVLDIIWLFLYIVFYWWGV"
     misc_feature    16789..17562
                     /gene="cox3"
                     /locus_tag="CaglfMp12"
                     /note="Cytochrome c oxidase subunit III; Region: COX3;
                     pfam00510"
                     /db_xref="CDD:278911"
     misc_feature    order(16945..16947,16954..16959,16966..16968,16975..16983)
                     /gene="cox3"
                     /locus_tag="CaglfMp12"
                     /note="Subunit III/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(16948..16953,16960..16965,16972..16974,16990..16992,
                     17023..17028,17035..17037,17419..17421,17440..17442,
                     17476..17481)
                     /gene="cox3"
                     /locus_tag="CaglfMp12"
                     /note="Phospholipid binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238834"
     misc_feature    order(16999..17001,17008..17013,17044..17046,17053..17055,
                     17065..17070,17086..17088,17350..17355,17362..17364,
                     17374..17376)
                     /gene="cox3"
                     /locus_tag="CaglfMp12"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    17134..17136
                     /gene="cox3"
                     /locus_tag="CaglfMp12"
                     /note="Subunit III/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(17158..17166,17215..17217,17293..17295,17323..17331,
                     17344..17352)
                     /gene="cox3"
                     /locus_tag="CaglfMp12"
                     /note="Subunit III/VIa interface; other site"
                     /db_xref="CDD:238834"
     misc_feature    17251..17253
                     /gene="cox3"
                     /locus_tag="CaglfMp12"
                     /note="Subunit III/Vb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     gene            17616..17697
                     /gene="tRNA-Leu"
                     /locus_tag="CaglfMt30"
                     /db_xref="GeneID:807022"
     tRNA            17616..17697
                     /gene="tRNA-Leu"
                     /locus_tag="CaglfMt30"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:807022"
     gene            17715..17785
                     /gene="tRNA-Gln"
                     /locus_tag="CaglfMt31"
                     /db_xref="GeneID:806995"
     tRNA            17715..17785
                     /gene="tRNA-Gln"
                     /locus_tag="CaglfMt31"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:806995"
     gene            17818..17889
                     /gene="tRNA-Lys"
                     /locus_tag="CaglfMt32"
                     /db_xref="GeneID:807000"
     tRNA            17818..17889
                     /gene="tRNA-Lys"
                     /locus_tag="CaglfMt32"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:807000"
     gene            17915..17987
                     /gene="tRNA-Arg"
                     /locus_tag="CaglfMt33"
                     /db_xref="GeneID:806996"
     tRNA            17915..17987
                     /gene="tRNA-Arg"
                     /locus_tag="CaglfMt33"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:806996"
     gene            18004..18075
                     /gene="tRNA-Gly"
                     /locus_tag="CaglfMt34"
                     /db_xref="GeneID:806990"
     tRNA            18004..18075
                     /gene="tRNA-Gly"
                     /locus_tag="CaglfMt34"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:806990"
     gene            18085..18156
                     /gene="tRNA-Asp"
                     /locus_tag="CaglfMt35"
                     /db_xref="GeneID:806992"
     tRNA            18085..18156
                     /gene="tRNA-Asp"
