GenomeNet

Database: RefSeq
Entry: NC_005782
LinkDB: NC_005782
Original site: NC_005782 
LOCUS       NC_005782             693414 bp    DNA     linear   CON 14-SEP-2017
DEFINITION  Eremothecium gossypii ATCC 10895 chromosome I, complete sequence.
ACCESSION   NC_005782
VERSION     NC_005782.2
DBLINK      BioProject: PRJNA10623
            BioSample: SAMN03081415
            Assembly: GCF_000091025.4
KEYWORDS    RefSeq.
SOURCE      Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895)
  ORGANISM  Eremothecium gossypii ATCC 10895
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Eremothecium.
REFERENCE   1  (bases 1 to 693414)
  AUTHORS   Dietrich,F.S., Voegeli,S., Brachat,S., Lerch,A., Gates,K.,
            Steiner,S., Mohr,C., Pohlmann,R., Luedi,P., Choi,S., Wing,R.A.,
            Flavier,A., Gaffney,T.D. and Philippsen,P.
  TITLE     The Ashbya gossypii genome as a tool for mapping the ancient
            Saccharomyces cerevisiae genome
  JOURNAL   Science 304 (5668), 304-307 (2004)
   PUBMED   15001715
REFERENCE   2  (bases 1 to 693414)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 693414)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 693414)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2007) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 693414)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2002) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE016814.
            On Aug 5, 2010 this sequence version replaced NC_005782.1.
            This genome has been completely resequenced to high accuracy (derf)
            and reannotated. Gene names have been maintained, though some genes
            have been added, and many protein sequences have been corrected.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..693414
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /culture_collection="ATCC:10895"
                     /db_xref="taxon:284811"
                     /chromosome="I"
     source          3065..58136
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 1087"
     source          43901..90510
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 2402"
     source          81769..144133
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 1691"
     source          139741..216782
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 1057"
     source          209191..272642
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 1719"
     source          243125..310752
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 1131"
     source          272646..345488
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 1409"
     source          343611..404120
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 1225"
     source          399219..464416
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 1479"
     source          449530..533207
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 1475"
     source          516353..602441
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 1529"
     source          588526..653755
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 1415"
     source          638852..687828
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG 2436"
     telomere        complement(1..552)
                     /note="Chromosome I left end terminal telomere repeat.
                     Composed of an estimated 20 copies of a 24 base repeat
                     unit, and occasionally sequence variants of this repeat."
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_type=terminal
                     /rpt_unit_range=62..85
                     /rpt_unit_seq="ggtgtggtgtatgggtctctcagc"
     telomere        complement(553..3909)
                     /note="Chromosome I left subtelomeric sequence. Shares
                     some sequence similarity with other subtelomeric regions."
     misc_feature    3910..4261
                     /note="Pseudo - mitochondrial 21S rDNA fragment"
     gene            <8108..>9067
                     /locus_tag="AGOS_AAL186W"
                     /old_locus_tag="AAL186W"
                     /db_xref="GeneID:4618437"
     mRNA            <8108..>9067
                     /locus_tag="AGOS_AAL186W"
                     /old_locus_tag="AAL186W"
                     /product="AAL186Wp"
                     /transcript_id="NM_207709.1"
                     /db_xref="GeneID:4618437"
     CDS             8108..9067
                     /locus_tag="AGOS_AAL186W"
                     /old_locus_tag="AAL186W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR274C (RCE1)"
                     /codon_start=1
                     /product="AAL186Wp"
                     /protein_id="NP_982356.1"
                     /db_xref="GeneID:4618437"
                     /translation="MFPSSATLLSFYAATSYVAALYVFPGRRIYGHASRNDPKAIWYG
                     MKAVGCGVLANLLIIPWLQSRLASDGFSFVDCFFRLGLVPGAYAHFRGLHWDTLAYAT
                     DILRALSILGSLYAADLLDSAAYYLLVPDTSPVVDLVDRLSCTTGLRNYVFGPITEEL
                     VYTSMVLQNYRLLQPTISRAMLLLATPMFFGVAHVHHARQLLATGHRPAQVALTSSFQ
                     ILYTTLFGTFTNYIYYHTAGNLWACILLHAVCNYLSFPSLSSDVFADYCAKVPPALRA
                     LWKMRLLHAWGYTYRLCLLCGLLAFLDGIRTFSSSAGDLFLDA"
     gene            <9537..>12593
                     /locus_tag="AGOS_AAL185W"
                     /old_locus_tag="AAL185W"
                     /db_xref="GeneID:4618662"
     mRNA            <9537..>12593
                     /locus_tag="AGOS_AAL185W"
                     /old_locus_tag="AAL185W"
                     /product="AAL185Wp"
                     /transcript_id="NM_207710.1"
                     /db_xref="GeneID:4618662"
     CDS             9537..12593
                     /locus_tag="AGOS_AAL185W"
                     /old_locus_tag="AAL185W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML109W (ZDS2) and YMR273C (ZDS1)"
                     /codon_start=1
                     /product="AAL185Wp"
                     /protein_id="NP_982357.1"
                     /db_xref="GeneID:4618662"
                     /translation="MKADYTARASKTRGGQKVGGVRRESAGQGMSMSEDEFQAAQVRQ
                     RRSKSCAGPLEGVQERVLRAHTRQAKEKRKSEVLIAAQSLDYELQNVKNLKRISIGSM
                     DLLMDPEMEFRMNGAAVSPSASPRNSLTEESLEWFQLSAEQEQGGELPLHAESIDAHS
                     SAGGSSDTARDELLTSASSVVPSEELSCSHPLSPPAAAKKSTLMSSRSKLGRQHTDTT
                     HTKQATGEPFSSNLLWVRADQHPNVKPENYLELVHDTLNNLRIGARHGRGDSPVQQSN
                     TPVANGESSTASARSLVRKQSRLRKSFTEVEAIEESQFTDSIGSEIPVGKRMRVSSLK
                     EITEELTRISNNAGLTDSDAITLARTLGIGSQSADEHATFSECVPSAEAEENEYASSI
                     LAKNGLAIPARSSLRRSKFTTYRIRSAGSDSSPPENKSTSSSSLAAAYERNSRSPKMQ
                     KAAFKGSHPRLSGENTSLAPQSPNSINDIYDHYNTSDTDDGSPELQGSPVTHTSDASF
                     TSSPNIASGEHCARNAHKISPISVSQLSATSSSSTSPGSSKSAESTKSWTFDQKSPLR
                     SITLNSSTKGHKISAEKKKGWSWFGNSRRPSSESVLLPGTDSEGCPMDESQPIQSEEY
                     PLKHPISPVSDETPRRGNHSRNRHQTSSPEELEIGWTETSLTTLDGDTEQDGKPQHPK
                     TKEKLEKKFMKIFKKRSGTGLSQDTPNQGEESSLKATSRIRRSRESKRQTDEPSASLT
                     TSVSLNNHNNGRKSVSISRPTWQRTESSYNGDKGKGSITSLQPAVSVTSSRDSHEQTR
                     QDPQPQSLVTKMDGSSSNGVTVSSQRAGFSKKGRSKTSHSRSKLSTSHDIAPVDNRPS
                     DVDQKSTEANNTLSSRAEDSHPSLDPGKSALGPGEIAHSLPPRKLRFDDVLRPEKPNS
                     PMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSHLKLSDPKRELRQQVLLS
                     NFMYSYLNLVNHSLYLQQIEEDKNQGIQFESTDNMASSSGVVPEKW"
     gene            <12906..>13244
                     /locus_tag="AGOS_AAL184W"
                     /old_locus_tag="AAL184W"
                     /db_xref="GeneID:4618412"
     mRNA            <12906..>13244
                     /locus_tag="AGOS_AAL184W"
                     /old_locus_tag="AAL184W"
                     /product="AAL184Wp"
                     /transcript_id="NM_207711.1"
                     /db_xref="GeneID:4618412"
     CDS             12906..13244
                     /locus_tag="AGOS_AAL184W"
                     /old_locus_tag="AAL184W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML108W"
                     /codon_start=1
                     /product="AAL184Wp"
                     /protein_id="NP_982358.1"
                     /db_xref="GeneID:4618412"
                     /translation="MATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQV
                     DDLEVLNTWFDKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ
                     LDEDSSSDAK"
     gene            <13713..>14846
                     /locus_tag="AGOS_AAL183W"
                     /old_locus_tag="AAL183W"
                     /db_xref="GeneID:4618594"
     mRNA            <13713..>14846
                     /locus_tag="AGOS_AAL183W"
                     /old_locus_tag="AAL183W"
                     /product="AAL183Wp"
                     /transcript_id="NM_207712.1"
                     /db_xref="GeneID:4618594"
     CDS             13713..14846
                     /locus_tag="AGOS_AAL183W"
                     /old_locus_tag="AAL183W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR272C (SCS7)"
                     /codon_start=1
                     /product="AAL183Wp"
                     /protein_id="NP_982359.1"
                     /db_xref="GeneID:4618594"
                     /translation="MVSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPG
                     GDQYILDYAGKDITAVLKDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHV
                     MEVTPENLDTTTFVKELPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDF
                     YIDQIHRPRHYGKGSAPLFGNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLA
                     LTCFAAGVFVWTLIEYSLHRFLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVM
                     PPALFVVLCAPFYRLVFSIFPEYCACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKL
                     KKYHLEHHYKNYELGFGVTSWYWDKVFGTYLASNSPVSRPKCE"
     gene            15918..16028
                     /locus_tag="AGOS_t0001"
                     /db_xref="GeneID:4618626"
     tRNA            join(15918..15955,15985..16028)
                     /locus_tag="AGOS_t0001"
                     /product="tRNA-Leu"
                     /codon_recognized="UUG"
                     /db_xref="GeneID:4618626"
     gene            <16155..>19850
                     /locus_tag="AGOS_AAL182W"
                     /old_locus_tag="AAL182W"
                     /db_xref="GeneID:4618598"
     mRNA            <16155..>19850
                     /locus_tag="AGOS_AAL182W"
                     /old_locus_tag="AAL182W"
                     /product="AAL182Wp"
                     /transcript_id="NM_207713.1"
                     /db_xref="GeneID:4618598"
     CDS             16155..19850
                     /locus_tag="AGOS_AAL182W"
                     /old_locus_tag="AAL182W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL074C (SMC3)"
                     /codon_start=1
                     /product="AAL182Wp"
                     /protein_id="NP_982360.1"
                     /db_xref="GeneID:4618598"
                     /translation="MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAA
                     IRFVLSDDYTNLKREERRSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRR
                     TVGLKKDEYMINNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQL
                     LEEVIGAKSFERKLKESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSL
                     DRKRKMCQFALYDRELNEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSL
                     NQLGSELKMKESTDLQQAKDSELELAKHLADLNVKYEELISQNNALKEQSASNSESLL
                     AIRSQIAVKEQQLARLSPRFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKA
                     ERDAWIDQELSILKEELQCSSIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGIN
                     AELEDVQQELTVLKKAHLFKIDERKQLWRSEQKIQSVLESLVDDVKRAEGTLSETMDR
                     SLATGLKNVSEIAQRLNLPEGSVFGPLGELIKISEKYKACAEVVGGTSLFHVVVDTEN
                     TAALLMQELYNSKGGRVTFIPLNRVHVDSNIVYPSNDEHHCTPLIKKIKYDPKFERAI
                     KHVFGKTIVVKDLNQGTKLAKQFRLNAITLDGDKADSRGVLTGGFHDHHKQKRLDSMR
                     DLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDELNDKIKKSMSRREMILTQVEAVNIKL
                     EKAKRERFLLEETMVQLISKEEKAKINQKLLQDKLDMYTEDLSRDFDTELTLTEREEL
                     DEIAKKLPDLENLLNTTTDALSSVVVKIDSLKAELDSKLKPQAKELEDQPNEIMSTTA
                     IQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDTLKSRQEEEEKSLEKANSQQR
                     ALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRDIGLLPDDSADKYHNMSSSELLK
                     ELSSINDKISKMTNVNKRALENFKKFDDKQKDVMKRAKELDESKESIEKLIDKLKKQK
                     VEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEPSKPSKRQQKKRKRQETEDV
                     HFNDDQDENSSQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVD
                     PAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFYRVNFEN
                     KISTVVEVTKAEALNFVTGREKNENVI"
     gene            complement(<20056..>23721)
                     /locus_tag="AGOS_AAL181C"
                     /old_locus_tag="AAL181C"
                     /db_xref="GeneID:4618776"
     mRNA            complement(<20056..>23721)
                     /locus_tag="AGOS_AAL181C"
                     /old_locus_tag="AAL181C"
                     /product="AAL181Cp"
                     /transcript_id="NM_207714.1"
                     /db_xref="GeneID:4618776"
     CDS             complement(20056..23721)
                     /locus_tag="AGOS_AAL181C"
                     /old_locus_tag="AAL181C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL076W (NET1) and YKR010C (TOF2)"
                     /codon_start=1
                     /product="AAL181Cp"
                     /protein_id="NP_982361.1"
                     /db_xref="GeneID:4618776"
                     /translation="MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPISTSS
                     IAGGRGEFSSGIGNTSANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEK
                     CAKMYPGLAEEPEIVTLQDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLDEAAGDRTI
                     YMKKRKLNTGAAGVPAAGGSVQAAVLNVAKKRASIKTSALRVSTPLANQIYPPPTKKQ
                     VNSDFEDDDVADKSILPPPPPQSPPIRISSGMDQKRINMNDNAVSKSETVDPNKSRQQ
                     RLPSGTPMRPVSMVETPNRVSLTGPTVLSESTVSQKSTATPIITNIRITSGMLRIPEP
                     RLSEVEKELKEGPASPAVDLPARPSRIPMKKPYNPSMQQDEDLSSSSSSTEDNVPAVP
                     YENELERSGPTMATRQSSSTIADDQGSPTKKSRFEKNNIGLVELPSPRKSSLEKKVSK
                     LNKGLASDKGHEDSTGGITRKDHFSDEESEASQNGSVVVNRPETQREKSFQKSELLKI
                     FNSKRFDLPPRFKNSASEDEPTSSNQSRKKKPYVTVLNKDIDNSSPDPRNIIPRRTQR
                     HAAQKAAQSISSGTSRSNVFSGEEKNKYSEENQGDNIASDDNEGVYVHESNALKKLNV
                     HPLKESVVQDTLTGAQDINNPVSSRTVHPSISEHAVTAAASGTLSSNPEYRVAPIVTP
                     TLMSSAVPGKPEAILSKQGDPPASTALKPQLAPARKVESTQKKQAGKKSDTNQPSRTN
                     SKKTGLPADTAVPSSQKTVRARAAQIDAQIKQTATSSQSPVAESQSSVLNSEEAVADK
                     SEVDNNSSTQDKSLQQKTSKRKTPVKRTANADKKAVTLKRSSNSKGKEKDTEKGKERI
                     KEKEKEKEKEKEKEKEKVYQTPEFVESSDDERADAKTPLEKHSSDRPKSGSPSKHENG
                     QEKQDSFSGIILKKTAIEKDKVVANAPHKVNEKPMTADAGSTNLSPSGKVSKLDELRS
                     KFTKGRFPQGSSQKQIQQQKNTPKTSSKSIVPTVSDKFKPMDSTSGASSDDSADDDDD
                     DSMDSSTEDEGISMKKPRRGIVQPPKGSVSAPVKHVPQSLSSELEGVPQSTQIPNEAT
                     NTAPLTKLLDHISPPSTAKTITSRGVTESKGTSNRSLSSLSDLASRGVPDVREKGVNY
                     KKTAPNVVNNSSSDESEQETNDGSDSSDSDNSDSDSSDSSDDGNNFISAKSASKALRK
                     NKASSGFASLIRDSQKK"
     gene            complement(<23977..>24870)
                     /locus_tag="AGOS_AAL180C"
                     /old_locus_tag="AAL180C"
                     /db_xref="GeneID:4618415"
     mRNA            complement(<23977..>24870)
                     /locus_tag="AGOS_AAL180C"
                     /old_locus_tag="AAL180C"
                     /product="AAL180Cp"
                     /transcript_id="NM_207715.1"
                     /db_xref="GeneID:4618415"
     CDS             complement(23977..24870)
                     /locus_tag="AGOS_AAL180C"
                     /old_locus_tag="AAL180C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR011C"
                     /codon_start=1
                     /product="AAL180Cp"
                     /protein_id="NP_982362.1"
                     /db_xref="GeneID:4618415"
                     /translation="MGSLQAREMEELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRV
                     QDRYTLRLGTVETITGNLKIGCDTHADCEACPFYILEYNEVTTEYSLWKAADADWRLD
                     SIVATMYTGAGGPARERGGLPRELQGLREGLDMEYVWDCLRRLNLPLEQIDWAEFREL
                     LESMLAAKRVADDDCVTLRGVVALAALQATVQTSKRAVRSQLRAYDRRVRAASTPAST
                     RTSSPESLLPADSRESSVSSVHYTYGLPATQLDANFKTYFRSMAENFELFEEPALALR
                     GRVAKPRKKAAGRHGHRPVQA"
     gene            <25509..>26591
                     /locus_tag="AGOS_AAL179W"
                     /old_locus_tag="AAL179W"
                     /db_xref="GeneID:4618551"
     mRNA            <25509..>26591
                     /locus_tag="AGOS_AAL179W"
                     /old_locus_tag="AAL179W"
                     /product="AAL179Wp"
                     /transcript_id="NM_207716.1"
                     /db_xref="GeneID:4618551"
     CDS             25509..26591
                     /locus_tag="AGOS_AAL179W"
                     /old_locus_tag="AAL179W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL079C (PRY1)"
                     /codon_start=1
                     /product="AAL179Wp"
                     /protein_id="NP_982363.1"
                     /db_xref="GeneID:4618551"
                     /translation="MQISAVALSGAALLACASAHQHDRKKPHLVVVYGDVYVSGTDTF
                     TKYYSKMTDKLPASGSDGWSYSWSTATSWTSDSVSTEPSAEPTSTEPTNLPEVTSSPA
                     TPVQPTSAPEETFEEPTESTSAEPTSSPEPVKSAEPTSSPEPVKSVEPTSSPEPVKSV
                     EPVKSAEPVKSPEPVKSPEPVKSPEPVKSPEPVKSAEPTSSPEPTGSPQRSRPAGGQN
                     GASFEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGEN
                     LAVGYPTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSV
                     GDYLICSYDPAGNFLRRFGENVAPIA"
     gene            <26881..>27498
                     /locus_tag="AGOS_AAL178W"
                     /old_locus_tag="AAL178W"
                     /db_xref="GeneID:4618520"
     mRNA            <26881..>27498
                     /locus_tag="AGOS_AAL178W"
                     /old_locus_tag="AAL178W"
                     /product="AAL178Wp"
                     /transcript_id="NM_207717.1"
                     /db_xref="GeneID:4618520"
     CDS             26881..27498
                     /locus_tag="AGOS_AAL178W"
                     /old_locus_tag="AAL178W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL079C (PRY1) and YKR013W (PRY2); Tandem gene duplication
                     in Ashbya gossypii"
                     /codon_start=1
                     /product="AAL178Wp"
                     /protein_id="NP_982364.1"
                     /db_xref="GeneID:4618520"
                     /translation="MRACLLIPLLLVAATARTVTVSVTATRTVTVISAAAVTTLRTTV
                     FTTAYRTQTTPLTETPLSRPTAVNNTFASAVLDLHNDYRRRHHAVPLRWNSTLYTHAQ
                     HYANRILCNGSLVHSGLPHGENLALGYSPAAAVTAWYDEIAEYDFSTPGFSHATGHFT
                     QLVWRSTTSVGCAYVMCGPCYGLYIICQYDPPGNVADQYVANVLP"
     gene            <27774..>31370
                     /locus_tag="AGOS_AAL177W"
                     /old_locus_tag="AAL177W"
                     /db_xref="GeneID:4618666"
     mRNA            <27774..>31370
                     /locus_tag="AGOS_AAL177W"
                     /old_locus_tag="AAL177W"
                     /product="AAL177Wp"
                     /transcript_id="NM_207718.1"
                     /db_xref="GeneID:4618666"
     CDS             27774..31370
                     /locus_tag="AGOS_AAL177W"
                     /old_locus_tag="AAL177W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL080C (SCP160)"
                     /codon_start=1
                     /product="AAL177Wp"
                     /protein_id="NP_982365.1"
                     /db_xref="GeneID:4618666"
                     /translation="MESQAAVEEPQHSVVIETPPTTAESSETPVADTATGAEPEGAGG
                     AAVVAPKRMPTRADFPPLSSVIFETQKVQWGPNMKKPESQSASPSPSPGPVGSGAKPM
                     RSKTMQEAFSLDLQTQVTISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTN
                     VYNAKRELVKKLTRPVTVVIQVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTAEA
                     DAYDADLDDQLINISLHGDVASVNFAKDKILSIVKEETKNATISVAVENKQLIPFISL
                     ADVEISEDVTVKAFPNGSEKIVLMGPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRK
                     FQPLIDAEDVREKYKVSVIFPTALGDDTVSFYGLSANLDDAIAYARQSSKQYIVESLE
                     VSKAHGKNVAHAKNLMFYFAKYDILKDIKESFKEVKLVLPTPEELPGLDNVSINIISK
                     ADIAEQTKTVRKQIINIVNRLTPSHVLAVDDLDYELFHKDIKQALSKAEIPFVQLGDH
                     YEGDNTVLLFAKVDEEDFQPSPEEVKEHLEKVAAVLDEVRTKQSKLFTKIVNFDAEFQ
                     VLHFSDDSVTWNLVLENITSAGGHAQIKLHTPSEDEITIRGDEKAVKAAVKAFESIAE
                     NPSKKSKLTVSVPANTVSRLIGPKGTNLAQIRQKFDVQIDVPSESNDTNTEITLTGLE
                     YNLQHAKTHIASEAKKWADITTKELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQFPK
                     EGEVVTIKGPSRGVNKAHAELKALLDFEIENGHKSVINVPVEHVPRVIGKNGDVINGI
                     RAELGVELKLLQNTKTAKEQNLDTVQLEITGSRQAIKEASKAVDAIIAEASDFTTKQL
                     EIDAKYHKLIVGPGGSTLKDFISKAGGDDIRNKTVDVPNAESTNKVITISGPKTFVEK
                     MSKALNQIVQDIKASVAKELNIPADRQGALIGPGGSVRRQLESQFNVRIEVPDKGKEG
                     KVTIHGRPEAVEKCEKEIFSTIIRDSYDQEIMVPAVYHAFVSERGQLINKLRMTYFIN
                     VKHGNSSKKANKLSRSEQPIPIERVRGSEGEGTKLTIEEVSAPEASANDNIPWRLTYE
                     HVDLSDILGEEGKHAMTKEQALEAAADQIKERIELAPKANCIGYLWCENVKKFNKVVG
                     PGGSNIKQIRETTNTLINVPKKSDKVSDIIYVRGTKESVEKACKMICDALNK"
     gene            complement(<31588..>32205)
                     /locus_tag="AGOS_AAL176C"
                     /old_locus_tag="AAL176C"
                     /db_xref="GeneID:4618519"
     mRNA            complement(<31588..>32205)
                     /locus_tag="AGOS_AAL176C"
                     /old_locus_tag="AAL176C"
                     /product="AAL176Cp"
                     /transcript_id="NM_207719.1"
                     /db_xref="GeneID:4618519"
     CDS             complement(31588..32205)
                     /locus_tag="AGOS_AAL176C"
                     /old_locus_tag="AAL176C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR014C (YPT52)"
                     /codon_start=1
                     /product="AAL176Cp"
                     /protein_id="NP_982366.1"
                     /db_xref="GeneID:4618519"
                     /translation="MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRT
                     IKLADHDDAMIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVN
                     ELKSKVGDEDLVIFLVGNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTG
                     ILDVFQGIGGKLYEQRRESLAAQPQHSSSIQLQRPTTNDATSCCV"
     gene            <32874..>35525
                     /locus_tag="AGOS_AAL175W"
                     /old_locus_tag="AAL175W"
                     /db_xref="GeneID:4618426"
     mRNA            <32874..>35525
                     /locus_tag="AGOS_AAL175W"
                     /old_locus_tag="AAL175W"
                     /product="AAL175Wp"
                     /transcript_id="NM_207720.1"
                     /db_xref="GeneID:4618426"
     CDS             32874..35525
                     /locus_tag="AGOS_AAL175W"
                     /old_locus_tag="AAL175W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YML099C (ARG81)"
                     /codon_start=1
                     /product="AAL175Wp"
                     /protein_id="NP_982367.1"
                     /db_xref="GeneID:4618426"
                     /translation="MIKDEKDTASARCTPAARNDEALQKKEGSGTAVRRPRAKTFTGC
                     WTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAGEDRDGDG
                     EQPAQPFQRRNIMFVRYDEEYEYYEDMDDELSALHSPPLEMIADHKTWIIKRFGVFKG
                     TDRVKRKYVPRKRRKVNPVFADAMAREHRRKLEEREKQARRKRKGELQGSLGSGNATG
                     AGFAKAGPPAAESAGAMSPVSATPLFDFDFSTPGLVSSEWMAGELKDDTTLSSAMLRN
                     TLSFPTGLSVAQHGDGITADTAPPKSQSSIFPEQTLPLQSAGTMVPPSVDEVSKVYRL
                     LLNNQGTDCNSSTGYKGLSGVHTPYTVDNVAIHGPESRMPASAIESVPSIVPDPTIFT
                     LAEHTNSLIRLPRMGMQIHGLTRFLLSYYQQNVADLMSVVALPKNPWKTIYFPRAVKA
                     LGELGALGYTSHSRNALLNALLAVSCFHLQSKFPKNSKEMKYFVSLGMDFRNQASGFL
                     NACLSSTSRQEHYKDVLTAILSMNSIDVVWGTMSDCQYHLTICEEFIESRMKSRPLLS
                     EKARCLHRIFSFLKLIQDSTALDKVQEKEIIMKDAGDKEFQKNGSSTPPLSTDSSSFT
                     GRYVEQLNKDNGRVCIEFIEKDGQYFDTRGSVPLFNTIVTKSYPHEINETRIDTLSMD
                     VLYGLPNSLILLFSDCVSLVRHRFYFKRHNTAQPTSFGLFCVKIEQRLLSWKPEWIFW
                     KDDSKAEFINDTVEGVYHHTMSFYYGLLIYYFTMARSLEDHTLQNYVQKVLSHLRELG
                     NIIEHKDVKIVPLMWQGFMAGCSCTDSSMQLEFKKWTAQLVNFGIGSYWGARQIMLEV
                     WRRRMTDGKCDNWYSVYCDWEMNLMLA"
     gene            complement(<35718..>37988)
                     /locus_tag="AGOS_AAL174C"
                     /old_locus_tag="AAL174C"
                     /db_xref="GeneID:4618591"
     mRNA            complement(<35718..>37988)
                     /locus_tag="AGOS_AAL174C"
                     /old_locus_tag="AAL174C"
                     /product="AAL174Cp"
                     /transcript_id="NM_207721.1"
                     /db_xref="GeneID:4618591"
     CDS             complement(35718..37988)
                     /locus_tag="AGOS_AAL174C"
                     /old_locus_tag="AAL174C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL001W (DNM1)"
                     /codon_start=1
                     /product="AAL174Cp"
                     /protein_id="NP_982368.1"
                     /db_xref="GeneID:4618591"
                     /translation="MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSI
                     LETLVGRDFLPRGTGIVTRRPLVLQLNNIKADSPLITAYTAEEAEPTLENRLRGQSGA
                     RDTWGEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTL
                     IDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARD
                     VDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVED
                     ALAREEEFFSKHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTE
                     QELASYGGSNIISPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIY
                     NNIFGNSLKSINPTANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPS
                     QRCVELVYEELMKICHNCGSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDI
                     HRAFINTNHPNFLSATEAMADIAEARRQKQQNAKRSADLKKKRQQELEKAAAVGEPTN
                     GNPSPKVDSDSTITSSDSEGEDERDPKQNKDSFLNYFFGKDQQRKDGDDIAPSFSDKQ
                     ERTMDSFFQQEADFMAMETLKIQDTVAAPVEAEHPELTEREELECELIRRLIISYFGI
                     VREMVEDQIPKAVMCFLVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIK
                     LLEGYKQASVIIGDIL"
     gene            complement(<38265..>39527)
                     /locus_tag="AGOS_AAL173C"
                     /old_locus_tag="AAL173C"
                     /db_xref="GeneID:4618402"
     mRNA            complement(<38265..>39527)
                     /locus_tag="AGOS_AAL173C"
                     /old_locus_tag="AAL173C"
                     /product="AAL173Cp"
                     /transcript_id="NM_207722.1"
                     /db_xref="GeneID:4618402"
     CDS             complement(38265..39527)
                     /locus_tag="AGOS_AAL173C"
                     /old_locus_tag="AAL173C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL002W (RTT109)"
                     /codon_start=1
                     /product="AAL173Cp"
                     /protein_id="NP_982369.1"
                     /db_xref="GeneID:4618402"
                     /translation="MGLKELLAEALPAGHDFDVLHLQSPATERPPLTEASGCSPTTIA
                     AQHFFTLSNNSKVFYALQVVVYICIEGTSGDRMLFVSKADTNGYCDVRVDVRRATRAL
                     LQFLLSIDPSHYLQRVRRMRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAA
                     DRARYTSFPCPPQYTTRLALFTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDL
                     LVTLFDPATDAALLIPGEDSAVTAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPD
                     DPKGRFLDDLAHEGRNPSLRAFWTELVARQEFRLGVVVGVVGAAGLYTGPCARPAPED
                     LLCPASPADYVHVKHYVTAEEYATAAGASEAHRNLVDCLLLRYGVAMPRVRGAHSTTP
                     RPAPTQDATKRPAVNDLTARCVRKKPRC"
     gene            complement(<39647..>40350)
                     /locus_tag="AGOS_AAL172C"
                     /old_locus_tag="AAL172C"
                     /db_xref="GeneID:4618797"
     mRNA            complement(join(<39647..40229,40286..>40350))
                     /locus_tag="AGOS_AAL172C"
                     /old_locus_tag="AAL172C"
                     /product="AAL172Cp"
                     /transcript_id="NM_207723.1"
                     /db_xref="GeneID:4618797"
     CDS             complement(join(39647..40229,40286..40350))
                     /locus_tag="AGOS_AAL172C"
                     /old_locus_tag="AAL172C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL001W (PRE3); 1-intron"
                     /codon_start=1
                     /product="AAL172Cp"
                     /protein_id="NP_982370.1"
                     /db_xref="GeneID:4618797"
                     /translation="MDGIQVDINRLKKGEVSLGTSIMAVKFRDGVILGADSRTTTGTY
                     IANRVTDKLTRVHDRIWCCRSGSAADTQAVADMVQHYLELYTMQYGEPSASTAASLFS
                     TICYENKDHLTAGIIVAGYDDKNKGEVYSIPLGGSVHKAPYAIAGSGSTFIYGYCDKH
                     FREDMSKEETIDFMKHSLSQAIKWDGSSGGVIRMVVLTEAGAERLIFYPEDYENL"
     gene            <40611..>43586
                     /locus_tag="AGOS_AAL171W"
                     /old_locus_tag="AAL171W"
                     /db_xref="GeneID:4618568"
     mRNA            <40611..>43586
                     /locus_tag="AGOS_AAL171W"
                     /old_locus_tag="AAL171W"
                     /product="AAL171Wp"
                     /transcript_id="NM_207724.1"
                     /db_xref="GeneID:4618568"
     CDS             40611..43586
                     /locus_tag="AGOS_AAL171W"
                     /old_locus_tag="AAL171W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL003W (SFI1)"
                     /codon_start=1
                     /product="AAL171Wp"
                     /protein_id="NP_982371.1"
                     /db_xref="GeneID:4618568"
                     /translation="MDDSAPSASSDGTMLPDISYAGTMEELGYSTNDLIASDAHYSTG
                     SLVHKSIQELMQNLKISRNRRYFEPSLTGQEPEYIYWDNNFLQRSSGLSNQAVLSPLF
                     EEPYEDHSGGGGGGGDGGGVEDEQDTVLQRLYNMVQVFLVRHGLSLDFAKVLKKYVAL
                     LHEGGSEPLQDQYILALQNELQQSYELSPIMDSILTAFLLRPENIPMKLALVEYRHQL
                     QLVRKWFLSWRLKWNITTNLGVCESIWGNYLLKKYLYRWTEKYKLVAEYWEEDASNAD
                     ELRLTASMFDTWAKQYSIRKTKEKMADNFHVVDYVERFRSRYMRMTECNDKAEVFHAH
                     NLKTKFLARWRLAGRTKSVAPVFTVLTQRMTLAKVLQHFNSMNELNSFGCFAEKALTL
                     RPLLIKWVSRLQRQDIQQRQLDAAELTFVKKKAYKIWRKQFHYRLSELHLQATLDNNL
                     LEFIFNRVWSIRYTERKMLYQVLSDKNKLLMKKQFSAWRLTTSLKVKSETQRNSNVAK
                     KALRALILGAKLQQHNKLTEVKLISSYLSVWRKRHTEEQNVRVVGKMLVQRYWEHEFK
                     RKYLAFDDLNYITDKSYHSHLVKLMFSCWQQAYARKAVLYDKASLFQRLKAAQRLKKA
                     VAKIDAVRFRETYYDDIVSNIYLKRYVDVWRQNASIRKDVRLEIILDNYECKNNVKLK
                     RRFLRKMKERWSFYSNECVRVANRKNRRDMGKLLLSRIIGKMELRKLWLKQAGRLRSS
                     MLLLNGFMYWLDRMDKIQQLYAVVQLKVEEKDVNLVVKCISKWNMKTLKFKRNEETGQ
                     MFRSRWNRALLRYVVTLWKDKTKKLANQRPLDVFRPYRNSISHDFMTPLKADKVTIPG
                     SERVKKNKMERIKNRYRGARRAIPSPIKSSDILDSTTKRKLSKIGKIQTPLQNAYVDD
                     PNTTPIPKLKLEQEGRRYSLRVRNIDFNRIPELDPFSRPDSRDRASTFIIDRPILPDD
                     TFIVDESPTKMKAPRSPLS"
     gene            <43827..>45236
                     /locus_tag="AGOS_AAL170W"
                     /old_locus_tag="AAL170W"
                     /db_xref="GeneID:4618566"
     mRNA            <43827..>45236
                     /locus_tag="AGOS_AAL170W"
                     /old_locus_tag="AAL170W"
                     /product="AAL170Wp"
                     /transcript_id="NM_207725.1"
                     /db_xref="GeneID:4618566"
     CDS             43827..45236
                     /locus_tag="AGOS_AAL170W"
                     /old_locus_tag="AAL170W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL002C (OST1)"
                     /codon_start=1
                     /product="AAL170Wp"
                     /protein_id="NP_982372.1"
                     /db_xref="GeneID:4618566"
                     /translation="MMILSYPIALVLSVLCRFAVGEVDASFTPRPVWENIDYARKVNL
                     VKSYPHEAVHLTIKNTGSQPESIYYFGIRDDVYEKLSMFAAFFKDMKVYVDNVPLPKS
                     SEIDGQPVRYIMIKLPAPVEPGEKVQLEVDYAHNAGRVPLQERITLGSGHYMRLTTNK
                     LPFTSYPTAKYSLEFIGARELRELGATSSTPAGDEEKQSLKLSPSLNTADTASANVTV
                     TYRRDLPFPRVVNLRRDIWVSHWAGTLQFEEYYELTNDAAKLKGGFSRAEFIKGRHAL
                     KTGPYLVGFEMYLPTGATEHYYTDLVGMVSTHKVVDDRFFLKPRFPIFGGWFYNFTVG
                     WTNELSQFLHSDASNEEHVLRVPILNGPPDSFYDNVELSVYLPEGAQVLDVQLPLALQ
                     EKGVTTEYSYFDLTSGHVKMTVKCKNIIDTVQKGTMFVKYRYSKQLMYWKPVPIALYV
                     FVFLVSYFLLKRVDFSIGK"
     gene            complement(<45296..>47227)
                     /locus_tag="AGOS_AAL169C"
                     /old_locus_tag="AAL169C"
                     /db_xref="GeneID:4618411"
     mRNA            complement(<45296..>47227)
                     /locus_tag="AGOS_AAL169C"
                     /old_locus_tag="AAL169C"
                     /product="AAL169Cp"
                     /transcript_id="NM_207726.1"
                     /db_xref="GeneID:4618411"
     CDS             complement(45296..47227)
                     /locus_tag="AGOS_AAL169C"
                     /old_locus_tag="AAL169C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL004W (ORC3)"
                     /codon_start=1
                     /product="AAL169Cp"
                     /protein_id="NP_982373.1"
                     /db_xref="GeneID:4618411"
                     /translation="MNVRDFADSQKTHYTIVPSAKRRKLDSYDTNNVPFVRLFDGEEP
                     ESMVLQRWELYHQLYYEFHSQVDDILHEIQRDVYGSIPRAIAKGLSQCNGKYFSTLFL
                     LGADGSTQVEAPEDDNKQINVVVDLTPKESPNLRMILRRSMFKLHSALDTKLHGNQDE
                     ADGEEVLDVEESDEQQTGSATPFTEAEEEIDGVLYDLSMIERFSKKFPKRLNLIFNFK
                     DVDSFYFQVLEDFIWLLQATLENDQVRICFVFNINTNISNFEKNLKQNCVRLLKKNFT
                     KLDLSHNKGHKYVNSVFKSFLNTVDGKLNLSPRFVKFILDKMNNKSNQNLPLLIKILD
                     YSLMAYFFQNPYSMFIDLTNINHFDDKYIQGLVKCNTFMSFIEIMIKEQAPSDDILSL
                     LENRDKALEEFFAEFLVRENPINGHLNHVVDFLEQKLGVTDFNVIELYHHMLLGTLDD
                     FLKAWPQCNGHMEQLSFEPLEIVFQELFTLDNNNGLLTQALFPFLRSNMEDNLLNCER
                     IFPAPTRLQTAENKLEMELNQLLDPPICRLFKLYREANAVINVYDFFTAFKETLPSKE
                     ILELLRKAVEQDELKLQPDQRDTLVKFFSGSNDDEIFDKLALVWFVQSVSECQYIGIF
                     RTHQYKSYEAIEKIIWRGI"
     gene            complement(<47497..>47862)
                     /locus_tag="AGOS_AAL168C"
                     /old_locus_tag="AAL168C"
                     /db_xref="GeneID:4618435"
     mRNA            complement(<47497..>47862)
                     /locus_tag="AGOS_AAL168C"
                     /old_locus_tag="AAL168C"
                     /product="AAL168Cp"
                     /transcript_id="NM_207727.1"
                     /db_xref="GeneID:4618435"
     CDS             complement(47497..47862)
                     /locus_tag="AGOS_AAL168C"
                     /old_locus_tag="AAL168C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL003W (COX16)"
                     /codon_start=1
                     /product="AAL168Cp"
                     /protein_id="NP_982374.1"
                     /db_xref="GeneID:4618435"
                     /translation="MSLGSRTFRSKRQMAAFEKSLQGRYLKLLRRNPFLFYGVPFCTL
                     MAVGSYCLSDFTAVKYEREDKKVRSVQEDELVKLRANRRTVDLKEEFYRLQGLADQDW
                     EPVRVPRLPGESENVWDVE"
     gene            <48049..>50940
                     /locus_tag="AGOS_AAL167W"
                     /old_locus_tag="AAL167W"
                     /db_xref="GeneID:4618453"
     mRNA            <48049..>50940
                     /locus_tag="AGOS_AAL167W"
                     /old_locus_tag="AAL167W"
                     /product="AAL167Wp"
                     /transcript_id="NM_207728.1"
                     /db_xref="GeneID:4618453"
     CDS             48049..50940
                     /locus_tag="AGOS_AAL167W"
                     /old_locus_tag="AAL167W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL005C (SPO75)"
                     /codon_start=1
                     /product="AAL167Wp"
                     /protein_id="NP_982375.1"
                     /db_xref="GeneID:4618453"
                     /translation="MRHRAKRIMNRSAALENEYFHYFSRFIYSYVDLSDNTALLMLKF
                     YPDGVHNPYRTPYNYTAQIYSNFLNSTRTGSAQRDYGINFETFLSGVLISVIYCLCQT
                     LLFSYLRTRLPRIYQPNVFLTEHPVAPVVLFRNFKTKLFSWVHPTWNTPLESYKKYGL
                     DSFFFLRYLKVLCLYFLILSVMTIPVLIPIHYTSGYQVLDVPGNSREFGIRHRHTTEG
                     DRLLTQFSLKSTGLDEISMSNISPRHSSRLIFHFILGIFAVVWFHATLITELDYFVTQ
                     RNSAFLGEDPAAQKQQCAMFLNNIPDMFMSSERGLLDFFHSMIPDSVHQIVFIPKEYR
                     ELKDKRKLEGKLFNEIEQVCYDIIRKRFYMSPKSESVYLPYKEESSTGSTILAPTAWA
                     SVENTLPEGVLPHSTFLNSYDEIFKPKNTTQSGFRFKLARWKYTLRTILTFDFIFGLR
                     MKICTLKYNKLKILIPCIVYDVNRHIEKKLERLETTITQYNRLKQRGYKEITVYHSEQ
                     ERPPTRNSSPPLKSKQAVVVFKNVILAHFFDQLLLSASTSSMKEKILGIKPEDIHWKN
                     ITLTNRLVLMSRVALSNFLSVMVIVGWVIPVAFVGLISQIPFLAKLVPLPSWSANSTS
                     ILDKSLSSIVPVMTLIFLTEGVPFLFRWFGWLKCCRSGSSTELDVQKWFFAFLFVHIF
                     LVVTISSGISVIVEKLVNNPVSIPDLLGTNLPKSSNFFCSFMLIRGLSYFGGNFMQVK
                     SLLFELFYYRWKVYTPRAVFERNVNVQQYQWGSVYPMFSVLACIGIIYCVISPIILLF
                     ASFSFALVMFSFKYSIKYQYNPVNNSESYGKYYPTALMQLYAGIYFLEICLIGLFTLS
                     NCYRLSIGMIIVLIFTISAHFQIWSNYKYHLDHMPAQLCMEAIQNTPYNFRIPSLEGH
                     ERQVWLPNDTVGVSSSLKILLEEKYELPCQQNDCHLDENGKLVLTGYSS"
     gene            complement(<50981..>52315)
                     /locus_tag="AGOS_AAL166C"
                     /old_locus_tag="AAL166C"
                     /db_xref="GeneID:4618775"
     mRNA            complement(<50981..>52315)
                     /locus_tag="AGOS_AAL166C"
                     /old_locus_tag="AAL166C"
                     /product="AAL166Cp"
                     /transcript_id="NM_207729.1"
                     /db_xref="GeneID:4618775"
     CDS             complement(50981..52315)
                     /locus_tag="AGOS_AAL166C"
                     /old_locus_tag="AAL166C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL006W (MMM1)"
                     /codon_start=1
                     /product="AAL166Cp"
                     /protein_id="NP_982376.1"
                     /db_xref="GeneID:4618775"
                     /translation="MKGVENTLSQSESVNRGYNGWMGMESETSARATHSSEQMISLEE
                     YVREMLPMHLQKLLMERIIEAEQTGAAHTSVFAAPTGVAAQYPAMGPPMLPGQTFSSR
                     SFAEGLVVGQLSVIVVLIFFIKFFIFSDGPAKTGGGGGSSAESRSSGFTGSPLTSTTS
                     RLLSTLIKRGGKEGTEFAEDSENERTRQINAILEKTYYDVETHSPESLDWFNVLIAQT
                     IQKFREEALQKDNIVHSLNDFISRKSSQLPNYLDAVKITELDIGDDFPIFSNCRIKYS
                     PPLNKKRLEAKIDIDLSDRLTLGIETRLLMNYPKYLTASLPVKLTVSMLRFQACLTVS
                     LTTAEEFVPTMAATTDTDAGDSEGHYLVFSFSPDYRMEFDIKSLIGARSKLENIPKIS
                     SLVEYQIKKWFMDRCVEPRFQFVKLPSMWPRSKNTREEKSDMQEEDPSRAPE"
     gene            <53020..>55020
                     /locus_tag="AGOS_AAL165W"
                     /old_locus_tag="AAL165W"
                     /db_xref="GeneID:4618545"
     mRNA            <53020..>55020
                     /locus_tag="AGOS_AAL165W"
                     /old_locus_tag="AAL165W"
                     /product="AAL165Wp"
                     /transcript_id="NM_207730.2"
                     /db_xref="GeneID:4618545"
     CDS             53020..55020
                     /locus_tag="AGOS_AAL165W"
                     /old_locus_tag="AAL165W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL007C"
                     /codon_start=1
                     /product="AAL165Wp"
                     /protein_id="NP_982377.1"
                     /db_xref="GeneID:4618545"
                     /translation="MSRLDPGKQNLEVKSLDPNHSRLNPEASRLRINDIIKDLSINHA
                     HPVSPQANTLTVLSSVFKNCDEQVLLQSLVSNSYFWCRFFALVAKYAYSNSLLHASLV
                     VLRATEHMLLTMKGVPSDTLKTYCDSFHGNLNIISIFAGELMGSGEASKINMEIIRVV
                     GNYIACLNKLAKKSVTSAALAMGEVYLTMRTTGFLTAISYLIEESSDDKLYDSIVKVF
                     VTPLRSMKVIMTSNHVSEATMKLSKELNSAVESAFYLNKAAKEQFLAINEDYSDPTTL
                     TLLQIVDAITVLRDDNLSLKKRMAEQLMFDKHPFPLLAGCVGVTDMLFNHFSVNSENK
                     DIPRHITQLMLNKDAVMFAVVHKLTLYWSSSKAKSSEDLACLLVLLKHLMDKVDSTVN
                     SNAGVDETPIIEKTLDIINNMSYESLRQLQLKQVKAKHYQKWNQYGSNFNTMLSHQVE
                     DYVRQQRIYQLQTGTWVYAEDPTSDRRYKHPKVYFLVLSDNHNNLLAREFKYRLEKTP
                     TVDQNEILTSDVEGIVGNTTLMIPLRRVTDFQSRELKWNKELPKHRRLINIISKAVFT
                     EVQLMGKTGKPLITFYLDNRDASFIWLDGLQLLASSQKKPKLSKSTKNQIDTLIDIRK
                     NIQLIGLSDYNFSLGYNLAASEEEQYYDIDTLSTLTEDFFYD"
     gene            complement(<55223..>57427)
                     /locus_tag="AGOS_AAL164C"
                     /old_locus_tag="AAL164C"
                     /db_xref="GeneID:4618422"
     mRNA            complement(<55223..>57427)
                     /locus_tag="AGOS_AAL164C"
                     /old_locus_tag="AAL164C"
                     /product="AAL164Cp"
                     /transcript_id="NM_207731.1"
                     /db_xref="GeneID:4618422"
     CDS             complement(55223..57427)
                     /locus_tag="AGOS_AAL164C"
                     /old_locus_tag="AAL164C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL008W (DRS1)"
                     /codon_start=1
                     /product="AAL164Cp"
                     /protein_id="NP_982378.1"
                     /db_xref="GeneID:4618422"
                     /translation="MGTKKVNQFKDFVPTISDSEEDIPDLDASDDEYETAGKVKSRKK
                     TKKGRKGGAVIADDEDAHADLNPEFHFNDEGAEGTTDFSGWDFVGDGERAEQKDVDLD
                     GIIRRKGGLVQLAGVEESEEEVEEAESAAGASDDEELALDGFGMGAVAQREAAGAADE
                     SDSESDKDSDNSAEEAVELDGVEFGDEQEEAREEDTAEEMAQFYAPSNEGEEAKNVVH
                     STFNSLSLSRPVLKGLAALGYTKPSPIQGATIPIALLGKDVIAGAVTGSGKTAAFMIP
                     IIERLLYKPAKIASTRVLVLTPTRELAIQVADVGKKLGKFVSGLTFGLAVGGLNLRQQ
                     EQALKLRPDIVIATPGRIIDHIRNSASFSVDSVEVLVIDEADRMLEDGFQDELNEIMS
                     LIPSKRQTLLFSATMNSRIKQLISLSLKKPVRIMIDPPKQAANKLTQEFVRLRKREHL
                     KPALLYHLLRKLDSTGQKRIVVFVARKEVAHRLRVILGLLGMKAGELHGSLTQEQRLQ
                     SVNNFKSLDVPVLVCTDLASRGLDIPKIEVVINYDMPKTYEIYLHRVGRTARAGREGK
                     SVTLVGESTQERSIVKDAIKSVDGSKGSGRACGRVVDWKQVEEIHKLVQAKEDVIGEI
                     LEEEKQEKEILRAEMEIRKGENMLKFKEEINARPRRTWFQSESEKKNSSILQALSKNK
                     KVTNSKKRKREEAQQEVGSRQYKKTQKDRTTNQELAFRKQKKGGNKKKKVRK"
     gene            <57819..>58418
                     /locus_tag="AGOS_AAL163W"
                     /old_locus_tag="AAL163W"
                     /db_xref="GeneID:4618722"
     mRNA            <57819..>58418
                     /locus_tag="AGOS_AAL163W"
                     /old_locus_tag="AAL163W"
                     /product="AAL163Wp"
                     /transcript_id="NM_207732.1"
                     /db_xref="GeneID:4618722"
     CDS             57819..58418
                     /locus_tag="AGOS_AAL163W"
                     /old_locus_tag="AAL163W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL004C (SYS1)"
                     /codon_start=1
                     /product="AAL163Wp"
                     /protein_id="NP_982379.1"
                     /db_xref="GeneID:4618722"
                     /translation="MASIRRYLRIPQELKPSEIFRQSSLSPSKIVLQIVLLQVFYYLT
                     AYVLFYGWANLCGYEFEASKWIFSWELIDFSNSLGLSLTLLWLLDALVCVFFLTVIVG
                     RSKLAWDFAVTIHAINLLVVWFHTKQLPSFSWFFLQLCSSLILVFLGTWTTRWRELRD
                     TFFEGLIDQEPITGGAESPYHGSSQNRQQFEMKDLEAQK"
     gene            complement(<58565..>64189)
                     /locus_tag="AGOS_AAL162C"
                     /old_locus_tag="AAL162C"
                     /db_xref="GeneID:4618479"
     mRNA            complement(<58565..>64189)
                     /locus_tag="AGOS_AAL162C"
                     /old_locus_tag="AAL162C"
                     /product="AAL162Cp"
                     /transcript_id="NM_207733.2"
                     /db_xref="GeneID:4618479"
     CDS             complement(58565..64189)
                     /locus_tag="AGOS_AAL162C"
                     /old_locus_tag="AAL162C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL005W (CYR1)"
                     /codon_start=1
                     /product="AAL162Cp"
                     /protein_id="NP_982380.1"
                     /db_xref="GeneID:4618479"
                     /translation="MDRKAHRAGERRAAGRTDGRGGWERGADGLAAGSRRDSVDDSWS
                     SLSSNSQEAPLEHEVRSGGRIVEPGSDLPPHMKHSRGLHHASFARVSQHPSSPLAKQL
                     RPVRNVTMQSAAEDDDARATGAPPPIRRIPSRAGSFFKRLTGRKSSINGSETSAAADA
                     DVAAAPSSLRRKVNTFIHGNEARRDSKGTISTSSADSRRGSTASGGSASIIQLPDGQR
                     LSLQEYKPVSPTTTALSSASSAAAQQGGDRSTGSPVHVPWDNAEASNEHESGVNTTFF
                     NLDMDLNNLSDITSAYQQQTETTTNANLEVNMANAGKPVVHMPRPQKLPAREVRHTKG
                     AAQWTAPESWDVDDPVIKPSKQKQKCHNPAHRHHRHHYSPRSDMTGTSGDNNRLSADP
                     NRYSNLEDSPNHSRLTAAFSRSPIHRDMSPLSIMSSDSIVSSNSDSCSFSVVSNPEDT
                     PKDITHPDNASTSSIHAQELENNDIEDDKLQHHLEKYYNHFSDIDYHKKYTIRIFNTD
                     DTFTTLSCRPETTVKEMIPQIKRKFNVPPGNYQVSLKVGKLSKVLRPTAKPILIQIRL
                     LLFNGYKKTDRLNIMGIEDLSFVFSFVFHPVITSQLTYEQEQRLSKGEFVHVDLRNMD
                     LTIPPIIFYQHTSDIESLDVSNNANIFLPLDFIESVIKLSSLRMVNIRASRFPSNICE
                     ATKLITLDLERNFIKRVPDQMSKLTNLTILNLRCNELDRLPRGFKDLKSLQLLDISSN
                     KFNIYPEVINSCTNLLQLDLSYNKIRSLPDSMNQLQKLAKINLSNNRITHVNDLSKMT
                     SLRTLDLRYNRIESIKCRVPNLQNLFLTENRLTMFDDDQLMLRTLELQRNPLSILTLK
                     NDYLEHLTSLSISKAKLAVLPESLLRRLPRLEKLELSENSLTVLPPDIKHLKKLVHLS
                     VAKNKLESLPDEIASLKNLKMLDLHCNNLMTLPAALSTLSLTFVNISSNMLSGHHELY
                     RTFQGTSNIAKSLMFLSAADNQMGDKFWEIFNTFKTLKVLNLSYNNFMALPELEMENL
                     TELYLSGNHLTTLSGEAFLKLKSLRVLMLNANNLQSLPAEISQLSQLSVIDVGSNQLK
                     YNISNYHYDWNWRQNTELKYLNFSGNTRFEIKSAMEYGTNMHLSDLTVLKQLRVLGLM
                     DVTLNTSRVPDDGVNFRLRTMGSTINGMEYGVADSLGQTDSVSTRDVTFERFRGNEDE
                     CLICLYDGINDNTNTGHKISQVIRDIYDRILVRSLEKYGDSTPAEIRDALRFSFLQLN
                     KEINSSILAAGNNKNSNGNTNNNNNTNNNNNNGNNNTNSNGESVVLTAADSLSGASVT
                     VVFMKGKNIYTANIGNATAILSKGNADYRILTRKHVPTDTEEFERIRLSGGYVDNKRV
                     NGVSEISRAIGFFDLLPHIHASPDISETTLTYTDDMLVIATQSLLSYVSLEKICDIAR
                     ENKSQPMLAAERMKDYAIAYGCTDNITILCVSFNKNVGKQKQFSLNKSDLLGRRLNFE
                     DVSLRRLRPEIAPPTGHLAIVFTDIKNSTFLWELFPNAMRVAIKAHNDIMRRTLRIFG
                     GYEVKTEGDAFMVAFPTPTSALVWCLTIQLKLLELDWPEEITSIKSGCMITDDSGNTI
                     YQGLSVRMGIHWGCPVPEVDIVTQRMDYLGPMVNKAARVSATADGGQITLSSDFLAEL
                     NKIMKLHHMVVQDKKPLKEVYGEEFVGEVLEREIQMLDNVGLVLEELGEQKLKGLETR
                     EFITIAYPKQLAARHTMSTGEKSTNIVNDKYVLQLKVISTTLENILSTVNGGLIEIDN
                     SVLQLPTHMTRDKKVDKALSQNTEYDWISLLDHLVTRLESTVAMLQLRQRLEGGLEIC
                     RPGNNTKKSVFELLDLLCTGTGFKRDTPSENK"
     gene            <64596..>64790
                     /locus_tag="AGOS_AAL161W"
                     /old_locus_tag="AAL161W"
                     /db_xref="GeneID:4618474"
     mRNA            <64596..>64790
                     /locus_tag="AGOS_AAL161W"
                     /old_locus_tag="AAL161W"
                     /product="AAL161Wp"
                     /transcript_id="NM_207734.1"
                     /db_xref="GeneID:4618474"
     CDS             64596..64790
                     /locus_tag="AGOS_AAL161W"
                     /old_locus_tag="AAL161W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL009C (COX17)"
                     /codon_start=1
                     /product="AAL161Wp"
                     /protein_id="NP_982381.1"
                     /db_xref="GeneID:4618474"
                     /translation="MPESSSVPGVSQGSSTDKPKPCCVCKPEKEARDSCLLFNGVDAV
                     KCQELVQKYKDCMKGYGFEV"
     gene            <64921..>65880
                     /locus_tag="AGOS_AAL160W"
                     /old_locus_tag="AAL160W"
                     /db_xref="GeneID:4618595"
     mRNA            <64921..>65880
                     /locus_tag="AGOS_AAL160W"
                     /old_locus_tag="AAL160W"
                     /product="AAL160Wp"
                     /transcript_id="NM_207735.1"
                     /db_xref="GeneID:4618595"
     CDS             64921..65880
                     /locus_tag="AGOS_AAL160W"
                     /old_locus_tag="AAL160W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR017W (MEU1)"
                     /codon_start=1
                     /product="AAL160Wp"
                     /protein_id="NP_982382.1"
                     /db_xref="GeneID:4618595"
                     /translation="MTGSENLETYEGRVELGIIGGTGLYQLGCLEPVATLATVETPWG
                     RTSSPVTVGRVRTEGADAFYVAFIARHGVDHEIPPSRVPNRANVACLKRLGCRAILSF
                     SAVGSLQHQIKPRDFVLPQQIIDRTKGIRESSFFNDIGLVAHVPFGEPFSEAFAKYIH
                     RFRDVLENPDSEEPCELHFDRDTTVVCMEGPQFSTRAESKLYRQFGGDVINMSVLPEA
                     KLARECEIAYQIVCMSTDYDAWRDELEPVTVETVVGNLTANARNANALASKVIAAMAA
                     ERPPFLKNADGLHGVVQMSISTKPSAISEEGQRQLDYLFPGDA"
     gene            complement(<65961..>67118)
                     /locus_tag="AGOS_AAL159C"
                     /old_locus_tag="AAL159C"
                     /db_xref="GeneID:4618490"
     mRNA            complement(<65961..>67118)
                     /locus_tag="AGOS_AAL159C"
                     /old_locus_tag="AAL159C"
                     /product="AAL159Cp"
                     /transcript_id="NM_207736.1"
                     /db_xref="GeneID:4618490"
     CDS             complement(65961..67118)
                     /locus_tag="AGOS_AAL159C"
                     /old_locus_tag="AAL159C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR018C (POM34)"
                     /codon_start=1
                     /product="AAL159Cp"
                     /protein_id="NP_982383.1"
                     /db_xref="GeneID:4618490"
                     /translation="MSGISGSARKVFETPMRPISREQFQSMREKVVKLSPELYRTRIL
                     SDPTVNKFPLRAPGVVAANVFERVDSDPIEAAKSQVVHVPVLPPTTQDDDLLPEQEVA
                     MATRMATGMRAETVGSGCDASSAKPLGNYENPALAAFTRRVVNKEQEIKRIIANVWTL
                     LIWNLVYKFLGLFLQSSRTGRFIYQSLSHFFYANVVFKLNPHARLDSGWFRFWTLENI
                     SHLIHMLLLINIALSLYMLLVKAQHITVGDLGLNERQKELLGVSASSDTRNSIIEDVT
                     NPRPLLHRVSSKGSMSEHILPSDAAQPQPFLFKSLQTPLRSLKGHPSPTVQSELPYTG
                     GGRESLFPAASSLVSQKLATPAQPANRPGSGYIPSSKYAYMMDSPSARKRL"
     gene            <67892..>69328
                     /locus_tag="AGOS_AAL158W"
                     /old_locus_tag="AAL158W"
                     /db_xref="GeneID:4618619"
     mRNA            <67892..>69328
                     /locus_tag="AGOS_AAL158W"
                     /old_locus_tag="AAL158W"
                     /product="AAL158Wp"
                     /transcript_id="NM_207737.1"
                     /db_xref="GeneID:4618619"
     CDS             67892..69328
                     /locus_tag="AGOS_AAL158W"
                     /old_locus_tag="AAL158W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL010C (PSR1) and YLR019W (PSR2)"
                     /codon_start=1
                     /product="AAL158Wp"
                     /protein_id="NP_982384.1"
                     /db_xref="GeneID:4618619"
                     /translation="MGFISSLLCCSGSKQSYNKRSSSPAPSVARKQVGNKTSIRRSQA
                     SSKASSCNALSSSADSMDKAAELCVSPAPATAPAGSAVHSDNIARVAAVTSTDAPGGS
                     DTRRNQDEGQSDARVQEDIISTPNVSEVPAQEAGKLGRPECSEEQCVGQKTEEGLLKA
                     PDKIATYGNSLGVVHSGDCEKQGGNLDDCGSSDKETFFGDKQLVTVYHGETDTSTGTT
                     DNDKQDVSNNVIHGVTTTVKERQDSSSTEGITTDASNNDEEPRQEEARSDPELGYEGE
                     VLLDLSSLQPEQAHAPGYDTLLPPQRPEFRGRKCLVLDLDETLVHSSFKYLHTADFVI
                     PVEIDNQVHNVYVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQYKAVHH
                     RLFRDSCYNYEGNYIKNLSQIGRPLSDLIILDNSPASYIFHPQHAVPISSWFSDAHDN
                     ELLDILPLLEDLSSRKVPDVARILDVTI"
     gene            complement(<70077..>71516)
                     /locus_tag="AGOS_AAL157C"
                     /old_locus_tag="AAL157C"
                     /db_xref="GeneID:4618455"
     mRNA            complement(<70077..>71516)
                     /locus_tag="AGOS_AAL157C"
                     /old_locus_tag="AAL157C"
                     /product="AAL157Cp"
                     /transcript_id="NM_207738.1"
                     /db_xref="GeneID:4618455"
     CDS             complement(70077..71516)
                     /locus_tag="AGOS_AAL157C"
                     /old_locus_tag="AAL157C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL011W (SOF1)"
                     /codon_start=1
                     /product="AAL157Cp"
                     /protein_id="NP_982385.1"
                     /db_xref="GeneID:4618455"
                     /translation="MKIKTISRNADEYVPVKSTQESQLPRNLDPALHPFERAREYTKA
                     LTATKLERMFAKPFVGQLGYGHRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREE
                     LCSFRAHYGLVTGLCVTPTHLSPTKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKI
                     VSDTGDGALLKTFYGEHAFQSIDHHRRNPNFVTGGAQIQLWDVNRKKPLSNLSWGVDN
                     VSFVRFNQNEEDILASTGSDNSIVLYDLRTNSPTQKVVQRMRTNALCWNPMEPFNFAI
                     ANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHG
                     HSREVYHTKRMQHVFQVKFTMDSKYIVSGSDDGNVRLWRAKAWERSHVKTTKEKNKLE
                     YDEKLKERFKHMPEIRRISKHRHVPKVIKKAQEIKNIEIASLKRREGNERRTRKDMPF
                     VSERKKQIVGSVHSYEEKSSKADKEDDDQ"
     gene            complement(<71775..>73298)
                     /locus_tag="AGOS_AAL156C"
                     /old_locus_tag="AAL156C"
                     /db_xref="GeneID:4618531"
     mRNA            complement(<71775..>73298)
                     /locus_tag="AGOS_AAL156C"
                     /old_locus_tag="AAL156C"
                     /product="AAL156Cp"
                     /transcript_id="NM_207739.1"
                     /db_xref="GeneID:4618531"
     CDS             complement(71775..73298)
                     /locus_tag="AGOS_AAL156C"
                     /old_locus_tag="AAL156C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR020C (YEH2) and YLL012W (YEH1)"
                     /codon_start=1
                     /product="AAL156Cp"
                     /protein_id="NP_982386.1"
                     /db_xref="GeneID:4618531"
                     /translation="MSVLGKTRIWLYTVTASVVTTLLLAAIFVAATWNTLITDRWKRK
                     HRLRRRVIPTVQEAVVSDKDRIRVTVRRSVSATSESPFLGSDGKRHESDEEPGSAESG
                     AAPGSGGNPFRDAMAAEDIKLVPDLAYYYRQYGIEIEEYEVTTDDGFVLFLWHFVGQG
                     SVTQGPPMLLLHGLLQSCGSFASSGRKSLAYYFYESGYDVWLGNNRCGLNAKTVPSQV
                     DEHEKWDWDMKEMVKYDLKAMVEYVLQKTARKKLTLVAHSQGTTQGFMGLLHGEALYG
                     GTSFRLMDKLDNFVALAPAVYPGPLLYENVFMRFMASTIDVPWVYGVRSFLPIMMQVR
                     ALVVGNRFFSVVCYLFFNYLFDWNDLLWDKPLRDRHFMFSPVHISVNLMKWWLSKDPG
                     RRSFRNYSHCIFPEEGAWFPLVDGNSDSHTLLDGQVRRNAPTEYPRILLFVPKQDRLV
                     DGKRLIDHFTNHEDERIYKIWYFDDYSHLDVLWASDVSDRIGKSMLEELRAPQGSSS"
     gene            <73598..>74134
                     /locus_tag="AGOS_AAL155W"
                     /old_locus_tag="AAL155W"
                     /db_xref="GeneID:4618614"
     mRNA            <73598..>74134
                     /locus_tag="AGOS_AAL155W"
                     /old_locus_tag="AAL155W"
                     /product="AAL155Wp"
                     /transcript_id="NM_207740.1"
                     /db_xref="GeneID:4618614"
     CDS             73598..74134
                     /locus_tag="AGOS_AAL155W"
                     /old_locus_tag="AAL155W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR021W (IRC25)"
                     /codon_start=1
                     /product="AAL155Wp"
                     /protein_id="NP_982387.1"
                     /db_xref="GeneID:4618614"
                     /translation="MIYRELQKAIPPALWGLDESAQNELELTAVHFTNKTLLHIRFNG
                     EMDATYEVQPRGAGGLAADVGGLHGGAASSLRAEGNDEDEFVEDHLSKYNVSMKMGNS
                     NDMKLPVVVMQIAELYERAVYPSVLGAEARAGPDLGLLVTLSSRFWRSASAGGPGSGS
                     DFDRLMFVLQSIREMYGI"
     gene            complement(<74156..>75007)
                     /locus_tag="AGOS_AAL154C"
                     /old_locus_tag="AAL154C"
                     /db_xref="GeneID:4618580"
     mRNA            complement(<74156..>75007)
                     /locus_tag="AGOS_AAL154C"
                     /old_locus_tag="AAL154C"
                     /product="AAL154Cp"
                     /transcript_id="NM_207741.1"
                     /db_xref="GeneID:4618580"
     CDS             complement(74156..75007)
                     /locus_tag="AGOS_AAL154C"
                     /old_locus_tag="AAL154C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR022C (SDO1)"
                     /codon_start=1
                     /product="AAL154Cp"
                     /protein_id="NP_982388.1"
                     /db_xref="GeneID:4618580"
                     /translation="MFVSFSYRPSMALALLEAIFNDSGSETQWISKSSRPMGVINQPS
                     GQIKLTNVSLVRLKKGKKRFEVACYQNKVQDYRRGVETDLDEVLQINQVFLNVSKGQV
                     ASNEDLNGAFGTKEQEVVIKEILSRGEIQLSEKERQQMHGKITNELLTLVSAKCVNPN
                     SKKRYPPTMIHKALAELKFNVVTNKPAKLQALEAIKLLVQRQIIPIARAKMRVKAVLP
                     REGNAEAIAQAASLIAATEAAPESATTWMCTGLIDPMNYRELVTLCGKCGTLQVLDMA
                     VLDDANQ"
     gene            complement(<75086..>76345)
                     /locus_tag="AGOS_AAL153C"
                     /old_locus_tag="AAL153C"
                     /db_xref="GeneID:4618444"
     mRNA            complement(<75086..>76345)
                     /locus_tag="AGOS_AAL153C"
                     /old_locus_tag="AAL153C"
                     /product="AAL153Cp"
                     /transcript_id="NM_207742.1"
                     /db_xref="GeneID:4618444"
     CDS             complement(75086..76345)
                     /locus_tag="AGOS_AAL153C"
                     /old_locus_tag="AAL153C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR023C (IZH3)"
                     /codon_start=1
                     /product="AAL153Cp"
                     /protein_id="NP_982389.1"
                     /db_xref="GeneID:4618444"
                     /translation="MSHPNTHMPRTHAVHGRAAPQRRGCRTSVEKTDQSGHSRSSLAE
                     SAMEQAQLRSRGEAGGGRSVLCASGEPGSAHKWAGAVTCSGAEEQPLHWAESRARGLA
                     RHLHYWELPYAWRENRYIIYGHRFYHSHRKSLLSVLNAYGWHNETINIWSHLVGAAVL
                     AYLLCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCHLKLRSR
                     FVCVDYTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVASIGLGTAAGVMNWSPHFDR
                     PEARPLRIAVYVGLAALGLVSFVHVWMQVRWASAHLMAPLVYKSLVWYGIGVVFYATL
                     VPERWRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSLWWVDYFCHSHFLWHVF
                     VVLGVVGHYRAVLQMSRIVWLDAGRAF"
     gene            <77508..>79871
                     /locus_tag="AGOS_AAL152W"
                     /old_locus_tag="AAL152W"
                     /db_xref="GeneID:4618484"
     mRNA            <77508..>79871
                     /locus_tag="AGOS_AAL152W"
                     /old_locus_tag="AAL152W"
                     /product="AAL152Wp"
                     /transcript_id="NM_207743.1"
                     /db_xref="GeneID:4618484"
     CDS             77508..79871
                     /locus_tag="AGOS_AAL152W"
                     /old_locus_tag="AAL152W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL013C (PUF3)"
                     /codon_start=1
                     /product="AAL152Wp"
                     /protein_id="NP_982390.1"
                     /db_xref="GeneID:4618484"
                     /translation="METAAQAERIRGQMSTTEHTTDPWAGSVDYGSASRRNSNMDPEL
                     ASIVSSLSALSTGPGAGAPQQLGGFRRASMNSNSSDVESELLFAGMSPTVRRTTLSVG
                     GGAGGGGRLAMLGHYPASIAGTLPAGGQGGTFFERFGRTLAEATREVETGLGTYSVRQ
                     ALRESAASSAQDLLARPGVAAATSDENALRKMSVSSETVESVSESMSMHNESNPSHNI
                     WNVANAPVFRPNHGDSGGDPYSSVYGGFPYGMFGQYPSGTGLGGGGAFAAGGTVAKGE
                     EASREEPQGDAATATNGQFAFPAGAPFLYFPVGSNGGSGAAIPAVLPPQPSRHSPSES
                     QKGKSKGNPYLQQHPRGYKAPGMPLQNSNSKAAPQTSISGKGHHGHHYSSSKQSSTQN
                     QHQANQQQSQYQHQSSSGATKRNGKNQQPIMRSPLLEEFRTNPTNKTYKLHEIYGSAL
                     EFCKDQHGSRFIQQELATASNIEKEVIFNEIRDHAIQLSHDVFGNYVIQKFFEFGTKT
                     QKDILVEQFRGKLEALSLEMYACRVIQRAFEFIDEDQKIDLVMELSSSVLTMIKDQNG
                     NHVIQKTIECIPMSKLPFILESLRGQIYHLSTHFYGCRVVQRLLEYGSKADQEEILNE
                     LDQFIPYLVQDQYGNYVIQHILQHGGDNPAENHIDKSKQDIVDTISKTVVEFSKHKFA
                     SNVVEKTILYGSASQKRQVLDKILPKDEEHAATLEDTSPLILMMRDQYANYVVQKLVG
                     VGTGNDKKLIVIAIRSYLERLNKNNTLGNRHLASVEKLAALVEKVKL"
     gene            complement(<80213..>80533)
                     /locus_tag="AGOS_AAL151C"
                     /old_locus_tag="AAL151C"
                     /db_xref="GeneID:4618496"
     mRNA            complement(<80213..>80533)
                     /locus_tag="AGOS_AAL151C"
                     /old_locus_tag="AAL151C"
                     /product="AAL151Cp"
                     /transcript_id="NM_207744.1"
                     /db_xref="GeneID:4618496"
     CDS             complement(80213..80533)
                     /locus_tag="AGOS_AAL151C"
                     /old_locus_tag="AAL151C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL014W (EMC6)"
                     /codon_start=1
                     /product="AAL151Cp"
                     /protein_id="NP_982391.1"
                     /db_xref="GeneID:4618496"
                     /translation="MANPVSADILSSRSVSFNKKRLLYVHDITSLVFGCGAGILQLES
                     LQGFIMFAVSYLSISAIFAMRLCKFEPSKYFQNPVQDIILTSLFRELAGFVMAWTFTY
                     ALLS"
     gene            <80894..>82015
                     /locus_tag="AGOS_AAL150W"
                     /old_locus_tag="AAL150W"
                     /db_xref="GeneID:4618578"
     mRNA            <80894..>82015
                     /locus_tag="AGOS_AAL150W"
                     /old_locus_tag="AAL150W"
                     /product="AAL150Wp"
                     /transcript_id="NM_207745.1"
                     /db_xref="GeneID:4618578"
     CDS             80894..82015
                     /locus_tag="AGOS_AAL150W"
                     /old_locus_tag="AAL150W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR187C (HGH1)"
                     /codon_start=1
                     /product="AAL150Wp"
                     /protein_id="NP_982392.1"
                     /db_xref="GeneID:4618578"
                     /translation="MPSQLEELVSFLHSPQPAVKQIALDNLVGFSTGPHAGIFKNENY
                     RPIQDLKELAKNNSKTIVQQSVTILANLCDDPVMRMKIVTDIDFLSYLAWKICDLGNS
                     SADIMCILLSNLAKDEGITNIFGINGVHDSVSLDEKVFMSKNVIDCLMDCFVKGYDRK
                     LNQYANFDYLSFFFADISRFRKGRNYFVEEQQYDGVVPISKLLVFTEKYDNKTRRLGV
                     ASTIKNSLFDSLHHEKMLKDEKINLLPYILLPIATSRDSELDEEDLFNLPDELQFLPE
                     DKQRDPVPEIICVHLESLLLLCTTANGREYLRSKSVYPLIRELHKNVENEEIGELCHR
                     IVNMLMRGEPENEKVEEIVSKSAEDESEESDDEAIVEVL"
     gene            complement(<82194..>84065)
                     /locus_tag="AGOS_AAL149C"
                     /old_locus_tag="AAL149C"
                     /db_xref="GeneID:4618728"
     mRNA            complement(<82194..>84065)
                     /locus_tag="AGOS_AAL149C"
                     /old_locus_tag="AAL149C"
                     /product="AAL149Cp"
                     /transcript_id="NM_207746.1"
                     /db_xref="GeneID:4618728"
     CDS             complement(82194..84065)
                     /locus_tag="AGOS_AAL149C"
                     /old_locus_tag="AAL149C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR186W (TFG1)"
                     /codon_start=1
                     /product="AAL149Cp"
                     /protein_id="NP_982393.1"
                     /db_xref="GeneID:4618728"
                     /translation="MSNGRKAAGPQPFIKRDQLRRDFLRTRVKRNGPGKGGVKKEDPD
                     SMEEQTRQMLQGGGGGVKREDDDYQEFPLRAANAQDLKNVKVHLLKFQSKKKIEPTKD
                     FHLPVRLHRKDTRNVQFQLTRAEIVQRQKEIAEYKRRLEGEQGATPVSASSRESGGAE
                     GTEGTPGDSGGALQPLAAEKPGPTTKLPEAGLAEDPTKVGLVKYDGKEQVDFDFQSGT
                     IDPFADVAPDGGGRFKRGNSKRKTRQLKLLDEKARKLRFEEFYPWVMEDFDGLNTWVG
                     SYEAGNSDSYVFLSAENDGSFTMIPADKVYRFTARNKYATLTIEEAEKRMEKNGAGAP
                     RWLMKHLDNIGTTTTRYDRTRRRLKVVDGNDRQEEDDRVDNSEVELDYDEEFADDEEA
                     PIIDGNEEENKESEQRIKKEMLQANAMGLRDDDAVEDEDDLFGEKKIDEEGEKVKKAL
                     LKTDLGALYESDDDSNPYLSESDLDDDDDKKIKKEDQDEDSLSRKSSPKKKASRSPHA
                     GHIYVKSIKNCIIVISADKSILNNFPKGEWNPSSANHDNGAKDRTDFASRDGAPAPHE
                     LLTEQDIIDAVQGKEITLKQLIKELRSKFKHPENKDRLKLFVKRLVKLNGTFLELAR"
     gene            <84528..>85742
                     /locus_tag="AGOS_AAL148W"
                     /old_locus_tag="AAL148W"
                     /db_xref="GeneID:4618730"
     mRNA            <84528..>85742
                     /locus_tag="AGOS_AAL148W"
                     /old_locus_tag="AAL148W"
                     /product="AAL148Wp"
                     /transcript_id="NM_207747.1"
                     /db_xref="GeneID:4618730"
     CDS             84528..85742
                     /locus_tag="AGOS_AAL148W"
                     /old_locus_tag="AAL148W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR185C (TYS1)"
                     /codon_start=1
                     /product="AAL148Wp"
                     /protein_id="NP_982394.1"
                     /db_xref="GeneID:4618730"
                     /translation="MSETIVDPTEAYELIVKNLQEVLNPQIIKEVLEEQKRPLRLYWG
                     TAPTGKPHCGYFVPMTKLAHFLRAGCEVTVLLADLHAFLDNMKASLEVVNYRVRYYEF
                     VVKAILRSINVPIEKLRFVVGSSYQTSAAYTMDLFRMSNVVSQNDAKRAGADVVKQVS
                     NPLLSGLLYPLMQALDEEYLGVDAQFGGVDQRKIFVLAEENMGSLGYKKRAHLMNPMV
                     PGLTMGGKMSASDPNSKIDILEEPKVVKKKINTAFCSPGEVEDNGLLSFIQYVLGPIQ
                     ELKNAPGYFEFFIDRPEKFGGPITYHSFEELRQAFKDQKLAPPDLKTGVADAINALLA
                     PIREEFANNPEFQDVAAKAYPVVTEQKTKKVKKPKNKGTRYPGAPKPAADVDAEVDEA
                     SVQMKKTSLETN"
     gene            complement(<85927..>91368)
                     /locus_tag="AGOS_AAL147C"
                     /old_locus_tag="AAL147C"
                     /db_xref="GeneID:4618636"
     mRNA            complement(<85927..>91368)
                     /locus_tag="AGOS_AAL147C"
                     /old_locus_tag="AAL147C"
                     /product="AAL147Cp"
                     /transcript_id="NM_207748.2"
                     /db_xref="GeneID:4618636"
     CDS             complement(85927..91368)
                     /locus_tag="AGOS_AAL147C"
                     /old_locus_tag="AAL147C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR024C (UBR2)"
                     /codon_start=1
                     /product="AAL147Cp"
                     /protein_id="NP_982395.2"
                     /db_xref="GeneID:4618636"
                     /translation="MGTVDYICDIREYLVHLPRLSNYQVNDTVLYQLWKVLFECLNQG
                     RSKGIVDWKKLLRVYESPNWQNGVFQSIHLPAEWREKFLEEYTGTGEGVGNDHRGTSC
                     NKLCQPTETVYYCFNCTKNPLYEICDECFDPTKHVGHQYTSKVVSRPEGKVCHCGDPS
                     GLSNPEEGFECKSALNNLPRRTMSYEHDESLVSILAHVLDYIVDTMMQLKEWTNDDIF
                     LTLPMTLEQQSEYYALQLYEKDCKIHIKDLAAKISRVLCKPLEYGIMMVEKLVRGEAF
                     VILLESKDTQKLKTVKEIFTNEHIATHIKNKNEVFRENLVDELIRWIYELCYKRPNVQ
                     RKLALRVAMMSTWNSKLLGMTLRSQATMVPYWSKIYLLGNFTVQYSQRTSFPWCSPWS
                     FDEAKNEQHDPRVLEIMKEYDKRLAEVVPDNSTAKYQPLNGSRFQYLITDGTAVMSKV
                     SRYRMMKVICSMFTIIDDSKKCLAAQYLDVYCAVLYNTVASESTDYKISLMNMLSQYI
                     FQNPQIANMIITKAPGFIQRALQFAFALLSFAPATLINCPPIPLSYDFKLPDDSIKSK
                     RSVVCFKDIYLIMSTNTVPESVFQNQELTSVIIKCFASFNNILPLRREAKEHVEFENF
                     DFSSYYFLFSSILVMVDGFVRNVCLIKDPRRRREVVYDLLDRSISLEIKMLSCFRNSI
                     PFSDSLWDSSDAEPQVKMVRETIYNVTSNIISFQVGIDTQNFFNPMSYFFKFVLQWSQ
                     CGRYETLPEELKGYINLVSFFKENKKLIFMAESALSTLVLIAQINSGFWVRNGAPIIH
                     QLRMYTKYSMREFTYFSDIFNLQLAMSLSPPNDFMVTFISRWHLKNWTEGVPIDDYPD
                     KDVTSSMVDQCLLLLIQLLSEVRSLTMSSSVEGFEKTMRSEIIHALCFHNCSHSNLMN
                     VIPEHVTKHPAFDLYLEHLANYTPPIGITDHGVYTLKEEYMNEVDPYFVGFSATKRYE
                     AEKLMRSRMESNQLIPYMDTFVPAKNVIMELQFTPFSGLYQITSTDIFGIFIKSTLEH
                     IAKFKYEAMLSKVAHIIHLCFINNLNGFVNVFWREYSFDETALSFYNSIGSLLFSFLL
                     DEDFCSDHGKIREIFSLLQREAPHVDVDGYLNEQTPNYDPQIWKSRSRELKKGEDEYE
                     KKRLAKRKRDRLLRKLAKQQQQFMENNNVTPEDIDSRETTIDGSFSAIGWEYPDDTCV
                     FCKMPRVENDTFVYFTHFEQNTVDKYTDFGKLNLLQSLYTSAKPQPLFPSPGSTSICH
                     VVKACGHGSHFSCMERHMKASRNAHNHMTKNVPNGLGFSLLFCPLCNSLVNSFIPRLS
                     DVNTRCDEELFAGTHENKYSMSSEELDTLCLKSLIIFCSLTVQSKFSRLPDIYTLFCS
                     VIANTISNIELITRSGDTTIPITKRLTNQQLLTLRLLTEMKIYILERKLFSHQTGKIT
                     GIPIPAVREYDDWAAFNVEFLHSNLLLDACRYLNPITRKGYPLSAFVYASIKRKLHQI
                     FIALSTTLVEDSDCMIDGDQNVMDWDVDDIDSGQEGADSVLGVVLTYIVALSTAISID
                     RSQLNRVAKWKVLLYNVTEKALTVFLRRFLMLIFAEYPITKRECNTIELELSSLLSYF
                     GVPQLDSILTDFRVNDLPLTKATIKEASKGPNIQSYAQKVYSLRVESPYGSPLIPLPH
                     RLSDLLSDEEEQLQYRINRHEVAMCLFCGTKVFIQNASMLHNFMIGECTNHYSNECTQ
                     TAVYGCFLLVRSNTVYLAYGDRGTFFKAPYVNKHGEVDEDYKYGTPVFLDEKLYSHLG
                     NDIVLGGKIPHLVHRLTENMSDVGGWESM"
     gene            <92509..>98211
                     /locus_tag="AGOS_AAL146W"
                     /old_locus_tag="AAL146W"
                     /db_xref="GeneID:4618525"
     mRNA            <92509..>98211
                     /locus_tag="AGOS_AAL146W"
                     /old_locus_tag="AAL146W"
                     /product="AAL146Wp"
                     /transcript_id="NM_207749.1"
                     /db_xref="GeneID:4618525"
     CDS             92509..98211
                     /locus_tag="AGOS_AAL146W"
                     /old_locus_tag="AAL146W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR184C (UBR1)"
                     /codon_start=1
                     /product="AAL146Wp"
                     /protein_id="NP_982396.1"
                     /db_xref="GeneID:4618525"
                     /translation="MIREGAGEVQRHLRHTLESLHDHEYFKSPRGPQERSEMDKVLRS
                     FVFRYLYYVLSDNGRLLPHLFAGAPKDKFPTSVEDAMQVDSPSLSKADIFYAIDEITG
                     AKSHRHTGRNCGRAFQPGEPLYRCQECAYDDTCVLCISCFNPDDHVNHHVSTHICNEL
                     HDGICDCGDAEAWNVPLHCKAEEDDSDGDEEDSVFENDYNMELFEAVLEELFDHFIEV
                     FNQNIEPLPTIQKDLTMKLREIIQDGKTQEKFELLSALAYRNQYMEAQKPSSGPASFE
                     TEQDLDKKLDGYVVLIYNDEYHNFSQATSALRQGGPDNKHTDQLTARIDGEGRAMLKC
                     SRDLSAVIGGFFSVQTNGLSATLTPWSEYIHQEACKYMIHWVKNCLSIPNPSFQKVFR
                     EAMGKVLCSEYIRASETTDMTPVIDKYFIPDRRNTGCHIYADLSVLGKGNVIPLGHHK
                     VLLQESLNEIALNLNNYEELKYRRYSNSRLQQILFFDNRYWKKLRKDIRRAVIPTLAS
                     SVKYKPTFSQQVVEIFNHMTRSVAFMDREPQLSALADCVVQLFTCPTTVRTIFENENF
                     PDIMWSVIDIFTEFSKVDDGILLWQRVQKSNPSKSYSYSFKHGLYAVETLLSKVENAN
                     LILRPPEFISIVTLCKLFNGAWRIKRKEGEHVLREDQHFILYLEYTTSIYNIIRAMNR
                     VLDSSRAALSEDTLLQAIGLLNTFLGHRTLPYKLVQEAHDVIAFKVSKQKVAFMNPVH
                     TLFSCLIEKVPLAKAFEAVSSTKDFLTIADFSLRAAVLCSQIDVGFWVRNGMSVLHQS
                     AYYRTNPEINSYSRDIHLNQLAFLKENDDLPRVIYNLLDRWELLGWFTGAEQYETTVY
                     EERITNIIQQFIAFVYHILSERHFFRYFGSSAERETHTMKNIIIYSLLMKPLPYSELL
                     KSVPDYLSEKLSVFDECLHEVSEYVEPKGLEDSGVFSLKKEMYKKIDPLRLLNMKNDF