                     /locus_tag="CaglfMt35"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:806992"
     gene            18180..18262
                     /gene="tRNA-Ser1"
                     /locus_tag="CaglfMt36"
                     /db_xref="GeneID:807010"
     tRNA            18180..18262
                     /gene="tRNA-Ser1"
                     /locus_tag="CaglfMt36"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:807010"
     gene            18281..18367
                     /gene="tRNA-Ser2"
                     /locus_tag="CaglfMt37"
                     /db_xref="GeneID:807012"
     tRNA            18281..18367
                     /gene="tRNA-Ser2"
                     /locus_tag="CaglfMt37"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:807012"
     gene            18404..20053
                     /gene="15S rRNA"
                     /locus_tag="CaglfMr14"
                     /db_xref="GeneID:807023"
     rRNA            18404..20053
                     /gene="15S rRNA"
                     /locus_tag="CaglfMr14"
                     /product="15S ribosomal RNA"
                     /db_xref="GeneID:807023"
ORIGIN      
        1 aaaatatttt aaacttgtat agtttaaatg gttaaaacat ttgtctcata aacaaataat
       61 gtaaggttca aatccttcta caagtattaa ctacaattta ataatattat aatatataat
      121 ataatatatt ataataatct aattaattaa taattagata aaataaaaat aaaataaaat
      181 atgaaattaa taaaattatt aaaattaaat attaataata ataataataa taaattatta
      241 ttaaagaatt tattattatt aataaataag aatagattaa taaataaatt aagtaataat
      301 aataaatatt taagtgaatt aaataataaa ggtaatagtt tacaacattt aaataatata
      361 aataattgaa aattacagaa ttataattat aataaaaata atcttattaa taattatatt
      421 aatagtaaat taattaataa attattatat aaattaatat cattaaaaaa taataaaatt
      481 attattagta aaccattata taaaattaat ataaatgtaa ttaatattag attttattat
      541 tataatataa ataattataa ttataataat aatatttatt atattaatat aattaataaa
      601 ttaataaata gattaaatat taatataaat aatttaagta atattttaag ttattattat
      661 aataaaaaag ttattattga acctattaaa ttaaaatatt tatataataa taatgaaatt
      721 ataactaaat atattagttt attagataat aataaatata ataatggttt attaatagaa
      781 tatcaaagac tattaaataa tattatgcct aaattaaatg atcataatat ctctataaat
      841 tatattaata atattaataa tattaataaa ttaaaatata ataatatttt attaaataat
      901 aataataata ttaataatat ttataataat attaatatta ataataatat aaatttatta
      961 atgtttaaat atttaattgg ttgatctatt atgttaaaag gtagattaaa taaaaatatt
     1021 agtagaatta gtactctata tttaaataat ggtactttta ataataaaaa atatttatga
     1081 ggtaatttaa ataataattt taaattaaat tatattaata gtaataataa tatctataac
     1141 tataataata ttaataaaaa tggtaaatat aatattaaag ttaaattaaa ttatatttaa
     1201 taaatatatc taacaaaata tattataaat ataataataa taataaacat aaatatttaa
     1261 tatttaaaat aaattatttt aaatatatat atataataat atataatatt ttaattaaat
     1321 tatatacaat aataatataa tatttaatat ttaaattata tttaattatt taataatata
     1381 tataataata atataatatt aaagttaaaa tatatttaaa ttatatataa taatataata
     1441 tttaatattt aaattatatt taattattta ttaattaatt aattaattta ttaataatat
     1501 ttatatatat tattatataa tataatattc tttatataag taattatata taatatagga
     1561 gggatttcca atgttggtaa ttggagttga gctgtaaact caatgattat atatcttcat
     1621 aggttcaatt cctattccct tcattttatt aattaattta gtctttatgg cttagtggtt
     1681 aaagcatctc actgttaatg agaatacata ggttcaattc ctattgaaga cgtatatata
     1741 atataaataa gggggttata gttaaattgg tagaacaatt gtgttgcatg caatagatat
     1801 gagttcaatt ctcattaact ccataaatat atatatatat atatgtatat aattatagaa
     1861 actataattc aattggttag aatagtattt tgataaggta ccaatatagg ttcgattcct
     1921 gttagtttca atataaagga tatagtttaa tggtaaaact attgatttca aatcaatcat
     1981 taagagttcg aatcttttta tccttggtat aagtaataat aataaaaata atagatttga
     2041 aatatttatt atatagattt aaagagataa tcatggaata catatattat aataatatta