                     EHSATIVKTHLAEGSNAVGQVVLQPQLISPKHLDELAAHLGDFTRTQVFAKLIYKLLQ
                     ACIDREDGTYLYELLHLLHGIFKDDELLRGKSSIPEAYISKPICNLLLLIDTKANVFS
                     ENAIRKADFLLEHMIRKRHNDIFESLAAYFGQDYVEQYKAKKLNQGINFEETEKDRKK
                     RLARLRQQKIMAKFSKQQAKFVRSNPNVITDDLFDAEVRTGSDGLVCSLCQDEESLDA
                     FVIPAYHESSPIFFYGDYTPQNFAKPWNGFVNDDDNLTFYDDLKLYSLQEARKGSTTT
                     FVSCNHIIHYECFRRYIQKKRFSNNLFICPLCQTFSNCVLPIPHWSLRLPKSPVTVDQ
                     LLSQPSEENLINLFIDDQTPNSTAAMNMLKEVCKKNGNYDKSYGSVSQEFVTSILTCH
                     WANTISMIEIASRIEKNTHQTLLQGKEQKFKTLRGVLSAIGWFYKCMGTPRQKFVPYV
                     FHGEDDGPANQVFQYIVHKSLFSGAPVSETISHALAIWIRTLATQFLISSNKTGYEIT
                     YHQAVSLGPVYEAPPEFTTACSSLDQIIAIEDTTLKTKMVDLTYTMLMKTLLPTLRRC
                     MIMLYVFSGLLSAESCLRIDGLDLSADLPFEDLPSYFQKLVTLLCKTGFVSIFNRSTI
                     ETMDHQYLRNIPMEYAGTVKLVDLAKYLNTYVTNTKQLKLRDEATSMQSRNIKNRLDF
                     KICLTCGVRVYSRSDGTEIMKHMAKNCFKAYSLFLIPHDSEVRLVLQHPHSHISIPAP
                     YLNSHGESGKNAIQRGDLTTLNIHRYEHLNYLWLNNEIPGYISRIMGDEFRVSIISSG
                     VVFNFDRNVLRRQMRANVGNEESSEEEDLMDDDEMSPDDDPDFRWEVTPEEFFRDGIL
                     RLGGAPGQGGDIRDFFQFITNLRTDDRNDNIPTFQFTNGALGRNQNDDDDQDGDEILP
                     "
     gene            <98539..>98983
                     /locus_tag="AGOS_AAL145W"
                     /old_locus_tag="AAL145W"
                     /db_xref="GeneID:4618560"
     mRNA            join(<98539..98541,98786..>98983)
                     /locus_tag="AGOS_AAL145W"
                     /old_locus_tag="AAL145W"
                     /product="AAL145Wp"
                     /transcript_id="NM_207750.1"
                     /db_xref="GeneID:4618560"
     CDS             join(98539..98541,98786..98983)
                     /locus_tag="AGOS_AAL145W"
                     /old_locus_tag="AAL145W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR183C (QCR9); 1-intron"
                     /codon_start=1
                     /product="AAL145Wp"
                     /protein_id="NP_982397.1"
                     /db_xref="GeneID:4618560"
                     /translation="MSFSTLYNTLFRRNSVFVGTIFASAFVFQTAFDSGITAWYEKHN
                     KGKLWKDVKLQLQNGEDDDDDE"
     gene            complement(<99351..>99662)
                     /locus_tag="AGOS_AAL144C"
                     /old_locus_tag="AAL144C"
                     /db_xref="GeneID:4618482"
     mRNA            complement(<99351..>99662)
                     /locus_tag="AGOS_AAL144C"
                     /old_locus_tag="AAL144C"
                     /product="AAL144Cp"
                     /transcript_id="NM_207751.1"
                     /db_xref="GeneID:4618482"
     CDS             complement(99351..99662)
                     /locus_tag="AGOS_AAL144C"
                     /old_locus_tag="AAL144C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR181W (TIM13)"
                     /codon_start=1
                     /product="AAL144Cp"
                     /protein_id="NP_982398.1"
                     /db_xref="GeneID:4618482"
                     /translation="MALSSIFGGGSPSQQSNLPTSSASSSVKDQLKGQIAQELAVANA
                     TELVNKVTENCFEKCLMAPYTSKQDTCVDQCLAKYMRSWNAISQAYVARIQQASANGD
                     I"
     gene            99806..99876
                     /locus_tag="AGOS_t0002"
                     /db_xref="GeneID:4618570"
     tRNA            99806..99876
                     /locus_tag="AGOS_t0002"
                     /product="tRNA-Gly"
                     /codon_recognized="GGC"
                     /db_xref="GeneID:4618570"
     gene            <100017..>100635
                     /locus_tag="AGOS_AAL143W"
                     /old_locus_tag="AAL143W"
                     /db_xref="GeneID:4618593"
     mRNA            join(<100017..100038,100100..>100635)
                     /locus_tag="AGOS_AAL143W"
                     /old_locus_tag="AAL143W"
                     /product="AAL143Wp"
                     /transcript_id="NM_207752.1"
                     /db_xref="GeneID:4618593"
     CDS             join(100017..100038,100100..100635)
                     /locus_tag="AGOS_AAL143W"
                     /old_locus_tag="AAL143W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL024C (APS3); 1-intron"
                     /codon_start=1
                     /product="AAL143Wp"
                     /protein_id="NP_982399.1"
                     /db_xref="GeneID:4618593"
                     /translation="MIHAVLIFNKKCQPRLVKYYTPVDLPKQKLLLEQVYELISQRNS
                     SIQSSFLITPPSLLSSGSETINEDIQIIYKNYATLYFTFIVDDQESELAILDLIQTFV
                     EALDRCFAEVNELDLIFNWQTLESVLEEIIQGGMVIETNVKKIVETVDELNRTSNQEA
                     RFGNGLGNAFQAITMGGFSNWGARQ"
     gene            complement(<100759..>101190)
                     /locus_tag="AGOS_AAL142C"
                     /old_locus_tag="AAL142C"
                     /db_xref="GeneID:4618449"
     mRNA            complement(<100759..>101190)
                     /locus_tag="AGOS_AAL142C"
                     /old_locus_tag="AAL142C"
                     /product="AAL142Cp"
                     /transcript_id="NM_207753.2"
                     /db_xref="GeneID:4618449"
     CDS             complement(100759..101190)
                     /locus_tag="AGOS_AAL142C"
                     /old_locus_tag="AAL142C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR174C (CBP4)"
                     /codon_start=1
                     /product="AAL142Cp"
                     /protein_id="NP_982400.2"
                     /db_xref="GeneID:4618449"
                     /translation="MERPVWFRWLRVYAIGFGIIGAGVLLFKYTTPTDEELIAALSPE
                     LRQQYERERKLRQAEQQELMRIVKQTAASETPVWNTGPIKSPWERKGVSAESREQFQQ
                     VKAEQVQREELQRIREELETIRQQSANKTQEIASKKSWWPW"
     gene            complement(<101503..>102996)
                     /locus_tag="AGOS_AAL141C"
                     /old_locus_tag="AAL141C"
                     /db_xref="GeneID:4618669"
     mRNA            complement(<101503..>102996)
                     /locus_tag="AGOS_AAL141C"
                     /old_locus_tag="AAL141C"
                     /product="AAL141Cp"
                     /transcript_id="NM_207754.1"
                     /db_xref="GeneID:4618669"
     CDS             complement(101503..102996)
                     /locus_tag="AGOS_AAL141C"
                     /old_locus_tag="AAL141C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR175C (ERG1)"
                     /codon_start=1
                     /product="AAL141Cp"
                     /protein_id="NP_982401.1"
                     /db_xref="GeneID:4618669"
                     /translation="MSKETSYPKELLCADEKVVYDAIVVGAGVVGPCVATALARKGKK
                     VLIVEREWSQPDRIVGELMQPAGVRALRSLGMVQAINNIDACSTSGYTVIYNGEKISF
                     AYPYKADLSPPEKIPDLVFDGNDKVVDDGTISAKEFEEDEREHGVGFVHGRFLQNLRA
                     ICAAEDRVTRLQGNVISILRNDSKEVIGAKVDVPGRGKVDFKAHMTFVCDGIFSRFRK
                     ELSTTNTSKVWSSFVGLSLHHADLPTKHHGHVILGSEHMPVIAYQISSTETRILCAYN
                     YPTLPKNVPEWLQKEVQPFIPPSLRKSFDAALESKSYKCMPNSWLPASQNNVTGLCVV
                     GDALNMRHPLTGGGMAVGLMDVVLLVKTIGDMDFSDREEVLNELLGFHYERKAHACVI
                     NTLSIALYSLFAADSYYLKKLQKGCFEYLGRGEDWVRQPISFLSGVLPSPYLLTKVFF
                     TVALYSVLINFRGRTPLGFLLAIYEGFAIIFTAAKVFTPFLYEQLLQ"
     gene            complement(<103420..>104970)
                     /locus_tag="AGOS_AAL140C"
                     /old_locus_tag="AAL140C"
                     /db_xref="GeneID:4618691"
     mRNA            complement(<103420..>104970)
                     /locus_tag="AGOS_AAL140C"
                     /old_locus_tag="AAL140C"
                     /product="AAL140Cp"
                     /transcript_id="NM_207755.1"
                     /db_xref="GeneID:4618691"
     CDS             complement(103420..104970)
                     /locus_tag="AGOS_AAL140C"
                     /old_locus_tag="AAL140C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL025W (RRN7)"
                     /codon_start=1
                     /product="AAL140Cp"
                     /protein_id="NP_982402.1"
                     /db_xref="GeneID:4618691"
                     /translation="MSTYIRGPVCGTDNCRSRLWRIINGHRTCQYGHVMEGDVEFNDD
                     DEEFSAMGVVTRRLNLTTNATGNFQSSQAFSQTQVLAQHEDEKRLLGAPARELFLKCF
                     QYILRKQCSWLIEEQGFPIEFSKTVKIIWMLYLKHMEPETPPAGDDANETVSAPSQTL
                     TERYRTANGGRMGLSMLSTLAFHYLACVHLGLPAHTDDFIRWVSSLEMPYFRAVECLP
                     AEWQKKLPNYYTQIMEGSSVPRNAQLHHKISSVALQVKFSAHFQDAIPAGPMILKLVT
                     LTGLPPEFYLYTTTLLELIEHHSYVSVLAHDSTHVARPHLYPELRIAALFITSVDWVL
                     QQQDYYNIEYLLAWLRRENAVRLTQDTASRNRELAHLAQQPTQLPVAWSQEQASAYLD
                     WLESDFLPKYDHFTNSHIPLDHKIARRKLYNILPLAPAAKLEPTHPSSRTFINTLQEF
                     YFTTASSLSTVSESPAAATRSAAVAKVRHKLVRDLAAEFGVSSQQLTNAVNTIQKQCL
                     VAVRRQAT"
     gene            complement(<105162..>107222)
                     /locus_tag="AGOS_AAL139C"
                     /old_locus_tag="AAL139C"
                     /db_xref="GeneID:4618498"
     mRNA            complement(<105162..>107222)
                     /locus_tag="AGOS_AAL139C"
                     /old_locus_tag="AAL139C"
                     /product="AAL139Cp"
                     /transcript_id="NM_207756.1"
                     /db_xref="GeneID:4618498"
     CDS             complement(105162..107222)
                     /locus_tag="AGOS_AAL139C"
                     /old_locus_tag="AAL139C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR178C (PBP1)"
                     /codon_start=1
                     /product="AAL139Cp"
                     /protein_id="NP_982403.1"
                     /db_xref="GeneID:4618498"
                     /translation="MKGSLNSRKEGAFSSVTAGRTGNDVGGSFYENEETKKAFSDRMN
                     YVLVNSIGGRAVVTIPSGVKYSGMLLACNATTSNGVDVILKYPRIIDKGIDEEDAAVL
                     SAQLKETLLIEGDDVAELELLDVDFSLDDKWEQIKRREEQKARERRDGKLQEFRTDTD
                     IAGAGEVKERELQKWTPDDSEAFALEGSLEDHAEEWDQFAVNEQKFGITSTFDEYLYT
                     TKINKGDPNYETRLKEADRIAREIEAQGTAGNVHLAEERGIVVDDSGMDEEDKYSGVD
                     RRGDELLAQLKMNAKPALGRPTKYVPPSLRNEPHNADPAILSSTKKGWSPPAPKSPVD
                     KKIQLDELKKFSEKFKVPYKMPEDVKTIFKKSEELPSKSPSALKVNPSLPPKPTPQPA
                     SSTATPSITPSKTSNRNSKPSTPASSKVELKRPQNKFGPQSGHTPSNSPSAGRANTYR
                     RRNNPPFFGDDGPKCLKKDFKKNFNVFLKSKEAFESRSRHKQTAEGKAMDAFLIEKPY
                     FTTPTWISTMDRSFRTLFPDERTAIQKAQLRLQHRIMNAIGGNMPMGSIPGMMAMPVG
                     PAGSQSTPFMASPGMFMPFQPQPMFYPPVPQMLTMVGGPADDRRNSTHSPSPTTNSPH
                     GAPAFINGAPIGPFGYPAAFQPIMAPVGTGNVNGVAGPNGNGSNYKNHYHHHNNGNRY
                     HRHR"
     gene            complement(<107399..>108322)
                     /locus_tag="AGOS_AAL138C"
                     /old_locus_tag="AAL138C"
                     /db_xref="GeneID:4618644"
     mRNA            complement(<107399..>108322)
                     /locus_tag="AGOS_AAL138C"
                     /old_locus_tag="AAL138C"
                     /product="AAL138Cp"
                     /transcript_id="NM_207757.1"
                     /db_xref="GeneID:4618644"
     CDS             complement(107399..108322)
                     /locus_tag="AGOS_AAL138C"
                     /old_locus_tag="AAL138C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR179C (OKP1)"
                     /codon_start=1
                     /product="AAL138Cp"
                     /protein_id="NP_982404.1"
                     /db_xref="GeneID:4618644"
                     /translation="MARNILDEIASESDPSQDEEGSLLAVDGDAFRLDQAAPAEPAAR
                     ELFLRDDSESPLRRPHGGSGSSEGGSSDAEGEAPETQRRPEGRKRVKFSAAERGVADF
                     NPWDIRRAVRRAFRDKLPENYSIKTWRRPPRALLRSLADLLSANADNAVEGALSAYHR
                     ELTRTLGPNELAAFRHDREQLIRSILHKLRTRLKRTHFPARVSEHVLDIEDIYARRTF
                     IQQRHIAELNAAEDLERQLLAEQQALAARTAERSDASAKVLLDRLTANLHPALNKAVS
                     NAYGLIKDAENTRETYLADCDDLNLHLSDTE"
     gene            <108988..>109983
                     /locus_tag="AGOS_AAL137W"
                     /old_locus_tag="AAL137W"
                     /db_xref="GeneID:4618464"
     mRNA            <108988..>109983
                     /locus_tag="AGOS_AAL137W"
                     /old_locus_tag="AAL137W"
                     /product="AAL137Wp"
                     /transcript_id="NM_207758.1"
                     /db_xref="GeneID:4618464"
     CDS             108988..109983
                     /locus_tag="AGOS_AAL137W"
                     /old_locus_tag="AAL137W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YGR144W (THI4)"
                     /codon_start=1
                     /product="AAL137Wp"
                     /protein_id="NP_982405.1"
                     /db_xref="GeneID:4618464"
                     /translation="MQNEHSEFAKMSQTLTNVQELRLRASTTRHALSDIVREKDWSDF
                     QFAPIREATVSRAMTTRYFEDLYRYAVSDVVIVGAGSSGLSAAYVLAKNRPDLRIAII
                     EANVAPGGGAWLGGQLFSAMIMRKPTHLFLDELEIPYEDEGDYVVVKHAALFTSTVLS
                     KVLQFPNVKLFNATAVEDLVTKPSANGGVTIAGVVTNWTLVTMAHDVQSCMDPNVIEL
                     EGYKDDGTRDPKKKHGVVLSTTGHDGPFGAFCAKRLAALDAQHAIKGMQSLDMNTAEA
                     GVVKESGATAGVEYMYFAGMETATKKGVSRMGPTFGAMAVSGIKAAEEILRHFAE"
     gene            complement(<110158..>111426)
                     /locus_tag="AGOS_AAL136C"
                     /old_locus_tag="AAL136C"
                     /db_xref="GeneID:4618603"
     mRNA            complement(<110158..>111426)
                     /locus_tag="AGOS_AAL136C"
                     /old_locus_tag="AAL136C"
                     /product="AAL136Cp"
                     /transcript_id="NM_207759.1"
                     /db_xref="GeneID:4618603"
     CDS             complement(110158..111426)
                     /locus_tag="AGOS_AAL136C"
                     /old_locus_tag="AAL136C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL026W (RNR2) and YGR180C (RNR4)"
                     /codon_start=1
                     /product="AAL136Cp"
                     /protein_id="NP_982406.1"
                     /db_xref="GeneID:4618603"
                     /translation="MPETSVPKETPSKVTANALSELDLTTSRRSLGPTLAKENQPQLG
                     SHEKVHIIDEKHAVADGDVDANQSLSQAAREHQQFLRSHQVHRHHLKEQEKNEPLLME
                     NKRRFVLFPIKYHDIWQAYKRAEASFWTAEEIDLSKDIHDWNNRMTENERFFISRVLA
                     FFAASDGIVNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKEA
                     DHLFNAIETIPEIKEKAEWAIRWIQDKDALFAERLVAFAAVEGIFFSGSFAAIFWLKK
                     KGLMPGLTFSNELICRDEGLHTDFACLLFAHLNNKPDTEIVEKIITEAVEIEKRYFQD
                     AIPVALLGMNSSLMNQYVEFVADRLLVALGNKKYYNVSNPFDFMENISLAGKTNFFEK
                     RVSDYQKAGVMAKSTKQESESGAFTFDEDF"
     gene            complement(<111644..>112417)
                     /locus_tag="AGOS_AAL135C"
                     /old_locus_tag="AAL135C"
                     /db_xref="GeneID:4618633"
     mRNA            complement(<111644..>112417)
                     /locus_tag="AGOS_AAL135C"
                     /old_locus_tag="AAL135C"
                     /product="AAL135Cp"
                     /transcript_id="NM_207760.1"
                     /db_xref="GeneID:4618633"
     CDS             complement(111644..112417)
                     /locus_tag="AGOS_AAL135C"
                     /old_locus_tag="AAL135C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR172C (YIP1)"
                     /codon_start=1
                     /product="AAL135Cp"
                     /protein_id="NP_982407.1"
                     /db_xref="GeneID:4618633"
                     /translation="MSYYANHNSQGGFYQPSQQFQFPQGAMSFDPSGSGGLSNSSPAN
                     FTNEQLPNGIINALSTRGYSFEPPLLEELGINFGHILTKTKFVLTPTTSVNLPLEIFN
                     DTDLSGPLLFCLVFGTMLLTAGKVHFGYIYGVALFGSLSLYQLLRLMSQPVSPASQTA
                     SPSATPVPHASNAVSFLKTASILGYSFLPLCFLATVGVFCSLNNWFGYILGLISVVWC
                     TWSSSGFFIYYLQLHNVRVLIAYPLLIFYSVFALMAIFV"
     gene            <112667..>113773
                     /locus_tag="AGOS_AAL134W"
                     /old_locus_tag="AAL134W"
                     /db_xref="GeneID:4618526"
     mRNA            <112667..>113773
                     /locus_tag="AGOS_AAL134W"
                     /old_locus_tag="AAL134W"
                     /product="AAL134Wp"
                     /transcript_id="NM_207761.1"
                     /db_xref="GeneID:4618526"
     CDS             112667..113773
                     /locus_tag="AGOS_AAL134W"
                     /old_locus_tag="AAL134W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR173W (RBG2)"
                     /codon_start=1
                     /product="AAL134Wp"
                     /protein_id="NP_982408.1"
                     /db_xref="GeneID:4618526"
                     /translation="MGVIEKIKAIEEEMARTQKNKATEHHLGLLKGKLARYRQQLLEE
                     STASSGGGGTGFEVAKSGDARVVLIGYPSVGKSSLLGKVTTTKSEVAHYAFTTLTSVP
                     GVLKYQGAEIQMVDLPGIIHGASKGKGRGRQVIATARTADLIVMVLDATKSNHQRESL
                     ERELETMGIRLNKEKPNIYFKKKETGGLKITFTSPDRSNLTEEAIKLILRDYRIHNAD
                     ILVRDSSCTIDDFIDVLNEQHRNYIKCLYVYNKIDAVSLEEVDRLAREPNTVVMSCEM
                     DLGLEDVVDEIWYQLHLNRVFTKKRGVRPDFSDPLVVRNGSTVGDLCHQIHRDFKDKF
                     KYALVWGSSAKHSPQKCGLNHKIHDEDVISLFTK"
     gene            <113952..>115655
                     /locus_tag="AGOS_AAL133W"
                     /old_locus_tag="AAL133W"
                     /db_xref="GeneID:4618649"
     mRNA            <113952..>115655
                     /locus_tag="AGOS_AAL133W"
                     /old_locus_tag="AAL133W"
                     /product="AAL133Wp"
                     /transcript_id="NM_207762.1"
                     /db_xref="GeneID:4618649"
     CDS             113952..115655
                     /locus_tag="AGOS_AAL133W"
                     /old_locus_tag="AAL133W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR171C (MSM1)"
                     /codon_start=1
                     /product="AAL133Wp"
                     /protein_id="NP_982409.1"
                     /db_xref="GeneID:4618649"
                     /translation="MVASTRRALRAIQKFHITTPIFYPNAKPHLGHLYSSLICDVQAR
                     WQKLRDSEVLFTTGTDEHGLKIQTASEQQGYASPKVFVDKLCTHFISLDEQANIGYTR
                     FIRTTDKDHISNVLRLWELCKANGYIYKGEHSGWYSVSDETFYPATKVVQVIDGREFP
                     VMDGSTVTEGAEYINTETRNRVIHQTEVNYFFRLSSFRERLISHLKENPGFILPPSRS
                     AQILDLLLKAELPDLSISRPKTRLKWGISVPGDESQKIYVWFDALCNYVTSIGGVDAV
                     LEDRPIANLVHSIPQGSVSGSSKEWWNATTHLVGKDIVKFHTIYWPAILLAAGLPLPE
                     KVVVHGHWLSDGVKMSKSLGNVVVPEEMIEKYDTDPMRWFILEHDTIEHDASFSEEGL
                     CQTRELLCSKWGNLLHRCGGPKFNIHRAVQKFHHKPITDLTKNNPELYGNLLSRLTTL
                     ADEIDQLLSKYDTANALRLIWSIINDANMVVQHGEPWKKPLEEQDLIIYTAVEAARIV
                     SIAAQPFIPVLANRFLDRLDVHFDKRSLEYASVGADSSYGTTANVRGREVPISSLSRQ
                     R"
     gene            complement(<115713..>116960)
                     /locus_tag="AGOS_AAL132C"
                     /old_locus_tag="AAL132C"
                     /db_xref="GeneID:4618641"
     mRNA            complement(<115713..>116960)
                     /locus_tag="AGOS_AAL132C"
                     /old_locus_tag="AAL132C"
                     /product="AAL132Cp"
                     /transcript_id="NM_207763.1"
                     /db_xref="GeneID:4618641"
     CDS             complement(115713..116960)
                     /locus_tag="AGOS_AAL132C"
                     /old_locus_tag="AAL132C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR006W (POL31)"
                     /codon_start=1
                     /product="AAL132Cp"
                     /protein_id="NP_982410.1"
                     /db_xref="GeneID:4618641"
                     /translation="MQFYQMYAYRLNESRKRVLANCQRKWDDGFRIQGKPVVQKAKVL
                     DIQAGEPCWCVGTIYCEMKYKPNVLEEVVNDTYGTKAPVKSYTDPEGTDEIMLEDESG
                     RVLLVGDIITSTPFVTGTVVGVLGMEAEAGTFQVVDICYPQAIPQAPLVRAPGKSVAL
                     ISGICAASNDPKLSLKLRLLQDLLSGDIGDTGSIASVARLIICGDSVGTCESNSIGGA
                     LDELGSFMANTLTSLPITILPGANDPSERSLPQQPLHKALFKQALKPYFAEVNSEVFE
                     SVTNPYWFDLEGIQVLVSSGQNVDDMCKYVIPYLGTEQLRDTIEHRLDLIEASLKWQN
                     IAPTAPDTLWCYPYKDNDPFIMNEWPHVYIIGNQHAYGYRKVLLENEVEVVLITLPKF
                     SSSGQFVILDLDTLNAEVITIDA"
     gene            complement(<117330..>120374)
                     /locus_tag="AGOS_AAL131C"
                     /old_locus_tag="AAL131C"
                     /db_xref="GeneID:4618567"
     mRNA            complement(<117330..>120374)
                     /locus_tag="AGOS_AAL131C"
                     /old_locus_tag="AAL131C"
                     /product="AAL131Cp"
                     /transcript_id="NM_207764.1"
                     /db_xref="GeneID:4618567"
     CDS             complement(117330..120374)
                     /locus_tag="AGOS_AAL131C"
                     /old_locus_tag="AAL131C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR170W (PSD2)"
                     /codon_start=1
                     /product="AAL131Cp"
                     /protein_id="NP_982411.1"
                     /db_xref="GeneID:4618567"
                     /translation="MGVGLIRRRRRSRQPRLTLKVEVQQARIVTVEDTRCNPLCLVVT
                     NGVFNRTKRFKNTSTPSWRQTLKLALPSKPSSEWLRVLLYDDVLRWQDNGDNSLERGR
                     YLYLGEARFSLLDLFRGEKGKYSPERSAEWVPFYSGRTGYKAGEVLLAFSLVSSGNEP
                     STMAVFREWRSYLLDSLAARRIQRKQEIELLGEGQRLADTEDDEGDDDDEDNENMLGY
                     TSLSDSSPDDFTNYEDIIEHSMVSCYIEDEEEDEGDTFDNDDWEYMDDIFYADDKSYG
                     TDQQGMESKRYNQNNGSVDSFAFVPEVSTTPFTEVSESSNAKEKDSHSSDDTEGTEVM
                     LFGRRKRNMRRARPRNNDFEISKKTHAMGVAFVEVKRILDLPPLRNKFSTTFDMDPFV
                     IITFGRRVFKTSWKKHSLNPEYNEQAAFEVYPHEMSFKLDFRVLDRDSFSFHDRVADA
                     SVDFKDVISRKSTNGICHWDLEVPLNLRYNTLSETHASRMYLKLSFFPYHILKKHFWD
                     QVINAASTLQHFDVVQLTLLLDGLGHFTEDEVNEFFYHSGKSPWSKDTLPKEVIIRHL
                     QEWKNSSAFRRVQKCPLCCQQVKATKALRHSKLNAENDLITHFAICSSGHKKQLKPSY
                     VSSDFASKRWFSRLLIKLTYGKYALGSNNANILVQDRDTGIVIEEKISAYVKLGIRII
                     YNARGKQSKKFKSLLRSVTIKQGKKFDRPASAKDIEPFIKFHSLDMSECLETNFTTFN
                     EFFYRKLKPGSRTPESPNPKVLLSPADSRCTVFATVRRSKEIWIKGRTFTLEKLTGGQ
                     FPELCNERSCSVGIFRLAPQDYHRFHSPCNGVIGKPHYISGEYYTVNPMAVRTELDVF
                     AENVRVVVPIISEEYGTLLYIPIGAMMVGSIILTCNPGDKVKRGQELGYFKFGGSTVL
                     LVLQSKNIVLDTDLVKNSEENIETLVRVGMSIGHTPDIKEHCRTKVHVNDNEELERIK
                     RTITVTEENAQSTNYTSWEYQTLKKLNEKEPEFQGLLDILTE"
     gene            <120875..>121156
                     /locus_tag="AGOS_AAL130W"
                     /old_locus_tag="AAL130W"
                     /db_xref="GeneID:4618647"
     mRNA            <120875..>121156
                     /locus_tag="AGOS_AAL130W"
                     /old_locus_tag="AAL130W"
                     /product="AAL130Wp"
                     /transcript_id="NM_207765.1"
                     /db_xref="GeneID:4618647"
     CDS             120875..121156
                     /locus_tag="AGOS_AAL130W"
                     /old_locus_tag="AAL130W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR005C-A and YGR169C-A"
                     /codon_start=1
                     /product="AAL130Wp"
                     /protein_id="NP_982412.1"
                     /db_xref="GeneID:4618647"
                     /translation="MGKRFSESAAKKIAGQARKREQAATKERAERERLEAEEASKWEE
                     GSRQANARKLQEEQKRLEKLKAKQEREALLAAEEEALGKGGKGKKSTRK"
     gene            complement(<121231..>122103)
                     /locus_tag="AGOS_AAL129C"
                     /old_locus_tag="AAL129C"
                     /db_xref="GeneID:4618615"
     mRNA            complement(<121231..>122103)
                     /locus_tag="AGOS_AAL129C"
                     /old_locus_tag="AAL129C"
                     /product="AAL129Cp"
                     /transcript_id="NM_207766.1"
                     /db_xref="GeneID:4618615"
     CDS             complement(121231..122103)
                     /locus_tag="AGOS_AAL129C"
                     /old_locus_tag="AAL129C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL023C (PET130)"
                     /codon_start=1
                     /product="AAL129Cp"
                     /protein_id="NP_982413.1"
                     /db_xref="GeneID:4618615"
                     /translation="MSCKLLLERVARWAGPEAAGPVGQLTPPVTSGGASFLRVGAAAT
                     QTDPEPSTTCLKGVLAPVQQYYMTRCRTWAPQVYQCDYFALRFFPAEHFLGMARKSKP
                     GLLLTYTGDHLLNANVGDQSAGVQQRVELARSAEMEKRLRQISNLIQARGSLRPRDWS
                     YLRVGARKTIRAQFLQAWCKYHGPEAVLARLEGAMDSPFLDKHGRTAHKVAKDGLYHY
                     TIRVFPDGTTAADFAAHLERSVLYTANLSWDSYSRHAGRKWISENNAQADIAALNKAL
                     HKSDIPYRYIKSST"
     gene            complement(<122219..>122755)
                     /locus_tag="AGOS_AAL128C"
                     /old_locus_tag="AAL128C"
                     /db_xref="GeneID:4618577"
     mRNA            complement(<122219..>122755)
                     /locus_tag="AGOS_AAL128C"
                     /old_locus_tag="AAL128C"
                     /product="AAL128Cp"
                     /transcript_id="NM_207767.1"
                     /db_xref="GeneID:4618577"
     CDS             complement(122219..122755)
                     /locus_tag="AGOS_AAL128C"
                     /old_locus_tag="AAL128C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YBR072W (HSP26)"
                     /codon_start=1
                     /product="AAL128Cp"
                     /protein_id="NP_982414.1"
                     /db_xref="GeneID:4618577"
                     /translation="MQSSGRSTAMSSPFFDFVDSINHEVNSINNRLMNAGRSGQRSLR
                     PVSRISNWLLPQDEDLMPPVDMLEREREYEVGISVPGVASHDDIQLEYRRNNNEIIVS
                     GEIPALEEDAVEDGWRVRERAHGRFKRAIGLPEKPGIDAEHIEAQYKDGVLKLKVPKL
                     EDRDQPDEVRRIAIGSKQ"
     gene            <123217..>126399
                     /locus_tag="AGOS_AAL127W"
                     /old_locus_tag="AAL127W"
                     /db_xref="GeneID:4618600"
     mRNA            join(<123217..123395,123786..>126399)
                     /locus_tag="AGOS_AAL127W"
                     /old_locus_tag="AAL127W"
                     /product="AAL127Wp"
                     /transcript_id="NM_207768.2"
                     /db_xref="GeneID:4618600"
     CDS             join(123217..123395,123786..126399)
                     /locus_tag="AGOS_AAL127W"
                     /old_locus_tag="AAL127W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL157W (APE2) and YHR047C (AAP1); 1-intron"
                     /codon_start=1
                     /product="AAL127Wp"
                     /protein_id="NP_982415.2"
                     /db_xref="GeneID:4618600"
                     /translation="MQKRVYTTERAYSTADLMLAAAIGRRITTAWPGVFRRGPGRCAL
                     HAASRALWCKPTTHTRDNMCQNSNNGAGKKPREVLPANVKPVHYQLQMEPDFTGFTFQ
                     GQVNIELEVNDPAVNSVELNTCDLEIQESRIGETAATFVEHNEDLQRTRFTFPETVFQ
                     QDKRVTLSLKFTGILNDNMAGFYRAKYEDKLTGETKYMATTQMEPTDARRAFPCFDEP
                     NLKATYDITLVSEPNYTHLSNMDVKKEELRDGKKYTEFNTTPPMSTYLVAFVISELRY
                     VENKDFRIPIRVYATPGNEHLGQFAADLTAKTLAFFENAFGIQYPLPKIDNVAVHEFS
                     AGAMENWGLVTYRVVDLLLDRENTTLGCLQRVAEVVQHELAHQWFGNLVTMDWWEGLW
                     LNEGFATWMSWYSCNEFEPEWRVWEQYVPDNLQSALSLDSLRSSHPIEVPVKRADEIN
                     QIFDAISYSKGSSLLRMISKWLGEDVFVKGVSNYLNKFKYGNAKTTDLWDALSETSGK
                     DVRSVMDIWTKKVGFPVITVEENDGKLTFTQHRYLSTGDVKPEEDQTIYPVFLSLRTK
                     KGVDNTLVLDKRSISVDLEDIDFYKVNADQAGIYITSYPDERWDKFASQASLLSVEDR
                     TGLVGDVRSLASSGYTSTANLLKLVSKWSNEDSFVVWDEMASCLFSLRSNWMFENEEV
                     TKAIDHYLRQLFAPKAHALGWNFTDEDTFASQRLKIRLFSAACSVGDEKVSNAALEMF
                     DKYIAGDKKAIHPLIKPSVFIAAANKGTEFYYEKILEIYKNASSDDEKLAALRTLGKF
                     NDPKLIQRTLGFLFDGTVLTQDIYIPMQGLRTHKEGIVALWAWFQENWDEIVKRLPPG
                     LSMLGSVVILATSAFSSHQMADEVRAFFATKSTKGFDQSLAQSLDSITAKAQWLDRDR
                     EVVAEYLKGNYYKNHK"
     gene            complement(<126585..>128237)
                     /locus_tag="AGOS_AAL126C"
                     /old_locus_tag="AAL126C"
                     /db_xref="GeneID:4618548"
     mRNA            complement(<126585..>128237)
                     /locus_tag="AGOS_AAL126C"
                     /old_locus_tag="AAL126C"
                     /product="AAL126Cp"
                     /transcript_id="NM_207769.2"
                     /db_xref="GeneID:4618548"
     CDS             complement(126585..128237)
                     /locus_tag="AGOS_AAL126C"
                     /old_locus_tag="AAL126C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR045W"
                     /codon_start=1
                     /product="AAL126Cp"
                     /protein_id="NP_982416.2"
                     /db_xref="GeneID:4618548"
                     /translation="MGLWIIFELAVTVVICCWTTNWLIQHVILDAKRDLQKAALAEQA
                     SIAPVRKEGETAIYRNMLVPMGFPLTTGLNLSRGYQFRRGNFGDIWSAAVAVGKGENY
                     ICFADGMRWTVGTVNHAAKQLRAYFMQEKLAHVGIVPSVSTRGGFICAIAAFMASLDG
                     GVAHFLPAVPRKDRALDVLVIDSWEIAARLNGSENWYKRIIVCDHSAKPPGLPANLIS
                     LHELIDDKESDDTFKYECTDDTDDNKEFLRISNVSMETTSYLQGSLVSSVANFIKTFP
                     MAQSLSERDKLTVVLDQLEESLALQIWSKLFAVLLHGSSISFVKASDLRTISSSTTLL
                     VVSGQAQGIKDLVSTQLQKCNRFMFSWAISLLSEGVFSGCARISTNFANLRCVYIMNE
                     VACARHLNFFPEEIPQRESTDVRRLTRIQLNQIRALLGARVVMELYAPYTIMGPIAQT
                     NIYDYRIFPALVDATFTCYGTLSTSLEGKLVDSAANPDLSSAKRQGLLVVRGFTIGKP
                     LEQERLDRAMKLVQNFHGGEGWTPLVGVFGIWGSDGCFYEFK"
     gene            <128577..>129590
                     /locus_tag="AGOS_AAL125W"
                     /old_locus_tag="AAL125W"
                     /db_xref="GeneID:4618575"
     mRNA            <128577..>129590
                     /locus_tag="AGOS_AAL125W"
                     /old_locus_tag="AAL125W"
                     /product="AAL125Wp"
                     /transcript_id="NM_207770.2"
                     /db_xref="GeneID:4618575"
     CDS             128577..129590
                     /locus_tag="AGOS_AAL125W"
                     /old_locus_tag="AAL125W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR279W (RNH202)"
                     /codon_start=1
                     /product="AAL125Wp"
                     /protein_id="NP_982417.2"
                     /db_xref="GeneID:4618575"
                     /translation="MPPILKGDVPETYVVILPKCVENSTLTVFQLPHPSNNRSKSPVR
                     LFIHDGLVYQLQTQKFSRGCPYNRADDEVNERYHYTADGQAYKSAIYLNEEDPSQSLV
                     LESGEFDYHTKYDLAFSLCRYYYRNNVVNTEAECLEPSRQAVRPSSNFLAVRDFHDEL
                     VSVDNPNWSHVPLDVLEAALLRVSDVVEEAGDRYFRISPQRITQWLSTKVERMLPVFP
                     SSLPLPSGIPDEYLRDVKTAWSTNLLLSLIPQLAYWELRNYEGENLNIKQAFARQDKY
                     KTDVLEKQKENDILIKGAMSVGLQQDVKREGPPRQTTNLKSTVKKKVATGKGAIDSFF
                     KKR"
     gene            <129770..>130687
                     /locus_tag="AGOS_AAL124W"
                     /old_locus_tag="AAL124W"
                     /db_xref="GeneID:4618536"
     mRNA            <129770..>130687
                     /locus_tag="AGOS_AAL124W"
                     /old_locus_tag="AAL124W"
                     /product="AAL124Wp"
                     /transcript_id="NM_207771.1"
                     /db_xref="GeneID:4618536"
     CDS             129770..130687
                     /locus_tag="AGOS_AAL124W"
                     /old_locus_tag="AAL124W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR280W (RRP45)"
                     /codon_start=1
                     /product="AAL124Wp"
                     /protein_id="NP_982418.1"
                     /db_xref="GeneID:4618536"
                     /translation="MAKAIEISTSESAFILEALRQNLRLDGRTFDQFRDVEIELGSEY
                     GDVTITMGKTKIHCRISAQIAQPYEDRPFEGLFVISTEMSPMAGAQFENGNNTGEDEV
                     LISRMIEKAVRRSSAMDLEGLCIIAGSKCWAIRADVHFLDCDGGFIDASCIAVMTGLL
                     HFRKPDVSVQGEQVIVHPVDEREPVALGILHIPVCVTFSFYNPEDAEVNVKGDSADEI
                     AIIDATLKEELLRDGVLTVTLNKNREVVQLSKAGGLPMDALSLMNCCHKAYTITEKIT
                     DQILAALKQDALQRDKYAAVLSAENPREA"
     gene            <131446..>132315
                     /locus_tag="AGOS_AAL123W"
                     /old_locus_tag="AAL123W"
                     /db_xref="GeneID:4618461"
     mRNA            <131446..>132315
                     /locus_tag="AGOS_AAL123W"
                     /old_locus_tag="AAL123W"
                     /product="AAL123Wp"
                     /transcript_id="NM_207772.1"
                     /db_xref="GeneID:4618461"
     CDS             131446..132315
                     /locus_tag="AGOS_AAL123W"
                     /old_locus_tag="AAL123W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR043C (DOG2) and YHR044C (DOG1); Tandem gene duplication
                     in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AAL123Wp"
                     /protein_id="NP_982419.1"
                     /db_xref="GeneID:4618461"
                     /translation="MCPITVDVCLFDLDGTIVDTTDAVEAAWQKVGRAHQVDAAKIRR
                     NSHGRRASETFKQYFPDADNDAAVKEFEHALVSQSHYVGLIPGANDLLLTLDRPSGCN
                     PGEVFRDNRWAIVTSATPSLARSWFNTLLKKVKPPKVFITSADVAKGKPDPEGYQKAK
                     DQLADILGLNKDKVRAVVFEDSALGIRAAKAMGAIAVGITSTYSKDVLYRSGADYVVE
                     DLAQVCVMQNGPDGITLEITGSMEKGTSDAVFEEDEEDEAGDETNDDDDDDDDYNEDE
                     YYDNSDGDHGKGR"
     gene            complement(<132428..>133528)
                     /locus_tag="AGOS_AAL122C"
                     /old_locus_tag="AAL122C"
                     /db_xref="GeneID:4618564"
     mRNA            complement(<132428..>133528)
                     /locus_tag="AGOS_AAL122C"
                     /old_locus_tag="AAL122C"
                     /product="AAL122Cp"
                     /transcript_id="NM_207773.1"
                     /db_xref="GeneID:4618564"
     CDS             complement(132428..133528)
                     /locus_tag="AGOS_AAL122C"
                     /old_locus_tag="AAL122C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR282C"
                     /codon_start=1
                     /product="AAL122Cp"
                     /protein_id="NP_982420.1"
                     /db_xref="GeneID:4618564"
                     /translation="MLGRFTRLLVATAQGYRYASNSASAKPIARSLRRSVLPDGPWKI
                     TEDKSHPLAHRVSKQMSIKPVTAITTSESYDLNKVIELLFQKGYQPVNLIPNEIVTFK
                     YFYEGLQGDVMVIGQNGSVVSWGFDEASHKQHILPLIDGARTNPLPQSLYESEDLDYV
                     EIESKEEWSQISSLVNVSGLEQSFIKEDLIVVDRTSGDKDMLDKAAFSSGISRSTMLA
                     VLERNMEAHIESTRSFTELLSKGNRLNITEAEILKSTGRLFLMRGKLNLYSELIETPD
                     LYWSEPTLETIYKQVSRNLDVPARISILNKKLDYATDESRALMSVLNEKKSTRLEWII
                     IYLITVEVCFELHHFYERFFGGKPDAHASLQE"
     gene            complement(<133709..>135775)
                     /locus_tag="AGOS_AAL121C"
                     /old_locus_tag="AAL121C"
                     /db_xref="GeneID:4618441"
     mRNA            complement(<133709..>135775)
                     /locus_tag="AGOS_AAL121C"
                     /old_locus_tag="AAL121C"
                     /product="AAL121Cp"
                     /transcript_id="NM_207774.1"
                     /db_xref="GeneID:4618441"
     CDS             complement(133709..135775)
                     /locus_tag="AGOS_AAL121C"
                     /old_locus_tag="AAL121C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR042W (NCP1)"
                     /codon_start=1
                     /product="AAL121Cp"
                     /protein_id="NP_982421.1"
                     /db_xref="GeneID:4618441"
                     /translation="MALKFDKLDFAVICALALAVVAYLKLDVLKELFAADDSALAVQS
                     SSRDIVEVLRENKKDYLVVYASQTGTGEDYAKKFAKELAAKYSLNVMCVDVENYDFDN
                     LNSLPKDVIVSFFVSTYGEGDLPDGGLEFEEWLQVLEEGDLGNVRYTMFGLGNSTYEF
                     YNGAAEKTQKLLKQAGARMLGTFGKADDGAGTTDEDYMAWKDDILEELKDALALHEKE
                     VSFISSYEYKVLPQDLMGSISLGEPNSQYLPGKTLAKKENMQLGPFDATHPYVAPITS
                     TKELFKKKDRNCIHVEFDLSGSNLKYSTGDHLGVWPSNPDEKVEKFLTTFGLDPTTIF