     2101 tattataata atactattaa tagttaatta ggttactaat aaaatatata tattatatta
     2161 tatatatttt taatacctaa aggtaaacct taaattatat atatatatta atttatttta
     2221 tatataataa aataagacta agtgaactga aacatcttag taacttaagg aataaaaatc
     2281 aacagagata ttatgagtat tggtgagaga aaataataat aggtcgtaaa aagtattatg
     2341 tattaattaa tatgtaagaa tataggatta acaatttcta agactaaata ctattaataa
     2401 gttaagaaag taccgtgagg gaaagtatgt aaatggttat tttataagca attatagata
     2461 ttatatataa tatcaataat gtaccttttg tataatgggt cagcaagtaa ttaatattag
     2521 caaaattaaa taattatata aaaatagaaa taaatatata tataaaaata tattaagagt
     2581 taatattaat tgacccgaaa gcatatgatc ttactatgac aagatggtta aaaacgatcg
     2641 aacaggttaa tgttgcaaaa ttatctgatt agttgtggta aggtatgaaa gataaatctg
     2701 atatgcagat agctggtttt ctatgaaata tatgttagta tagcccttat aattaaataa
     2761 ttaataataa tataataatt tattatatta ttattgaatg gtacagcaat taatatatat
     2821 tggggaatta ttataatttt atcaataata tttaatctcg aaatatttaa ttatatataa
     2881 ttaatttaat taattatata atttataagg agtcagatta tgtgcgataa ggtaaataat
     2941 ctaaagggaa acagcccaga ttaatatata aagttccaaa ttttataaaa tatatataaa
     3001 aaaaatatat ttaatttata aatttaattt ataaataata ataagtgaaa ataatattaa
     3061 aatattatta aataatcagt taatgggttt gacaataacc attttttaat gaacatgtaa
     3121 caatgcactg atcaataata ttatataata tttcaaatta aattaatttt taattaattt
     3181 attaataaac aatatacgga tcttattaat tataaaaatt attaaactga atatttaaat
     3241 attattaatt attattaaaa taattaataa tatggtaata gaacatctaa tgaaagagta
     3301 tattaattaa atattaatat attaataaat aattagatag agaatgctga catgagtaac
     3361 gataaaaagg tttaaacctt ttcacctaaa acataaggtt ttactataaa agtacggcac
     3421 ctaatataaa tatgaatata aatatattat agatggtaaa aatctaattt aataataaaa
     3481 atctttatag atatatatta tatatatata taaattaata aagatcagga aataaattat
     3541 taaatgtata ccgtaatgta taccgactca ggtatgttag tagagaatat gaaggtgtat
     3601 tagataatta aggataagga actcggcaaa aatagctcta acgttagtca ataaagagat
     3661 ataaaaacaa ggttgtacaa ctgtttacta aaaacaccgc actttgcaaa aactatttaa
     3721 gttatagtat aaggtgtgaa ctctgctcaa tgcttaatat ataaattata tatttattaa
     3781 agaatatata aataaattta agtaaatagc agccttatta tgagggttat aatgtagcga
     3841 aattccttgg ctgataatta cagtcccgca tgaatgacgt aatgatacaa caactgtctc
     3901 atccttaaac taagtgaaat tgaatttgca gtgaagatgc tgtatatttg tagttagaca
     3961 agaagaccct atgcagcttt actataatta gatagatcga attattattt attatattca
     4021 gcatattaag taatttatat atatatatat atatataata atcgtttaga tataaatgag
     4081 atacttatta taataatata ataattctaa tctttaataa atatatatat atttaataga
     4141 aaattaatat attcttaaat atattttata atattattat tattaataat attatatatt
     4201 aagagacaat ctctaattgg tagttttgat ggggcgtcat tttcagcaaa agtatctgaa
     4261 taagtccata tataaattat tataaaattt tatttataat ataaagtata tattatatat
     4321 actaattata aaatatatta tatattttta tatatataat ataataatag aaaaattata
     4381 tacagtaaaa ttgtctggaa aacaataata tttatttatt tttaataaat attaaattaa
     4441 tataatagta taactgtgta aagattatga cacaaacaag tggaataagt acgtaagtat
     4501 ggtataatga acaaataata ctgattgtaa aggttattga taacgaataa aagttacgct
     4561 agggataaca gggtaatata acgaaagagt agaaattgta agttatgttt gccacctcga
     4621 tgtcgactct acctatccta ttggttgtaa aagctaataa gggttcgact gttcgtcgat
     4681 taaaaggtaa cgtgagttgg gttaaatacg acgtgagtca gtatggtttt tatctactac
     4741 aaataatatt atcttattaa atctcattat tagtacgcaa ggaccataat gaattaacct
     4801 atggtgtacc tattaattat tatattaaat aatacataaa taatttattt attatttaat
     4861 caatattaat ttatatctta ataattgtta tagtaggtaa gctaagttaa taaataataa
     4921 atattgaata catataaaat atgaagtagt tttaaaacga taatatatac taataatctt
     4981 atactaagat taatataggt tttatatata ttttaatata cataaaatac taatttatta
     5041 gttatctata taatatctaa tctattattt ttattattat tattaatatt atataaaaat