                     DLKPKDITIKPPFPVPTTIGAAVRYYLEISGPVSRQVIGSLLQYVTEEQLKERLQALS
                     KNKEKYAKEITSKCMDLADALLYLSSGKKWTQVPWEFLIETVPHMQPRYYSISSSSSS
                     DKQTVHITAVVENYPNPEVSSLGPVTGVTTNLLRHIHLTRTKEDIAASSLPVHYNLAG
                     PRDLYQNYKLPVHVRRSTFRLPSNPSTPVIMVGPGTGVAPFRGFIRERISFLKNQENV
                     KLGKHLLFYGCRDDADFLYHDEWPVYAKELGSSFELMVAYSRIPNKKKVYVQDHLLER
                     ENEVLELINKGAFIYVCGDAKGMSQDVHRTLIDILRRGKNISEEESSEILKQFKTTGK
                     YQEDVW"
     gene            complement(<136161..>137054)
                     /locus_tag="AGOS_AAL120C"
                     /old_locus_tag="AAL120C"
                     /db_xref="GeneID:4618569"
     mRNA            complement(<136161..>137054)
                     /locus_tag="AGOS_AAL120C"
                     /old_locus_tag="AAL120C"
                     /product="AAL120Cp"
                     /transcript_id="NM_207775.1"
                     /db_xref="GeneID:4618569"
     CDS             complement(136161..137054)
                     /locus_tag="AGOS_AAL120C"
                     /old_locus_tag="AAL120C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR288W (NSE3)"
                     /codon_start=1
                     /product="AAL120Cp"
                     /protein_id="NP_982422.1"
                     /db_xref="GeneID:4618569"
                     /translation="MSDEAEAAETRSPLVCNVVRFVLSQCESQVRSTVLTKTRFTNAA
                     RDIAAAENITTTKYAKIFDEANAVLEEVYGFRLVGIPNKKSASNKASRTGDAEAADGD
                     PGSTPITDLGFKGDRFILCSTIKAPPAYMQMVLDQSRQLYVKRLGSGQYEPGTETDHT
                     LTSQFDTDQILALQGIMAVVICIILFSKNNALEQELLTHLAKFGIPTDGYAVPIINMR
                     IQDVLSYMVRLEYIQRTAPAASETGALDSIFYSVDRRTQVEFPQESLVEMCQRLLGLE
                     QTAVQSLRESIALSIGDAYSI"
     gene            complement(137152..137223)
                     /locus_tag="AGOS_t0003"
                     /db_xref="GeneID:4618814"
     tRNA            complement(137152..137223)
                     /locus_tag="AGOS_t0003"
                     /product="tRNA-Gln"
                     /codon_recognized="CAA"
                     /db_xref="GeneID:4618814"
     gene            <137919..>139532
                     /locus_tag="AGOS_AAL119W"
                     /old_locus_tag="AAL119W"
                     /db_xref="GeneID:4618581"
     mRNA            <137919..>139532
                     /locus_tag="AGOS_AAL119W"
                     /old_locus_tag="AAL119W"
                     /product="AAL119Wp"
                     /transcript_id="NM_207776.1"
                     /db_xref="GeneID:4618581"
     CDS             137919..139532
                     /locus_tag="AGOS_AAL119W"
                     /old_locus_tag="AAL119W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR021W (ATG18)"
                     /codon_start=1
                     /product="AAL119Wp"
                     /protein_id="NP_982423.1"
                     /db_xref="GeneID:4618581"
                     /translation="MSRTGMPVINFINFNQTGTCISMGTSEGLKIFNCDPFGRFYSDE
                     DGGCGIVEMLFSTSLLAVVGIGDNPSMSPRRLRILNTKRHSVICEVTFPTTILAVKMN
                     RSRLVVLLQEQIYIYDINSMRLLYTIETSSNPRGLISMSPSLENNYLAYPSPPKVINS
                     GIKSNANTNNIGISARSSIAEGGSEYLDKGTEPLTDSSKAGADLNSVKASTETTISPG
                     KEHSAGSGLNATSSSGTVKNGDVIFFNLQTLQPTMVIEAHKGEIAALALSKDGTLLAT
                     ASEKGTIIRVFSVETCTKVYQFRRGTYPTRIYSLNFSDDNEFLAASSSNKTVHIFKLG
                     KPNAENSSAAATNSDDDEGEADSDDGADDDGVGDSDDTRSTVSIESFDNGSHQTREPI
                     VDSSRKTVGRMIRKSSQNLSRKAAKALGSYFPKKVTSILEPRRHFASLKIPIESGSNL
                     KTICTIGEPLTLDISDYPELFSGSRTMAQSASISANSSDSSLTRNSNFVKMIPIRVVS
                     SEGYMYNYVLDPERGGDCLLLSQYPLLMD"
     gene            complement(<139712..>140035)
                     /locus_tag="AGOS_AAL118C"
                     /old_locus_tag="AAL118C"
                     /db_xref="GeneID:4618491"
     mRNA            complement(<139712..>140035)
                     /locus_tag="AGOS_AAL118C"
                     /old_locus_tag="AAL118C"
                     /product="AAL118Cp"
                     /transcript_id="NM_207777.1"
                     /db_xref="GeneID:4618491"
     CDS             complement(139712..140035)
                     /locus_tag="AGOS_AAL118C"
                     /old_locus_tag="AAL118C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR265W (RBL2)"
                     /codon_start=1
                     /product="AAL118Cp"
                     /protein_id="NP_982424.1"
                     /db_xref="GeneID:4618491"
                     /translation="MAPTQLEIKVRALQRLIKEEKYYQDELREQRERVELLKRDASVD
                     PYELKKQIEVMQDTERLLPRFYEKVQQFYNDLKDFVNGYNGDEDTADAHNALKLGNDL
                     LASRK"
     gene            complement(<140326..>141369)
                     /locus_tag="AGOS_AAL117C"
                     /old_locus_tag="AAL117C"
                     /db_xref="GeneID:4618621"
     mRNA            complement(<140326..>141369)
                     /locus_tag="AGOS_AAL117C"
                     /old_locus_tag="AAL117C"
                     /product="AAL117Cp"
                     /transcript_id="NM_207778.1"
                     /db_xref="GeneID:4618621"
     CDS             complement(140326..141369)
                     /locus_tag="AGOS_AAL117C"
                     /old_locus_tag="AAL117C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR262W"
                     /codon_start=1
                     /product="AAL117Cp"
                     /protein_id="NP_982425.1"
                     /db_xref="GeneID:4618621"
                     /translation="MAYGQIVIGPPGSGKSTYCNGCSQFFNAIGRHARIVNMDPANDS
                     LPYQCDVDIRDFITLEEIMNEQHLGPNGGLVYAFESVEHSLSLFALQIKTLVKDENAY
                     LVFDCPGQVELFTHHSALSKIFQQLVRDLDLRVCVVNLMDSIYITSPSQYVSVLLLAL
                     RSMLMMDLPHINVLSKIDMLSSYGDLPFRLDYYTEVQDLEYLQPHIEREHKGAKALRY
                     RRLTEAIGEVVSDFNLVAFEVLCVDDKQSMINLQSAIDKANGYIFGASEVGGDTVWAE
                     ATRQGTAAIEYDIQDRWIDNKDFYDKEEEARRKKLLEEHELLEKEVDVNQDDEWERAV
                     KEWESQHSVNFVK"
     gene            <141614..>142594
                     /locus_tag="AGOS_AAL116W"
                     /old_locus_tag="AAL116W"
                     /db_xref="GeneID:4618472"
     mRNA            <141614..>142594
                     /locus_tag="AGOS_AAL116W"
                     /old_locus_tag="AAL116W"
                     /product="AAL116Wp"
                     /transcript_id="NM_207779.1"
                     /db_xref="GeneID:4618472"
     CDS             141614..142594
                     /locus_tag="AGOS_AAL116W"
                     /old_locus_tag="AAL116W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR261C (RPN8)"
                     /codon_start=1
                     /product="AAL116Wp"
                     /protein_id="NP_982426.1"
                     /db_xref="GeneID:4618472"
                     /translation="MSVNYEQVNVAPLVLLSVLDHYKRMNTPDNKRCVGVLLGDNSGS
                     TIKVTNSFALPFEEDEKNPDVWFLDHNYIENMNDMCKKINAKEKMIGWYHSGPKLRSS
                     DLKINGLFKKYTQGNSLLLIVDVKQQGVGLPTDAYMAIEEVKDDGSSTERTFVHLPTA
                     IEAEEAEEIGVEHLLRDVRDQAAGNLSLRLTNQLKSLQGLQRKLRDIVAYLDKVNSGQ
                     LPANHIILGKLQDVFNLLPNLGSPDEEAPATKKDDVLASSNTLQKALTVKTNDELMVI
                     YISNLMRAIIAFDNLIENKIKNKKLQEAKRDPEPEEATKEEIQQQESAKA"
     gene            <142836..>144143
                     /locus_tag="AGOS_AAL115W"
                     /old_locus_tag="AAL115W"
                     /db_xref="GeneID:4618542"
     mRNA            <142836..>144143
                     /locus_tag="AGOS_AAL115W"
                     /old_locus_tag="AAL115W"
                     /product="AAL115Wp"
                     /transcript_id="NM_207780.1"
                     /db_xref="GeneID:4618542"
     CDS             142836..144143
                     /locus_tag="AGOS_AAL115W"
                     /old_locus_tag="AAL115W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL172C (COX10)"
                     /codon_start=1
                     /product="AAL115Wp"
                     /protein_id="NP_982427.1"
                     /db_xref="GeneID:4618542"
                     /translation="MPALCATYLIHSGNLRACLRIVPLTKPSVVIAYRHLSKSSSKIA
                     PAAALNTAPIEFTPNTSAASLHERSTVIKDAARSALRCNDTTPTPALPFDVKRVDKAN
                     RAAGRKLPAASGVLSAYALMGPYIQLAKPRLTVLVMLSAICSYALSPYPATVLELLSL
                     TVGTTLCSAAANGINMGREPDFDRQMMRTQARPVVRGLVTPMQAYKFSAVSGVIGTAI
                     LYAGVNPTVALLGASNIVLYSWFYTSLKRKHIINTWFGAITGAIPPLMGWAAASPLTH
                     PGCWCLAGLLYAWQFPHFNTLSHNIRNEYKNAGHVMTAWKNPKLNARVALRYSLLMFP
                     LCFGLSYYGITDWTYQIDSALVNGWMSFWAFKFWWQQRYNYSKKVYNNKAEFNKGMVL
                     ANVYARKTFWVSVLHLPAVLILAIVHKKGRWDWLFSDEGKLVA"
     gene            complement(<144347..>145843)
                     /locus_tag="AGOS_AAL114C"
                     /old_locus_tag="AAL114C"
                     /db_xref="GeneID:4618648"
     mRNA            complement(<144347..>145843)
                     /locus_tag="AGOS_AAL114C"
                     /old_locus_tag="AAL114C"
                     /product="AAL114Cp"
                     /transcript_id="NM_207781.1"
                     /db_xref="GeneID:4618648"
     CDS             complement(144347..145843)
                     /locus_tag="AGOS_AAL114C"
                     /old_locus_tag="AAL114C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR260W (GCD1)"
                     /codon_start=1
                     /product="AAL114Cp"
                     /protein_id="NP_982428.1"
                     /db_xref="GeneID:4618648"
                     /translation="MNFQAFVFCGKGLKLAPFSNTRGDKGMPKPLLPVANRAMLEYVL
                     DWCDQAQFKEINIVVDEGDEEVMQEGLAGFMQFREECYDVLSKNVGGFHTHYLRKPAP
                     IQFIGAKSEFTGEILQQELLERITGDFVLLPCDFITNIPPQIFLDQYLNRDHDSLAMA
                     VYYQNAFENIDKKQIKKFFTVYTDNEDSMKQPVLLDIYSREDVEKTKYLKMRSQMLWR
                     YPNSTVSVKLLNSYIYFCSHELVHLLSTDDSAVAADSDGSDSEDEVGSRNPNQIRPSY
                     FRNKTKMVKDPMNGRKSFAKLFRDIARRSWQHSRPRETVSIFIMPDVGIFIRANNLSA
                     YMEANRYILKIKSASTSHTVPVTGSSSAIGADSVIGASCTILGKTNVKRSVVGANCKI
                     GNRCRIVGSILLDGAEIDDEVTLENVIVGKFGKVGKKTKLTNCYVEGYYSVAPRTVLK
                     GETLANIYIEGENEFDDSDMDTSSSEESTDQSEMYNEEEYEGDDLFER"
     gene            <146140..>147438
                     /locus_tag="AGOS_AAL113W"
                     /old_locus_tag="AAL113W"
                     /db_xref="GeneID:4618495"
     mRNA            <146140..>147438
                     /locus_tag="AGOS_AAL113W"
                     /old_locus_tag="AAL113W"
                     /product="AAL113Wp"
                     /transcript_id="NM_207782.1"
                     /db_xref="GeneID:4618495"
     CDS             146140..147438
                     /locus_tag="AGOS_AAL113W"
                     /old_locus_tag="AAL113W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR259C (RPT4)"
                     /codon_start=1
                     /product="AAL113Wp"
                     /protein_id="NP_982429.1"
                     /db_xref="GeneID:4618495"
                     /translation="MSEEQDPLMAAMNGEDGDNKGASDNTGTGAATEAPKAAAPIAPE
                     QEARNKALSQFKKKLLEHRRYDDQLKQRRQDIRELERQYEKTEQDIKALQSIGQLVGE
                     VMKELSDEKYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDP
                     LVYNMTTFEQGEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGP
                     PGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMD
                     EVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLR
                     PGRLDRKIEISLPNEAGMLEIFKIHTAKVKKSGEFDFEAAVKMCDGFNGADIRNCVTE
                     AGFFAIRDDRDYIIQEDLMKAVRKVAEVKKLEGKLEYQKL"
     gene            complement(<147530..>148444)
                     /locus_tag="AGOS_AAL112C"
                     /old_locus_tag="AAL112C"
                     /db_xref="GeneID:4618616"
     mRNA            complement(<147530..>148444)
                     /locus_tag="AGOS_AAL112C"
                     /old_locus_tag="AAL112C"
                     /product="AAL112Cp"
                     /transcript_id="NM_207783.1"
                     /db_xref="GeneID:4618616"
     CDS             complement(147530..148444)
                     /locus_tag="AGOS_AAL112C"
                     /old_locus_tag="AAL112C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR258W (HNT3)"
                     /codon_start=1
                     /product="AAL112Cp"
                     /protein_id="NP_982430.1"
                     /db_xref="GeneID:4618616"
                     /translation="MSEIYYVEEKTTSEPGVDENPILTHWLLKDDIRVCKHCRRTFEA
                     SRFSEYAAKQHLARYHTQVDETMSFTQYIQEFSPTYEWGVHKCRLHNERSFSIEFFKY
                     IMAPSKWENELLYYDEHAVIIKDKFPKAQQHVLVIPRAIKTTLKHPTQLSITDKDKYQ
                     KHIDWALNYIWHDFTSKYKLKPGSSSPFSSHEEFNSLAHFIANFTQVGVHSVPSMENL
                     HIHVMTTDFYSKSMKHKKHFNSFNTEFFVRWDRLPLAEVPNTDAMERRIRESELTCTY
                     CKQGFSNRFAALSRHLGEEFHCRFVPVK"
     gene            complement(<148662..>149543)
                     /locus_tag="AGOS_AAL111C"
                     /old_locus_tag="AAL111C"
                     /db_xref="GeneID:4618667"
     mRNA            complement(<148662..>149543)
                     /locus_tag="AGOS_AAL111C"
                     /old_locus_tag="AAL111C"
                     /product="mitochondrial 54S ribosomal protein YmL40"
                     /transcript_id="NM_207784.1"
                     /db_xref="GeneID:4618667"
     CDS             complement(148662..149543)
                     /locus_tag="AGOS_AAL111C"
                     /old_locus_tag="AAL111C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL173W (MRPL40)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL40"
                     /protein_id="NP_982431.1"
                     /db_xref="GeneID:4618667"
                     /translation="MSYKYISKAGDRFIKQLAGRTHKDRLAINAMQTKMYPEFMKPSL
                     PPAAEEEQFSGVRKWKFLPGDRVVVVKEGKFRGNISKVFSHDKKTNGYMLDENGPTRQ
                     VPVPKEYWTEGQKTHMTLIPQAVRQEDIKLVADIDDPDAPGKVRTVAVHDIVFRGSYY
                     DENYKKMMPYRCVAGQEDLVIPWPVPEQTADGALATDPQTAREQTFFVETAVRTPIPN
                     AALYTVRNHKSKYRRGTLTTRDIARLVAPKMPMTESEKAYAKQKEERANIPTHKLTDD
                     DKEAIGAKLYEHFTKNL"
     gene            complement(<149837..>150355)
                     /locus_tag="AGOS_AAL110C"
                     /old_locus_tag="AAL110C"
                     /db_xref="GeneID:4618692"
     mRNA            complement(<149837..>150355)
                     /locus_tag="AGOS_AAL110C"
                     /old_locus_tag="AAL110C"
                     /product="AAL110Cp"
                     /transcript_id="NM_207785.1"
                     /db_xref="GeneID:4618692"
     CDS             complement(149837..150355)
                     /locus_tag="AGOS_AAL110C"
                     /old_locus_tag="AAL110C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR257W (CDC31)"
                     /codon_start=1
                     /product="AAL110Cp"
                     /protein_id="NP_982432.1"
                     /db_xref="GeneID:4618692"
                     /translation="MSNIHRRANARVGSKNSNVDNGVLQKELLEEQKQEIYEAFSLFD
                     MNNDGYLDFHEFKVALRALGFEMDKRDILEIIDKYDTDGRRLISYDDFYLVVGEMILQ
                     RDPLDEIKRAFKLFDDDHTGKISIKNLKRVVKELGENLTDQELAAMIDEFDLDGDGEI
                     NEEEFIAICTDN"
     gene            <150544..>153288
                     /locus_tag="AGOS_AAL109W"
                     /old_locus_tag="AAL109W"
                     /db_xref="GeneID:4618787"
     mRNA            <150544..>153288
                     /locus_tag="AGOS_AAL109W"
                     /old_locus_tag="AAL109W"
                     /product="AAL109Wp"
                     /transcript_id="NM_207786.1"
                     /db_xref="GeneID:4618787"
     CDS             150544..153288
                     /locus_tag="AGOS_AAL109W"
                     /old_locus_tag="AAL109W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL174C (NIP100)"
                     /codon_start=1
                     /product="AAL109Wp"
                     /protein_id="NP_982433.1"
                     /db_xref="GeneID:4618787"
                     /translation="MVKVGDRVKVRGLVGVVRYLGETKFAAGQWVGIELDEALGKNDG
                     SVQGVNYFRPSKRGGLYGLFARAETVVVVADGLPRSRLPKPLKTPSVDGGSRTASPGP
                     TSVASMATGRPRSRTTPSRDSGTSAGSQDNGTPLRMSASPRSSVPPPLLSGSPVLLPP
                     LEETKLQKVVEKLQEKLYRLHLECKELKRRLEEQAQSEKVETLVRDVEVLAIAKVSLE
                     EEKEELTQRLSSLEADYATVVGELGQYREEVELRRKIDLEEASRDDVGADVLWKQNEL
                     MKDALLQLEGSLEATNQLVVTLQEEKVQLAEDNNLLLKNIEELKNQLSDAQSTIDDLV
                     AQVDAEGNVSHIVESLTTQNLALTEQIDQLNKQLNEVSSKNEVTAELEQVYKEVEREL
                     LQQIHSLQQKVEDDELVISRLTEKNDELEFLLESNQPTSVDDSIVDDLRNTIVILEND
                     KCRLRLDAEFLHEKIRARKPDPLKEYTYQLNYLAMLVGDNPSYEETPTIEIRITLVYL
                     SAVCETIAGLYSMKSIEEDSVDYIINAIPLDKWITRYQNGQNLNIDRYQIWLKLLDAH
                     PLLEISANLVYGTFLRLCVDVTPALLAILKGSLSTQEIQDIYGCFQTIEKILLAIIKE
                     NNLHERLMSFKTLEVMPVLSQLFLIVDKLLQNDAAETVVSELQELQKIMAEAELELVE
                     APADATSEKSLDDLPPEEHTPPEVMIRLQKYEEMLQEKETAIEELMLKVRVLDIKNEK
                     TKEHENTIMKLRGELDELKEKNQSLLKKSDELQKTSALLEERIQKERANRYTLISTKG
                     YSELLEEKLKMEKLDLISEISDLRKVIRSLEHVETPDSLSWLKESLTMEKMRSPPIRT
                     KVNELLNVLQMSVRNCDVLPISGPQHEWQPKHKIVKYHLSTLVEREALIKRMTNNIYT
                     "
     gene            complement(<153310..>154678)
                     /locus_tag="AGOS_AAL108C"
                     /old_locus_tag="AAL108C"
                     /db_xref="GeneID:4618784"
     mRNA            complement(join(<153310..154600,154656..>154678))
                     /locus_tag="AGOS_AAL108C"
                     /old_locus_tag="AAL108C"
                     /product="AAL108Cp"
                     /transcript_id="NM_207787.1"
                     /db_xref="GeneID:4618784"
     CDS             complement(join(153310..154600,154656..154678))
                     /locus_tag="AGOS_AAL108C"
                     /old_locus_tag="AAL108C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL175W (SPT14); 1-intron"
                     /codon_start=1
                     /product="AAL108Cp"
                     /protein_id="NP_982434.1"
                     /db_xref="GeneID:4618784"
                     /translation="MMAAMNIAMVCDFFYPQLGGVEFHIYHLSQKLIELGHSVIIITH
                     AYGDRTGVRYLTNGLKVYYVPYLVLYRETTLPTVFASFPIIRNILLREKVELVHSHVS
                     VSTLAHESILHANTLGIYTVFTDHSLYGFESIGSILVNKLLKFTLTCVDQVICVSHTC
                     KENMVLRAEIDPSTVSVIPNAVVGKDFKPLEADRRVATGRTTIVVISRLFPNKGAGLL
                     THLIPRVCEMHSSVDFIIAGDGPNFVHFQQMIESYRLQDRVQLLGAVQHENVREVMCL
                     GDIYLHASLTEAFGTVLVEAASCGLLIVTTKVGGIPEVLPENMTVYASETSVSCLVEA
                     TNKAIGILREKKVDRMAFHEQVSQMYDWMDVARRTVQVYAKCQRNPANKDWNVMLKKY
                     YHRDKVWARTLYTLCCITEYILWYVLEWWYPRSEIDIAPKWPKKV"
     gene            <154776..>157184
                     /locus_tag="AGOS_AAL107W"
                     /old_locus_tag="AAL107W"
                     /db_xref="GeneID:4618623"
     mRNA            <154776..>157184
                     /locus_tag="AGOS_AAL107W"
                     /old_locus_tag="AAL107W"
                     /product="AAL107Wp"
                     /transcript_id="NM_207788.1"
                     /db_xref="GeneID:4618623"
     CDS             154776..157184
                     /locus_tag="AGOS_AAL107W"
                     /old_locus_tag="AAL107W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR256C (TRE2) and YPL176C (TRE1)"
                     /codon_start=1
                     /product="AAL107Wp"
                     /protein_id="NP_982435.1"
                     /db_xref="GeneID:4618623"
                     /translation="MISDSNRACRPITMQINRGYIAVAGDDESVQEAPGLGRSQEGGG
                     QPHGLLPSEPPSYGEAHSELEGQGSQFEMEFSDLEGDSYQGRFQKLREQFKYKVLDRV
                     RNRIIDPLGYLMQFLSEKTDYYLSKVGNPLLLRRFLYILVMSAMMYYVMISGLLPNNH
                     NTGMHGMFSDQQQLIEYARRCVNFAKMEEDLEYLSKMPHMAGTKGDMAMLNYVKSSFS
                     NNGLKVIQRDYQTYINYPGPVSTEIFKDGKSLFSFSLTEENFCPLSPVGSVEDASIIY
                     AHRGTRADLERLRDAHLLDDKTVLLMHYGEVVADQVFLAQEFGAVGILFVSDPYGTDE
                     NVIQRMPVGLPQYGTGNPLKPSAAEDPSSKLNGKDTAAIPKIPIIPLSYKQGRQIQEV
                     LAHSEQTIKFRNGWYTGTLKDIKVNMKSEPKEREDHHSWTVFGKIDGREQNDKAILVM
                     ASRDSIGYGASYPNYGQMMLLSLVELFQQIKYKFDWKPLRNIYFVSFDASVYNSADAT
                     ELLWSGVDKHKSRIYSVIDISQLGLESDGKKQLDIQAHALVQALFSQEREKFGFDMQV
                     RDVEQYGDWTPFMANGIPVAVLSSRNVVERKLPIFTKHDTFEYLSKTVLQNNGWVNTG
                     DLLLVVFQALLKLADDPLIPFDILTYADDLSHHLEDLERMAEGQDLVFTQVKEGLSIW
                     RKLGEDWNVWRSTWNRIVMIDNNGIEPSILSIERWTQNKKLSNIAARQFHRQGLPGRA
                     FYKNIIFGPSLYLSDKFHSWSFPAVRDAIQSGDMTRAHAALKYLATILKISAENYQDE
                     TLNL"
     gene            <157434..>157895
                     /locus_tag="AGOS_AAL106W"
                     /old_locus_tag="AAL106W"
                     /db_xref="GeneID:4618630"
     mRNA            <157434..>157895
                     /locus_tag="AGOS_AAL106W"
                     /old_locus_tag="AAL106W"
                     /product="AAL106Wp"
                     /transcript_id="NM_207789.1"
                     /db_xref="GeneID:4618630"
     CDS             157434..157895
                     /locus_tag="AGOS_AAL106W"
                     /old_locus_tag="AAL106W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL170W (DAP1)"
                     /codon_start=1
                     /product="AAL106Wp"
                     /protein_id="NP_982436.1"
                     /db_xref="GeneID:4618630"
                     /translation="MSFVKNMLFGGVATSEDPTGLTQDANGEVSKGQSSVEEPIVEGK
                     FFPRTLYKFNGHDDEKIFIAVRGKVYDCTTGRQFYGPSGPYSNFAGHDASRGLATNSF
                     ELDAVKHWDQPVDDLSDLSEQQLEALDGWAAHFEKKYPCIGVLVPEPGVNY"
     gene            complement(<158057..>158698)
                     /locus_tag="AGOS_AAL105C"
                     /old_locus_tag="AAL105C"
                     /db_xref="GeneID:4618807"
     mRNA            complement(<158057..>158698)
                     /locus_tag="AGOS_AAL105C"
                     /old_locus_tag="AAL105C"
                     /product="AAL105Cp"
                     /transcript_id="NM_207790.1"
                     /db_xref="GeneID:4618807"
     CDS             complement(158057..158698)
                     /locus_tag="AGOS_AAL105C"
                     /old_locus_tag="AAL105C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR255W (OSW1)"
                     /codon_start=1
                     /product="AAL105Cp"
                     /protein_id="NP_982437.1"
                     /db_xref="GeneID:4618807"
                     /translation="MRAPPQPRKSRHRLMLQVLRKFHDTVGLQKVRSRWHLHKVHKVS
                     RANGRASTCNKKADGNKKKHGDIPLSPIRLEDIANQPSGIETPKKRRMPLLIASFPRG
                     CAKSPMFNVLEKNKRSKLLLSRRKYKLKTFNGGNDVGMANGKTPRVHAVKREVIQHAH
                     MKVNYHRKGVVNSTCVLVDSQSKRRPEYLTFGQAYSLRLNDYPSLSIRHPVNV"
     gene            complement(<159175..>160932)
                     /locus_tag="AGOS_AAL104C"
                     /old_locus_tag="AAL104C"
                     /db_xref="GeneID:4618676"
     mRNA            complement(<159175..>160932)
                     /locus_tag="AGOS_AAL104C"
                     /old_locus_tag="AAL104C"
                     /product="AAL104Cp"
                     /transcript_id="NM_207791.1"
                     /db_xref="GeneID:4618676"
     CDS             complement(159175..160932)
                     /locus_tag="AGOS_AAL104C"
                     /old_locus_tag="AAL104C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL169C (MEX67)"
                     /codon_start=1
                     /product="AAL104Cp"
                     /protein_id="NP_982438.1"
                     /db_xref="GeneID:4618676"
                     /translation="MNGFGNVNQLSTLAAQHQEQSRSKIAVRGWQNATQQDLLNFVAR
                     KTRIGIQDSYVQGGQIIGFVNKQDVPALLKFNGIRFAGNALKFEKLDEDGTGATTSNT
                     ITLLRNFLMKRYNVQTKMLDLGGLYADPDLTQHGLVSSMSTQSKMFMALMKLAGSEPQ
                     LVVESVNLSNNGLKDVNSITSLAQTFPRLRNLCLANNQIARFQSLEVWKNKFRELREL
                     LLMNNPVANDPMYRSEMLRIFPKLVILDNNLVRDEQRLNALYSLPMRLQQFFFENDTL
                     GSSAIDFVTNFLRLWDTDRKQLMALYTPQSQFSVSVDSSIPAATVPEADQSPSFGHYL
                     PSSRNMTKVSSEKSKQERLGMGPDAIGNIFKALPGTKHFLQEQPEKYSLQTWTYSQVG
                     GFVITLHGFFEEVSKPEVENTKSYSYNARHRRYNHGQQNSAQNKLSKKSFDRTWTIVP
                     TQGSVIIASDLLTVRPYAAGAWIRVDEPKKTPTADVSQGAQPVAVPAAGPQIPGPPLT
                     NTMVPQPMGIPSTLQLPPEVQAKLSPIQLQLLNRLHQDTKLNAEYTYMLAEQSGWDYD
                     VALKSFQSSVNNLPRNAFV"
     gene            <161381..>163390
                     /locus_tag="AGOS_AAL103W"
                     /old_locus_tag="AAL103W"
                     /db_xref="GeneID:4618538"
     mRNA            <161381..>163390
                     /locus_tag="AGOS_AAL103W"
                     /old_locus_tag="AAL103W"
                     /product="AAL103Wp"
                     /transcript_id="NM_207792.1"
                     /db_xref="GeneID:4618538"
     CDS             161381..163390
                     /locus_tag="AGOS_AAL103W"
                     /old_locus_tag="AAL103W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR254C (SEC63)"
                     /codon_start=1
                     /product="AAL103Wp"
                     /protein_id="NP_982439.1"
                     /db_xref="GeneID:4618538"
                     /translation="MTLNYEYDESDETWPFFLLTVLLMVLVPATVVQLYRAVRRNVGA
                     RDITELQRIQQKYSGAAVQDYQRKHRGQGPADVIFSKRSALIIVGWVLVSYLVNRIAS
                     NETLHDSYKNVFDPYELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLE
                     EQYVLITKAYKALTDDATRDNFLRYGHPDGPQSTTHGIALPKFLIEGSGSPLVVVTYF
                     LLLALVLPGLVTRWWANTQSYTNKGLNTETASYFVDKLFNNKPSETVDEATIMNWLSH
                     AKEYRSKYPGLTAEAIEGIFQDHIHRRHSGPLEGFKFDIIAKSAVLLHGLLDIAASCR
                     NTEICIAVIETSKSIVQALPASPNAQILQLPNVEKDRFLANSKGENVHTIGKLFTFDD
                     NKIGKLLGIEDPATLKETLYVASQIPHLKVIDAQFKVPGEASVTPSSTPHIVVKVLVR
                     SAKHKMIPATLIPNEKLQESEDFGSLRDPFAVVNEQPLVPATFAPYFPTERHGGWCAL
                     VVLQKDGKIIQTPLVMTRLSFANLAKDFDKRTVQDLDAEFNPDDWEVGTIKIPLAQPA
                     PPEKGDYFFRIIIKSTEYFGGDLDFTMPMQVREPVKEDELDDTASIGDDTAQEDSDSD
                     EENELDNEDSDYTDIDTDTEVEDNITTADSVGESPDETEKLTAEE"
     gene            complement(<163463..>163942)
                     /locus_tag="AGOS_AAL102C"
                     /old_locus_tag="AAL102C"
                     /db_xref="GeneID:4618579"
     mRNA            complement(<163463..>163942)
                     /locus_tag="AGOS_AAL102C"
                     /old_locus_tag="AAL102C"
                     /product="AAL102Cp"
                     /transcript_id="NM_207793.1"
                     /db_xref="GeneID:4618579"
     CDS             complement(163463..163942)
                     /locus_tag="AGOS_AAL102C"
                     /old_locus_tag="AAL102C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR253W (NAT5)"
                     /codon_start=1
                     /product="AAL102Cp"
                     /protein_id="NP_982440.1"
                     /db_xref="GeneID:4618579"
                     /translation="MSRELVTVDEVYPTAVGTFDVIVKKSSQKEYSDEFGKELFSSKK
                     DDKSTLYSQLAFYGEVAVGAVKARIQDMRGHSAVVIDTLAVLEAYRGKGVGTKLLDYV
                     EKETKPFQPRAIYVTVAASATGELQWYQSHGFELLGDKSGSCENGSQAERNLVKWLV"
     gene            <163988..>165067
                     /locus_tag="AGOS_AAL101W"
                     /old_locus_tag="AAL101W"
                     /db_xref="GeneID:4618487"
     mRNA            <163988..>165067
                     /locus_tag="AGOS_AAL101W"
                     /old_locus_tag="AAL101W"
                     /product="AAL101Wp"
                     /transcript_id="NM_207794.1"
                     /db_xref="GeneID:4618487"
     CDS             163988..165067
                     /locus_tag="AGOS_AAL101W"
                     /old_locus_tag="AAL101W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL168W"
                     /codon_start=1
                     /product="AAL101Wp"
                     /protein_id="NP_982441.1"
                     /db_xref="GeneID:4618487"
                     /translation="MRKTVSSTFTPFIKLRRLANIWEQPSVATEGMLRHARGYSVARR
                     ASQGLRAHDVRGMESMQAKIVEFRTNLKRILALNKIPTDGSPEYTVLLTSCREAGVAE
                     ELPLLQKMPILRSKLRDDPFSNAAVRRIINTIEHGQKHARMQAPFPESEFKNTHCRDK
                     ATDGSPGDFDQGTSLSAKREQDLKIIQDLLRPVTSPAAPVRKYDWNIQGKKQRPMVKY
                     GDLLPFGNDYRKTQRYRFKYMSLLRDGGENKSSSLETLIYDITRHSAQVTTNETSSLY
                     SIDNKDLFTLINGSSFSPEEMLEVIDRHTAQGWKLVGEVRGEPTKVVFQRKQRTEKPE
                     MRLARVIYTTGALVAGGLLMSYFYI"
     gene            complement(<165123..>165695)
                     /locus_tag="AGOS_AAL100C"
                     /old_locus_tag="AAL100C"
                     /db_xref="GeneID:4618610"
     mRNA            complement(<165123..>165695)
                     /locus_tag="AGOS_AAL100C"
                     /old_locus_tag="AAL100C"
                     /product="AAL100Cp"
                     /transcript_id="NM_207795.1"
                     /db_xref="GeneID:4618610"
     CDS             complement(165123..165695)
                     /locus_tag="AGOS_AAL100C"
                     /old_locus_tag="AAL100C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR252W (TMA16)"
                     /codon_start=1
                     /product="AAL100Cp"
                     /protein_id="NP_982442.1"
                     /db_xref="GeneID:4618610"
                     /translation="MPVTKSLSKLQKGMKNKQHTIHPKGRKLQQLNKATIRDEKIQTK
                     KRAHNEKRSNELARVKFIQDAINVEQLKEQLTFTHEQCLLLIREFIGRDDDELEELKK
                     KRRANRPPTSRHQLLEAKKRLELEELRTGFLCPDLTDADNVAFLRRWNGTFGALATLK
                     LVRINERAERVVGGTKPVAQPAAAADVHME"
     gene            complement(<165813..>170207)
                     /locus_tag="AGOS_AAL099C"
                     /old_locus_tag="AAL099C"
                     /db_xref="GeneID:4618518"
     mRNA            complement(<165813..>170207)
                     /locus_tag="AGOS_AAL099C"
                     /old_locus_tag="AAL099C"
                     /product="AAL099Cp"
                     /transcript_id="NM_207796.2"
                     /db_xref="GeneID:4618518"
     CDS             complement(165813..170207)
                     /locus_tag="AGOS_AAL099C"
                     /old_locus_tag="AAL099C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL167C (REV3)"
                     /codon_start=1
                     /product="AAL099Cp"
                     /protein_id="NP_982443.2"
                     /db_xref="GeneID:4618518"
                     /translation="MVKLCSLLHQRKQAFYVMSQTSNHNLNSSEGNEDLIQIQWSDYD
                     CYQWPPTSLDPKHSLSWPGKAFSTVPIIRFYGKLTSGHNILSHLHGALPYLFISCDAP
                     PDELRYNSKATCHRLHVLLELALLNTSTKSHGSESAKQSDSTEDNIECLRYVANVSVV
                     KGVPFYGFNVGWSVFYKISLLNPRFVTLLANKLRDGSILGRSVSVYEAHIPYLLQTSA
                     DFNLYGCAYLNLTDCYFRGPVLNNLHNIDEYHQSDAVHTFLKRFLRPDNTLPREFERF
                     GTGLLEIDILPQFIANREELEYRYIHHDFIDALRAPANPNKKYLVSTNYVWKDVTWLR
                     ESKELGPYLPPDELQGVETRPPWDFEELERFHQLAKQQNCDGNPKNLSFATFIDNSWF
                     YENIKTASETISELWPKPLNGKQKIVALPDDEDNEEPLISTIDSVDIERLLYSTPKLK
                     RVKAQHGLLMRDDRVMNINPQSNKKHKSYTRESKLPVYRYKSPPISYADMSDALEANG
                     EPAVDYQGPYYSNPVDLPKGKDNTTHKYNIESDHISCREWVSFGDEVEFYRRKLTGSP
                     AKVNHWVYIPKPPKYYEVLKQPPDSPETSCIDGPTQSQQSAPSQQAPPNMSNEARESG
                     PQLLHLSMEIHVDTRRNMLPNPRTDEIKMICWSIDGPQSVGTMELSTDGLLVSLNEND
                     AIYKRIIEEACGKTRVAFFTSEYELITEFAKLVLIIDPDILSGYETNKSSWGYILARA
                     ELSHNIDFGLLISRLSRDDRSGLASEWNYSHSAGIKIAGRHMLNVWRKMRTEVNLAKY
                     NIENVAYHLLHERLPKFTHETLSGFWRTKSDRTSIKIVINYCLERVRCNIRLLNLKQV
                     ISRTVEQARLIGIDFYSVLSRGSQYRVESVLARLAKAEHLMLISPGKGDLRHQRALEC
                     VPLILEPDPTFYTSPVLVLDFQSLYPSIIIAYNYCYTTILGRTREMTAGENKIGITTN
                     ILKPNILQLLGDNITIAPNGVTYVKQNIRKSILAKMLSDILDTRVLLKRTISDMHNGS
                     KRLLSTLDNRQLALKLLANVTYGYASASYSGRMPCSDIADSIVHTGRETLRAAIQMIE
                     KEDKWGARVVYGDTDSLFVHLPGKSREQAFKIGAAISDAVTAANPNPIKLKFEKVYHP
                     CILLSKKRYVGHAYEHASQEVPRYDAKGIETVRRDGHPAQRKIIQRSLEILFRTKDLS
                     QLKAYIVNQFWKIMTGSVPIGDFCFSKEVRLGFYKSEAAAPPAAQVARRMMENDSMAE
                     PQYRERVSYVVAKSRPGTLLADRCIAPQDFLADPRLELDAEYYITKTLIPPLNRLLQT
                     VGLDLFDWYREMPRPSSYKHVGSGASDTLHHVLKSNRCLCCKREATTKNGLQLCDSCR
                     TSPSESSVALLLDRRTRESRFNRALRACRVCCFPLTKDLLAAPEIGPNQCQAHDCPVF
                     YTRKKYEGLLSDPSWHSAHRALQLLDDW"
     gene            <170288..>170806
                     /locus_tag="AGOS_AAL098W"
                     /old_locus_tag="AAL098W"
                     /db_xref="GeneID:4618524"
     mRNA            <170288..>170806
                     /locus_tag="AGOS_AAL098W"
                     /old_locus_tag="AAL098W"
                     /product="AAL098Wp"
                     /transcript_id="NM_207797.1"
                     /db_xref="GeneID:4618524"
     CDS             170288..170806
                     /locus_tag="AGOS_AAL098W"
                     /old_locus_tag="AAL098W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL166W (ATG29)"
                     /codon_start=1
                     /product="AAL098Wp"
                     /protein_id="NP_982444.1"
                     /db_xref="GeneID:4618524"
                     /translation="MNSKNTIVYVKVPGRQREGFVDPPPFEWNQHQDRKLWAHISTIE
                     DKDDIDWQLLSNQTNAPEFFIRKRVYQLFRVHLKSIEQEIYSHTSADRAPNRSSQAGD
                     EPAASVGVLNGYGQNINDIHDLSSLQTPPTCRGKANKDEDGGNSSGISELSSLSVSKS
                     ALEEALMDRLQL"
     gene            complement(<170783..>171889)
                     /locus_tag="AGOS_AAL097C"
                     /old_locus_tag="AAL097C"
                     /db_xref="GeneID:4618405"
     mRNA            complement(<170783..>171889)
                     /locus_tag="AGOS_AAL097C"
                     /old_locus_tag="AAL097C"
                     /product="AAL097Cp"
                     /transcript_id="NM_207798.1"
                     /db_xref="GeneID:4618405"
     CDS             complement(170783..171889)
                     /locus_tag="AGOS_AAL097C"
                     /old_locus_tag="AAL097C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL165C (SET6)"
                     /codon_start=1
                     /product="AAL097Cp"
                     /protein_id="NP_982445.1"
                     /db_xref="GeneID:4618405"
                     /translation="MEPAHIQIQISELFEVKLTDYGGRACFARQSQQRGDTVLKLTQA
                     LGSSIAYEYRKEVCHFCFAYDAGAVMKTKIGHAEARFQPSITGASSFGGGGLRFCSEI
                     CKNAYMQMESAEELVEAFETLLQAFQRSNKRRNTDLQDDDCGNAVITEAIIEERWRYV
                     ENEWTPKLSAMKPSKRHLMIPAIDEEVYSCARFVTECLFRLKHLPNESTMYQAFDQLQ
                     SNELQKITEFPVLLEFQLKVYKFLKVVLPIGLRDLLSSALFRKILGSEYGNSFGIWEQ
                     NEGNYSRDYLGYWVLPEASYFNHSCAPNLAKKRVGREMYFVLTSDVAAGEQLCIDYKG
                     ILDLPVVERRNILHSNWFFDCACERCALELQSIH"
     gene            <172280..>173191
                     /locus_tag="AGOS_AAL096W"
                     /old_locus_tag="AAL096W"
                     /db_xref="GeneID:4618471"
     mRNA            <172280..>173191
                     /locus_tag="AGOS_AAL096W"
                     /old_locus_tag="AAL096W"
                     /product="AAL096Wp"
                     /transcript_id="NM_207799.1"
                     /db_xref="GeneID:4618471"
     CDS             172280..173191
                     /locus_tag="AGOS_AAL096W"
                     /old_locus_tag="AAL096W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR251C (TUM1)"
                     /codon_start=1
                     /product="AAL096Wp"
                     /protein_id="NP_982446.1"
                     /db_xref="GeneID:4618471"
                     /translation="MSLYSLITPKAFSELLHRNTGKRIVPVDATWYMADKERDLAKKE