     5101 aatttataat aatattatat aaaattattt ataataatat tatataaaat aatttataat
     5161 aatattatat taatttaata tttattatat taatttaata aagttatatt agctcaattg
     5221 gtagagcatt cgttttgtaa tcgaaaggtt tggggttcaa atccctaata taacatatat
     5281 atatataaag gtaaatatat ttcaatggta gaaaatacgc ttgtggtgcg ttaaatctaa
     5341 gttcgattct tagtatttac ccttagatct tatcgtctaa tggttacgac atcaactttt
     5401 catgttgaaa atgttggttc aatcccaact aagattaata tataaaatat tataataata
     5461 ataaaattat aatattattt atttattaaa taataataat taaaattatt taattaaatt
     5521 aattaattta ttatatatat taattatatt atatataata agaatatata aattataaat
     5581 atataatttt atatatataa agtatatata tatatatata ttatatttat gtgtatatat
     5641 atgtatatat ttagagtaaa atatttttat tatggcattt agaaaatcaa atgtttattt
     5701 aagtttagtg aatagttatt taattgattc accacaacca tcaacaatta attattgatg
     5761 aaatttaggt tcattattag gattatgttt agtaattcaa attttaacag gtatttttat
     5821 ggctatgcat tattcatcaa atattgaatt agcattttca tcagtagaac atattatgag
     5881 agatgtacaa tatggttgat tattaagata tatgcatgca aatggagcat catttttctt
     5941 tatttgtatg tatatgcata ttgctaaagg tttatattat ggttcatata gatcacctag
     6001 agtactagta tgaattgtag gtgttattat ttttgtatta actatggctg ctgctttctt
     6061 aggttattgt tgtgtatatg gacaaatgtc acattgaggt gcactagtaa ttactaattt
     6121 attctcagct attcctttcg ttggtcaaga tattgtacaa tgattatgag gaggtttctc
     6181 agtatctaat cctactattc aaagattctt tgcattacat tatttagtac catttattat
     6241 tgctgcttta gtagtaatgc attttatggc tttacatgta catggttcat ctaatccttt
     6301 aggtattaca ggtaatatgg atagaattgg aatgcatggt tatttcattt ttaaagattt
     6361 aattactgtt tttgtattct taattttctt ctcattattt gtattcttct cacctaatac
     6421 tttaggacat cctgataatt atattcctgg taatccttta gtaacaccag catctattgt
     6481 acctgaatga tatttattac cattttatgc tattttaaga tctattcctg ataaattatt
     6541 aggtgttatt cttatgtttg ctgctatttt agttttatta gtattaccta ttactgatag
     6601 aagtgttgta agaggaaata cttttaaagt attatctaaa ttcttcttct tcttatttat
     6661 ctttaatttc ttattattag gacaaatcgg acaattacat attgaaccac ctttcgtatt
     6721 aatgggacaa attgctacat tcttatactt cgcttacttt attattatcg tacctattat
     6781 ctctactatt gaaaacgtat tattctatat cggtagagtt aataattaat taatattaat
     6841 aatttaatat atataatatt cttactttaa ttataagtaa ttataaatgt aatatgatgt
     6901 aattggttaa catattaggt tcatgaccta attatatacg ttcaaatcgt attattgcta
     6961 tatatatata tatataatat atattatata aagaaaagtc ataaataata ataatatatt
     7021 attatttaat taaataataa taatatattt aaataaataa tataaataat taaattgaaa
     7081 tatatattta ttttaataaa atattatata ttaataatat tttaaatata attaattaat
     7141 ataattaatt atattatagt tatataatat acataaataa gcttatatat agtatatagt
     7201 atatatatat attttataca gatagaagcc aaaaggtcag gcgctttctt tgggtgaaag
     7261 atctagttag ttcgagtcta tcctatctga atatattata atttataaat atataaatta
     7321 taaataataa aaattaatta aaataattta aattaaatat atatattaat attatattaa
     7381 tatatatata tatattttat atatatatat atgtattgat ttatttatat atatattaat
     7441 gaaataatta tgtaatataa ttatggtaca aagatgatta tattcaacaa atgctaaaga
     7501 tattgcagta ttatatttta tgattgcatt atttagtggt atggcaggta cagctatgtc
     7561 tatgattatt agattagaat tagctgctcc tggttcacaa tatttagcag gtaataatca
     7621 attattcaat gtattagttg taggacatgc tgttttaatg attttcttct tagttatgcc
     7681 agcattaatt ggaggttttg gtaaaataaa cctttataat aattattata ttaaatataa
     7741 ttataataat aataaattat ataattataa taaattatat aataataata attctaaaag
     7801 atatattaat aataataaat tatatattat aaatataaaa agatatataa gtttatataa
     7861 taaagataaa ttatatatta taaatataaa aagagatata agtttatata ataaagataa
     7921 attaggacct tatttatcag gtttaattga aggaaatggt actatttgag taccagaata
     7981 taataataaa cttaagcctt taattaatat tatttttcat attataaata aacctttagc
     8041 tgattattta tgtaatatat taaatattgg taaagtttat gatagaagta ataaaggtaa