                     FMELERIHNAIFFDIDVFMDQKSPYPHMLPSLETFNEEMGKLGIREDDILVVYDRCSN
                     FSASRAAWELTTLGHETVFLLTGLNAYKEEGYPLDITQVDSVTPYEPTSYTSCTSHAK
                     EQVITYEELHHLVETGEIKHYNFFDMRTLPRFLGEAPDPRPGVPSGHVPGAQPMPYAE
                     VLEGGNYSNTVEGIQSRIAASLSEHGTRLDCSKHSIVMCGSGVTACTVKTAFEACGYV
                     PVRLYDGSWSEWGRRAEPRYIAIGRDW"
     gene            <173532..>174869
                     /locus_tag="AGOS_AAL095W"
                     /old_locus_tag="AAL095W"
                     /db_xref="GeneID:4618653"
     mRNA            <173532..>174869
                     /locus_tag="AGOS_AAL095W"
                     /old_locus_tag="AAL095W"
                     /product="AAL095Wp"
                     /transcript_id="NM_207800.1"
                     /db_xref="GeneID:4618653"
     CDS             173532..174869
                     /locus_tag="AGOS_AAL095W"
                     /old_locus_tag="AAL095W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR250C (CLP1)"
                     /codon_start=1
                     /product="AAL095Wp"
                     /protein_id="NP_982447.1"
                     /db_xref="GeneID:4618653"
                     /translation="MSAIQSTQELLQPIGFDTPVAESKTVLLSPGKEWRARIPAESKL
                     TIKIVYGIAELFGTELANGVEYTIQCANIAVYSVDHVKLEWKSLDELETTVSPDTNMP
                     YLYNLHFALEKMRLSSFDGPRILVVGKASSGKTSLCKILCSYALKSKAYTPIYVNLNP
                     QEGAFSPPGFLTATPISDILDVESTMWGQSMTTGATKLHNKQPMVKNFGLEMIAENRP
                     LYMEVLGQLAQTVDGRLKNDPLVRRSGVIVDSPPLQHLDESYTELEVAITKFNIKTLV
                     VCAPDDSLAVELSDRFQTLVRSIVRIPTSRGICNIDDVARRALQRSQIREYFYGNGST
                     VLSPYTIGVDLLDAVVWRPKSSLTIDMSKTSPNMVELERVEVTAANLQHALVAITYAP
                     RKSTAEEVFRSGVLGVALITEVNDAKRKMRILLPVPGRLPDKAMILTAYRYLE"
     gene            <175139..>177139
                     /locus_tag="AGOS_AAL094W"
                     /old_locus_tag="AAL094W"
                     /db_xref="GeneID:4618607"
     mRNA            <175139..>177139
                     /locus_tag="AGOS_AAL094W"
                     /old_locus_tag="AAL094W"
                     /product="AAL094Wp"
                     /transcript_id="NM_207801.1"
                     /db_xref="GeneID:4618607"
     CDS             175139..177139
                     /locus_tag="AGOS_AAL094W"
                     /old_locus_tag="AAL094W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR249C (APC5)"
                     /codon_start=1
                     /product="AAL094Wp"
                     /protein_id="NP_982448.1"
                     /db_xref="GeneID:4618607"
                     /translation="MAPSEHQIYQHIQLTKWYDPHDVSSLLLVLFYALGTIAIKPDIL
                     LRVLDPTGIRSIYAYEKDLDLNATIKLPNLECLVQFLIDADEEAAALTLIAALEQIPS
                     MHGLIQLLTFFKNRVVIDSMCDIPDPYFKRGISKKSVFYMLLSRKFRGFTDIYLSGDM
                     TQKWRELHSYRAQFKTTKLWQAVNTKLPQKSAFLGKVFNESDDNTLPLPTIQTGEEEH
                     HVYPWILTTRERYEQLVNMELTKLNSCTNPDLSIAEELVRYTSLNQKTTFPSVLMVQY
                     TISLLNKNYQESQDLLFRIFDYAGSSFESSQTYDSASGPLFNSFMLSHLFRACGTPQA
                     AVKRIENVVKLVREHGSLTGVQPMLYSLFIFLKDYPHLSDNLQSAVAQLKKYFENTAR
                     NSLNSIKFLYSIESLLQLTYDAHIPQGLANAYKTRMLCMLDDKSRHIESVDPFIKTTE
                     IWNRIGIEEIPPCYATYANTSSDFSNYRGAYSEVVQSLVSGDDAPLYSLDIGAWPYSE
                     QQKVKQLKIRYLKKLGELDEAMNLVNVYIEDTRSKIIDKFWEFEFMKEKVYLLFECGM
                     AARSINFITEMIGTAEKAKNAYQLTQCFILLSTALVALRKYDMAVQLMRGNMYTVFQF
                     GQRELEKEFMNKYIEAMRNATCQTKGVTIDQLQVLQSKYMAA"
     gene            complement(<177136..>179340)
                     /locus_tag="AGOS_AAL093C"
                     /old_locus_tag="AAL093C"
                     /db_xref="GeneID:4618574"
     mRNA            complement(<177136..>179340)
                     /locus_tag="AGOS_AAL093C"
                     /old_locus_tag="AAL093C"
                     /product="AAL093Cp"
                     /transcript_id="NM_207802.1"
                     /db_xref="GeneID:4618574"
     CDS             complement(177136..179340)
                     /locus_tag="AGOS_AAL093C"
                     /old_locus_tag="AAL093C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL164C (MLH3)"
                     /codon_start=1
                     /product="AAL093Cp"
                     /protein_id="NP_982449.1"
                     /db_xref="GeneID:4618574"
                     /translation="MRGMAAPKIHRLEESVFLRLRSQLSIVSVGAAVRELMQNSVDAC
                     CGRLEVSVDLDRWRVHVRDDGEGLNREELAKVGQWHYTSKLRRLEDLTATDTYGFRGE
                     GLYMLSNISRVILLSKRAGMKHAALHRLPATDNALPRDSDDIRLLDGAHGTTVILEDL
                     FYNLPIRRRMLARTPPHRLYDEIRADVLQLLLFCQTLQVSVLVIKNNQEKQIVRSGNL
                     TQLTFPDTLMAVLMCCLGPVVAAKDLQYVSAKYQDIEVQGVISTVGVPSKDYQFIYIN
                     KRRYEDKRFIFGFNKLFRSARYKEDNMLAASTRGGQQAYSGYPVYLLVCKGPPSISDL
                     LQNPSKVIENLEYGRVLQPLLCQVAKSFLRHYGHATVSFLDRKMTRNRLRAELPLPIQ
                     GKTDQDAPESSLHSGTDARHLLNGGINPVNQHPKRKKYNPPVASMNSSADATKILEHV
                     AKIRTRNINVGLPVQKPVGSGSISSSLAFSDEHLSVDSIQLKDCIVINQIGNKFILLK
                     LEPSRSRTTPLLLILDQHAADERVKLEAYTRDYLFTLLTAQPSFYTTPCSIAMDLTHT
                     EADILLHYKREIEFWGFEICYKDEYTGPLYLKAIPTLFDAKKKNDVHYLKRALLQYAY
                     DLKSLKKTKITSIEADGYVTKHLNEFAWWKYMNAIPTVFLEILNSKACRSAIMFGDKL
                     NHDECLFLVRQLSTCNMPLRCAHGRPSVIPIADLKGLGSIVFESYIEDYRIT"
     gene            complement(<179804..>180406)
                     /locus_tag="AGOS_AAL092C"
                     /old_locus_tag="AAL092C"
                     /db_xref="GeneID:4618576"
     mRNA            complement(<179804..>180406)
                     /locus_tag="AGOS_AAL092C"
                     /old_locus_tag="AAL092C"
                     /product="AAL092Cp"
                     /transcript_id="NM_207803.1"
                     /db_xref="GeneID:4618576"
     CDS             complement(179804..180406)
                     /locus_tag="AGOS_AAL092C"
                     /old_locus_tag="AAL092C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL163C (SVS1) and YOR247W (SRL1)"
                     /codon_start=1
                     /product="AAL092Cp"
                     /protein_id="NP_982450.1"
                     /db_xref="GeneID:4618576"
                     /translation="MKFTSSILLACVSTFGTVHALYSNKTTTLAPMGGNQEYLVPNSV
                     STVVNDDDTTSTITLFRTITLDLPLTSASSSASSSATPYSSYSGSASSSASAPASSPA
                     SPSASPSSTTANCTSSTEQTFSTSSTQLYTTWTLTGSAGPLVTSSAYDKYVVYASAAC
                     TEKTVTVTEYAATKYVTVAASAMPSLAPLSGYYSNSTATH"
     gene            complement(<181243..>182034)
                     /locus_tag="AGOS_AAL091C"
                     /old_locus_tag="AAL091C"
                     /db_xref="GeneID:4618541"
     mRNA            complement(<181243..>182034)
                     /locus_tag="AGOS_AAL091C"
                     /old_locus_tag="AAL091C"
                     /product="AAL091Cp"
                     /transcript_id="NM_207804.1"
                     /db_xref="GeneID:4618541"
     CDS             complement(181243..182034)
                     /locus_tag="AGOS_AAL091C"
                     /old_locus_tag="AAL091C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL162C"
                     /codon_start=1
                     /product="AAL091Cp"
                     /protein_id="NP_982451.1"
                     /db_xref="GeneID:4618541"
                     /translation="MGAENSCRLLGPVALFIQFFMAAVAVGGLLVKRQYEHPKRTWRV
                     WSYDVGKQMIGSAGIHLLNVLLSIMKSQGLLGTLKKTDDQCDWFFVNLLMDTTVGIPI
                     LWCWLVLIHKGLQALGVQNIESGNYYPTLDKPEPGAAVPRTGPMFSAFVKQLLVFVSG
                     LAMMKVCIFLLLGCFEQLANLFADLVLGWSDPWPNLQVFLVMFVFPVLLNCFQYFCVD
                     NIIKLPSDRLTRQNVDNFDQESIFEQNGVYVPTLLAAAKQTYLAV"
     gene            complement(<182217..>184064)
                     /locus_tag="AGOS_AAL090C"
                     /old_locus_tag="AAL090C"
                     /db_xref="GeneID:4618643"
     mRNA            complement(<182217..>184064)
                     /locus_tag="AGOS_AAL090C"
                     /old_locus_tag="AAL090C"
                     /product="AAL090Cp"
                     /transcript_id="NM_207805.2"
                     /db_xref="GeneID:4618643"
     CDS             complement(182217..184064)
                     /locus_tag="AGOS_AAL090C"
                     /old_locus_tag="AAL090C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL161C (BEM4)"
                     /codon_start=1
                     /product="AAL090Cp"
                     /protein_id="NP_982452.2"
                     /db_xref="GeneID:4618643"
                     /translation="MSSEQDSVKNWLSDTPGRRSGQSEMDYEEVLFGLEPLINARSAA
                     ELLELELAGLEQCGAVLDQLAVHLRAPANRDLVRESGLLRQLLRAQALVFEAAFQGGG
                     SSDALLQVGSELVRCAANAMVDNDDNRREFHSLAGADGHPLLEHYLPKVLQMGEREGP
                     VGALKMRAIAMLQNFCLDSPEYRLQCAQTVPGPLIACLREMGDAYMEEDAALALKLGL
                     ELLADLAEDYASKATLDELEFLASLLCRMASACESADPEAAAESEGSEDSGADALQAL
                     CGVVEAIADKSAALDLSDKERCSALQRALFDSLDALHAKEFPNKLIVVRRITSSIGYI
                     SANEKCPNRHMRTLCYSVLERSQDGYALCGALFVLANSISGRSDVDEVLAQVPLQRQV
                     RVARGFTDPVQFQSFLDLFRKCLNLVTALTFSAEHQDALFSVVRTCHDQARYYAGLAP
                     LVDSFLNKLLAIFPGAALAAHGAVLDVAAERGGISACLLLEKVSKVPGVAPETFARLL
                     DAIFKFQESANGGVSLQHLFHVTRALGVYLHDTDARSSQLLLSQYSDKLTLLLSSVLS
                     LRDKDDPAATSVLNNAKFMAGMVWNTSQNTPELQGQDMADLVKAAKALL"
     gene            <184563..>185549
                     /locus_tag="AGOS_AAL089W"
                     /old_locus_tag="AAL089W"
                     /db_xref="GeneID:4618480"
     mRNA            <184563..>185549
                     /locus_tag="AGOS_AAL089W"
                     /old_locus_tag="AAL089W"
                     /product="AAL089Wp"
                     /transcript_id="NM_207806.1"
                     /db_xref="GeneID:4618480"
     CDS             184563..185549
                     /locus_tag="AGOS_AAL089W"
                     /old_locus_tag="AAL089W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR246C (ENV9)"
                     /codon_start=1
                     /product="AAL089Wp"
                     /protein_id="NP_982453.1"
                     /db_xref="GeneID:4618480"
                     /translation="MMDKLDLDQLPYYDPRVERKVALVTGGNSGIGWYTVLHLYMHGF
                     IVYVGGRNSSRVHKAIKEIKQEAENRLETARQDPHDELERCLGELRYLPIDLTDLRSV
                     EKAAKKFRAQESTLDVLINNAGVMALPYELTHDGFEVQMQTNYVSHFLLTMRLLPYVK
                     RSGGRVVTLSSIGHKIQFTYCPLDCHFDYRPNIFFTWLRYAMAKTAAIQFTKMLAIKH
                     PDVMCIAVHPGLVMNTNLFSYWTRLPIVGIIFWIFFQIVGFCFGVSNEEGSIGTLKSA
                     LSPALTLERDNGKYFTTGGVESRPSSVANNLDNAASTWIWTVHQLRDRGYEI"
     gene            <185827..>189141
                     /locus_tag="AGOS_AAL088W"
                     /old_locus_tag="AAL088W"
                     /db_xref="GeneID:4618800"
     mRNA            <185827..>189141
                     /locus_tag="AGOS_AAL088W"
                     /old_locus_tag="AAL088W"
                     /product="AAL088Wp"
                     /transcript_id="NM_207807.2"
                     /db_xref="GeneID:4618800"
     CDS             185827..189141
                     /locus_tag="AGOS_AAL088W"
                     /old_locus_tag="AAL088W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL160W (CDC60)"
                     /codon_start=1
                     /product="AAL088Wp"
                     /protein_id="NP_982454.2"
                     /db_xref="GeneID:4618800"
                     /translation="MSTVNSKGSKSSKGSKGLVLENTARRDTLIAIEKKYQQLWQEER
                     LFEVDAPTLEDEPATVDSEELQRRHPKFMATMAYPYMNGVLHVGHCFTMSKVEFSVGF
                     ERMNGKRALFPLGFHCTGMPILACADKLKREAEMFGEDFANAPAAEEEEELEVREDSK
                     PGSEDVTKFKAKKSKAVAKQGRSKYQFEIMMQLGIAREDVIKFADAQHWLTYFPPLCE
                     EDCTAIGARVDWRRAYITTDMNQYYDAFVRWQMNKLREAGKVKFGERYTIYSERDGQA
                     CMDHDRQSGEGVTPQEYVGIKIEVLEFAAEAQEIIDNSGLDKSKKIHFIAATLRPETM
                     YGQTCCFVSPTLQYGVFDAGDSYYITTERAFKNMSYQKLTPQRGYYKPLFTIEGKKFV
                     GSKVQPPLSVYKEVRILPMENVIASKGTAVVTCVPSNSPDDYMTTQELKNKPEYYGIK
                     PEWIDFEILPIISTEKYGDFIAKAICEEMKIRSPRDIIPLAEAKKLAYKEDFYNGVMI
                     YGPLKGTKVAQAKNLVRDQLIAEGKAFIYNEPESVVISRSGDECIVSLEDQWYLDYGE
                     PTWKKQAEECLEEMCLFAPEVKNHFEGVLDWLKNWAVSRTYGLGTRLPWDPKYLIESL
                     SDSTIYHAFYTFSHLLFKDYYGKEVGPLGIKAEQMTDEVFDYIFQNIDEVKETTIPLE
                     SLQKLRREFEYFYPLDVSISGKDLIPNHLTFFIYNHVALFPKKFWPRGIRANGHLMLN
                     NAKMSKSTGNFMTLKQIVEKFGADASRIALADAGDSMEDANLDEANANAAILRLFNFK
                     EWAQEIVQEVDSLRTGELTDFFDLAFENEMNALIEETYKQYELTNYKGALKFGLFDYQ
                     ASRDYYRESCGVMHRDLVLRYIETQILMLAPIAPHFCDYIYREVLGHTESVQVAKFPR
                     ASKPVDAGVLSALEYLRDLQRSIREAEGQALKKRKGKGSDVDPTKPAKLSMYITESFP
                     SWQTKYIEMVRELFEQQKLDDNQILKSKVEPKDMKRAMPFISMLKQRLASESPSTVFN
                     RELLFDEESIVKSTLDAIKRACQAIKVDVYQFIVFPHGSTKGRDILTGEEQEVPVCKA
                     TENALPGQPGICINNL"
     gene            <189767..>189973
                     /locus_tag="AGOS_AAL088WA"
                     /db_xref="GeneID:9487548"
     mRNA            <189767..>189973
                     /locus_tag="AGOS_AAL088WA"
                     /product="AAL088W-Ap"
                     /transcript_id="NM_001355297.1"
                     /db_xref="GeneID:9487548"
     CDS             189767..189973
                     /locus_tag="AGOS_AAL088WA"
                     /note="NOHBY121; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0D06083g"
                     /codon_start=1
                     /product="AAL088W-Ap"
                     /protein_id="NP_001342240.1"
                     /db_xref="GeneID:9487548"
                     /translation="MSDILELDIVRNDIGPVLEEYFTDREQFVLFAQEQDYDIDTCME
                     LCDTVRCLNEAMDETDSSHGGRNP"
     gene            complement(<190117..>190686)
                     /locus_tag="AGOS_AAL087C"
                     /old_locus_tag="AAL087C"
                     /db_xref="GeneID:4618430"
     mRNA            complement(<190117..>190686)
                     /locus_tag="AGOS_AAL087C"
                     /old_locus_tag="AAL087C"
                     /product="AAL087Cp"
                     /transcript_id="NM_207808.1"
                     /db_xref="GeneID:4618430"
     CDS             complement(190117..190686)
                     /locus_tag="AGOS_AAL087C"
                     /old_locus_tag="AAL087C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL159C (PET20)"
                     /codon_start=1
                     /product="AAL087Cp"
                     /protein_id="NP_982455.1"
                     /db_xref="GeneID:4618430"
                     /translation="MFCACRRNILSISRARVPTFGRIRYQSSFTFNDNASLLAEEQAA
                     EVQNGTGKNARSEGASASPAAKVTVEAGRPEESRRARKRDYSWFPVAPSTQHLTNEDI
                     ALSNLFSRQRPITPTPREDGVQHLILVLELPDLLPRKSGLAGHTRSSEWNTVPPAMLK
                     AMARFRPPPGTRRGGRRRPVLPPTRKRED"
     gene            191699..191772
                     /locus_tag="AGOS_t0004"
                     /db_xref="GeneID:4618429"
     tRNA            191699..191772
                     /locus_tag="AGOS_t0004"
                     /product="tRNA-Val"
                     /codon_recognized="GUA"
                     /db_xref="GeneID:4618429"
     gene            <191962..>192384
                     /locus_tag="AGOS_AAL086W"
                     /old_locus_tag="AAL086W"
                     /db_xref="GeneID:4618583"
     mRNA            <191962..>192384
                     /locus_tag="AGOS_AAL086W"
                     /old_locus_tag="AAL086W"
                     /product="AAL086Wp"
                     /transcript_id="NM_207809.1"
                     /db_xref="GeneID:4618583"
     CDS             191962..192384
                     /locus_tag="AGOS_AAL086W"
                     /old_locus_tag="AAL086W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR286C"
                     /codon_start=1
                     /product="AAL086Wp"
                     /protein_id="NP_982456.1"
                     /db_xref="GeneID:4618583"
                     /translation="MRPFWGHLLYYPSAEAYRNSRNYFSTVSSMLGHLVRRIHIARAC
                     NTQHNVRLQLFSKEHCGLCDNAKVAVANLLKRPEYQGLEVDTIDITLPENKTWWDKYC
                     LDVPVLHVENKKDSGRMKKIFHRVQEEQLIKTIKDIEN"
     gene            complement(<192431..>194931)
                     /locus_tag="AGOS_AAL085C"
                     /old_locus_tag="AAL085C"
                     /db_xref="GeneID:4618535"
     mRNA            complement(join(<192431..193757,193820..>194931))
                     /locus_tag="AGOS_AAL085C"
                     /old_locus_tag="AAL085C"
                     /product="AAL085Cp"
                     /transcript_id="NM_207810.2"
                     /db_xref="GeneID:4618535"
     CDS             complement(join(192431..193757,193820..194931))
                     /locus_tag="AGOS_AAL085C"
                     /old_locus_tag="AAL085C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR285W (ZIP1)"
                     /codon_start=1
                     /product="AAL085Cp"
                     /protein_id="NP_982457.2"
                     /db_xref="GeneID:4618535"
                     /translation="MSNFFRDNKIGFKPRSNIFLKMRSKESLKEAEADSSDSSGADSH
                     LFLRGDGVSNTSVTTGTSAAENSMGSAVHMQPTAMQMSTPKATKVLLALDGKDEGPNM
                     APLYAPGSEHDSGVHSRRPGDKGSESPSAVAWPRRKRDLAMVSGNDASSNDVLSEAFA
                     NTQRIYSNLKQELDRQHAKNEQQQQEIELYRNEIEAIRGKVSNYRNLLTALEDDSKLL
                     LEQKNNGEKKLEQLRLAYDSMAAKVGIFQKQSSELKMTLEDLRSLTLARESQLKGKDA
                     EIEHLKDELNNYTYQLDQEKVKNSELLHVLGGIKAELKELAVTVVEQCGSDASANMNT
                     ILGEVNSMKSTFAEELMRRLEPLGSIIGTKSAEQIKIIKEQTELLSSKLQEENEKSTQ
                     LLAARLEPMLQELLSRWNESGKLQKSTCTSIEEGQTRLIDTLKVSSDLVREQVEAVRL
                     NFMEQLKGVEKYLDKFGCQLDKNSQYENQVVDLQKQVHNIALQKSEVVALMKVKDTEV
                     DSLNAQLLQSGESVNSLRESNSALDKQVIQLGLELTRKVEENTRICEELTSEKATFEQ
                     KFEAQKEVVKLLTHEAESLKSRLEQCEGEATAAKKDKQEALDKFQQLQEHLHKLNVDA
                     VQLKAHELELVEENRKLKVTVDGMESANKEDENELFKLKEQVKIMDLEKHNFITERLD
                     YQDKIESLEKQLTQLRKQLQKENEISRDVKQAPVKPPHPEPLVYSSAVVPDRNSHNDD
                     EFDLSSSLNDELDLTNPSPIQIKTVPAKRKNQSTAKAMPSRKGKASSNINRKKLLSDD
                     DDELACKLKKKKRF"
     gene            <195420..>196436
                     /locus_tag="AGOS_AAL084W"
                     /old_locus_tag="AAL084W"
                     /db_xref="GeneID:4618702"
     mRNA            <195420..>196436
                     /locus_tag="AGOS_AAL084W"
                     /old_locus_tag="AAL084W"
                     /product="AAL084Wp"
                     /transcript_id="NM_207811.1"
                     /db_xref="GeneID:4618702"
     CDS             195420..196436
                     /locus_tag="AGOS_AAL084W"
                     /old_locus_tag="AAL084W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR284C (DPP1)"
                     /codon_start=1
                     /product="AAL084Wp"
                     /protein_id="NP_982458.1"
                     /db_xref="GeneID:4618702"
                     /translation="MHSEGIYFRLGTKDHDQSLEGYAAPKLPYTLHGESKMAVDRVTL
                     SIPKFKKQDLLEKWRFTDVLFCIALVGANVGVYFAKPFERQFTINDITLSHPFAQVQR
                     VNDAMLVVYSFVVPLAVIIVVSLLFADPSHRYYLLYISVLGLFLSFLSDMIITNYIKN
                     WIGRCRPDFLERCMPREGLEKDVLYGIEVCTTTDTDRLLEGFRTTPSGHSSESFAGLG
                     YLFLWLSGQLLTESPAVGAWRKAVAFIPLMAAAVIALSRTQDYRHHFVDVILGSILGM
                     WIAWWSYRRNFPAIQSYVPFKPLLDNSDVGLLNAPMLPRSVDEEMAPLNTPSVQSRSG
                     TAQV"
     gene            <196773..>201869
                     /locus_tag="AGOS_AAL083W"
                     /old_locus_tag="AAL083W"
                     /db_xref="GeneID:4618618"
     mRNA            <196773..>201869
                     /locus_tag="AGOS_AAL083W"
                     /old_locus_tag="AAL083W"
                     /product="AAL083Wp"
                     /transcript_id="NM_207812.1"
                     /db_xref="GeneID:4618618"
     CDS             196773..201869
                     /locus_tag="AGOS_AAL083W"
                     /old_locus_tag="AAL083W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR283C (GCN2)"
                     /codon_start=1
                     /product="AAL083Wp"
                     /protein_id="NP_982459.1"
                     /db_xref="GeneID:4618618"
                     /translation="MSMGNLTLDEYYEIQQNELEAMESIYAGDFVDLTQRKASWDKKP
                     QRVFEISLRSIEKEPAESSLTLHFVLVSTYPHAAPQITFKKVQNVLDSQLALLRDDIR
                     RIHKSARGQEILFEITTRVQEVLDESQANANTQSLEAERLQRLEDEKVKLKLAEQENK
                     EKIELERAKEQELIDELVQKELEKRQDDDSLFGMDKAVNLLPPAEWISTGEAYVFPKA
                     IRAKLPNNSYYWFRAVVNKEPVKIGNDVLSFGKQYTVKPFIPSDSPLIGILANADFMD
                     NFHYLLTEIELQNSYFNTSNGKKEIANLERELDTLLKVNHEHVNKLYSYTVERIGLSS
                     TSFVWKIRLLTEYAESTCIGNIIESVGYVNLATSRGWILRLLEALESLHKHGIAHKQI
                     DLHTVHLIKDTDFGNTVPKLMHASYGHTISNMLNRYPNTKSGSKMIVNNCPWIPPEMV
                     KFNNSKPQRKSDIWNLAVLFIQMISGVDTPLHYQTPVDFLESVDMDESVVDFLNKMLA
                     PDPRLRLGPLELLPMKFLRTNIDAAVGKFYLFPDSVGTGTPTIISTGSNQHLRSRGIS
                     RTSDGGHRRSFNVGSRFSSVNSTTRSRYATDFEEIAVLGKGAFGQVVKARNSLDSRYY
                     AIKKVRHTEEKLSSILSEVMLLASLNHQYVVRYYAAWLEEDMLVEEMAITSSDESDIE
                     SDDNTESSIIDSFSNANVTTTRTVLNSMNNDWDFISHSFNNSSISNIIFANSTDEEDS
                     ANDIPSEGSRSEDELTDKHYEDENDTKSIDQGTSPTLTEGRGGKQYKSGINYRRSRRS
                     LRPADLADEKRSLMKSSRAKPKSTLFIQMEYCENRTLYDLIHNENLSQQRDEYWRLFR
                     QILEALSYIHSQGIIHRDLKPMNIFIDESRNIKIGDFGLAKNVHKSADILRIEGAFGS
                     NVSADDLTSAIGTALYVASEVLTGNGNYNEKIDMYSLGIIFFEMVYHFDTLMERATDL
                     RKLRSSAVELPANFDSSKRNEKKIIRLLLDHDPAKRPTAAKLLASGWLPVKHQDEVTK
                     EALKNLADPSSPWQQQVRESLFSQPYSLSNDILFDNSQNTATPFSQLLRAQMKEEVEK
                     VFRRHGGIENNEPPIIFPKAPFYSSQNVYEVLDRGGSVLQLQYDLTYPMARYLSKNPH
                     CISKQYRMQSVYRPAEQQHGSVEPRRFGEIDFDIISGSSADSALYDAESIKIIDELIS
                     VFPVFEKTNTLIIVNHSDIMESIFNLCSIDKAQRSLVSQMLSQVGFAKSFKDVKTELK
                     AQLNISSTSLNDLEMFDFKVDFDNAKKRLNKLMIDSPHLTKVEESLSYIFKVLNFLKP
                     LGVTRNVVVSPLSNYNSAFYKGGIMFQAIYDSGRVKSLLAAGGRYDNLISYIARPSGG
                     KIKHIKRAVGFNLAWDTIYLIVQNYFKLASGKQTKNRSRFLRENAIEWKPKRCDILVA
                     SFSDAILNSLGVRIVNKLWKLGISVDLVRNCYSVEDVISAAQIDGCDWIILIKQQNFS
                     ASSHKRKYKPLRIRKLDSEIDVDMDLDEFIQLYQQETGIRSTAEILPSSENSQIEEGT
                     SKWEEFSSADGSQDGGSGIAPIGQQKVVHIPNNSARAKAKQNKKDKWVFEESARNASK
                     AIVHSLSSAPVFSVDAIRDEVLEIISITSLAQKDEWLRKVFGSGANSAPRSFATSIYN
                     SLSKEAAKGTKWAILHCHKTGSSCVVDLQR"
     gene            <202079..>202760
                     /locus_tag="AGOS_AAL082W"
                     /old_locus_tag="AAL082W"
                     /db_xref="GeneID:4618661"
     mRNA            join(<202079..202092,202145..>202760)
                     /locus_tag="AGOS_AAL082W"
                     /old_locus_tag="AAL082W"
                     /product="AAL082Wp"
                     /transcript_id="NM_207813.1"
                     /db_xref="GeneID:4618661"
     CDS             join(202079..202092,202145..202760)
                     /locus_tag="AGOS_AAL082W"
                     /old_locus_tag="AAL082W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR041C (SRB2); 1-intron"
                     /codon_start=1
                     /product="AAL082Wp"
                     /protein_id="NP_982460.1"
                     /db_xref="GeneID:4618661"
                     /translation="MKRTAVIFIEKATPSTITQFHDILSTHVLAIQEKWSFELKTFRS
                     SIKNLPPSDTKVLYSLQLTHRDNQTVVIKNQSAIVTGQHSTDALTSNGCSSGFPEPFD
                     NILTSKLSNIWTQRQSTKGNFGTTYKTSELIIRASNVFSSSGFKGLLLEIECTDPVSA
                     EEFDRRVANIRAMLSEIDINDYKLNKDEMNEGKPVFLCDLAYQYVKVLD"
     gene            complement(<202842..>203882)
                     /locus_tag="AGOS_AAL081C"
                     /old_locus_tag="AAL081C"
                     /db_xref="GeneID:4618527"
     mRNA            complement(<202842..>203882)
                     /locus_tag="AGOS_AAL081C"
                     /old_locus_tag="AAL081C"
                     /product="AAL081Cp"
                     /transcript_id="NM_207814.1"
                     /db_xref="GeneID:4618527"
     CDS             complement(202842..203882)
                     /locus_tag="AGOS_AAL081C"
                     /old_locus_tag="AAL081C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR289C (RTT103)"
                     /codon_start=1
                     /product="AAL081Cp"
                     /protein_id="NP_982461.1"
                     /db_xref="GeneID:4618527"
                     /translation="MSFSEEQFIGKLNGLDETQESIVGASKWLLTLYKEAPVVAQSWA
                     KYILMTSTNTRRKLLAIYLVNDVIQQAKHKRIFQFGNEFGRVLPNVLKQVFPELPQEL
                     QKKVQRVVAIWRQRQILSDNVLNNIERYLQGTGAGTTVAVGTINSRIDEACGLYRTLE
                     KYAPNVKSTQLKFEKSLEALDPNSMVYVENFKTVTKIATAAKETVHKSVELRQKLIEQ
                     LEVLVAEQKTLLANELHIVSEVDVQLASKDPSAVQGTSAGDDNVLPTYEQELDSDNSS
                     DDSDDESNLKKRSPHDDSDSQSKRPKLSRDEDMGGGYEPAVVAGTDASRTPEDQNSIT
                     SSIQDLLSKLAN"
     gene            <204016..>207198
                     /locus_tag="AGOS_AAL080W"
                     /old_locus_tag="AAL080W"
                     /db_xref="GeneID:4618416"
     mRNA            <204016..>207198
                     /locus_tag="AGOS_AAL080W"
                     /old_locus_tag="AAL080W"
                     /product="AAL080Wp"
                     /transcript_id="NM_207815.1"
                     /db_xref="GeneID:4618416"
     CDS             204016..207198
                     /locus_tag="AGOS_AAL080W"
                     /old_locus_tag="AAL080W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR291W (HRQ1)"
                     /codon_start=1
                     /product="AAL080Wp"
                     /protein_id="NP_982462.1"
                     /db_xref="GeneID:4618416"
                     /translation="MEGPVKKAKVDGLQEIRRIFTKLNTLYTFLLSRKHVLTTFETLR
                     GPLEQAIKRPLEIADLARIAVVMGRSVEFRYVDLNQIHAETKVFDFGRGGYQQKESDI
                     FQLKSGSESMDETQALVFEFVDGNMSRAWSAGGTPEFTMDQMRRMITRRRDVFEERLA
                     AFAASAEERGLDTWEELCRAADLELPRPKQYVDPVQAMIEAQEGRGTAGPDGQKDIDR
                     PPMNVLLERLKHTKIYSGQIAALHVQKERTAAYGKLDFDLAPEVVNALDHDQLYIHQA
                     EALNAVHAGNNVIITTSTSSGKSLIYQLCAIDALLKDRDSTFMYIFPTKALAQDQKRA
                     FQQLLSRIPSLATVVVATYDGDTEQQNRAAIRKHARVIFTNPDMIHSSILPNHPGWRH
                     FLMHLKLVVVDELHVYKGLFGSHVALVMRRLLRLVRDFYLNAQLRFISCSATIKRPVE
                     HMTNMFGVSDIVHVFKDGSPNGLKYLGVWNPPALPQHMHKRENFIQESAKILVELIVN
                     NTRTIAFCYVRRVCELLMKEVRIILQEMGRIDLVNDVMSYRGGYSVDDRRKIEEEMFH
                     GGLRAVISTNALELGIDIGTLDCVLMCGFPLSLANFHQQSGRAGRRNKDSLTLVVAAD
                     SPVDQHYVAHSEILLEYDNDPDKLQELTLDFDNELILEGHIQCAAFELPIDIKRDQQF
                     FNKKYLQDLCTNRLQHDSDGYHANDNYLPWPPKMVSLRGVEEDIYAVVDITNGRNIVI
                     EEIEASRTTFTLYDGGIFIHQGYPYLVKEFNADDKYAKVQRVDVDWLTSQRDFTDVDP
                     QEIQLVRSLTDSDVPVYFGKIRTTMIVFGFFKVDKHGRILDAVETHNPPVIIDSKGLW
                     IDIPRQALELVKERGLNMAGGIHAAEHGIIGLLPRFIVAGVDEINTECKAPEKEFAQR
                     QTSRLRPARLVFYDSKGGHHGSGLSSKIFENIESILNGALQRIEECPCEDGCPDCVAA
                     SFCKERSLVISKPASLIILHSILGHDPSTYMHKINQGPEPNMAQVKVETIEPVTTPVK
                     FAADVEIIDVRRIRNPKSEELEIKEEFTDE"
     gene            complement(<207304..>209064)
                     /locus_tag="AGOS_AAL079C"
                     /old_locus_tag="AAL079C"
                     /db_xref="GeneID:4618637"
     mRNA            complement(<207304..>209064)
                     /locus_tag="AGOS_AAL079C"
                     /old_locus_tag="AAL079C"
                     /product="AAL079Cp"
                     /transcript_id="NM_207816.2"
                     /db_xref="GeneID:4618637"
     CDS             complement(207304..209064)
                     /locus_tag="AGOS_AAL079C"
                     /old_locus_tag="AAL079C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR292C (SRP101); Newly annotated start codon according to
                     experimentaly determined 5' end of mRNA using 5' RACE"
                     /codon_start=1
                     /product="AAL079Cp"
                     /protein_id="NP_982463.2"
                     /db_xref="GeneID:4618637"
                     /translation="MIDQFAIFTAQGQLLFQYASLKKRFSEQLCNKFIHELISRPPAI
                     NESKFATVSVDSHTFIFRETKATRLFYVASYASAPSLTLNHEAEQVVDMSLQLWDSLG
                     LDSALRAARKEPKGSITLEAVQEELFKFEKYFTVKYESMVEKELSTKSIRDSSPAAQQ
                     LKKPTNKKATTGGTQKTRRWNSNGMLDDSNVNADQLDFSPIPDDISTAPAEVTNVNQS
                     DFGSRTEDGQFLIKEIDNMLSQAKKDSTRQPSSAGAPAGVLGFLRKKWLGNKTIDEGD
                     LHAILEKFKKHLIGKNVAPAAADYLTSRVSEQLVGLKTASWTSVEQTARDALEQALIS
                     ILTPGVSVDLLHEIQKKVGNKVDAKCDPYVFSIVGVNGVGKSTNLSKLAFWLLQNKFK
                     VLIVACDTFRSGAVEQLRVHVENLAQLTDDNHVRGSKNKRGKSGNDAVELFEAGYGGS
                     DLVTKIAKQAIKYAREQQFDVVLMDTAGRRHNDATLMSPLKSFADQAKPDKIIMVGEA
                     LVGTDSVQQAKNFNQAFGKDRNLDFFIISKCDTVGEMLGTMVNMVYATGIPILFIGVG
                     QTYTDLRTLSVTWAVNSLLS"
     gene            <209599..>211377
                     /locus_tag="AGOS_AAL078W"
                     /old_locus_tag="AAL078W"
                     /db_xref="GeneID:4618658"
     mRNA            <209599..>211377
                     /locus_tag="AGOS_AAL078W"
                     /old_locus_tag="AAL078W"
                     /product="AAL078Wp"
                     /transcript_id="NM_207817.1"
                     /db_xref="GeneID:4618658"
     CDS             209599..211377
                     /locus_tag="AGOS_AAL078W"
                     /old_locus_tag="AAL078W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YGL055W (OLE1)"
                     /codon_start=1
                     /product="AAL078Wp"
                     /protein_id="NP_982464.1"
                     /db_xref="GeneID:4618658"
                     /translation="MNGEVEDEDQIPEFDFSEFLRANSHRVAPYGSPLGTAPNSTGDE
                     ATAGADLSGDSALPVAEAPLLQGISTPEEGVDYDDGLIPELDCEQLLDENPHLVPPSA
                     PWMPSPLTVENTVPLLAAKLPKKYEPQVIHLLKKVDLVTMTFSIVLPVFSLLHLVFAA
                     PPLNATLVKIWIAYYLLTELSLIAGYHRLFTHQSYHCHIFVQFIMAVIGTSCGLGSIL
                     QFSSQHLAHHRYSDTERDPQSLSLYGWWFAQWGHKLFKGNKKSAKAVADCRKTLVSSV
                     CAPRNKQLRSKQFVVPPSYSLLKWQDENYYMLWIITNLFIPTILAFTVCQLSVFSCVF
                     YLGLVRMSLVQQQWLLAGSLGHLKTLPFSSQPFDDSRSAVDLPLSILAQVITFGESNH
                     NFHHEFPGDYRNGPAWYAFDPAKWAINLMGHLGLVHHMHSASSDQIDMCRVQQQQKIL
                     DGERSKLQWGIPIDRLPMITPEQFATVARKDYEEKEKALVAIEGIIHDVTPFMHDHPG
                     GMALVVASVGKDATPAFNGAVYAHSTAARNLLATMRVARLTKGSCVVQTSWEHNLLND
                     SQGQRIVRNRTQATVTRDIYYAASAA"
     gene            complement(<211522..>212607)
                     /locus_tag="AGOS_AAL077C"
                     /old_locus_tag="AAL077C"
                     /db_xref="GeneID:4618717"
     mRNA            complement(<211522..>212607)
                     /locus_tag="AGOS_AAL077C"
                     /old_locus_tag="AAL077C"
                     /product="AAL077Cp"
                     /transcript_id="NM_207818.1"
                     /db_xref="GeneID:4618717"
     CDS             complement(211522..212607)
                     /locus_tag="AGOS_AAL077C"
                     /old_locus_tag="AAL077C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR040W (BCD1)"
                     /codon_start=1
                     /product="AAL077Cp"
                     /protein_id="NP_982465.1"
                     /db_xref="GeneID:4618717"
                     /translation="MTSTTSCEGCEVCKTGEPKYRCPRCSRRTCSLACSRQHKEQENC
                     SGTSGQTTEYIPRGVLKGADTKDETNPLVQRDYNFLIGLNRKVQLLKEGSSQKNKNIV
                     HAGRGDGGHGRVGKPGSVVRRGVRCMLLPKGMQRSLWNKSKWDKSLDTFVWTIEWAVA
                     RPGGEQWTHCSHRNQEQSRLLDCIGKAVFDKCAEWLPLAAAGDDGEPLTKASRLQALV
                     GSGLRYYTKQFPAETEGVIDTKRVVELDPQKAVGELFRNKTVIEFPTVYIAASAEDME
                     RLGFRVASDGTTTSSSDSSDTSSSDSSDSSSGDSSSDSDSSSDGEPEENPARLEPAPP
                     PASPSHGGETDSDDGYTPGISLDFLAD"
     gene            <212993..>213387
                     /locus_tag="AGOS_AAL076W"
                     /old_locus_tag="AAL076W"
                     /db_xref="GeneID:4618689"
     mRNA            join(<212993..212995,213046..>213387)
                     /locus_tag="AGOS_AAL076W"
                     /old_locus_tag="AAL076W"
                     /product="AAL076Wp"
                     /transcript_id="NM_207819.1"
                     /db_xref="GeneID:4618689"
     CDS             join(212993..212995,213046..213387)
                     /locus_tag="AGOS_AAL076W"
                     /old_locus_tag="AAL076W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR039C-A (VMA10); 1-intron"
                     /codon_start=1
                     /product="AAL076Wp"
                     /protein_id="NP_982466.1"
                     /db_xref="GeneID:4618689"
                     /translation="MSQSNGIATLLKAEKEAHEIVASARRYRQERLKQAKLDALQEIN
                     EYRRRKEQELREYEAANAGGAEELERDAEQRAQKELDEIRRVAGAKRDAVVELLIDAV
                     TKPQHELHVNAG"
     gene            <213683..>215596
                     /locus_tag="AGOS_AAL075W"
                     /old_locus_tag="AAL075W"
                     /db_xref="GeneID:4618546"
     mRNA            <213683..>215596
                     /locus_tag="AGOS_AAL075W"
                     /old_locus_tag="AAL075W"
                     /product="AAL075Wp"
                     /transcript_id="NM_207820.1"
                     /db_xref="GeneID:4618546"
     CDS             213683..215596
                     /locus_tag="AGOS_AAL075W"
                     /old_locus_tag="AAL075W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR039C (MSC7)"
                     /codon_start=1
                     /product="AAL075Wp"
                     /protein_id="NP_982467.1"
                     /db_xref="GeneID:4618546"
                     /translation="MSQIYLNSSMLVQLNATVQEFISDWLEHYSIHQQTLNPTQRILQ
                     FGTTTTVVLLGFLYLMGKWFLGPGNGGKPVPFELAVPEAAQKHWKGKRLFSASVYDPQ
                     QPGMIQNYCPATGQFLGSFRSMSKEDIDERFAAAAKAQVSWAKTSFAQRRQVLKTMQK
                     FVLENQEMLARVACRDSGKTMLDASLGEIMVTMEKLQWMIKHGERTLRPSKRAGPANF
                     FMKLYKGGEVRYEPLGVVGAVVSWNYSFHNTLGPIIASTFAGNGVVIKCSEQVVWSSE
                     FFVKLARESLKVCGHDPELVQLCYCFPPSETDDTANYFTSHPSLRHLTFIGSKPVAHH
                     VLACAAKSLTPVVVELGGKDALVVLDSAKDLESLSSIIMRGTFQSAGQNCIGIERVIV
                     CQKNYDALVKILEHRISELRVGADIDNLEDVDVGAMISDNRFDYMEELIQDAVSQGAR
                     LLHGGSRYTHPKYPQGHYFQPTLLVDVTTDMRISQNEVFGPVLTVMKAKDIEDCIRIA
                     NDTPFGLGGSVFGKNRKDCNYVANHMNVGNVAINDFATYYVCQLPFGGIGSSGYGRFG
                     GEEGLLGLCNSKSICYDKVSWISTFIPPPVDYPIKSSAGAWNFARAFITGAYTNSLWQ
                     RAKSILELAKGGR"
     gene            complement(<215636..>216316)
                     /locus_tag="AGOS_AAL074C"
                     /old_locus_tag="AAL074C"
                     /db_xref="GeneID:4618550"
     mRNA            complement(<215636..>216316)
                     /locus_tag="AGOS_AAL074C"
                     /old_locus_tag="AAL074C"
                     /product="AAL074Cp"
                     /transcript_id="NM_207821.1"
                     /db_xref="GeneID:4618550"
     CDS             complement(215636..216316)
                     /locus_tag="AGOS_AAL074C"
                     /old_locus_tag="AAL074C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR038W (RRF1)"
                     /codon_start=1
                     /product="AAL074Cp"
                     /protein_id="NP_982468.1"
                     /db_xref="GeneID:4618550"
                     /translation="MFLLNASRLGAGSRLFSSAGVQFAKKRGQAAKEAVEVDLVDVGD
                     YVKKATERFQHTVELHKKRLGQMKAGKPDATMFDGLAVGNEKQKFTELAATSVKGKNM
                     LIVTVFDPKDTKRVASAIVGAGLNVTTERVLENQQQLKISLPPVTTETRERLCRDMKK