     8101 atattgtatt tgacaattac ttaaaattga agatttatat atttttatta atttaattaa
     8161 tggttattta agaactccta aatatgaaac tttaattaaa ttaattaatt gaataaatat
     8221 atatattgat aataataaat taaataataa taataataat attaattata ttaaatataa
     8281 atctattgat aattcattat taataaataa tggttgatta tcaggtttta gtgatataaa
     8341 tagtaatttt attataataa taaataaaaa aagaactaat aatataatta aattaaatta
     8401 taatttagaa attaaacaat tatataaaaa taataataat aattttaatt attataattt
     8461 aataataaat attgctaatt tatttaataa taatttatta attaaaataa aaaatataaa
     8521 attaaaaaat aataattata aactttatta tttatataat atttcaatta ataataatat
     8581 aaataattta ttattagtta ataattatta tataaaatat cctttattat ctattaaata
     8641 tttaaattat ataaattgat ctaatttatt attaaatatt cataataata ataattcttt
     8701 tcttaatatt aatagtatta atttatataa taaattaatt attaataata ataatattaa
     8761 tagaattatt aataattata attgaaaaca tttaaataat aattattata taaaatagtt
     8821 gccgttatat attgtaaaat atataattat tatatcacta tattctggaa actcctaaag
     8881 ctttatataa tatatactaa taattataat aataaataaa tttattttat ttattaattt
     8941 ataaattata aatttatata ttgataatta taaagataat tttatataaa taatatttat
     9001 ataaaataaa tggacaatca gaaggaaacg aagataatat atattgtata tattatataa
     9061 taggatcctc agagactaca cgtgataaat ataattaatt atattaatta attatattaa
     9121 gatatagtcc agattatata gaaatatata atatttatta agaactatat gttaccatta
     9181 atgattggtg catcagatat ggcatttcca agattaaata atgttggttt ctgattaatt
     9241 gttcctgctt tagtttgttt agttacttct acattagtag aagcaggtgc tggtactggt
     9301 tgaactgtat ttatgatatg cagttataaa atgtcacttg atgcatgaaa aaccttatat
     9361 tttttatctt tatataataa aatatattta ttaaaatact taatttatta taataataat
     9421 aataataaat tagttaaaat gtttaatatt ataggttgat atgccagcat attatattat
     9481 aatatatata ataataatat gtttcagaga ctaaacgtga caaaattaat tcatctaaat
     9541 aatataaaaa taaataatat aaaaataaat aatttaaata taaatgaatg attagtaggt
     9601 ataactgata gtaatggaat atttaatatt tatattaata ataataataa aattattttt
     9661 acatataaaa tttcattaat aattaataat attcaattat tatataaaat taaaaattat
     9721 ttaaaaattg gttctattaa ttatactaat aatatagtaa tatatctaat taataataat
     9781 aatgatttat taaatattat tttacctatt tttgataaat ataaattatt aacatcaaaa
     9841 agatttaatt atttattatt taaaaaatgt ttattaatta ataataataa taattttaat
     9901 caattattaa aaattaattt aattaataat attattaata ataataataa taataaatat
     9961 aataataatt atatttctga ttcatgatat aatatttata aaaattataa aaatattaat
    10021 attaataata taaaaataat aaataatata ttagaaaata atttattaat aattaataaa
    10081 attataacta aatcatgatt aattggttat atagaaacta aaagttcatt taaattaatt
    10141 aaaaaagata ataaaattat tcattatttt aatattaata taataaaatt agattatatt
    10201 gtaatatata gtattaaatt attattaaat attaatatta atataaataa ttataaatta
    10261 gaactatttg ataataaaag tattgaatat attattaatt atttaaaatt taataatcat
    10321 aaatcaagat tattaggtat aaaaagttat gaatatctaa tttgaaaaag atcatattat
    10381 aaatataaaa ataataataa aaaattatta attattaaaa tattattaga taaaaatatt
    10441 tagaaagaat taatttaaga tatagtccaa tcaatatagt aatatattgt taatatttaa
    10501 aggatatcca ccattatcat caattcaagc tcattcagga cctagtgttg atttagctat
    10561 ttttgcatta catttaactt ctatttcatc attattaggt tcaattaatt ttattgttac
    10621 aacattaaat atgagaacta atggtatgac aatgcataaa ttaccattat ttgtatgagc
    10681 tattttcatt acagctttct tattattatt atcattacca gtattatcag caggtgttac
    10741 aatgttatta ttagatagaa acttcaatac ttcattcttt gaagtagctg gaggtggtga
    10801 tcccatttta taccaacatt tattctgatt ctttggtcat ccagaagtat atattttaat
    10861 tattcctgga tttggtatta tttcacatat tgtatctact tattctaaaa aaccagtatt
    10921 tggtgaaatt tctatggtat atgctatggc atctattggt ttattaggat tcttagtatg
    10981 atcacatcat atgtatattg taggattaga tgctgatact agagcttatt tcacttctgc
    11041 tactatgatt attgctattc ctacaggaat taaaattttc tcatgattaa tttatccctt