                     VFEEYKNSANRHSLGHVRSEVLKELKKLDKKNDSVRKVIQEIENLHKEYTAMLQEQLK
                     HAEKNAMR"
     gene            <216808..>218499
                     /locus_tag="AGOS_AAL073W"
                     /old_locus_tag="AAL073W"
                     /db_xref="GeneID:4618515"
     mRNA            <216808..>218499
                     /locus_tag="AGOS_AAL073W"
                     /old_locus_tag="AAL073W"
                     /product="AAL073Wp"
                     /transcript_id="NM_207822.1"
                     /db_xref="GeneID:4618515"
     CDS             216808..218499
                     /locus_tag="AGOS_AAL073W"
                     /old_locus_tag="AAL073W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YGR087C (PDC6) and YLR134W (PDC5)"
                     /codon_start=1
                     /product="AAL073Wp"
                     /protein_id="NP_982469.1"
                     /db_xref="GeneID:4618515"
                     /translation="MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMR
                     WAGNANELNASYAADGYARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVP
                     STSAQAKQLLLHHTLGNGDFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQ
                     RPVYLGLPANMVDLTVPASLLNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILS
                     DACASRHDVKQETKQLIDVTQFPAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAV
                     ESADLILSVGALLSDFNTGSFSYSYKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLV
                     KRIGEAAKGYQPSPVPTYAAPNEDADPKTPLKQEWLWNQVSSFLKEGDIVITETGTAA
                     FGINQTRFPSSTIGISQVLWGSIGFTTGACLGAAFAAEEIDPNKRVILFIGDGSLQLT
                     VQEISTMVRWGLKPYLFVLNNDGYTIERLIHGETAQYNCIQPWKHLDLLPTFGAKDYE
                     THRVATTGEWRALTEKQEFNKNSSIRMIEIMLDVMDAPSSLIKQAKLTAATNAQP"
     gene            complement(<218957..>222619)
                     /locus_tag="AGOS_AAL072C"
                     /old_locus_tag="AAL072C"
                     /db_xref="GeneID:4618532"
     mRNA            complement(<218957..>222619)
                     /locus_tag="AGOS_AAL072C"
                     /old_locus_tag="AAL072C"
                     /product="AAL072Cp"
                     /transcript_id="NM_207823.1"
                     /db_xref="GeneID:4618532"
     CDS             complement(218957..222619)
                     /locus_tag="AGOS_AAL072C"
                     /old_locus_tag="AAL072C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR293C (SSD1)"
                     /codon_start=1
                     /product="AAL072Cp"
                     /protein_id="NP_982470.1"
                     /db_xref="GeneID:4618532"
                     /translation="MSGGGQKHEDGGSKYVTTSGGKNNPKQIHIAHRKSPSELTNLMI
                     EQFTLQRQLELVQVQQQQLLAQQQQLAQQAGQYLNAGGLGNAGGGATLPFLPQPPQPQ
                     YNSSPSGGNKSRSHSRNNSGYYNSGDFGGGAHRRTGSQSSVYGHARRHSLGLNEAKKA
                     AAEEQAKRAGNGAGNISIKIDVPSEVDPASPGVTESISSFKFPPTPLENTKGHRRVNS
                     NMSPNRAFQFPARPSNKENQDDFVQVGNSHRRTNSRGHDLSGINSNWRAQQGQQQQPA
                     PFHKQTFSNQGFGALEPPPVFQPGHRSRGSNASAHSFSSNSGGNNSNGRKSLFAPYLP
                     QANIPQLIEEGRLVAGVLRVNKKNRSDAWVSTDGVLDADIFICGSKDRNRALEGDLVA
                     VELLMVDDVWESKKEKEEKKRRKDASTQHDLILESKDDYHNDASSSIVTASASSTASQ
                     GTSASSDKNEDGSNSGSGSIKRRGSLKQRPTQKKNDDVEVEGQSLLLVEEEEINDEYR
                     PLYAGHVVAVLDRIPGQLFSGTLGLLRPSQQANNSDKPQKPKIVWFKPTDKKVPLIAI
                     PIEQAPKDFVENADKYLDKMFVASIKRWPITSLHPFGTLVSQLGEINDPSSEIDAILR
                     DNNFLLDEYLDPHDRTRERDTFKPVEVPLSELAQRKFYDGAIAISENGILSDLAIHVS
                     HLPNGSIELGCHVVDATAHIEEGSSLDRRARKRSSAVFMPQKTLYLLPEALNKFLTLE
                     PGKRTCTISVVYTLAPETLAVTSCWVGETSVSPKAVLTFDEISDVLGKGTGHENTFVE
                     TVSAVAASFYRERLGMKNSVPNLLKTKLALLDSLDDEKVKVDINILDKSPAAYVIGEI
                     EHKVNSTIAERTYVKLGSSAFLRRQPQPISTKLQLFKKKIQKFGFEIDITTPESLLSS
                     ILAIEDPTVRLGVELLLFKTVNRARYFVAGKVEPDQYGHFSLNLHLYTHFTSPLRRYA
                     DHVVHRQLKSILRGTEYRQDVDSLKITSEYCNFKKDCASHAQEQAVHLLLCKSINDMG
                     NATGQLLTMATVLQVYESSFDVFIPELGIEKRVHGDQLPLIKAEYDSSNRVLDLYWQK
                     GVDSATFVPVDEKNPNSYRNSIRNKFSSSSKEIASVQLSARDSHERLIKSDDLATEFD
                     KLHIKPPQLYIPAAEATADPLAAYLNDVITRVEGDNYIQEIHELKKVPILLRAEIGMA
                     LPCLTVRALNPFTSRD"
     gene            complement(<223169..>224890)
                     /locus_tag="AGOS_AAL071C"
                     /old_locus_tag="AAL071C"
                     /db_xref="GeneID:4618407"
     mRNA            complement(<223169..>224890)
                     /locus_tag="AGOS_AAL071C"
                     /old_locus_tag="AAL071C"
                     /product="AAL071Cp"
                     /transcript_id="NM_207824.1"
                     /db_xref="GeneID:4618407"
     CDS             complement(223169..224890)
                     /locus_tag="AGOS_AAL071C"
                     /old_locus_tag="AAL071C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR037W (PUT2)"
                     /codon_start=1
                     /product="AAL071Cp"
                     /protein_id="NP_982471.1"
                     /db_xref="GeneID:4618407"
                     /translation="MLSRSRLLGYSARTIAQLSRPGCPRISNEAVKPFSKRDTLDWDL
                     LRASLSKFNNSSLDVPLVINGERIYFNDAGKRELFKQVNPARHTQVLAHVTQASREDV
                     RAAVRAAQDAKQKWYETPFYDRAAVFLKAADLVATKYRYDMLAATMLGQGKNVQQAEI
                     DCITELADFFRFNVKYAEELYQQQPAESSPGVWNRSEYRPLEGFVYAVSPFNFTAIAG
                     NLVGAPALMGNTVVWKPSQNAALSNYLLLTVLEEAGLPRGVINFVPGNPVDVTEEVLA
                     DKALGGLHFTGSTAVFKQLYGKIQQGVVSGLYRDYPRIVGETGGKNFHLVHPSANLPH
                     AVLSTLRGAFEFQGQKCSAASRLYLPQSKADAFLADLAGTLAAIKPANTSASSINGGD
                     LHAFMGPVIHEQSFDKLAAAIERARTDPELEILYGGDHSKSQGYFVGPTVVRTSNPRH
                     DFMTAEFFGPILTVYEYPDAQFDQVCDLIDSTSAYGLTGAVFARDRDAIAAADRRLKY
                     AAGNFYINDKATGAVVAQQWFGGARMSGTNDKAGSPNVLSRFVSVRSVKENFYELTDF
                     KYPSNYE"
     gene            complement(<225226..>226479)
                     /locus_tag="AGOS_AAL070C"
                     /old_locus_tag="AAL070C"
                     /db_xref="GeneID:4618727"
     mRNA            complement(<225226..>226479)
                     /locus_tag="AGOS_AAL070C"
                     /old_locus_tag="AAL070C"
                     /product="AAL070Cp"
                     /transcript_id="NM_207825.2"
                     /db_xref="GeneID:4618727"
     CDS             complement(225226..226479)
                     /locus_tag="AGOS_AAL070C"
                     /old_locus_tag="AAL070C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR036W (BRL1)"
                     /codon_start=1
                     /product="AAL070Cp"
                     /protein_id="NP_982472.2"
                     /db_xref="GeneID:4618727"
                     /translation="MMEEFGQLSLGDGCDTYGHRRDKTLQDVDLSAISRLRISEPGVS
                     QCARERSTISEEYRCKLQPYFSTTPSPLRQTIVAESDDEMDIDPAESVEAERTDAEQL
                     EDVLQDEEPEEDARASSSGHRGSVIKALLSPTTLGVAAATKELEDLAAPAAPPPVPAA
                     AAAAPLRSAPALGEQELQELRHNFNTRPLQVQVNHHHYYPGFAPYGAQSAHDPYDLPQ
                     PWSERSRPASKHTYAFTSYLQLALNVLTVFAISSLALSFLRALKTDLQSTWRHNKLEL
                     DYESQACRQSYDANLCDPATRVPALYEQCAQWEKCMSRDNNIFFRARSTLSARLVGDV
                     INSFIEPLGWKALLSILIGLLIWCFSSNFLLGFARAKSYYGSPLALAAPPAASPRQIT
                     ASQGSPERDLAISTALASAPRVRER"
     gene            complement(<226815..>228812)
                     /locus_tag="AGOS_AAL069C"
                     /old_locus_tag="AAL069C"
                     /db_xref="GeneID:4618791"
     mRNA            complement(<226815..>228812)
                     /locus_tag="AGOS_AAL069C"
                     /old_locus_tag="AAL069C"
                     /product="AAL069Cp"
                     /transcript_id="NM_207826.2"
                     /db_xref="GeneID:4618791"
     CDS             complement(226815..228812)
                     /locus_tag="AGOS_AAL069C"
                     /old_locus_tag="AAL069C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR295C (HDA2)"
                     /codon_start=1
                     /product="AAL069Cp"
                     /protein_id="NP_982473.1"
                     /db_xref="GeneID:4618791"
                     /translation="MNFCSKNAQMYYIPVGLTSLQKDLIEILLCMHAESFLEEFGPSE
                     AVMQSAAQIKTEKEPEAVEGLGLGPLTPTQMNTMLLRHLRAVANHPCLLVDHYMPRKF
                     LLMEPGEELIAMSEKFRVLNQMMEAILSRRRRQRPLQLVLVSHSVKELDLIEGFMLGK
                     MVKIKRLSGTSLFDEKHQYTERGTAAAESNSTLTSGSTLKDTSPGSVEGKLSSGEAGA
                     GYTTGGIKDDYDYQNSRRHMRAADDGAERQCDHEDWLFLATTTHLTHCTDLFDQYDVD
                     VVLSLDPLLDVSLPALRSVRKQSKSVPLVKLFVQDSAEHFMLTRGISAEHEEDHIYDA
                     VGHFIKNRGVHRQRLGMSAAALAEVVTALLENCEAATDLKSTKPTDTPSELSIVDALS
                     ERIMLLKLNHTPYELPLQRGPFSMKSYQLQLKQLIYARLEACQREQECKCAYILDRRM
                     QETANLNRLDEVNAEAGRLFQSLKDEEKLVVDSERRLERTRDEHDRLREKSAHLRRRK
                     AELEELLASSDLDSRVSSKRARLAELRQQLMPLEQQNTAMADSNEELRTRYQTRSSHA
                     ATLSSALASLRERKAALTKESTGPATCWMAASATEEHDRLQTELNDLVQQRHFLQKYI
                     DTMKSQYAITNLDELNRTQHNKSGAATSRVRTTRATSPTYI"
     gene            complement(<229090..>231084)
                     /locus_tag="AGOS_AAL068C"
                     /old_locus_tag="AAL068C"
                     /db_xref="GeneID:4618701"
     mRNA            complement(<229090..>231084)
                     /locus_tag="AGOS_AAL068C"
                     /old_locus_tag="AAL068C"
                     /product="AAL068Cp"
                     /transcript_id="NM_207827.2"
                     /db_xref="GeneID:4618701"
     CDS             complement(229090..231084)
                     /locus_tag="AGOS_AAL068C"
                     /old_locus_tag="AAL068C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR035W"
                     /codon_start=1
                     /product="AAL068Cp"
                     /protein_id="NP_982474.2"
                     /db_xref="GeneID:4618701"
                     /translation="MLQASYGTAPSTRNEALQQVIDRDENGHFCAVYDFALCATTEVG
                     VSPCGKCLAYPNSACRVVRERWLCAFCGSWNAAAGVGARRRGAHYAVGLGTSPAAAQL
                     VFVVDLTMEAAELQALKTHVAALVGSVSGRFGLVTLTDGAVTVCGGRGRAAAVPTDEY
                     RKFQLERLDPQPLLKRHLGEMSELWLTAEELLVAVGALEAQPCGAAQEERPRRGTGIA
                     FFVAALFNMHRVGFALKVLAFLAGPCTQGPGKVVSKSYRNHMRGHSELQNRKARYSSQ
                     AADYYRSLREFAPAVSYDVFITSLDQTGVWEMAQCLNHVVQYDTLVEDRFHLDMHAYA
                     RRLRNEIVPHQVNLITSDTVLVDGCFGPVRKLPPLRNNYSDTERGVGSTTTWAYNGTL
                     LSADELSLCFSLCLAPSVRQSSKESAAPNITLQVEFMYEVHGELCVAVTTLVLPTTSD
                     PAALSLPQSFNATICCVSFMKRIAWEILNGHWHSYKLHDWCTALDDLCVRHLDSGSFN
                     ASQLVQLSYYLQRSALLRLAQTSPDEWAVYLLAILRRDSTQCLHICRPLITMLTPERQ
                     QLRLNPDVLRDVRPMVVDASNYVIVRYSDPNDSALHAVRAMAQQLQLSRWPVPWYKDT
                     PIGKSQDRYVLSRLGVSTASNLPSSEVSLDAYITYIHSKL"
     gene            <231315..>231956
                     /locus_tag="AGOS_AAL067W"
                     /old_locus_tag="AAL067W"
                     /db_xref="GeneID:4618675"
     mRNA            <231315..>231956
                     /locus_tag="AGOS_AAL067W"
                     /old_locus_tag="AAL067W"
                     /product="AAL067Wp"
                     /transcript_id="NM_207828.1"
                     /db_xref="GeneID:4618675"
     CDS             231315..231956
                     /locus_tag="AGOS_AAL067W"
                     /old_locus_tag="AAL067W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR296W (MHR1)"
                     /codon_start=1
                     /product="AAL067Wp"
                     /protein_id="NP_982475.1"
                     /db_xref="GeneID:4618675"
                     /translation="MSKTVGASRFRPAGWLQRAGYAPQVFVFRNLESGQVIYSQLPTF
                     TERQINKNFYRPNWENRKPSTRPDIWKCMAVVDLASHEESVRLYQNLCRLRYLREVPQ
                     RKAAEQLRKRNEFGHIWYSAQYRPTYTQEAVADLRECLLRARGGATVHWEDPWRMGDR
                     AKHWAALPAVQHQFLPRMANVAREESAILKQLGERAKRAFAAPAPPAPAPQSL"
     gene            <232309..>233325
                     /locus_tag="AGOS_AAL066W"
                     /old_locus_tag="AAL066W"
                     /db_xref="GeneID:4618712"
     mRNA            <232309..>233325
                     /locus_tag="AGOS_AAL066W"
                     /old_locus_tag="AAL066W"
                     /product="AAL066Wp"
                     /transcript_id="NM_207829.1"
                     /db_xref="GeneID:4618712"
     CDS             232309..233325
                     /locus_tag="AGOS_AAL066W"
                     /old_locus_tag="AAL066W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR297W (SUR2)"
                     /codon_start=1
                     /product="AAL066Wp"
                     /protein_id="NP_982476.1"
                     /db_xref="GeneID:4618712"
                     /translation="MLNHTYSDIGVRLAPRFLPDVSFMDDVVAPLTAVKPRPTLVPGI
                     SDGHLSLLAPVLAYWVFSGLFHVMDTLRLAEKYRIHPSEEVASRNRAGRLDVLAQVVL
                     QHIIQTLTGLVLVYYDGEPQTGMEQLAMWRWRQAAPGWVSNEAIYVAYHYGLSVAKLL
                     VGFFLIDTWQFWLHYLMHMNKTLYRKFHAHHHRLYVPYAYGALYNNPVEAFVLDSCGT
                     ALAALVTRMTHREEMLLYTFATMKTVDDHCGYALPWDPFQWLFPNNAVYHDIHHQNFG
                     IKSNFAQPFFTIWDSFCRTKFPQFEEYEKKQRRVTVDRYKQFLAERQMEREAKLTLLS
                     KKLS"
     gene            complement(<233743..>234366)
                     /locus_tag="AGOS_AAL065C"
                     /old_locus_tag="AAL065C"
                     /db_xref="GeneID:4618447"
     mRNA            complement(<233743..>234366)
                     /locus_tag="AGOS_AAL065C"
                     /old_locus_tag="AAL065C"
                     /product="AAL065Cp"
                     /transcript_id="NM_207830.1"
                     /db_xref="GeneID:4618447"
     CDS             complement(233743..234366)
                     /locus_tag="AGOS_AAL065C"
                     /old_locus_tag="AAL065C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR298C (ATP5)"
                     /codon_start=1
                     /product="AAL065Cp"
                     /protein_id="NP_982477.1"
                     /db_xref="GeneID:4618447"
                     /translation="MSSRVFVRSLAAAAKAGVKPPIQLFGLEGTYASALFTAASKTTS
                     IESAGKALASLSKTIAKDAKLGAILANPALPAGDRTVVVQTLAQKTPGMDAAVQNLMQ
                     VLAENNRLNLLQGVAGEFTKLTDAHNGLVQATVTTAQPLEGKLFRRVEKALAQSSFIG
                     AGKTLKLENVVKPEIQGGLIVEVADRTVDLSIASRISKLNQVLKESI"
     gene            <234785..>236371
                     /locus_tag="AGOS_AAL064W"
                     /old_locus_tag="AAL064W"
                     /db_xref="GeneID:4618523"
     mRNA            <234785..>236371
                     /locus_tag="AGOS_AAL064W"
                     /old_locus_tag="AAL064W"
                     /product="AAL064Wp"
                     /transcript_id="NM_207831.1"
                     /db_xref="GeneID:4618523"
     CDS             234785..236371
                     /locus_tag="AGOS_AAL064W"
                     /old_locus_tag="AAL064W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR299W (BFR2)"
                     /codon_start=1
                     /product="AAL064Wp"
                     /protein_id="NP_982478.1"
                     /db_xref="GeneID:4618523"
                     /translation="MGKTLADQITELANKSKVPDFDIEDEQVFEHDSNASGSEASDED
                     EALQAAHYVQVGRSKLRNKHNVLVEDSKYSGSKGSREALFNSSGEEDGSESDRRGSDS
                     DGGSDSDSDAPEATLSSEQSADESARSDSDSGDSDSDSGSDAGEENSAVAEDADAKRE
                     RLSQLVRLETQQAMGKLNAAVQNDALKGYAIMEQSRFFEGAIDVRIKLQKAIAAANQL
                     PLTKQSWESRLDAQDAELLESTCKLLHKVAGKCAELRTTFQNKERINQTEIDYQPSKK
                     RSIDALAEQCHDLDSQLRDYRGAVLHMWSSKVAATSGKTALSSSKFKAINQPANVQVD
                     NQLADMPRLVKRTQLNRRGVVPLGFEEDYKQKRLPLLDSNSAQDGGQEEDADVPANYD
                     PRKKDNNAIDASENPYIFDDEDFYRVLLNDLVDKKILNAQQGSNVQVAIKARSQNKLK
                     KNVDTKASKGRKLNYSVQEPIANYEAPINGGFKWSDEQIDEFFAGLLGQRVNFDERET
                     SEAKDNEEEAIEHDDLRIFG"
     gene            complement(<236487..>238094)
                     /locus_tag="AGOS_AAL063C"
                     /old_locus_tag="AAL063C"
                     /db_xref="GeneID:4618592"
     mRNA            complement(<236487..>238094)
                     /locus_tag="AGOS_AAL063C"
                     /old_locus_tag="AAL063C"
                     /product="AAL063Cp"
                     /transcript_id="NM_207832.1"
                     /db_xref="GeneID:4618592"
     CDS             complement(236487..238094)
                     /locus_tag="AGOS_AAL063C"
                     /old_locus_tag="AAL063C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR032W (ERC1) (ERC1); non-syntenic homolog of YDR338C"
                     /codon_start=1
                     /product="AAL063Cp"
                     /protein_id="NP_982479.1"
                     /db_xref="GeneID:4618592"
                     /translation="MQTEEEALTASLAAFDKKLGTYRSINAGNYADDAVSGSYSVVVN
                     SRYAMLCGSDFEEPLDGAQTLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCT
                     AMELASASLAVMTYNITGLSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMV
                     GMSLTAIIWFFSASWLQLLIPEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAV
                     YEASTYVLAIVFPLTIVFVLGFTRHFGFVGAPIGIVTSQWLMVIILFVFARSIRPDTL
                     RCWYPFMQSSHHFKRVFTHWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIAS
                     QTVIANLSSLIYQIPFAIGCVISNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCL
                     FVAFLNKPLARLFTNNEEVVELAHSVSYILAVNQIYDAFNTFGAAILRGQGRQRLGGI
                     WNMIAYYIVSLPLGWWLAFGPLKLKLAGLWYGCGIGILILALAFSWYIYNSDWQLIIQ
                     ECNKRENTEVENDMLHSDSVDASFSSQ"
     gene            <238294..>239277
                     /locus_tag="AGOS_AAL062W"
                     /old_locus_tag="AAL062W"
                     /db_xref="GeneID:4618664"
     mRNA            <238294..>239277
                     /locus_tag="AGOS_AAL062W"
                     /old_locus_tag="AAL062W"
                     /product="AAL062Wp"
                     /transcript_id="NM_207833.1"
                     /db_xref="GeneID:4618664"
     CDS             238294..239277
                     /locus_tag="AGOS_AAL062W"
                     /old_locus_tag="AAL062W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR034C (PIH1)"
                     /codon_start=1
                     /product="AAL062Wp"
                     /protein_id="NP_982480.1"
                     /db_xref="GeneID:4618664"
                     /translation="MDFLLRPIDSKECSVITFVPTPGFVIKSKLEHGKDATLVVGTKT
                     FVNVCHHTQVPLPDVPFDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCI
                     NSECMQWIEKDYQLREILVEWCLESCELRQSVGISREAVVFPRMKSKGALPAVEVLQQ
                     DLTHDYKHEIAENSSLGMDDPRQILHMRGALDEEASGDDGTLPSLFPERPATRPLIEE
                     VNTGRHSASVEAPKTLPACGLPRLEFAVTMGRPRNDANYKIKVQVASALNSGHAYSVH
                     YDGKENSLLVTSTSQAYEPKEICIPLPGVVAGTRSMRALFLKRSNALVVFL"
     gene            complement(<239517..>240779)
                     /locus_tag="AGOS_AAL061C"
                     /old_locus_tag="AAL061C"
                     /db_xref="GeneID:4618670"
     mRNA            complement(<239517..>240779)
                     /locus_tag="AGOS_AAL061C"
                     /old_locus_tag="AAL061C"
                     /product="AAL061Cp"
                     /transcript_id="NM_207834.2"
                     /db_xref="GeneID:4618670"
     CDS             complement(239517..240779)
                     /locus_tag="AGOS_AAL061C"
                     /old_locus_tag="AAL061C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR300C (PRO1) and YHR033W"
                     /codon_start=1
                     /product="AAL061Cp"
                     /protein_id="NP_982481.1"
                     /db_xref="GeneID:4618670"
                     /translation="MDGTDRKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRR
                     MGHKVVIVSSGCIAVGLKTVGTDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKI
                     AQILLTRNDIVDWSQYKNAQNTFHELLAMGVTPIVNENDTLSISGVKFGDNDTLSAIT
                     AGLIGADYLFLMTDVDCLYTDNPRTNPDAKPILVVPDLSQGLPGVNTSSGSGSGVGTG
                     GMATKILAADLATNAGVHTIIMKSERPVDMVRIVEFMEWREQCTAVSADAETLQTDEL
                     NLLQEHGVPLHTRFIANVWQPSLNKREFWILHGLVSCGTVIIDKGAYKALTRKNKAGL
                     LPAGVIAVEGSFHELEAVDLKIGVRKADGSLDESEPLQTVGRARCNYSSVEVDKIKGL
                     QSGQIETVLGYIDSEYIAHRENLAFPPR"
     gene            <241007..>244924
                     /locus_tag="AGOS_AAL060W"
                     /old_locus_tag="AAL060W"
                     /db_xref="GeneID:4618423"
     mRNA            <241007..>244924
                     /locus_tag="AGOS_AAL060W"
                     /old_locus_tag="AAL060W"
                     /product="AAL060Wp"
                     /transcript_id="NM_207835.2"
                     /db_xref="GeneID:4618423"
     CDS             241007..244924
                     /locus_tag="AGOS_AAL060W"
                     /old_locus_tag="AAL060W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR301W (CFT1)"
                     /codon_start=1
                     /product="AAL060Wp"
                     /protein_id="NP_982482.1"
                     /db_xref="GeneID:4618423"
                     /translation="MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDN
                     EGRLVLAYEWKLSGRVHGLSLVPHKSGLGRLAVLTGRGRVSIVRFDAENQTLETESLH
                     YYDAKFEELSALTVGAAPRLEQEPAARCLLVHNGDCLAVLPLRGHEEEGEEAEEEEEH
                     PAKRARTDADGRLVGASTVMPASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCG
                     NEKLTRQTMKFIILSLDLDDEKSTVINMLQGLPNTLHTIIPLSNGCVLAGVNELLYVD
                     NTGALQGAISLNAFSNSGLNTRIQDNSKLQAFFEQPLCYFATQSNGRDILLLMDEKAR
                     MYNVIIEAEGRLLTTFNCVQLPIVNEIFKRNMMPTSICGNMNLETGSLFIGFQSGDAM
                     HVRLNNLKSSLEHKGTVSETLETDEDYMELYGNNAEKEKKNLETESPFDIECLDRLLN
                     IGPVTSLAVGKASSIEHTVAKLANPNKDELSIVATSGNGTGSHLTILENTIVPTVQQA
                     LKFISVTQIWNLKIKGKDKYLVTTDSSQTRSDIYSIDRDFKPFKAADFRKNDTTVSTA
                     VTGGGKRIVQVTSKGVHLFDINFKRMMTMNFDFEVVHVCIKDPFLLLTNSKGDIKIYE
                     LEPKHKKKFVKTVLPDALKEIIITFGVILESNMCNKYINGLEKSEEPQLLFTFVTADN
                     QIVFFTKDHNDRIFQLNGIDDFRQKLFISTYQLPEDINPDPSIKQVIISRLGHKHKQE
                     YLTILTFGGEVYLYRKCIDNPDRFIKCDHELLITGAPENAYPKGVQGVERVAHYIEDY
                     NGYSVIFITGTVPYIIIKEDNSVPRIFPFANITLVSMTRWGENSVMCVDDVKNARIMT
                     LNLDRDRYYGNKMSLAKIYLEDPLEDFQTLNNITYHERTQTFIVSYAKSIDYVALSEE
                     DEPLVGYNPDKIHAMGFQSGIILLSPKSWEIIDKIEYGKNSLINDMRTMMIQLNSNTK
                     RRREYLVVGNTYVRDEDIGGTGSFYLYDITEVVPEPGKPDTNYKFKDIFQEDIRGTVS
                     TVCEISGRFMISQSSKAMVRDIQEDNSVVPVAFLDMPVFITDAKSFGNLMIIGDSMQG
                     FSFLGFDAEPYRMLTLGKSVSKLETMCVEFLVNNGDVYFLVTDRNNLMHVLKYAPDEP
                     NSLSGQRLVHCTSFNLHSTNTCMRLIKKNDEFGKVSRGFGIYMPSFQCIGSQADGTIF
                     KVVPLSEASYRSLYLIQQQLIDKEVQLCGLNPRMERLENPFYQMGHILRPMLDFTVLK
                     RFATLSIPTRMTMASKAGRQAHAEIWRDLIDIEYSLTSLNKIT"
     gene            <245110..>245763
                     /locus_tag="AGOS_AAL059W"
                     /old_locus_tag="AAL059W"
                     /db_xref="GeneID:4618509"
     mRNA            <245110..>245763
                     /locus_tag="AGOS_AAL059W"
                     /old_locus_tag="AAL059W"
                     /product="AAL059Wp"
                     /transcript_id="NM_207836.1"
                     /db_xref="GeneID:4618509"
     CDS             245110..245763
                     /locus_tag="AGOS_AAL059W"
                     /old_locus_tag="AAL059W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR302W (GPI11)"
                     /codon_start=1
                     /product="AAL059Wp"
                     /protein_id="NP_982483.1"
                     /db_xref="GeneID:4618509"
                     /translation="MTTKKRPVGKKKFVSFSDDDALSRTGRLPKNLPQHGSPPVYVRR
                     TWQTIPFHLIVLSYWFIKHSNGYDVRKCTWLLVPCQVLYLALQFNPATVYGNKILKLN
                     YALLAVSGVTCILLTIPCMLLVVLFGAPFLEMLDKTWLLSLHCCVLSYPAVYSVLNSD
                     FKVGFFKKYFISIAVGCWISCLAIPLDWDRPWQEWPIPLVVGAQLGAMFGYTFCSQL"
     gene            complement(<245830..>246612)
                     /locus_tag="AGOS_AAL058C"
                     /old_locus_tag="AAL058C"
                     /db_xref="GeneID:4618652"
     mRNA            complement(<245830..>246612)
                     /locus_tag="AGOS_AAL058C"
                     /old_locus_tag="AAL058C"
                     /product="AAL058Cp"
                     /transcript_id="NM_207837.1"
                     /db_xref="GeneID:4618652"
     CDS             complement(245830..246612)
                     /locus_tag="AGOS_AAL058C"
                     /old_locus_tag="AAL058C"
                     /note="NOHBY103; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0C10230g"
                     /codon_start=1
                     /product="AAL058Cp"
                     /protein_id="NP_982484.1"
                     /db_xref="GeneID:4618652"
                     /translation="MQFRRWLTRSRPTFSNLSELVVCKEGTGAGPFIELPEFKILEDA
                     VVLKIPAASVVYGRLEQLGMFNVPSGASRPFIKLEHMRNGFTKFCTGVEPVNLVCSSP
                     APTNNLKVLEVNYEDEAWVIKDAGSRILSYSGNISVEEDKLTGRGVVVLNGQGPIYEL
                     DLGKCDEVLLAPESVCAYTADTSLQLVKLDALLTISKAVKKYGQLLFGKHYEGILTVL
                     TRMANKDKIYYRAKGPGRLLLQTHYLPGSQEYSTAELLQSMK"
     gene            complement(<246898..>249327)
                     /locus_tag="AGOS_AAL057C"
                     /old_locus_tag="AAL057C"
                     /db_xref="GeneID:4618517"
     mRNA            complement(<246898..>249327)
                     /locus_tag="AGOS_AAL057C"
                     /old_locus_tag="AAL057C"
                     /product="AAL057Cp"
                     /transcript_id="NM_207838.2"
                     /db_xref="GeneID:4618517"
     CDS             complement(246898..249327)
                     /locus_tag="AGOS_AAL057C"
                     /old_locus_tag="AAL057C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR303C (RSC3) and YHR056C (RSC30)"
                     /codon_start=1
                     /product="AAL057Cp"
                     /protein_id="NP_982485.1"
                     /db_xref="GeneID:4618517"
                     /translation="MGVDIRGRKMKKPPACVQCRKRKIGCDRAKPLCGNCVRNGKSDC
                     FYPDIPGVYAQSGGGGATPPGKSAELASVEQIREYSARLQQLSMPPRPVPASPAPAEP
                     TVYVPKVTMLPAVVRRYDYSAAGEEPLTHVVRGPAIFDTAKVPYTQDEIMAKELDFLR
                     GRLLDLQKATGKTVPGLGGLRGRPGSGRRARSDTIGAEDDDSLLDGMDGHSLHSSGNG
                     DGPASLKKRKQDQFDEFKSVDPSFLDPKQVLRVLLNKSAFFTPTVPIPGNENRLFHVG
                     HLAMHDDYLCFFHNRLYDIMANTLPERLSQQQQTKLKPVAEMEPLRFPPKMLCTHWIN
                     YFTTQTDVSTLIPFVQSSDIIQSIDQWFPQKDVTFRIESISLDQLATLGLITLFLLFC
                     YNSLSSTVLVPLKDDEMHRYEQLRSYVPQLHANLKSIMLLVCMGGSTNLSRKWKVRLL
                     PFIAVMKFYQTLSGWSPSTSHSTDFDEDLNWSLDLGINHETQDQNAIIIWNFVYKNCC
                     WRKLIHGELPLPLLSKLSGSSKILDSSLLQDYDFLKTIMKLLQYLHSREETQSVAKLQ
                     KLKLKCKEALNNASQRCYNAQLMVSHVVDTLVYRNMELFVDVYTLLHYESIGDVEKYN
                     ETFKSFIQFLQESVFYIFSGLANLKFAGYEYIFHLPTFTILKNILLILFSLTERTRLG
                     VGKDTPELAQMNDTLITLIRKICMLISDYSKNCKKENPVVTDIKVIVATLLEANSYDH
                     PAVPSSLRNGIKSLDILKINKNVAKLRTMSETLIKTDFYEKRGPFVPESLPTFGVTAG
                     NFDSVYQAFFQ"
     gene            complement(<249672..>250283)
                     /locus_tag="AGOS_AAL056C"
                     /old_locus_tag="AAL056C"
                     /db_xref="GeneID:4618645"
     mRNA            complement(<249672..>250283)
                     /locus_tag="AGOS_AAL056C"
                     /old_locus_tag="AAL056C"
                     /product="AAL056Cp"
                     /transcript_id="NM_207839.1"
                     /db_xref="GeneID:4618645"
     CDS             complement(249672..250283)
                     /locus_tag="AGOS_AAL056C"
                     /old_locus_tag="AAL056C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR304C (CPR5) and YHR057C (CPR2)"
                     /codon_start=1
                     /product="AAL056Cp"
                     /protein_id="NP_982486.1"
                     /db_xref="GeneID:4618645"
                     /translation="MQVLFVLAQALLCAFALADPTVTHRVFFDLQHGDEPLGRVVLGL
                     FGDVAPRTVANFVTLAKSQDASAGYINSTFHRVIPNFMIQGGDFTHGTGVGGRSIYGA
                     TFEDESFAVKHDKPGRLSMANRGRDTNGSQFFITTVATPWLDGRHVVFGQVLDGMDVV
                     SAVEAVPRNARDVPDISVRIVACGELQDTPADATGATLETDEL"
     gene            complement(<250364..>251071)
                     /locus_tag="AGOS_AAL055C"
                     /old_locus_tag="AAL055C"
                     /db_xref="GeneID:4618481"
     mRNA            complement(<250364..>251071)
                     /locus_tag="AGOS_AAL055C"
                     /old_locus_tag="AAL055C"
                     /product="AAL055Cp"
                     /transcript_id="NM_207840.1"
                     /db_xref="GeneID:4618481"
     CDS             complement(250364..251071)
                     /locus_tag="AGOS_AAL055C"
                     /old_locus_tag="AAL055C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR058C (MED6)"
                     /codon_start=1
                     /product="AAL055Cp"
                     /protein_id="NP_982487.1"
                     /db_xref="GeneID:4618481"
                     /translation="MSQPPLDELQWKSPEWIQSFGLRTDNVLDYFSQSPFFDKTSNNH
                     VVKMQQQFSQQMPPAPQTARPKAAPSAERQAIWDRYPAYALLEQELAKLKGIEYVLAH
                     VREPDFWVVRKQRRAGDRVTALNDYYIIGANVYQAPTAYSVVQNRLLSTGFHLSAALG
                     AIQRLARFQPGQGAAFVPVEQNSVQPASGTTASSATAPALTAALDGATAGYSDVLTPE
                     MMDRLMLQSLKSTPLYL"
     gene            <251167..>251535
                     /locus_tag="AGOS_AAL054W"
                     /old_locus_tag="AAL054W"
                     /db_xref="GeneID:4618781"
     mRNA            <251167..>251535
                     /locus_tag="AGOS_AAL054W"
                     /old_locus_tag="AAL054W"
                     /product="AAL054Wp"
                     /transcript_id="NM_207841.1"
                     /db_xref="GeneID:4618781"
     CDS             251167..251535
                     /locus_tag="AGOS_AAL054W"
                     /old_locus_tag="AAL054W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR059W (FYV4)"
                     /codon_start=1
                     /product="AAL054Wp"
                     /protein_id="NP_982488.1"
                     /db_xref="GeneID:4618781"
                     /translation="MLQTRLFHACAALARAASRPVPKPTSEIPDVSTFLAKIGRQCSE
                     HAELYENKWENLFMWDGPKLKEKGVPVQQRRYILQQVERLRQGGPVREIREGKKSFFG
                     GERKRKEKVAKWRAEQRHAA"
     gene            complement(<251562..>252173)
                     /locus_tag="AGOS_AAL053C"
                     /old_locus_tag="AAL053C"
                     /db_xref="GeneID:4618469"
     mRNA            complement(join(<251562..252068,252120..>252173))
                     /locus_tag="AGOS_AAL053C"
                     /old_locus_tag="AAL053C"
                     /product="AAL053Cp"
                     /transcript_id="NM_207842.2"
                     /db_xref="GeneID:4618469"
     CDS             complement(join(251562..252068,252120..252173))
                     /locus_tag="AGOS_AAL053C"
                     /old_locus_tag="AAL053C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR305C (HNT2); 1-intron"
                     /codon_start=1
                     /product="AAL053Cp"
                     /protein_id="NP_982489.2"
                     /db_xref="GeneID:4618469"
                     /translation="MSQAVYFSHFLVTNQVFYRTRYSYALVNLKPLVPGHVLIAPLRP
                     TCVRLRDLTPEEHSDYFQTLQVVHQFIQAEFKAAALNIAIQDGPEAGQTVPHLHTHLI
                     PRYADNNIGDAIYDHLDRWSFEDQLADWQRRRAAYCGDEAARRELAKPDDVRKPRTAD
                     DMTAEARALSAGLQSFLADHPALAPK"
     gene            complement(<252226..>253518)
                     /locus_tag="AGOS_AAL052C"
                     /old_locus_tag="AAL052C"
                     /db_xref="GeneID:4618718"
     mRNA            complement(<252226..>253518)
                     /locus_tag="AGOS_AAL052C"
                     /old_locus_tag="AAL052C"
                     /product="AAL052Cp"
                     /transcript_id="NM_207843.2"
                     /db_xref="GeneID:4618718"
     CDS             complement(252226..253518)
                     /locus_tag="AGOS_AAL052C"
                     /old_locus_tag="AAL052C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR306C"
                     /codon_start=1
                     /product="AAL052Cp"
                     /protein_id="NP_982490.1"
                     /db_xref="GeneID:4618718"
                     /translation="MAGKRRPKKARAPYRKYVAGQGFVHTYGVSSTESSAHDESGLFP
                     ADSGVQVSDDDIARRLVDMTLSASAAFAGGAAPIPYPGHSMVLPWELQFLVLSKCKTI
                     ETHFMQVCRRWYIMCLPLIYRAPRLSSKNFYKFVETLVAARKQNYGQYVVDLDLSMII
                     QSGKNSFVAKVLRRCSQHLEHFTAPQTSFGIAPLISLRSCSNLRYLDLGLLSETVKLK
                     QLFEAINGFQHLTHLSFPRSSIACEGFREVAWPQSLVYLKLSGGITNEFIREAALPHT
                     IRTLEFSFCPQVDEHSIYMLLSKTGESLEYLRFYYPMPALGDKSLDYVFRYCSNLLGV
                     QLVVDYCSKWAFSEHLLSPLAYPRPLRSIVLESSGSLGLSFKIHPDDITIAVAEDRLP
                     CIRDVRISSRLGWDSHSSDVEDLVSVLDDRDANLYVKF"
     gene            complement(253791..253863)
                     /locus_tag="AGOS_t0005"
                     /db_xref="GeneID:4618773"
     tRNA            complement(253791..253863)
                     /locus_tag="AGOS_t0005"
                     /product="tRNA-Val"
                     /codon_recognized="GUG"
                     /db_xref="GeneID:4618773"
     gene            complement(<254282..>256129)
                     /locus_tag="AGOS_AAL051C"
                     /old_locus_tag="AAL051C"
                     /db_xref="GeneID:4618571"
     mRNA            complement(<254282..>256129)
                     /locus_tag="AGOS_AAL051C"
                     /old_locus_tag="AAL051C"
                     /product="AAL051Cp"
                     /transcript_id="NM_207844.1"
                     /db_xref="GeneID:4618571"
     CDS             complement(254282..256129)
                     /locus_tag="AGOS_AAL051C"
                     /old_locus_tag="AAL051C"
                     /note="NOHBY102; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0C14850g"
                     /codon_start=1
                     /product="AAL051Cp"
                     /protein_id="NP_982491.1"
                     /db_xref="GeneID:4618571"
                     /translation="MFSVPHFDDMEELYSAYRPITPSLSNSRPSHSEQLKYSTQPTER
                     IPLHDFRRDSLELYGLKPKHYSVEDAESEPACEPAPDSSDTGSAPLQPRWKDWILEKR
                     RGIEELERQLDNFKLNGTENEIEEGSEDMRAKYKMFNPPAEYKFSPFEDHNEEAAEAL
                     SHDDILSNMNHNIHRSRWAADKIRSNIDKFFLKNSELLEEPEVIPGAYPRDVVYIPIP
                     VRGEGDKERFEGDEYDKHVGPIIYLSYGILIPAAVKLCSFTLYHIVSLSRRDYTFSSI
                     CLESEPLIIGLDKVITGLLSLFAVQQCLDYVITFPLACHTRYHLLKYGIEIIRDGGSD
                     IIWREYSREFLRFHNRALTEFRQKLQKKIWFSALIIAAFGLLSASFVSWIYAVTVTED
                     SFGTCLNTILFGRAQLVAIIICFLGQTCYDLMAYIKHFIGEYAEDTMEMLMKKLDQYK
                     QAQQDRKPVETRHVSQGTEEMSGTVKGTTDGIKEQSSLRGSAKKSKHDVLLISTPDNS
                     SSVVYHPQPYVSPLKGRSSLNSRSLHLVDPASPPNTRRKKVPDAKSFRKAFAGKAQER
                     IRWRVTKVERDLLAISIYMVKLPFRVVFLPARMAMRILPWRLYISFNRG"
     gene            <256489..>258450
                     /locus_tag="AGOS_AAL050W"
                     /old_locus_tag="AAL050W"
                     /db_xref="GeneID:4618446"
     mRNA            <256489..>258450
                     /locus_tag="AGOS_AAL050W"
                     /old_locus_tag="AAL050W"
                     /product="AAL050Wp"
                     /transcript_id="NM_207845.2"
                     /db_xref="GeneID:4618446"
     CDS             256489..258450
                     /locus_tag="AGOS_AAL050W"
                     /old_locus_tag="AAL050W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR307W"
                     /codon_start=1
                     /product="AAL050Wp"
                     /protein_id="NP_982492.2"
                     /db_xref="GeneID:4618446"
                     /translation="MAESGEAMGAVPEAAESEAQVVSKNGPFRSYLPSTVYQAWRGER
                     MEQQGVVVWCGPAAFAALYVLCSGWLAACAGLAASGTETEMLEEIDAVRLGGFHIGVR
                     PPLGLHVLARLGLGLIGLRRLALLAACVVLQYLYKSLRCAGIQRLWAGAAVGCIALLE
                     VFRDAAVHASLEMYHAMFLAIILYNWKSFKLQEPFGQAWWLRLSAVAVCSGLAAGTKF
                     VGLGTWAWVLLLNSAHIFQLIGDLEVSTRTVWKHVLIRLPLLTLVPLSIILLGYHSHL
                     QAPSYSSRDSSYMPTLFKAQLDGYQVVQPASVYYGSGVVIRHSSSIGGYLHSHELTYP
                     GGSEEQQITLYDFEDANNKWTVEPVYNEAMDDIINSTQPVRNGDLIKLRHVQTGKLLR
                     ASAAKPPVSQRDYDQEVSCTGDSGYSGDSDETWRVDIQDAEYHEDLKPVLHHFSLVNK
                     GQSCTLLSHDVKLPEWALYQQEVICLASPVHKYSLFYVDSSEMMHNETMQLPRLSFPA
                     KFWAYIHAQYKYDYFVKNFNATGDVPYLRWLVHISENKLQNCIWVAGLLSVIWWWLLF
                     TYRCFTWNPWDPAVAFEPTTLRSALYRDNSFEYVAGWFIHYIVFSRCSHGNLQIVQYL
                     PALLFTTLQIANTFQTFSEWIHRLIVKLF"
     gene            complement(<258487..>258969)
                     /locus_tag="AGOS_AAL049C"
                     /old_locus_tag="AAL049C"
                     /db_xref="GeneID:4618672"
     mRNA            complement(<258487..>258969)
                     /locus_tag="AGOS_AAL049C"
                     /old_locus_tag="AAL049C"
                     /product="AAL049Cp"
                     /transcript_id="NM_207846.1"
                     /db_xref="GeneID:4618672"
     CDS             complement(258487..258969)
                     /locus_tag="AGOS_AAL049C"
                     /old_locus_tag="AAL049C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR308C (SRB7)"
                     /codon_start=1
                     /product="AAL049Cp"
                     /protein_id="NP_982493.1"
                     /db_xref="GeneID:4618672"
                     /translation="MLVQIPITTIPTADRRTKMTDRLTQLQQCLDQIVEQFGSAITYV
                     DRNHDFEPHNELEDKLSDPQATIAAAEDFDRNIDELTTDMILKTRQIIKLIDSLPGVD
                     VSAEEQLSRIDSLQKKLIQVEGEKIEAIKRKESLTKDIEELINEFTEGIANSRRLNKA
                     "
     gene            <259049..>259588
                     /locus_tag="AGOS_AAL048W"
                     /old_locus_tag="AAL048W"
                     /db_xref="GeneID:4618639"
     mRNA            <259049..>259588
                     /locus_tag="AGOS_AAL048W"
                     /old_locus_tag="AAL048W"
                     /product="AAL048Wp"
                     /transcript_id="NM_207847.1"
                     /db_xref="GeneID:4618639"
     CDS             259049..259588
                     /locus_tag="AGOS_AAL048W"
                     /old_locus_tag="AAL048W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR060W (VMA22)"
                     /codon_start=1
                     /product="AAL048Wp"
                     /protein_id="NP_982494.1"
                     /db_xref="GeneID:4618639"
                     /translation="MGRQVVGNDDLIGLLKKLSEYDVLLDRLQGQMADGFYNLSRANY
                     HNKDSLRGSYGRDYWDQTFAGTRFVRIEQDGVIVEDAGAKADKDETQATEGGLHNRRK
                     DVSKKEAAQRRQKTPLYMFGGALSVPSSLRMCQEHFQRCLPVVVRLVNCRREIDVLLD
                     ELERSAAAGTCADDISQTT"
     gene            complement(<259746..>260891)
                     /locus_tag="AGOS_AAL047C"
                     /old_locus_tag="AAL047C"
                     /db_xref="GeneID:4618476"
     mRNA            complement(<259746..>260891)
                     /locus_tag="AGOS_AAL047C"
                     /old_locus_tag="AAL047C"
                     /product="AAL047Cp"
                     /transcript_id="NM_207848.1"
                     /db_xref="GeneID:4618476"
     CDS             complement(259746..260891)
                     /locus_tag="AGOS_AAL047C"
                     /old_locus_tag="AAL047C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR309C (GIC2) and YHR061C (GIC1)"
                     /codon_start=1
                     /product="AAL047Cp"
                     /protein_id="NP_982495.1"
                     /db_xref="GeneID:4618476"
                     /translation="MCSRRATGSGCRSKMDAHNNLPQIKSIWIDEDEEAEKLYGLQAQ
                     QMMDSDDEELLGVVTLNSEQPVLNNKTRIELPPLPPSAYELKKSQSAMDLLARKKQKW
                     KQFFLGRREARGRMSISVPFAFQHISHADGRLYEEEAAAEAAVPAGGGFSKAFVTDAL
                     PPTASPLEDARARRSVSSLSGRSSRRTSRASASLSTARVVSTSTMATSVLELAARPPE
                     KLGQLERAHLEGRIGRLPSESGSMDELQRYHFPTVREEPPAAFETPRVRGEDKFGWDT
                     PDNARTLTEHMLEQLQGSPAVPATVGTPRRKSDSALTPILCMKETFTESQTPNERRSV
                     DDVLLYYHQGSETDSTLTGPSNRFSFVGGSPKLPHPPAVHREGDAYM"
     gene            complement(<261327..>262145)
                     /locus_tag="AGOS_AAL046C"
                     /old_locus_tag="AAL046C"
                     /db_xref="GeneID:4618558"
     mRNA            complement(<261327..>262145)
                     /locus_tag="AGOS_AAL046C"
                     /old_locus_tag="AAL046C"
                     /product="AAL046Cp"
                     /transcript_id="NM_207849.1"
                     /db_xref="GeneID:4618558"
     CDS             complement(261327..262145)
                     /locus_tag="AGOS_AAL046C"
                     /old_locus_tag="AAL046C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR062C (RPP1)"
                     /codon_start=1
                     /product="AAL046Cp"
                     /protein_id="NP_982496.1"
                     /db_xref="GeneID:4618558"
                     /translation="MLVDLNVPWPQKSYDAKPSAQDLDQLKRTLTTLHALGYTHVALN
                     FTVPHSTSFPKASDQLNPIDLAALADVRAATGLRLYTRLTLVVDDPARGQALARVAAA
                     FDIVAALPVSERGLALAAGGLDVDLLTFHYGQRLPALLKHKTVCGCVRAGLKIELVYA
                     HALRDVPARRSFVVNCKTVIRAARARGLVVSSGARSPLECRNILGVAALLRHIGLKDD
                     RCSRAMRDLASLALLNGRLRSKSYRHTVRAAPVPKRPRSPDAGAADNHKKPRDA"
     gene            complement(<262389..>264965)
                     /locus_tag="AGOS_AAL045C"
                     /old_locus_tag="AAL045C"
                     /db_xref="GeneID:4618599"
     mRNA            complement(<262389..>264965)
                     /locus_tag="AGOS_AAL045C"
                     /old_locus_tag="AAL045C"
                     /product="AAL045Cp"
                     /transcript_id="NM_207850.1"
                     /db_xref="GeneID:4618599"
     CDS             complement(262389..264965)
                     /locus_tag="AGOS_AAL045C"
                     /old_locus_tag="AAL045C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR310C (SUM1)"
                     /codon_start=1
                     /product="AAL045Cp"
                     /protein_id="NP_982497.1"
                     /db_xref="GeneID:4618599"
                     /translation="MERGTTAGTGEAMAAELQAQAAAVARLHERLQTLEGLLPEQDEV
                     VTQTLDTLTATAKNLAHNQRALETKLDDLLKNQTNTDMAINELSGRLESLMGLFGNGG
                     LGVVVGPPGGAQCGAAPPASRGPGRPKKNQTFVTTNLPNGASYSRIQLPLNNINIPKS
                     RKHFTDPNQEPPKKETTGTQPVAPDGTLPPPRRRGRPPKNRKNLATAAVSTGPVAAAS
                     GGQVSSTSSKRASAEPTGVSAAQQRKANSEEAPVRGRRAAALSGSAVSTRGSRRRSTR
                     ARRQKNFYDEESDESEELSNSEVSEESDLDKDEDDNGNDASYEESSARKPAQRVPKLK
                     EKEKVKHEDEDEDDLSESPNSLSKTRRQLELERRRDPREKMLVSMKYSDRDKAKSFME
                     SNKDLLKAMKEEERKKRMTAINYEPIYNNSLQQTIRQVQSNAAGIIPPLSSSTLVPIP
                     QSSDSNRTITADASTLSIPNTEPRRMGILSMLNSHEPSPSQAATGPSLEVAESSTTSV
                     APQPPIAEITATTTPVRSPSSSSHKRSVNDTDPLEDTPIKRQKNSPNAAATSIIPQSA
                     PTTGYTTGYTTMTTTMTPSSELTKNSAQAAARGRPSNASNGSDNSAALLMASPIELVC
                     KDGYFYRRNDLTTPITTGNYLGMKFKNKEEELIKMTMHEEDYAELTRQDRINAYFMKP
                     DIDIETEYACQVLSNVTLTEKYVNSLEYFLMEFRWENRLVSLGLKLRESKRTWQRRKA
                     LFALFEFWRDKSREKRGFRDFTILHAVKEMENYRVFINRSVSWFYNHITLLKMILFDL
                     CDNTDTQWREWMFPKGSAVPVETADAGVTKQNINQFIDSMLTLDFLEDGTENLHTKSS
                     AA"
     gene            complement(<265544..>266593)
                     /locus_tag="AGOS_AAL044C"
                     /old_locus_tag="AAL044C"
                     /db_xref="GeneID:4618803"
     mRNA            complement(<265544..>266593)
                     /locus_tag="AGOS_AAL044C"
                     /old_locus_tag="AAL044C"
                     /product="AAL044Cp"
                     /transcript_id="NM_207851.1"
                     /db_xref="GeneID:4618803"
     CDS             complement(265544..266593)
                     /locus_tag="AGOS_AAL044C"
                     /old_locus_tag="AAL044C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR063C (PAN5)"
                     /codon_start=1
                     /product="AAL044Cp"
                     /protein_id="NP_982498.1"
                     /db_xref="GeneID:4618803"
                     /translation="MATAPTVHIIGFGSIGGLIGVHLQCAGIARVVPVLSSPARAALF
                     HELGSKATLDSVHCPETPPLSAYFPAAVSTSDLQETGSPIDHLVITCKAQHTLAALRP
                     VWPLLHNGSTIALLQNGLGVAELLRAEASRRGLSPTLFQGVVTHGAHRDSHWNLHHAG
                     KGQLLLACLPRDPTSIIQAPATVARARASPLAAALLRTPLDAALLPYQQLLPRQLEKL
                     VVNACINPLSALLDCPNGALVPQRELFAAIAAEAAPVLRSAYSALFSSTTGPPPADPD
                     LLAPERLSEKAAAVAVATASNSSSTREDVRAGRTTEIDFINGYIVDLAAAAGLPASAV
                     RLNRALQLLVHALRR"
     gene            complement(<266845..>268461)
                     /locus_tag="AGOS_AAL043C"
                     /old_locus_tag="AAL043C"
                     /db_xref="GeneID:4618609"
     mRNA            complement(<266845..>268461)
                     /locus_tag="AGOS_AAL043C"
                     /old_locus_tag="AAL043C"
                     /product="AAL043Cp"
                     /transcript_id="NM_207852.2"
                     /db_xref="GeneID:4618609"
     CDS             complement(266845..268461)
                     /locus_tag="AGOS_AAL043C"
                     /old_locus_tag="AAL043C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR064C (SSZ1)"
                     /codon_start=1
                     /product="AAL043Cp"
                     /protein_id="NP_982499.2"
                     /db_xref="GeneID:4618609"
                     /translation="MSAPIIGIAFGNTSSSIAYVNPKKDVDVIANPDGERAIPSCLSY
                     VGDDEYHGGQALQQLVRNASNTIVNFRDFVGLSYAECDGNRCATGAPLVDLDGKPGFL
                     IARAGREERLTVDEVVTRHLRKLREAAEDYIGQSISQAVLTVPTNFAEKQKSALRETA
                     SRAGLEVVQFVNEPSSALLAHVEQFPFDKDVNVVVADFGGVRSDAAVVAVRNGIFTLL
                     ATEHDATLGGALLDEELIEFFAKDFEAKNKCNPRKNARSLAKLRASAEITKKTLSNAT
                     SATISIDSLADGFDYHNSVNRMRYELVANKVFSKFTQSIQNVITKANLDVLDIDAVLL
                     AGGVSFTPKLTTNLEFLFPESVQILGPQHKNATNNPNELLASGAALQAQLVSSYDADE
                     LAQALQPIVINTQHLSKNIGVLDAAGKFVPILLAESSYPIRKTVRVEDATGDILISVY
                     EGTSIAKETVVEPSAKDEPEDEEESEWSDEDDEPEVIREKDYVIEAKLMDLGIKNVKG
                     LELSFTINKDGVLTVAAKDLGSSNAVKGSL"
     gene            <268820..>270649
                     /locus_tag="AGOS_AAL042W"
                     /old_locus_tag="AAL042W"
                     /db_xref="GeneID:4618608"
     mRNA            <268820..>270649
                     /locus_tag="AGOS_AAL042W"
                     /old_locus_tag="AAL042W"
                     /product="AAL042Wp"
                     /transcript_id="NM_207853.1"
                     /db_xref="GeneID:4618608"
     CDS             268820..270649
                     /locus_tag="AGOS_AAL042W"
                     /old_locus_tag="AAL042W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR311W (TFB1)"
                     /codon_start=1
                     /product="AAL042Wp"
                     /protein_id="NP_982500.1"
                     /db_xref="GeneID:4618608"
                     /translation="MSHSGAAVFKKVSGMLLIDEESNPAILTWRSTDGDKSHSVMLNT
                     INKLQATPASSDKMMLRLVGKVSTAKRLKDEDGGEAEPKPVVHMFTFNNRIVMDNIKE
                     TLQHIISRYKDEEVYEEKRRKEGSDAPTPQAEAPLINTTALDDSLSREKLLVNLKLQQ
                     SLLKENRTLMKTFQEAVIKSGLPPQEFWATRIPLLRAFALATSQKTGPYNVLSTIKPV
                     ASSDNKVNVSVSREKILTIFQNYPIVKKAYDDNVPKNFKEQEFWARFFSSKLFRKLRG
                     ERIMQNDRGDMIIDRYLTLDQEFDRLDDEMLLHPIKKLLDLEGNQNDDPEKRGNRPHF
                     TMLPGTDPNGNNDGSVDILKGMNRLSEKMIKSLENEYSRVNLQMQDLDKEEREEILFS
                     DLEEEGKTEYEEIYLRQRSPTSETDTNPAMTSTSTAEDIKNEINSITGDLQGTLDLTA
                     VGKINSQTAQRINRQVMKAVKVNAKQAKHLRFDSTMGAFLSSQTTDSQEANSNLPPDI
                     LESARVLHGTCCEFLKHFYNHFQSGEPKSGVIVKKLYGHLKECTHKVENLLTTASQSD
                     SEQDVAALCSAYLNPALLSINLAIEKYDAAVEEIESYNKAEDV"
     gene            complement(<270726..>272186)
                     /locus_tag="AGOS_AAL041C"
                     /old_locus_tag="AAL041C"
                     /db_xref="GeneID:4618601"
     mRNA            complement(<270726..>272186)
                     /locus_tag="AGOS_AAL041C"
                     /old_locus_tag="AAL041C"
                     /product="AAL041Cp"
                     /transcript_id="NM_207854.2"
                     /db_xref="GeneID:4618601"
     CDS             complement(270726..272186)
                     /locus_tag="AGOS_AAL041C"
                     /old_locus_tag="AAL041C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR065C (RRP3)"
                     /codon_start=1
                     /product="AAL041Cp"
                     /protein_id="NP_982501.2"
                     /db_xref="GeneID:4618601"
                     /translation="MSKVTKQSKSHKSSELVSLAEKIKQKALENRKQSREESQATEEA
                     NTASETEAAVIEETAEPEEGFSSFRELDLVPELIEACDNLNFTKPTPIQSKAIPPALQ
                     GKDIIGLAQTGSGKTAAFAIPILNRLWHDQQPYYACILAPTRELAQQIKETFDSLGSL
                     MGVRTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTKGFALRKLQFLVMDEA
                     DRLLDMEFGPVLDRILKNIPTKGRTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQ
                     TVDTLVQTLIVVPGGLKNTFLIYLLNEFIGKTTIVFTRTKANAERISGLCNLLEFSAT
                     ALHGDLNQNQRTGALDLFKAGKKSILVATDVAARGLDIPSVDLVINYDIPVDSKSYIH
                     RVGRTARAGRSGKSVSLVSQYDLELILRIEEVLGKKLPKENVDKSIVLSLRDSVDKAN
                     GEVIMELNRRNKEKQTRGKGRRSRTATRENMDKEEE"
     gene            <272443..>273765
                     /locus_tag="AGOS_AAL040W"
                     /old_locus_tag="AAL040W"
                     /db_xref="GeneID:4618628"
     mRNA            <272443..>273765
                     /locus_tag="AGOS_AAL040W"
                     /old_locus_tag="AAL040W"
                     /product="AAL040Wp"
                     /transcript_id="NM_207855.1"
                     /db_xref="GeneID:4618628"
     CDS             272443..273765
                     /locus_tag="AGOS_AAL040W"
                     /old_locus_tag="AAL040W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR312W (SSF2) and YHR066W (SSF1)"
                     /codon_start=1
                     /product="AAL040Wp"
                     /protein_id="NP_982502.1"
                     /db_xref="GeneID:4618628"
                     /translation="MAKRRHKNRTHVKPSEEELKQIPKSMVIRVGQTSLSNHSLNQLV
                     KDFRMIMQPHTAVRLKERKSNKLKDFVVMCGPLGVSHLFIFTQSEKTGNVSLKVARTP
                     QGPTVTFQVLDYSLGKDIKRFLKHPKSLGKDDILNPPLLVLNGFDIKNEDEGRANVEK
                     VVVSMFQNIFPPLNPARTQLSSIRRVFMINKDQETGELSLRHYAIDIRQVDISRNLKR
                     LYRSKNKLNKSVPNLHKKDDIASLILDHDVGAYTSESEVDDDAIVRIIDQRDTRVAAK
                     EPVAANGEEDGDVDMEDAQDDDVEEPALEDDTPQPKKRAIKLTEVGPRLTLKLVKIEE
                     GICSGKVLHHEYVQKTDAEIRALEKRHAQKLKLKEQRRKEQEENIARKKAVKDAKKQR
                     KLERRKLRETAPEGEKPAESSADDSSSEDDYSDVPEDLDSDLFSEVDN"
     gene            complement(<273870..>274721)
                     /locus_tag="AGOS_AAL039C"
                     /old_locus_tag="AAL039C"
                     /db_xref="GeneID:4618796"
     mRNA            complement(<273870..>274721)
                     /locus_tag="AGOS_AAL039C"
                     /old_locus_tag="AAL039C"
                     /product="AAL039Cp"
                     /transcript_id="NM_207856.1"
                     /db_xref="GeneID:4618796"
     CDS             complement(273870..274721)
                     /locus_tag="AGOS_AAL039C"
                     /old_locus_tag="AAL039C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR313C (PIB1)"
                     /codon_start=1
                     /product="AAL039Cp"
                     /protein_id="NP_982503.1"
                     /db_xref="GeneID:4618796"
                     /translation="MQQEHNLEAINNFAIWQNDDLVSNCLHCHLKFTFLLRKHHCRCC
                     GGIFCASCTQHFEHYDLSKVKVLQRCEGTVETAPYRTCDSCYENLLQRGLLAGAQDGP
                     AGQVAGSSLREGVGDVEEPARKLVKDDTVRETVAEHGSEHSSTAVSVRARPEEYDHCP
                     LCNADLSGDPEDTAAEHVQNCIARATSVQQHLVCESPGPMSYQNRILVSIVPGYTEGG
                     GRLPECPICFEDMEPGQKVGRLECLCVFHNECIQMWLERKSRKTRSGGWPARSPKNFC
                     PLHDAIV"
     gene            <274925..>275836
                     /locus_tag="AGOS_AAL038W"
                     /old_locus_tag="AAL038W"
                     /db_xref="GeneID:4618733"
     mRNA            <274925..>275836
                     /locus_tag="AGOS_AAL038W"
                     /old_locus_tag="AAL038W"
                     /product="AAL038Wp"
                     /transcript_id="NM_207857.1"
                     /db_xref="GeneID:4618733"
     CDS             274925..275836
                     /locus_tag="AGOS_AAL038W"
                     /old_locus_tag="AAL038W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR067W (HTD2)"
                     /codon_start=1
                     /product="AAL038Wp"
                     /protein_id="NP_982504.1"
                     /db_xref="GeneID:4618733"
                     /translation="MGGKSGHLRLLGRLGGTAAGANVGRGGCGAARERDYTVDLGRRV
                     VSRMRETVRRRPTEEFEALIGVHGERRTELGPGEHLLFFNPRDVAASADGYHEYVTPG
                     AITGAVRTFRRRMWAQGTVEWLRPLSHGVEYECTERVRFVREVGGTHYVGLQRDIADG
                     AGTALRELRTLAYATGAPDGPRREAVAVPATCTGCVLEHEVVAAYSRLTLNPHRIHLD
                     RKYCASEGYADLVVQGPLSLQLALKTVEQQGFAGLHGVRYKNTNIMYAGTAIEVCIGV
                     PSGGKLALWIRDAVEHDVNYLVAEVAL"
     gene            complement(<275833..>276669)
                     /locus_tag="AGOS_AAL037C"
                     /old_locus_tag="AAL037C"
                     /db_xref="GeneID:4618627"
     mRNA            complement(<275833..>276669)
                     /locus_tag="AGOS_AAL037C"
                     /old_locus_tag="AAL037C"
                     /product="AAL037Cp"
                     /transcript_id="NM_207858.1"
                     /db_xref="GeneID:4618627"
     CDS             complement(275833..276669)
                     /locus_tag="AGOS_AAL037C"
                     /old_locus_tag="AAL037C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR315C (IPK1)"
                     /codon_start=1
                     /product="AAL037Cp"
                     /protein_id="NP_982505.1"
                     /db_xref="GeneID:4618627"
                     /translation="MVKIIGKGGANYVLAFGNDNDDLYRICVRGRSLRENNRSTVDNY
                     HYALEVVKPQLGEFVCRMELVDLPVCDSLRQVLKSKIEVWDATTVTCLKMPNLVPAGS
                     LSHTVDHFTKIHIGERAIVWEFKPKWLSGNDKYCRNCTLNLLRGQTSISYCHAQLLNP
                     GQAGPILKSLFAGLNVPPAFIEDMEAYIAQPCSVLQRLRVAQEQVDASLGPLDQPDTA
                     ASPERCLSMTLKDVSCFVSWHKDASPVAVVVDLDMKPAAKSAHWTALQEQLDRFQPQV
                     RH"
     gene            <276851..>277999
                     /locus_tag="AGOS_AAL036W"
                     /old_locus_tag="AAL036W"
                     /db_xref="GeneID:4618497"
     mRNA            <276851..>277999
                     /locus_tag="AGOS_AAL036W"
                     /old_locus_tag="AAL036W"
                     /product="AAL036Wp"
                     /transcript_id="NM_207859.1"
                     /db_xref="GeneID:4618497"
     CDS             276851..277999
                     /locus_tag="AGOS_AAL036W"
                     /old_locus_tag="AAL036W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR068W (DYS1)"
                     /codon_start=1
                     /product="AAL036Wp"
                     /protein_id="NP_982506.1"
                     /db_xref="GeneID:4618497"
                     /translation="MSNNDETVLGHLADHVFKHSGPIPESFVEVKGIDYSKPDAIDMR
                     ASDLIKSMKTMGFQASSLGQACDIIDEMRAWRGKHIDELDEYSRKGSFDENGFQKSTI
                     FLGYTSNLISSGLRETLRYLVQHNMVSAIVTTAGGVEEDIIKCLAPTYLGEFTLKGAA
                     LRDKGMNRIGNLLVPNNNYCKFEEWIVPILDAMLAEQEAYVAQQGKDCLGVNTDVDSP
                     IWTPSKLCDRLGKEINDESSVLYWAHKNKIPVFCPAITDGSIGDMLFLHTFRASPQQL
                     RLDLVADIRKINSMSMEASQAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFD
                     GSDAGARPDEAVSWGKIKVEAKSVKVYADVTTVFPLIVAATFANGKKN"
     gene            <278192..>279550
                     /locus_tag="AGOS_AAL035W"
                     /old_locus_tag="AAL035W"
                     /db_xref="GeneID:4618417"
     mRNA            <278192..>279550
                     /locus_tag="AGOS_AAL035W"
                     /old_locus_tag="AAL035W"
                     /product="AAL035Wp"
                     /transcript_id="NM_207860.1"
                     /db_xref="GeneID:4618417"
     CDS             278192..279550
                     /locus_tag="AGOS_AAL035W"
                     /old_locus_tag="AAL035W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR316W (OMS1)"
                     /codon_start=1
                     /product="AAL035Wp"
                     /protein_id="NP_982507.1"
                     /db_xref="GeneID:4618417"
                     /translation="MLSAIASARQRIGSLAQGPVFGRSIAAVRHKGHLPPFGAKVSRP
                     KTKEELQKERLEAALRSPNKLVRWGAYFQTEEFNKAMTKYLFAVYGLFLIYGIYYMKK
                     LYTKEKERDALEEKAADGHINEYESLRLKQLQGKLRTRDERKLELYNALKDKHPDWDS
                     EDYDGVEFEVEDLNKINRHILPARDTTEFYDEKAEEYDRSVRMEEMAIRMGKRRKWLM
                     KHCEGDVLEVASGTGRNIDYLDLSKIDTITFLDASKNMMKIANKKFREKYPHFKQAAF
                     VVGKAEDLVDLATGHSPQQQNLELVNSPEQVIPESKPKVKYDTIIEAFGLCSHHDPVR
                     ALKNFAKLLKPGGRIVLLEHGRGTYDVVNKILDKRAEHRLETWGCRWNLDIGEILDDS
                     DLEIVTEKRTHLGTTWCIVAKRKGDMPKKEEIGFLEKYIRPSLRSSMPPADDKPREST
                     KN"
     gene            complement(<279633..>280688)
                     /locus_tag="AGOS_AAL034C"
                     /old_locus_tag="AAL034C"
                     /db_xref="GeneID:4618475"
     mRNA            complement(<279633..>280688)
                     /locus_tag="AGOS_AAL034C"
                     /old_locus_tag="AAL034C"
                     /product="AAL034Cp"
                     /transcript_id="NM_207861.1"
                     /db_xref="GeneID:4618475"
     CDS             complement(279633..280688)
                     /locus_tag="AGOS_AAL034C"
                     /old_locus_tag="AAL034C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR069C (RRP4)"
                     /codon_start=1
                     /product="AAL034Cp"
                     /protein_id="NP_982508.1"
                     /db_xref="GeneID:4618475"
                     /translation="MSEVITIRKRRGFQFHRSQYLDDEEEEFDLDVEMEGADSSVIMT
                     PGELITDDPVWMRGHGTYFLENKTYSSVAGTVSRVNRLLSVIPWRGRYTPETGDHIVG
                     RIVEVGNKRWKVDIGGKQHAVLMLGSVNLPGGVLRRKSESDELQMRSFLKEGDLLNAE
                     VQSLFQDGSSALHTRSLKYGKLRNGMFVRVPSSLIVRSKNHTHNLPGNVTVILGVNGF
                     VWLRKTSDIDLSNNHHGSTVSGKAANTLAGVASGEYKPGANSVSITRLEEESSWEIYS
                     DKNDPIPSNIRNTISRYANVIKILAHCEIGITEARIVASYEASMAYGNVGSLIETETM
                     DAIGQDVINGEKMRGNA"
     gene            <280845..>282314
                     /locus_tag="AGOS_AAL033W"
                     /old_locus_tag="AAL033W"
                     /db_xref="GeneID:4618462"
     mRNA            <280845..>282314
                     /locus_tag="AGOS_AAL033W"
                     /old_locus_tag="AAL033W"
                     /product="AAL033Wp"
                     /transcript_id="NM_207862.1"
                     /db_xref="GeneID:4618462"
     CDS             280845..282314
                     /locus_tag="AGOS_AAL033W"
                     /old_locus_tag="AAL033W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR070W (TRM5)"
                     /codon_start=1
                     /product="AAL033Wp"
                     /protein_id="NP_982509.1"
                     /db_xref="GeneID:4618462"
                     /translation="MQRLVKNFSKMALPARYLPPVHRGITQLDKSVFTRSIPLVVVSF
                     PDPRNISVFSKRFKDEILRVPRVPHVVRLVDSPARVDGLPPLKKQMVANDNHVAKGVL
                     LKDSVHRVEDVKQQLSADAQAFLDECGAAVRDYNYTLDYEFYHADEILRSVLPEEFLD
                     EVPSGFTATGHVAHVNLRTELKPYGSLIGQVILDKNRQIETVVDKVDAIASQFRTFQM
                     NVLAGRPDLVVSQRESNCTFTFDFSKVYWNSRLHTEHERLVRLFEPGQLVADVFAGVG
                     PFAIPAAKKEVLVLANDLNPESFRYLRDNIAANKVDGFVRPKNLDGREFIRSSPALLR
                     DWTAQTGGSVTVAPARRRRGAPPAPPRIVTLPRYFHHYVMNLPDSALSFLNEFAGLYS
                     RHGISEDAAADPAFVLPYIHCHCFEKYSPDEPEPAPADLHARIHRRVLEIMHTSADIL
                     PMTALSFHLVRKVAPTKPMFCVTFQLPQSIAFSPLATTT"
     gene            <282816..>283550
                     /locus_tag="AGOS_AAL032W"
                     /old_locus_tag="AAL032W"
                     /db_xref="GeneID:4618552"
     mRNA            <282816..>283550
                     /locus_tag="AGOS_AAL032W"
                     /old_locus_tag="AAL032W"
                     /product="AAL032Wp"
                     /transcript_id="NM_207863.1"
                     /db_xref="GeneID:4618552"
     CDS             282816..283550
                     /locus_tag="AGOS_AAL032W"
                     /old_locus_tag="AAL032W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR071W (PCL5)"
                     /codon_start=1
                     /product="AAL032Wp"
                     /protein_id="NP_982510.1"
                     /db_xref="GeneID:4618552"
                     /translation="MQEEGFRELPGLTAAPLPPSPGVGNGGGARGAVDGARKSPTRLM
                     QVIATLLAALTFNYSNQRINNSKHSLLQFLAEIVRRSKSSRGVTVLATYYFHRLYQYR
                     LKSLPLAQVPEFARSSKRMFLCSLILAHKFTQDSTFSMKAWSTITGLPPKDISTMERW
                     ALNQLQYRLYVSAEDLDRWTEDVLFMNCRSEPVHLHSGECCKSARDPGDVHSGECSKR
                     ARDSDEADPRQDSPWDCVKRLHRCVT"
     STS             283201..284741
                     /standard_name="ha3097"
                     /db_xref="UniSTS:515645"
     gene            complement(283640..283732)
                     /locus_tag="AGOS_t0006"
                     /db_xref="GeneID:4618810"
     tRNA            complement(join(283640..283675,283694..283732))
                     /locus_tag="AGOS_t0006"
                     /product="tRNA-Phe"
                     /codon_recognized="UUC"
                     /db_xref="GeneID:4618810"
     gene            <283888..>284307
                     /locus_tag="AGOS_AAL031W"
                     /old_locus_tag="AAL031W"
                     /db_xref="GeneID:4618470"
     mRNA            <283888..>284307
                     /locus_tag="AGOS_AAL031W"
                     /old_locus_tag="AAL031W"
                     /product="AAL031Wp"
                     /transcript_id="NM_207864.1"
                     /db_xref="GeneID:4618470"
     CDS             283888..284307
                     /locus_tag="AGOS_AAL031W"
                     /old_locus_tag="AAL031W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YNL133C (FYV6)"
                     /codon_start=1
                     /product="AAL031Wp"
                     /protein_id="NP_982511.1"
                     /db_xref="GeneID:4618470"
                     /translation="MDPLDVEDEVDESDTTSLQAQLRQNAIRKQEQFQQEIQERNSMV
                     NRMSAEALQYFNQLHKAECSKKEELQTYIDENLKVFEKKQKRAQAPTKNNERSSSTHA
                     ALEEHKAASVTKKKLGIVKKGAPRKTKIRLPVRKSPN"
     gene            284532..284643
                     /locus_tag="AGOS_t0007"
                     /db_xref="GeneID:4618782"
     tRNA            join(284532..284569,284600..284643)
                     /locus_tag="AGOS_t0007"
                     /product="tRNA-Leu"
                     /codon_recognized="UUG"
                     /db_xref="GeneID:4618782"
     gene            complement(<284742..>289361)
                     /locus_tag="AGOS_AAL030C"
                     /old_locus_tag="AAL030C"
                     /db_xref="GeneID:4618483"
     mRNA            complement(<284742..>289361)
                     /locus_tag="AGOS_AAL030C"
                     /old_locus_tag="AAL030C"
                     /product="AAL030Cp"
                     /transcript_id="NM_207865.2"
                     /db_xref="GeneID:4618483"
     CDS             complement(284742..289361)
                     /locus_tag="AGOS_AAL030C"
                     /old_locus_tag="AAL030C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR247C (IRC20)"
                     /codon_start=1
                     /product="AAL030Cp"
                     /protein_id="NP_982512.2"
                     /db_xref="GeneID:4618483"
                     /translation="MGNARCEKAFSLKDDGRLRKRMAAADMGKAVADVRQEGATAGAG
                     RGQHTGRAAGAAQRAAHFAVAVGRGQVTAQQLPPGPGPAPERGGRRLRREAECEVPLA
                     EFRVWCGAERPADAYTAEDVVVDYVRTERRERLLAARQQGLELRCTLAPLAEAQEALL
                     EAISLKCFEYELRREQWAAKAAAARPEKRRRRRGQRAAVRLPAAYQDVEVCVCELQWN
                     KSGDWCLVMQVSLWCLRNSVNHFSTDTNELLDMLYGSDQYHSSKLEVPRTYVQHQFLH
                     QVARYTRQTLTGSGDLAHVPQLKVELLPFQQESVQWMLEKETVKKTYGRSDEELLSFL
                     NEQISYGYHKLSGDWFWNKLSGYVITEADVLLLYQAYLRDEIHAKGMLSEEMGLGKTV
                     EVLALLLLRPRAMDPVEEQVYEVVSTGKRMRRVKTNLIVCPQVIVQQWLDEIAKHVDG
                     SLKAYHYRGFANIKEEFNTENISELVATLSEYDVIITSYATVSAEVHYAEYSTTMRSR
                     RHKSPKYDYSSPLSLMQFFRIILDEVQMLGSESTNAARCTNLLQRIHTWGVSGTPIHS
                     LADFKVVFSYLQLHPFQDSPKYIDTVCQNTRKLGNNRMHLDPAQIRKLQRVNGVTFTA
                     RELLDIIPRFNLCIRHTKNDVEYQIKIPKQHHYLIQLQFSPIERDNYVNLWKSFLEAS
                     GYDSDGQGPCYLGPAVLNYWLSQLRKTCCHAMMSVLGFSSNEAGNLSALGKGALKSSV
                     NLPNMNDVLKYMIDDVQDKIDSLCVENYSLKIQSAQVRMELEELPSEAIRILKDVENQ
                     LITDFKTNLGISDPYATSVTGQAQRNNKAADEVGSKKKNKIRIYMDFLHQCTFFIATA
                     YYFMGSKKLEKVDEDNEKLDQLGQAEAKQQYTDIYSAAELHEITEIQELEHSYYDIAE
                     KLRKQILVASAGKVEDEIQLVRKYLNSKRVADKTQLRHIEFQQEDLSSNMTVASCYKT
                     MADIFQRMNQGIAQFNGLLKELEEVCMKPINHEYDDNDAEAKAQDYENSINDQDKIFA
                     LLDCLERILSNRDEIITSDEEVRIPKVSSLVKDVTSDYHRELLKQVQFVGGTPLKQIF
                     ADLKNVSIVMGLTVDGEAKTESFESYLLSFQSQPQIIKKENHQMREILKRFNSIYNAK
                     TAYFSNLQKISDSLVSIIQLEPSVRATILRNTRGDSMYLKNIQKISTLQSRLKYLQNL
                     TKLEQALKDNKRFNCTICLCDICDGAIIGCGHFFCQECISSWLETKQSCPLCKTQTKS
                     SELYSFKFREEETELKHVLVADADSRPTPSQEVISQAVQSIENDPIYLNKYEVCPYLD
                     RIRQLETSVNYGSKIDFVIKLLKYLRLQHETNPTSPALQIVIYSQYAELLEIVAHVLK
                     QNSIKFLTTTKNVRNFAKVVETFKADPEITCLLLDTKRQASGLTLINATHVFLLEPIV
                     NNSTEFQAINRIHRIGQTSETYVWHFMLLNTVEHSILRYKSILEKNKGDSTKGTRQQG
                     GGLRVVSDEDTLSDPESEAENAYNINQAGDEAVSEEHLWHCLFQK"
     gene            <289973..>291577
                     /locus_tag="AGOS_AAL029W"
                     /old_locus_tag="AAL029W"
                     /db_xref="GeneID:4618704"
     mRNA            <289973..>291577
                     /locus_tag="AGOS_AAL029W"
                     /old_locus_tag="AAL029W"
                     /product="AAL029Wp"
                     /transcript_id="NM_207866.2"
                     /db_xref="GeneID:4618704"
     CDS             289973..291577
                     /locus_tag="AGOS_AAL029W"
                     /old_locus_tag="AAL029W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR248W (RCK2) and YGL158W (RCK1)"
                     /codon_start=1
                     /product="AAL029Wp"
                     /protein_id="NP_982513.1"
                     /db_xref="GeneID:4618704"
                     /translation="MPVDSPHSEDIVLNISLRQAEAEPEGGAAGARRTEERGPAVAEQ
                     AAGAEPAGARSGGLESEESLSEEEDEEEDEDEEPEGVFPEQSELAGYKLLGKIGEGAF
                     SEVYRAVPLKDGPNAYLSSRYKQVAVKVISKKRLSTTASTTGRRRDKREEAGENKATS
                     REQVLKEITIHKAVSSGENIVTFIDFQETESYYFIVQELLAGGEIFGEIVRLTYFSED
                     LSRHVIRQLALAVKHMHSLGIVHRDIKPENLLFSPIDFIPSKRQQLRQSDDPKTKQDE
                     GLFRPGIGGGGIGVIKLADFGLSKQIYATNTTTPCGTVGYTAPEVVKDERYSMKVDMW
                     GIGCVLYTVLCGFPPFYDEKIDVLTELISKGQYTFLRPWWDEISPGAKNAVRRLLEVD
                     PDKRYDIDEFLADPWLNSYDCNVLRPLVPLDRRKRHAHNHSHKPYKKDSTLIYSPAAV
                     AMRDALDISNAVQREEEAKHMTPGGHQLGALREDEEESAAAFGDLDHNMFQLRLNSST
                     ILKRRNQKKPAQEGIGVNIPMTVEEI"
     gene            <291792..>294926
                     /locus_tag="AGOS_AAL028W"
                     /old_locus_tag="AAL028W"
                     /db_xref="GeneID:4618454"
     mRNA            <291792..>294926
                     /locus_tag="AGOS_AAL028W"
                     /old_locus_tag="AAL028W"
                     /product="AAL028Wp"
                     /transcript_id="NM_207867.2"
                     /db_xref="GeneID:4618454"
     CDS             291792..294926
                     /locus_tag="AGOS_AAL028W"
                     /old_locus_tag="AAL028W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR249W (YEF3) and YNL014W (HEF3)"
                     /codon_start=1
                     /product="AAL028Wp"
                     /protein_id="NP_982514.2"
                     /db_xref="GeneID:4618454"
                     /translation="MSDSAQSIKVLGELFEKLSVATAENREATATEIASFLNGNIIEH
                     DVPEEFFKNLTKAVKDKKTAAAALETIAHIANENNLSPSVEPYIVDLVPEVCVKTGDK
                     DKDVQSIASETLLAIVKAIDPVAIKVILPHLTKSLVTTNKWQEKVSVLAAISALVDAA
                     KTQVALRMPELIPVLSEAMWDTKKEVKHAATATMTKATETVDNKDIERFIPELIQCIA
                     DPSQVSETVHLLGATTFVAEVTPATLSIMVPLLNRGLAERETSIKRKAAVIIDNMCKL
                     VEDPQVVAPFLEKLLPGLKNNFATIADPEAREVTLRGLKTLRRVGNVSDDDTLPEVSH
                     AGDIVTTRGVLDELTKDTPIAPRFAPVVNYIAAIAADLIDERIIDQQAWFTHVTPYMT
                     VFFHEKQSKEIIDDFRKRAVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAKILLNKTQ
                     LRLKRARRYGLCGPNGAGKSTLMRAIANGQVDGFPTQDECRTVYVEHDIDGTQADTSV
                     LDFVFQGDVGTREVITEKLREFGFSDEMIAMPIMSLSGGWKMKLALARAVLKNADILL
                     LDEPTNHLDTVNVAWLVNYLNTCGITSIIVSHDSGFLDNVCQYIIHYEGLKLRKYKGN
                     LSEFVKKCPTAKSYYELGASDLEFKFPEPGFLEGVKTKQKAIVKVSNMSFQYPGTSKP
                     QIADINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTTGEVYTHENCRIAYIKQHA
                     FAHIENHLDKTPSEYIQWRFQTGEDRETMDRANRQINESDAESMNKIFKIDGTPRRIA
                     GIHSRRKFKNTYEYECSFLLGENIGMKSERWVPMMSVDNAWLPRGELIESHSKMVAEV
                     DMKEALASGQFRPLTRKEIEEHCAMLGLEAELVSHSRIRGLSGGQKVKLVLAACTWQR
                     PHLIVLDEPTNYLDRDSLGALSKALKAFEGGVIIITHSAEFTKDLTEEVWAVKDGIMT
                     PSGHNWVSGQGSGPRLEKKEDEGDKFDAMGNKIATGNKKKKLSSAELRKKKKERMKKK
                     KELGDAYVSSDDEF"
     gene            <295234..>297379
                     /locus_tag="AGOS_AAL027W"
                     /old_locus_tag="AAL027W"
                     /db_xref="GeneID:4618602"
     mRNA            join(<295234..295347,295418..>297379)
                     /locus_tag="AGOS_AAL027W"
                     /old_locus_tag="AAL027W"
                     /product="AAL027Wp"
                     /transcript_id="NM_207868.2"
                     /db_xref="GeneID:4618602"
     CDS             join(295234..295347,295418..297379)
                     /locus_tag="AGOS_AAL027W"
                     /old_locus_tag="AAL027W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL012W (SPO1); 1-intron"
                     /codon_start=1
                     /product="AAL027Wp"
                     /protein_id="NP_982515.2"
                     /db_xref="GeneID:4618602"
                     /translation="MRLTIVITAFALLGNALSNFYTPHGVMCPREDLIRNSNTGLSEQ
                     EHSYIKNHHYLTQNHLIKFLQNASIPDFDINDFLHKTSQRPINLAIAVSGGGYRSMLT
                     SSGFLLGMHSRGLFNCASYIASISGGSWTLMRLLLTNFNIEELKEWNINSSLLEGVPN
                     FEIKNRDIIQQFEATANSPESITHTSQEVFMDEDFYSELQDQASIWKRSLALGPAGEL
                     PTFSEFYDRLERSWAQLDHSPHHKRSIDTLLKLKETFEDVFKADSEDGEVNQIRKLEE
                     MMDSFSSFRKVLSFYIDLHSEVRPKKIMGFPVSFTDYWGRALWKKIYVNESMISSMSE
                     LFARSEITNNYEAPLPIIIANCKNEDLVNAVFEFTPFEFGSWNRLLGLFVNLKYLGSN