    11101 tagtaaggat aatatgttga tcataaataa ttattttaat aatatcttct acactcttta
    11161 taattattat aataaatata ataataataa taataaatat tatattatta ataataatat
    11221 taaagattta gtaatttatg gtcttaattt agaatctaat gtaaataaac ctaattttct
    11281 taaagatatt ataaatataa taaatattcc taataattta ttatatatta ttgtaggtat
    11341 tttattaata gatggtcaaa ttaattattc atctaaaaag aatttagata ataaaaatat
    11401 tattgatatt aattgtaaat ttaaattaaa attatctata aaaaataaag aatatttaat
    11461 ttatgtatat aaattattag aacattattg tatttcaata cctaaattaa aaaaagatat
    11521 aataagaggt aaagaatatt taaaattaga attttatact agatctttac catgttttac
    11581 attattaaga aaacattttt ataaaggtag aataaaaatt gtacctaatg atttatatga
    11641 tttattaaat tatgaatctt tagctcatat aattatatgt aatagttcat ttattaaaaa
    11701 taaaggtatt tatttaaata tactatcatt tctattaaaa gaaataatct ttattataaa
    11761 tatctttatt attaaattta atttaaattg tactttacat aaattaaata ataattatat
    11821 tatttatatt aaatttaaat ctattaaatt attatacaat aatattaaaa attatattct
    11881 accttctata aaatataaat tttattataa attaaaatta ttaaaataat tataagaagc
    11941 aaactcgagg gaaaccctat attaaaaaat tataaatata atttatatat atataaaata
    12001 tatataatat attaattata ttaaattatt aagaaattaa tatattaatt atataaatta
    12061 ttaaggaatt aatataggat aatcgtcgaa ctaaattata ttaagaaatt aatatataaa
    12121 agcgtagaga ctagatgctt ctgataatct aagtaattaa ataattaaat atttaattat
    12181 atgattatat aaggtatagt ccaatggaat cagtaatgat tttgaagcaa tacttcaaat
    12241 attaatatat atatatatat taatatccta cctaaattat tatattatat aataattatt
    12301 aaaaagggaa aaaataatat atttaattat tatttttttt ataaatttaa ctaactaata
    12361 aatagtatat attataatat attatttata gaatctgaga tgatttaagg ttaaatatta
    12421 agagcaacaa tttatggagg ttctattaga ttagcagttc ctatgttata tgctattgca
    12481 ttcttatttt tattcactat tggtggtatg acaggagtag cattagcaaa tgcatcatta
    12541 gatgtagcat tccatgatac atattatgta gtaggtcatt tccattatgt attatcaatg
    12601 ggagcagtat tttcaactat tgcaggatat tattattgaa gtcctcaaat tttaggatta
    12661 tattataatg aaaaattagc acaaattcaa ttctgattaa tttttgtagg agctaatgta
    12721 ctatttatgc ctatgcattt cttaggtatt aatggtatgc ctagaagaat tcctgattat
    12781 cctgatgctt ttgctggttg aaactatgta gcatcagtag gatcatttat tgctatgatc
    12841 tcattagttt tatttattta catcttatat gatcaatttg taaatggttt aactaataaa
    12901 gctaataata aatcagtatt atatactaaa tcacctgatt ttgtagaatc taatgaaatc
    12961 tttaacttaa atactattaa aacttcttct attgaattct tattaacttc accaccagct
    13021 gttcattcat ttaatacacc agctgtacaa tcataattta taataaataa attaattata
    13081 atattcttta attataaata aaaaatatat tcatataatt atataataat ataataattt
    13141 actattatta tattatgtaa gttattaatc ttatatatat ataatatata taagaatatt
    13201 aaaataatct attaataata atttatttat tattaatgtt gtatttatat taaatatata
    13261 aaaaatatat aaatatgcca caattaattc cattttattt tatgaatcaa ttaacatatg
    13321 gtttattatt aattactgta ttattaattt tattttcaca attcttttta cctataattt
    13381 taagattata tgtatcaaga ttatttattt ctaaattata aatataatta ataataataa
    13441 tatataatta taatataata taattaataa tatataatta taatataata taattaataa
    13501 taatttatat atattaattt aaaatatttt ttttttttat taatataaaa tataatatta
    13561 tttattatat aataatatta attttaataa gttataatat atatttataa agtatgcaga
    13621 atacattatt aagaacatat attaattcac cgttagaaca atttgaagtt aagctatttt
    13681 taggtttaaa tacaccattt attgatttaa gtggtttaaa tattacaaca tttacattat
    13741 atactattat tgtattatta gtagtatcat cattatatgt attaagtaat aataataata
    13801 aaattattgg ttcaagatga ttattatcac aagaagtaat ttatgataca attttaaata
    13861 tggttaaagg acaaattaaa ggtaaagatt gaggatatta ttttccattt atttatacat
    13921 tatttatgtt tattttaatt tctaatttaa ttagtatgat tccttattca tatgctttaa
    13981 cagcacaatt tgtatttatt atttcattaa gtatgattat ttgattaggt attactattt
    14041 taagtttatt taaacatggt tgagtattct tctcattatt tgtaccatca ggtacagctt
    14101 tacctttagt acctttatta gttgtaattg aattattatc ttatgttgct agagctttct
    14161 ctttaggttt aagattatct gctaatatct tctctggaca tttattaatg gctatcttag
    14221 ctggtttaac tataactttt gtacaaatta atatctttac tttaatttta ggatttatcc
    14281 ctttagctat tatcttaatt attatgtgct tagaatttgg tattgctatt atccaagcct
    14341 acgttttctc tatcttagcc tcttcttact taaaagatgg tttatactta cattaattta
    14401 tataatacaa ataaattaat tatattataa tattctttaa ttaattatta ttaataataa
    14461 taatataagt aattattata taaaatatta tatacattat ataataataa tttataaaaa
    14521 aaagtatata ttaataataa taataaaata ataattatat aaatatatat atatatatat
    14581 atatattaat tatttaaata tataataaag attataaaaa atataatatt atgcaattag
    14641 cattagccgc aaaatatatt ggagctggaa tttcaacaat tggattaatt ggagcaggta
    14701 ttggtattgg tatcgtattc gctgcattaa ttaatggagt ttcaagaaat ccatcattaa
    14761 aagatacatt attctcatat tctattttag gaatggcttt atcagaagct acaggattat
    14821 tctgtttaat gatctcattc atgttattat tcgctgttta ataataataa tgtttactat
    14881 taatatagta atattataat attcttaata aataaatatt taaatatata aataaatatt
    14941 ataatatata ttataataat atatactaat taatatatat taattatatt aataatatat
    15001 atatataatt attaaatata ctaattatat atttaatata ttatataata ctaattatat
    15061 atttaatata ttatataata ctaattatat tttataatat atatataata atatataata
    15121 tttaatatat taaataatat atataatatt tattatataa ataatatata aatattaatt
    15181 tatataaaat aatatataaa tattaattta tattcaataa tatataaata taaatttatt
    15241 attaattatt taataatatt aataataata ataattattt tattagttta tatatatgta
    15301 tgtatatttt attttttaag gaaatagata taagtaatat ataaaggaca cgaaagtcta
    15361 aaaagattaa gaaagtataa attatgttaa atttattaaa tacattattt ttaaatgtta
    15421 ttagtaatga tgtgccaaca ccttatggta tttattttca agattcagct acacctaatc
    15481 aagaaggtat tttagaatta catgataata ttatgtttta tttatttatt attttaggtt
    15541 tagtatcatg aatgttattt acaattgtta aaacatattc aaaaaatcct atggcatata
    15601 aatatattaa acatggacaa actattgaaa ttatttgaac tatgtttcca gcagtaattt
    15661 tattaattat tgctttccct agtttcattt tattatattt atgtgatgaa gttatttcac
    15721 cagctatgac tattaaagct attggatatc aatgatattg aaaatatgaa tattctgatt
    15781 ttattaatga taatggtgaa ctaattgaat ttgaatcata tgttattcct gatgatttat
    15841 tagaagaagg acaattaaga ttattagata ctgatacttc agtagtagta cctgttgata
    15901 cacatattag atttgtagta acaggagctg atgttattca tgattttgct attcctagtt
    15961 taggtattaa agtagatgct aatcctggta gattaaatca agtatcagct ttaattcaaa
    16021 gagaaggagt attctatgga caatgttcag aattactgcg gtgttaatca tgctgccatg
    16081 cctattaaaa ttgaagctgt atcattacct aaattcttag aatgattaaa tgaacaataa
    16141 ataaataaat atatatatac actatatatt tatatataat attcttattt tatatatata
    16201 agtaataata gcctttatag cttagtggta aagcgataaa ctgaagattt atttacatgt
    16261 agttcgattc tcattaaggg cattaatata agtagatata atttaatcgg taaaatgtat
    16321 gtttttaggt acatattatc taagttcaaa tcttagtatt tacaaataaa taaaaataaa
    16381 aaggaggtgt tgtttaaagg ttaagctatt agattgcaga tctacttatt aagagttcga
    16441 ttctcttcat ctctttataa tatatacatt aggatattag cttaattggt atagcattcg
    16501 ttttacacac gaaagattat aggttcgaat cctatatttc ctacatttaa taatatataa
    16561 taatattatt aattaattaa attataatat atataatata taatatgaat tatatataat
    16621 tataatatta tattaaatat atattttata tatatattta atttttatta atatattaat
    16681 atatatatat gtatattatt gtatatatat atatatatat ttaaagatat taaatttata
    16741 aatttattaa aataaatgac acatttagaa agatcaagac atcaacaata tccatatcat
    16801 atggtattac catcaccatg accaatgtta ttatcatttg cattattatc attaacatta
    16861 tcattaggat taacaatgca tggttatatt ggtaatatga atttagtata tttagcatta
    16921 ttagtagttc tattaacaag tgtattttga tttagagatg taattgcaga agcaacatat
    16981 ttaggtgatc atacaattgc agttagaaaa ggtattaatt taggtttttt attatttgta
    17041 ttatcagaag tattaatttt tgcaggttta ttttgagcat attttcattc agcaatgagt
    17101 ccagatattg tattaggagc tagttgacct ccagtaggaa ttcaagcagt acaacctaca
    17161 gaattacctt tattaaatac tattatttta ttatcatcag gtgctactat tacatatagt
    17221 catcatgcat taatttgtag aaatagaaat aaagctttat caggtttatt tattactatt
    17281 tgattaatta ttatttttgt aacttgtcaa tatattgaat atactaatgc tgctttcact
    17341 attagtgatg gtgtttatgg atcagtattc tatgctggta ctggtttaca tttcttacat
    17401 atggttatgt tagctgttat gttaattatt tgttattgaa gaatgagaac atatcaattc
    17461 acatctactc atcatgtagg ttttgaaact actattttat attgtcatgt attagatatt
    17521 atctgattat tcttatatat cgtattctat tgatgaggtg tataatataa tataatatat
    17581 ataatattct ttattattat aagtaattat atatagctat tttggtggaa ttggtagaca
    17641 cgatactctt aagatgtatt actttatagt atgaaggttc aaatccttca aatagcatat
    17701 cttaataatt atatgagtcg tagactaata ggtaagttac caaaatttga gtttggagtt
    17761 tgtttgttcg aatcaaaccg attcaatatt aattattaat ataaaatata ttttatagag
    17821 agtattgttt aaaggtaaaa cagttgtctt ttaagcaacc catgcttggt tcgaatccag
    17881 ctattctcaa ttaatatata tatataacat tatagctctc ttagcttaat ggttaaagca
    17941 taatacttct aatattaata ttccatgttc aaatcatgga gagagtataa gtaataaaat
    18001 aaaatagata taagttaatt ggtaaactga atgtcttcca cacattgatt gtgagttcga
    18061 ttctcactat ctatatattt taatggatcc atagcttaat agtaaagtcc tattttgtca
    18121 taatagagga tgtcagtgca aatctgattg gattcgttat atatatatat aaatatatag
    18181 gaaaattcac cataggtaag gtaaattatt tgctatgtaa ttgaatttat tattcttatg
    18241 agttcgaatc tcatattttc cgtcttatta tataaataaa ggatggttga ctgagtggtt
    18301 taaggtgtga tatttgagct atcattagtt ttaataaact acgtaggttc aaatcctaca
    18361 tcatccgtaa tatataatat atatatataa gtaaggaata ataaataaat aataaagaac
    18421 atgatgttgg ttcagattaa acgctaaata aggacatgac acatgcaaat caaacattta
    18481 ttattgataa aataataaat atgtggtgta aacgtgagta ataatataag aattaatgaa
    18541 ctataaaata gattaaatat ctaataaata tatatatata atatatatat atatattaaa
    18601 taaatattta tttaaagtat aatatttgtt tatagtcaag cttataatag tttaggtagt
    18661 aggttaatta atagtttata acctagccaa cgatctatag ttaataatga aagttataat
    18721 aaccacgttg actttgaaat atagtcaata tctataagat acagcagtga ggaatattga
    18781 acaatgatcg aaagattgat tcagttactt attagaacaa tatataataa tatttattaa
    18841 tatataatat taatatataa aatatatata taaattgatt aaaaataaag ttcataaata
    18901 gtttaaataa tgatataaac taatctttta ttaataaaga tatatattta agttattatt
    18961 atttaataat tttaatttaa atatatttta atagtcctaa ccaaaatttg tgccagcagc
    19021 tgcggtaata caaagagggc tagcgttaat cataatggtt taaaggatac gtagaattaa
    19081 tataatataa aattatattt agagttaata tatattaatt aaagaattat aatagtaaag
    19141 atgaaataat tatgataatt ataagactgg tatatgtgaa aatattaatt aatttattaa
    19201 ctgacattga ggtattaaga ctagagtagc gaaacggatt cgatacccgt gtagttctag
    19261 tagtaaacta tgagtactat atattataat atatatattt ataatatata catgaaaatg
    19321 taagtattcc acctgaagag tacgttagca ataatgaaac tcaaaacaat agacggttac
    19381 agacttaagc agtggagcat gttatttaat tcgataatcc acgattaatc ttaccatatt
    19441 ttgaatattt atatatatat aataatatat atataattac aggcgttaca ttgttgtctt
    19501 tagttcgtgc tgcaaagtct tagattaagt tcattaacga acacaactcc atatatataa
    19561 taatatatta tatataatta atataattta ttataaatta tattataaag gaattaagac
    19621 aaatcataat gatccttata atatgggcta tagacgtgct ataataaaat gataataaaa
    19681 ttatataata tataataata ataaaattat atataattaa taatataaaa cattttatat
    19741 ttttatatat ttttatataa tatataatat gaattataat ctgaaattcg attatatgaa
    19801 ataagaattg ctagtaatac gtaaattagt atattacggt gaatattcta actgtttcgc
    19861 actaatcact catcacgcgt tgaaatatat tattatctta atatataata acatatctat
    19921 atttttatat aaataaatat atattaatat aatatataat tatatagttg aaataatatt
    19981 aattaatgcg aagttgaaat acagttactg taggggaacc tgcagtggga ttataaaact
    20041 ctttaatatt ctttataaat aaa
//
DBGET integrated database retrieval system