                     FTEGVAQSCVQGFDDIGFITATSSSLFNNVLIYAWKLASESSLKTMKAIRALFSTFGV
                     NLKNKPNSFFGTRSDFALFQPNPFYRYPGVDSPLTNSDKLYLVDGGEDGENIPLRPFL
                     QPERQVDLIFALDSSSGRINYPTGGILRNLYDNLHATDGAAAVVQTGDVQSVTDLLPY
                     IPSAEEFEAKGLLKRPVAFGCYPESYHIRNASATAAPGKLPPIVFYHANRNSTYNSNT
                     STFKLRYNHSEVQGMLENGASLFTHDNNTAYFQCVGCLVVKRAYDNVNASAKLPPTCQ
                     QCFRRYCYN"
     gene            <297668..>298921
                     /locus_tag="AGOS_AAL026W"
                     /old_locus_tag="AAL026W"
                     /db_xref="GeneID:4618478"
     mRNA            <297668..>298921
                     /locus_tag="AGOS_AAL026W"
                     /old_locus_tag="AAL026W"
                     /product="AAL026Wp"
                     /transcript_id="NM_207869.1"
                     /db_xref="GeneID:4618478"
     CDS             297668..298921
                     /locus_tag="AGOS_AAL026W"
                     /old_locus_tag="AAL026W"
                     /note="NOHBY101; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AAL026Wp"
                     /protein_id="NP_982516.1"
                     /db_xref="GeneID:4618478"
                     /translation="MVQRGRGGRDAAVGAAHGHGHMRQLYELVYNGGAVGTVTLRPDL
                     PRHGTLDPSNVVCTLVELYHSIPGDIPLIKTHSIAGWVFLNEVEPGNLIVWGKSDMRV
                     VVDPMEMSAQQEQAALLGGVGYGHWSELEDVAAAAAAAAAAAAGASAHAHAGAGSHVG
                     TAVGGPGTGPLAHNAHAHQHTHQHAHHHAHQHRHSGMVNLTRFNSAPPGIMEFQTPEQ
                     VKDYIQRIYAFQERIGIVCLKTKDYKSKVTRIDFGCEFYGTRAGKTAAPNDISPGGAA
                     NGDSDEHRTRSTHHLGSGTKRCPFFIRYRYQSAKDNYYLDEACSNLDHDHDRVDVWNY
                     NTNKRLLIKEYKRQLIQLMSSSDNVSSGDVIRLLVSEASKDDLYKGYFSNNTRKKDFA
                     KAMRKNCEYFRRSYLDKRSFDGQVT"
     gene            <299329..>300015
                     /locus_tag="AGOS_AAL025W"
                     /old_locus_tag="AAL025W"
                     /db_xref="GeneID:4618680"
     mRNA            <299329..>300015
                     /locus_tag="AGOS_AAL025W"
                     /old_locus_tag="AAL025W"
                     /product="AAL025Wp"
                     /transcript_id="NM_207870.1"
                     /db_xref="GeneID:4618680"
     CDS             299329..300015
                     /locus_tag="AGOS_AAL025W"
                     /old_locus_tag="AAL025W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR250W (SSP120)"
                     /codon_start=1
                     /product="AAL025Wp"
                     /protein_id="NP_982517.1"
                     /db_xref="GeneID:4618680"
                     /translation="MRLLELGLVFGGLLGSVRCMPHGDKIHTEVERPPEGKNWEQWHM
                     EHEHQMAEYTPEKFFNLHDTNGKGYMDERDILSLYGLSRPEVVGTGDGMGQHDDSERI
                     DEETANRIVKLIGELLDTNDDGKVTKAEYLNFAKRGKSFPDLGVGVGHHLDFEKEFNV
                     HHWNTHHQNNEKTTHREDVEHDLLHYYHSLEQDELKRGATRGSYVTDDQLESQIMKQK
                     IPSKYLTGRL"
     gene            complement(<300125..>301459)
                     /locus_tag="AGOS_AAL024C"
                     /old_locus_tag="AAL024C"
                     /db_xref="GeneID:4618674"
     mRNA            complement(<300125..>301459)
                     /locus_tag="AGOS_AAL024C"
                     /old_locus_tag="AAL024C"
                     /product="AAL024Cp"
                     /transcript_id="NM_207871.1"
                     /db_xref="GeneID:4618674"
     CDS             complement(300125..301459)
                     /locus_tag="AGOS_AAL024C"
                     /old_locus_tag="AAL024C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL011C"
                     /codon_start=1
                     /product="AAL024Cp"
                     /protein_id="NP_982518.1"
                     /db_xref="GeneID:4618674"
                     /translation="MAEGTRRRLSVVVLGGGTATNALVPCFEELSSSVAYIMPISDNG
                     GSTSEILRVIGGPAIGDIRSRLVRVISDAFLIQVLSYRLPQENKRAKEEWNEIVEGSH
                     AIWGGVPSPLRECVRPFLAHIQSELLKRGKISKPFQFAKASVGNLFLTGARLFLGSLD
                     AAIELTLRLGRCDASVDVIPCINSNHMYHISALLENETVITGQSQISHPSQPIHDQFA
                     GTMSRAGDESSSPSYTSVQGLNTPSQADDDEEEEDAAPFYIHPDLRTSQLYFEKMIDE
                     EPLPAPVKRVFYINPYGEEIFPVANSRSIHQLKRCDMLVYSIGSLITSLLPMVILGNV
                     AEVVVEGKMKKVLLVNNKYDRETFGLGGLQYVLMIIDAMHMAVTRYKKKRAKLDHMQW
                     PPAAYITDVVYLRDGQINADWKILEQKGIRCHGVDGDVFDDKLLTEVLSNIQ"
     gene            <301693..>302580
                     /locus_tag="AGOS_AAL023W"
                     /old_locus_tag="AAL023W"
                     /db_xref="GeneID:4618785"
     mRNA            <301693..>302580
                     /locus_tag="AGOS_AAL023W"
                     /old_locus_tag="AAL023W"
                     /product="AAL023Wp"
                     /transcript_id="NM_207872.2"
                     /db_xref="GeneID:4618785"
     CDS             301693..302580
                     /locus_tag="AGOS_AAL023W"
                     /old_locus_tag="AAL023W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL010W"
                     /codon_start=1
                     /product="AAL023Wp"
                     /protein_id="NP_982519.2"
                     /db_xref="GeneID:4618785"
                     /translation="MEVAALPTPLYNIISYVIMLVDAKTTAFLRPLALYIRSVCAADF
                     ELAPRINSQRIMAKAVIFSDFDGTITWQDSNDFLADQYGLGQAARRRLFEGVIEGTTS
                     FRDGFLQMLESIRLPFDQCVSKVREHVQLDPGFKDMYEWTRREGVPLVVISSGMRPLI
                     EALLEQLLGHEALQQIEVIANEVDVRQDGTWCIRYRDESEHGHDKSRSIAACKQRWQH
                     LEPAPVYFYCGDGISDLSAAKECDLLFAKSGKDLISFCKKQDVPFREFNTFDDVLSAV
                     KRVVAGEASVTELQGGSAA"
     gene            <302930..>304177
                     /locus_tag="AGOS_AAL022W"
                     /old_locus_tag="AAL022W"
                     /db_xref="GeneID:4618465"
     mRNA            <302930..>304177
                     /locus_tag="AGOS_AAL022W"
                     /old_locus_tag="AAL022W"
                     /product="AAL022Wp"
                     /transcript_id="NM_207873.1"
                     /db_xref="GeneID:4618465"
     CDS             302930..304177
                     /locus_tag="AGOS_AAL022W"
                     /old_locus_tag="AAL022W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR174W (IDP2) and YNL009W (IDP3)"
                     /codon_start=1
                     /product="AAL022Wp"
                     /protein_id="NP_982520.1"
                     /db_xref="GeneID:4618465"
                     /translation="MGKVKVQQPIVEMDGDEQTRIIWHLIKDQLIFPYLDVDLKYYDL
                     SIENRDATEDRVTVESAEATLKYGVAVKCATITPDEARVEEFGLKEMWKSPNGTIRNI
                     LGGTVFREPIIIPRIPRLVPGWNEPIIVGRHAFGDQYKATDVVIPGEGTLKLVFESKD
                     GDKSKNLDLEVFEYPKDGGVAMTMYNTTDSITGFAKSSFELALQRKMPLYSTTKNTIL
                     KKYDGKFKDIFEGMYAAEYKEKFEAAGIWYEHRLIDDMVAQMLKSKGGFIIAMKNYDG
                     DVQSDIVAQGFGSLGLMTSVLVSPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIAS
                     IFAWTRGIIHRGKVDGTPDVVKFGELLEKSTLDTVQEDNIMTKDLALILGKTDRASYV
                     TTEEFITAVANRLADGYKRLFCE"
     gene            305373..305443
                     /locus_tag="AGOS_t0008"
                     /db_xref="GeneID:4618634"
     tRNA            305373..305443
                     /locus_tag="AGOS_t0008"
                     /product="tRNA-Gly"
                     /codon_recognized="GGC"
                     /db_xref="GeneID:4618634"
     gene            <305723..>306625
                     /locus_tag="AGOS_AAL021W"
                     /old_locus_tag="AAL021W"
                     /db_xref="GeneID:4618687"
     mRNA            <305723..>306625
                     /locus_tag="AGOS_AAL021W"
                     /old_locus_tag="AAL021W"
                     /product="AAL021Wp"
                     /transcript_id="NM_207874.1"
                     /db_xref="GeneID:4618687"
     CDS             305723..306625
                     /locus_tag="AGOS_AAL021W"
                     /old_locus_tag="AAL021W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCL009C (ILV6)"
                     /codon_start=1
                     /product="AAL021Wp"
                     /protein_id="NP_982521.1"
                     /db_xref="GeneID:4618687"
                     /translation="MLRQSIKGIGSGSWIRCNSSSSTAALVYKQLHKHKVKPPVPKFE
                     TSSWSANSAVASILYETPAPSREPKKQCVLNCLVQNEPGVLSRVSGTLAAKGFNIDSL
                     VVCSTEVPDLSRMTIVLQGQDAVVEQARRQIEDLVPVYAVLDYTNTDLIKRELLLTRI
                     SLLGAEYFEELVARHAGLTEACSDAAENVSADQTFHPSNLPLSELQRMKHEHLNAITN
                     LATNFGGRVVDISESNCVVELSAKPSRISAFLKLIKPYGVLEVARTGMMALPRTPVDD
                     ETTNQENMVADASEAVDISQLPPG"
     gene            complement(<306691..>307770)
                     /locus_tag="AGOS_AAL020C"
                     /old_locus_tag="AAL020C"
                     /db_xref="GeneID:4618492"
     mRNA            complement(<306691..>307770)
                     /locus_tag="AGOS_AAL020C"
                     /old_locus_tag="AAL020C"
                     /product="mitochondrial 54S ribosomal protein YmL2"
                     /transcript_id="NM_207875.1"
                     /db_xref="GeneID:4618492"
     CDS             complement(306691..307770)
                     /locus_tag="AGOS_AAL020C"
                     /old_locus_tag="AAL020C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL005C (MRP7)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL2"
                     /protein_id="NP_982522.1"
                     /db_xref="GeneID:4618492"
                     /translation="MSFWKVATLWQMPLRPSILVQVRTATKRAAGSRTSMKDSAGRRL
                     GPKKTEGQRVEVGQIIMRQRGTRFYPGENVGIGKDHTLFALEPGWVRYYLDPFHTGRK
                     FVGVALYQDMRLPIEHFAPRVRRFGRQLLSGKEAETEEQALPRSVFLAKEKILERAQQ
                     RADAREQRRAEFGHILREELGLALDQDAEQLATEYLLRVQTNLKSGFNSADARFNAMY
                     HMEVRMRNTPEKVGQMDLLKKTVASVDAATSFSNKFELGRHISEGERVAWREALHKDL
                     AGLVIRTAEEKQRVVERLKEASKYLSLSEEIHLRRKFLKPVKPETEAVAEAAGKGTVT
                     IKRFNYGTGKVDTIIREKKAFLAKL"
     gene            <308131..>308841
                     /locus_tag="AGOS_AAL019W"
                     /old_locus_tag="AAL019W"
                     /db_xref="GeneID:4618418"
     mRNA            <308131..>308841
                     /locus_tag="AGOS_AAL019W"
                     /old_locus_tag="AAL019W"
                     /product="AAL019Wp"
                     /transcript_id="NM_207876.1"
                     /db_xref="GeneID:4618418"
     CDS             308131..308841
                     /locus_tag="AGOS_AAL019W"
                     /old_locus_tag="AAL019W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCL010C (SGF29)"
                     /codon_start=1
                     /product="AAL019Wp"
                     /protein_id="NP_982523.1"
                     /db_xref="GeneID:4618418"
                     /translation="MDGQWDIIVSSLQKLCASHEALPLDGDGGTKRVQLRNMTAEQLQ
                     LQLLHYQEHRDAVGGARRLVAAMQAAVDALLGDGGPAPPDPGPAGRSYWTSSFNPNDP
                     IYVGSEVAYKPRRTGAEGEWFQCQVIKVSADGTRFEVRDPEPDEFGQPGGTFKCNWKE
                     LLLIPPRTTPRQLTPHYPSGTKVLARYPETTTFYPAMVIGNKRDGTCRLRFDGEEEAD
                     KETEVDRRYVLPFPARRS"
     gene            <309526..>310539
                     /locus_tag="AGOS_AAL018W"
                     /old_locus_tag="AAL018W"
                     /db_xref="GeneID:4618547"
     mRNA            <309526..>310539
                     /locus_tag="AGOS_AAL018W"
                     /old_locus_tag="AAL018W"
                     /product="AAL018Wp"
                     /transcript_id="NM_207877.1"
                     /db_xref="GeneID:4618547"
     CDS             309526..310539
                     /locus_tag="AGOS_AAL018W"
                     /old_locus_tag="AAL018W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL004W (HRB1) and YCL011C (GBP2)"
                     /codon_start=1
                     /product="AAL018Wp"
                     /protein_id="NP_982524.1"
                     /db_xref="GeneID:4618547"
                     /translation="MSRNYSNSVFIGNLTYDTTPEDLRQLFGEVGHVVRADIITSRGH
                     HRGMGTVEYTNAQDVDEAIRRFNGMDFMHRELFVRRDNPPPVGERRERRGPGPLPRRT
                     HPGGFEIFVANLPYSISWQTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQ
                     IAAIERWNGYELEGRILEVREGKGTDVGSAGRGDSYVPKQIPSYDYDGEYRGTEVRAE
                     LPHSENASVSVSGKASPEYEQYTPSDVEFTSKAAPGGAKNRIIYCENMPLATAESDLY
                     DLFETAGKVLRANLQYDSEGNPTGSSVCEFETVADAQECIERLNNYHYGGCDLKMSYA
                     SYA"
     gene            <310789..>311266
                     /locus_tag="AGOS_AAL017W"
                     /old_locus_tag="AAL017W"
                     /db_xref="GeneID:4618473"
     mRNA            join(<310789..310879,311043..>311266)
                     /locus_tag="AGOS_AAL017W"
                     /old_locus_tag="AAL017W"
                     /product="AAL017Wp"
                     /transcript_id="NM_207878.1"
                     /db_xref="GeneID:4618473"
     CDS             join(310789..310879,311043..311266)
                     /locus_tag="AGOS_AAL017W"
                     /old_locus_tag="AAL017W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCL012C; 1-intron"
                     /codon_start=1
                     /product="AAL017Wp"
                     /protein_id="NP_982525.1"
                     /db_xref="GeneID:4618473"
                     /translation="MFGLISLWHLFWLAVMAGILVVAHRNRETIHGFSSQNFDLTSAN
                     SNDTRSGLDEASKQEIRRIMEEQGLGFDQARLVYTTRKFGAHGIAPDGMPLDPKVVTF
                     RR"
     gene            complement(<311444..>315880)
                     /locus_tag="AGOS_AAL016C"
                     /old_locus_tag="AAL016C"
                     /db_xref="GeneID:4618640"
     mRNA            complement(<311444..>315880)
                     /locus_tag="AGOS_AAL016C"
                     /old_locus_tag="AAL016C"
                     /product="AAL016Cp"
                     /transcript_id="NM_207879.1"
                     /db_xref="GeneID:4618640"
     CDS             complement(311444..315880)
                     /locus_tag="AGOS_AAL016C"
                     /old_locus_tag="AAL016C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCL014W (BUD3)"
                     /codon_start=1
                     /product="AAL016Cp"
                     /protein_id="NP_982526.1"
                     /db_xref="GeneID:4618640"
                     /translation="MLTAKQDEVGRELRVATGTSLIEYPVKDWLLRRQPTEWEALLGE
                     AAIFSGQDELLWGPFVACVYREPRTTRLNCLFMDRIGVMHLHSVDVSDTSRFYPAVEN
                     LRPEYRTQVVRRCLAVGLLKKYVLLDPSAVRLIRAELPYDYDQTTAGDLANTCELVEG
                     QAARDVGQLLVRLGLVQPRHVRSLMLDVVYENHADVVDANNKLVYYLGEQLEQLFDPL
                     TEYSPEPTELSYRVPDQVRTSLSDEMPLMVSICEELLQLQTNFTLSLVGFLQKFLIPL
                     RIKALNEQVPGLSTVKLNNIFPPTIDEVTRINCIFLDALKAALPYGSLEVLKACSITA
                     PYFYKAYTRHEAATKFFSRDIKSFLSTFGKSLSDLNFYSEIKLDTLIHGPQEKLTKLK
                     LIIDRLFDSKDWETNEEQKEADRCYRSICDVIDSFGKDEPPNTYDTRVFTPSGKILTE
                     LAKGWPAELQYKWLKRRVVGVFDVISVTDPESRDIVVIFSDYIVFLHVINGNLYYSGD
                     SKKPLISDVLMNSLINEVPLPPKIPKLEVLSHSYIDDVVVSTYGKNSLRFDTLNAERP
                     SSVAYTLASSSVEASYVADLCTKARILEKDTAFHLFKTAIDSFHVYSTAHESEAYKTE
                     RIKSPFVLFLNIPDSIGALQDHNATVGLFASLNKNDKVTLVRLGLDGSREESFASLDN
                     FLSLIIEELLIFYPSYLSSATSPLFQQLMQINEQLVQTLLDPKGVHSASKSKCALRTS
                     KKKKMPANLVSTNDNSRTLSPGTIISRTPRTISTITPKQEKRKSVGQASNSPARGSIS
                     TTPRKHKRESILGKISGLFHKKDKKENKRNSVGSDTRNRHDNGSVHILRNSSSSFREL
                     ESPRQMKRFSSVVHTAVPSSSKRRTSGISPSKGTVNLRALQDAENDDNADISKIPIPE
                     GESLFDDTIRVDGVDADFYAQKDRLSKIYNHDLYGEVVPSAPGSKNVNVVSGATREQE
                     KQQNTQKAIARELLASVDQQKRQPTHSAPAESQIVIPGLPQSNVPQINFGRSPSFIEL
                     FGGMRLVLDENDESVNWRRLCSERSLNEKYQIRPATYAGCISGELAPPVGIISDQRDS
                     NLSGDNDADTPLPMHSSNKSILSDETLEKGEFERDFAISTPKSQTVSDVNARRETWGY
                     SHSHDEEIDSEKRANTKPVSAPAPNVIPGLIITANSPTKPWHKENTRIKVSDVRSEGT
                     DVSYISSLKKSSNRLVELSVNSQEDFEDERHTPVIEPIQNPEAPSLIENTETAPVASN
                     SSNEETLSKLLGSQGVIDLTEETIDYSSINRKHASIQTAYPVLDDVEFSTFHMSFGDM
                     KAEDSHLANQRESYLFSNSTIAGKKDESHGPVFYKLPDFVADDSYLGYSAVDQHAKHE
                     RNTEIGEEDEAMWVSPSKLDIFDLSKQPESVYKRTSIPAKHAELLSKMRKDGSVKFEE
                     SMFIRDNSYVYLGQFLSADEVIEQQDKKLAANTDEMDSARRL"
     gene            <316203..>317294
                     /locus_tag="AGOS_AAL015W"
                     /old_locus_tag="AAL015W"
                     /db_xref="GeneID:4618629"
     mRNA            <316203..>317294
                     /locus_tag="AGOS_AAL015W"
                     /old_locus_tag="AAL015W"
                     /product="AAL015Wp"
                     /transcript_id="NM_207880.1"
                     /db_xref="GeneID:4618629"
     CDS             316203..317294
                     /locus_tag="AGOS_AAL015W"
                     /old_locus_tag="AAL015W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCL016C (DCC1)"
                     /codon_start=1
                     /product="AAL015Wp"
                     /protein_id="NP_982527.1"
                     /db_xref="GeneID:4618629"
                     /translation="MSVNLYTELENVGTYKVLQLTEELIRAFQSGPVELKAGGDDSEV
                     VLCSADKTWAVRQKNHSNTVILMKEFAPVPAAETQVSARGPVQGEWLGYTQQTCELEP
                     RATAGQVDLSALPIYNGQHVGDGPDVETLVENATCSRAEFYAAWRAAGGCSVGGTACV
                     ISPDLLGRTLHLVLATAVADGFDLACVGPEQMWASIARSMAAGAHGATHPYSREVIET
                     VLHRFGRVGSDGVSFELDLSRIARWYGVQALKKFASTEAIMVDEFMIKWRSLFPAYFR
                     CDLDLELLYGEFARPQHERIQYLSRSTLPMDIKDRFQQLFRIQNAWDIREITPFIEEL
                     NTRGIGMDNFVLKYARRKKTGKTIVVMPR"
     gene            complement(<317372..>318187)
                     /locus_tag="AGOS_AAL014C"
                     /old_locus_tag="AAL014C"
                     /db_xref="GeneID:4618508"
     mRNA            complement(<317372..>318187)
                     /locus_tag="AGOS_AAL014C"
                     /old_locus_tag="AAL014C"
                     /product="AAL014Cp"
                     /transcript_id="NM_207881.1"
                     /db_xref="GeneID:4618508"
     CDS             complement(317372..318187)
                     /locus_tag="AGOS_AAL014C"
                     /old_locus_tag="AAL014C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL003C (PET8)"
                     /codon_start=1
                     /product="AAL014Cp"
                     /protein_id="NP_982528.1"
                     /db_xref="GeneID:4618508"
                     /translation="MDSTFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGGFFHNGG
                     YRGIYRGLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSL
                     GEMSACLVRVPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMRE
                     IPFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMM
                     LHERRVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVHSLF"
     gene            <318485..>319957
                     /locus_tag="AGOS_AAL013W"
                     /old_locus_tag="AAL013W"
                     /db_xref="GeneID:4618565"
     mRNA            <318485..>319957
                     /locus_tag="AGOS_AAL013W"
                     /old_locus_tag="AAL013W"
                     /product="AAL013Wp"
                     /transcript_id="NM_207882.1"
                     /db_xref="GeneID:4618565"
     CDS             318485..319957
                     /locus_tag="AGOS_AAL013W"
                     /old_locus_tag="AAL013W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCL017C (NFS1)"
                     /codon_start=1
                     /product="AAL013Wp"
                     /protein_id="NP_982529.1"
                     /db_xref="GeneID:4618565"
                     /translation="MLRQVLRRSLSDSRRPLRSVGSISCSARASGIGMRAYSSQIFKE
                     GMQLETHTDIQSAAREQAQERMGSEALASNNSVLKHAYQESVDHGTRPIYLDMQATTP
                     TDPRVVDTMLKFYTGLYGNPHSNTHSYGWETSQEVEKARKNVADVIKADPKEIIFTSG
                     ATESNNMALKGVARFYKKRKNHIITTRTEHKCVLEAARSMKDEGFDVTFLNVNEDGLV
                     SLEELEQAIRPETSLVSVMSVNNEIGVVQPIKEIGAICRRHKVFFHSDAAQAYGKIPI
                     DVDEMNIDLLSISSHKIYGPKGIGALYVRRRPRVRMEPLLSGGGQERGFRSGTLPPPL
                     VVGLGHAAKLMVEEYEYDSAHVRRLSDRLLKGLLSIEQTTLNGSADHRYPGCVNVSFA
                     FVEGESLLMALRDIALSSGSACTSASLEPSYVLHAIGRDDALAHSSIRFGIGRFTTEA
                     EVDYVIKAITERVEFLRELSPLWEMYKDGIDLNTIEWSGH"
     gene            complement(<320132..>321250)
                     /locus_tag="AGOS_AAL012C"
                     /old_locus_tag="AAL012C"
                     /db_xref="GeneID:4618651"
     mRNA            complement(<320132..>321250)
                     /locus_tag="AGOS_AAL012C"
                     /old_locus_tag="AAL012C"
                     /product="AAL012Cp"
                     /transcript_id="NM_207883.2"
                     /db_xref="GeneID:4618651"
     CDS             complement(320132..321250)
                     /locus_tag="AGOS_AAL012C"
                     /old_locus_tag="AAL012C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCL018W (LEU2); The sequence of this gene comes from
                     strain ATCC 10895."
                     /codon_start=1
                     /product="AAL012Cp"
                     /protein_id="NP_982530.1"
                     /db_xref="GeneID:4618651"
                     /translation="MAAVKRIVVLPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYH
                     LVGGAAIDATGSALPDEALGAAKEADAVLLGAVGGPKWQGGAVRPEQGLLKLRQELGV
                     YANLRPCNFAADSLLELSPLRPEIARDTDIMVVRELLGGSYFGERHEDEGDGVAWDTD
                     KYTVKEVQRIARMAGFLALQHDPPLPVWSLDKANVLASSRLWRKTVEETFQSEFPNVQ
                     LQHQLIDSAAMILVKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPD
                     SKSAFGLYEPCHGSAPDLPAGKANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVLD
                     SGVRTGDLLGSSSTSEVGDAIALAVKEALRRQSAAGLS"
     gene            complement(<321494..>322375)
                     /locus_tag="AGOS_AAL011C"
                     /old_locus_tag="AAL011C"
                     /db_xref="GeneID:4618620"
     mRNA            complement(<321494..>322375)
                     /locus_tag="AGOS_AAL011C"
                     /old_locus_tag="AAL011C"
                     /product="AAL011Cp"
                     /transcript_id="NM_207884.1"
                     /db_xref="GeneID:4618620"
     CDS             complement(321494..322375)
                     /locus_tag="AGOS_AAL011C"
                     /old_locus_tag="AAL011C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL002C (RLP7)"
                     /codon_start=1
                     /product="AAL011Cp"
                     /protein_id="NP_982531.1"
                     /db_xref="GeneID:4618620"
                     /translation="MATLNSNPEILLRKRRNAERTRVEKQEAARRRAEAEVRQRRARQ
                     HKFVRAEALVASTLATEREKTRIQRVSKRAAKQRAGHVTGGEWLVRVRAAADGGLERE
                     KTAYDGRATLLFVVRVRGPAAAKIPRKAHRVLTLLRLAEVNTGVFVRLTAEVFPLLQV
                     VAPYVVVGRPSLASIRALVQKRARVVHQRAGEAAPVEMVLNDNGVVEERLGDEGVICV
                     EDIIHEIATMGEAFAKCNFFLLPFKLGREVSGFSALSRLQKLKQREEASQTRPVSNAA
                     AAPLVEVDVDELIGRLN"
     gene            <322942..>325446
                     /locus_tag="AGOS_AAL010W"
                     /old_locus_tag="AAL010W"
                     /db_xref="GeneID:4618726"
     mRNA            <322942..>325446
                     /locus_tag="AGOS_AAL010W"
                     /old_locus_tag="AAL010W"
                     /product="AAL010Wp"
                     /transcript_id="NM_207885.1"
                     /db_xref="GeneID:4618726"
     CDS             322942..325446
                     /locus_tag="AGOS_AAL010W"
                     /old_locus_tag="AAL010W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR176C (RFX1)"
                     /codon_start=1
                     /product="AAL010Wp"
                     /protein_id="NP_982532.1"
                     /db_xref="GeneID:4618726"
                     /translation="MNVDQASQEPWASASLLNRSTPSTSTGTPLNTAQSSLPSAPTTS
                     NSHGPGAGSGPGAEGPALHQQLVPQQQPLMAGRGEPPISAGGAGSGQAQGLLAQPLAQ
                     QMYGAAPHGALMAHPPHLQYATGYGPSHLPPISSKGGAAMKHQAEDFGALHSPPRQYA
                     AQLQRPPSTAGQIPLVLAPQQRHGTPPAQVQQLLHQAPSQHPHQHQNQHLHQNQHQNQ
                     HLHQSQQNPQHVQVQLKHFQHMQDLHRQQQHHQLLLQEQEQRWKKRKAGEPAPQPVIA
                     SELTSKRTTQENILKLVALRNKDKPLTEYATTVRAAEIEVLNMDTSTHSKSDIQAAEQ
                     HRERERQVYALIWLMNNCVPDGDSYVPRGRIFAQYAASCASNNLKPLSQATLGKLIRS
                     LFPHLKTRRLGMRGQSKYHYCGLKLISPLLMSDEMPTVAATPVSSCMSTPINMISTNT
                     ASINLDNTSFSNSTIESAPSSAAGMVNSGVSSVDAVSNISKPALHNNNRRVSMILTGA
                     HENLKFIDNFFSRTCEEKVELPLAFPSINPYLPHNVDMDIASSVESLYKVYCNQLFEN
                     IRFMKFDDLPSTLESFSSGSISPQMYNLFISEELYQWVEHSDLITYRALAKMLSSLIV
                     EFDDIPDIVLDKLSQFSNTYLAMITKATIDLPVPIVSSKKRIVSQFIQLVKRLIKVID
                     SGRNASKIVSLEQNRNNMFQDWNQFVNLEDVLAIEMSHFSKDYPKMKEQITAFVQKEL
                     LGLLSPEYMSFEGNNASNGFAKLARFAKKLCELLQSWGHLPGRIVALSFVGLTTTALR
                     ELSFHDAESFGAWWILKSFVDEWVYWCGEVGCFLDN"
     gene            complement(<325769..>326680)
                     /locus_tag="AGOS_AAL009C"
                     /old_locus_tag="AAL009C"
                     /db_xref="GeneID:4618725"
     mRNA            complement(<325769..>326680)
                     /locus_tag="AGOS_AAL009C"
                     /old_locus_tag="AAL009C"
                     /product="AAL009Cp"
                     /transcript_id="NM_207886.1"
                     /db_xref="GeneID:4618725"
     CDS             complement(325769..326680)
                     /locus_tag="AGOS_AAL009C"
                     /old_locus_tag="AAL009C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL006W (LST8)"
                     /codon_start=1
                     /product="AAL009Cp"
                     /protein_id="NP_982533.1"
                     /db_xref="GeneID:4618725"
                     /translation="MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDK
                     RYLAAAGHLHVRMYDIRTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVW
                     DVRSPSVQRNYKHDAPVNEVVIHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNT
                     ALQSLSIASDGSMLVAGNNKGNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVD
                     VKHLATCSADHTARVWSVEDNFQLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRL
                     WDLSTREIVRQYGGHHKGAVCVALNDV"
     gene            <327111..>328160
                     /locus_tag="AGOS_AAL008W"
                     /old_locus_tag="AAL008W"
                     /db_xref="GeneID:4618806"
     mRNA            <327111..>328160
                     /locus_tag="AGOS_AAL008W"
                     /old_locus_tag="AAL008W"
                     /product="AAL008Wp"
                     /transcript_id="NM_207887.1"
                     /db_xref="GeneID:4618806"
     CDS             327111..328160
                     /locus_tag="AGOS_AAL008W"
                     /old_locus_tag="AAL008W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL007C (SIS1)"
                     /codon_start=1
                     /product="AAL008Wp"
                     /protein_id="NP_982534.1"
                     /db_xref="GeneID:4618806"
                     /translation="MVKETKLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTEK
                     FKEISEAFEILSDPNKREVYDTYGLEAARGNAPSGFGGAGPGGAGFGGFSTGGGGRHA
                     FSQEDAFNIFSQFFGNSAGGASSPFGFSSAGGDEFGFGGFPGGAGLHTSSGGMPGGFG
                     GMPGSSGMHSHSQPEEKLVQVNLPVSLEDLFVGKRKSFKITRKGQTGIPEKKQIDIQL
                     RPGWKAGTKITYKNEGDYNPSTGGRQTIQFIIQEKPHEFFKRDGNDLIYTLPLTFKES
                     LLGFDKTVRTIDGRQISIHKTQPVQPSEEMRYPGQGMPLSKNPSERGDLIVKYKTDYP
                     ITLTEKQRRAILENF"
     gene            complement(<328627..>330084)
                     /locus_tag="AGOS_AAL007C"
                     /old_locus_tag="AAL007C"
                     /db_xref="GeneID:4618808"
     mRNA            complement(<328627..>330084)
                     /locus_tag="AGOS_AAL007C"
                     /old_locus_tag="AAL007C"
                     /product="AAL007Cp"
                     /transcript_id="NM_207888.1"
                     /db_xref="GeneID:4618808"
     CDS             complement(328627..330084)
                     /locus_tag="AGOS_AAL007C"
                     /old_locus_tag="AAL007C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR175W (CBF5)"
                     /codon_start=1
                     /product="AAL007Cp"
                     /protein_id="NP_982535.1"
                     /db_xref="GeneID:4618808"
                     /translation="MSEEHMIKPENVAPSADTSEWPLLLKNYDKLLVRSGHYTPIPAG
                     ASPLKRDLKSYVSSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLI
                     VCIDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRELENLTGALFQRPPLISAVK
                     RQLRVRTIYDSKLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRV
                     RSGALDENDNMVTLHDVLDAQWVYDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVN
                     AVCYGAKLMIPGLLRYEEGIELYDEVVLITTKGEAIAVAIAQMSTVDLATCDHGVVAK
                     VKRCIMERDLYPRRWGLGPVAQKKKQLKADGKLDKYGRVNENTPEDWKKTYVSHEPSA
                     DAAAEVAPVKSEPLIEEVSKKDAKTEVEVPAEKKQDDEEKKEKKEKKEKSEKKEKKEK
                     KEKSEKSEKKEKKEKKRKADDENASEEKKKKKSKK"
     gene            complement(<330276..>331669)
                     /locus_tag="AGOS_AAL006C"
                     /old_locus_tag="AAL006C"
                     /db_xref="GeneID:4618774"
     mRNA            complement(join(<330276..331541,331598..>331669))
                     /locus_tag="AGOS_AAL006C"
                     /old_locus_tag="AAL006C"
                     /product="AAL006Cp"
                     /transcript_id="NM_207889.1"
                     /db_xref="GeneID:4618774"
     CDS             complement(join(330276..331541,331598..331669))
                     /locus_tag="AGOS_AAL006C"
                     /old_locus_tag="AAL006C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCL008C (STP22); 1-intron"
                     /codon_start=1
                     /product="AAL006Cp"
                     /protein_id="NP_982536.1"
                     /db_xref="GeneID:4618774"
                     /translation="MQNSTTAVDVPQPVLDWLFKVLQPEYYDPRTTFHDVVIALRAYK
                     KLRPRTRVFTDEAGRSKLLLCLYGKVGNVDVLIWIPFEYPNVAPHAYIDLEANKGRSI
                     IVNQRLDGDGLFYLPILGHWHPQNCNVVKLVQDLEQAIMAQEPLRPAAGAVKNTETQN
                     MRADMTVSSLPALPPRPSMENNETQKTDLATTPHGPKKPSLPPKPPKVPSVADAEERR
                     DDSVRELDSALSHLRLQNEAPHSNEHAKPHASLPPSNLSAAPVQNQPNWLDSDFTQCD
                     EPTHRDSLAVLQDTLNKLAERTNARYHTEWNAKEKSIDEAIESFRHIYSYEADNIRHM
                     EDAIVENSEILQTEIDKLNGELLKAQKFEEKYPDGLPDMNSCVTAESIALNQLYMLVA
                     RDYALSDTIQILSVMLNQGLISVDPFIKKTRSLAAEQFLTRYHMDKILQLLDN"
     gene            <331860..>332155
                     /locus_tag="AGOS_AAL005W"
                     /old_locus_tag="AAL005W"
                     /db_xref="GeneID:4618738"
     mRNA            join(<331860..331867,331945..>332155)
                     /locus_tag="AGOS_AAL005W"
                     /old_locus_tag="AAL005W"
                     /product="AAL005Wp"
                     /transcript_id="NM_207890.1"
                     /db_xref="GeneID:4618738"
     CDS             join(331860..331867,331945..332155)
                     /locus_tag="AGOS_AAL005W"
                     /old_locus_tag="AAL005W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCL005W-A (VMA9); 1-intron"
                     /codon_start=1
                     /product="AAL005Wp"
                     /protein_id="NP_982537.1"
                     /db_xref="GeneID:4618738"
                     /translation="MSFYTVVATFLSVVLASAVFWVLAPKENQTVWRSTIILSMSMMF
                     LMWAVTYLSQLHPLVVPRRSDLRPEFAE"
     gene            complement(332325..332396)
                     /locus_tag="AGOS_t0009"
                     /db_xref="GeneID:4618799"
     tRNA            complement(332325..332396)
                     /locus_tag="AGOS_t0009"
                     /product="tRNA-Asp"
                     /codon_recognized="GAC"
                     /db_xref="GeneID:4618799"
     gene            complement(333431..333451)
                     /locus_tag="AGOS_AgSNR43"
                     /old_locus_tag="AgSNR43"
                     /db_xref="GeneID:4618783"
     ncRNA           complement(333431..333451)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR43"
                     /old_locus_tag="AgSNR43"
                     /product="AgSNR43"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR43; start and end coordinates are
                     approximate."
                     /transcript_id="NR_149388.1"
                     /db_xref="GeneID:4618783"
     gene            <333713..>334648
                     /locus_tag="AGOS_AAL004W"
                     /old_locus_tag="AAL004W"
                     /db_xref="GeneID:4618562"
     mRNA            <333713..>334648
                     /locus_tag="AGOS_AAL004W"
                     /old_locus_tag="AAL004W"
                     /product="AAL004Wp"
                     /transcript_id="NM_207891.1"
                     /db_xref="GeneID:4618562"
     CDS             333713..334648
                     /locus_tag="AGOS_AAL004W"
                     /old_locus_tag="AAL004W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCL005W (LDB16)"
                     /codon_start=1
                     /product="AAL004Wp"
                     /protein_id="NP_982538.1"
                     /db_xref="GeneID:4618562"
                     /translation="MGKLDCQRNWYQQLIRRAMSNDGTTPLSHVSALTDSVGWAIHER
                     FKPVTMVIWLVHSVFFQPIYTTVNLLLWQPMLTLQRAIWKLALLPANLLLKIFLRTSV
                     EELAVGTDFRGALTIAKVCIQYVIATAVVGSFLGITTGVVLGSIHRMVRIPALYVAIL
                     PTYVDKTTQWVSTVRDFFSNIIDAGLRSIPILSSGVLVDEGGDLFTDLLDTYEHEYVQ
                     YSQSSSNGLREPVKGDYDDYGNMTPISIQDEEELGTSTLSAISNLWDSVPDSGTVRTD
                     VDELKYNLKNSSRQKIAHTTQRYDKFDFSELHHRH"
     gene            complement(334921..334992)
                     /locus_tag="AGOS_t0010"
                     /db_xref="GeneID:4618736"
     tRNA            complement(334921..334992)
                     /locus_tag="AGOS_t0010"
                     /product="tRNA-Arg"
                     /codon_recognized="AGA"
                     /db_xref="GeneID:4618736"
     gene            <335133..>336659
                     /locus_tag="AGOS_AAL003W"
                     /old_locus_tag="AAL003W"
                     /db_xref="GeneID:4618716"
     mRNA            <335133..>336659
                     /locus_tag="AGOS_AAL003W"
                     /old_locus_tag="AAL003W"
                     /product="AAL003Wp"
                     /transcript_id="NM_207892.1"
                     /db_xref="GeneID:4618716"
     CDS             335133..336659
                     /locus_tag="AGOS_AAL003W"
                     /old_locus_tag="AAL003W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCL004W (PGS1)"
                     /codon_start=1
                     /product="AAL003Wp"
                     /protein_id="NP_982539.1"
                     /db_xref="GeneID:4618716"
                     /translation="MRTYIRYSRPLKAVQRTMSTNRTPMNGLEGIFDAVKGSLSSLRT
                     IFYFKEGEIDVLQHPVEFYDTLKQKIAAANDRIFLASLYLGRTEHEVIACLDDALKAK
                     PHLRISLLVDGLRGTRETPNPCSASLLAKLTKEHGDRVEVRLYMTPEYTGWKRALFPK
                     RFNEGIGLQHMKIYGFDDEVILSGANLSNDYFTNRQDRYYLFKSKHFADYYFKMHNLI
                     SKMSYQAKYSNTKQSYMLYWPKNNATIEPRLDKHKFVTQASELLSKFLTATHENGMEG
                     VQYLDDYPTIVYPISQFTPLFKKNNDFSTEKPSILRLLSSIPSSETSWAFTAGYFNIL
                     PEIKKRLLDSPSCVGKIITAAPTANGFYQSRGISKYLPDAYLYLAQKFLKSVHAEGKS
                     DTISLYEWQKGVVNQPGGWSYHAKGIWISDGCDEDSRPVVTVVGSSNYTRRAYSSDLE
                     TNAIILTTDDRLRAAMGAELQNILRHTKKITLNDFTNDPQRYVKPGVRAATEVLGKKL
                     "
     gene            <337035..>337586
                     /locus_tag="AGOS_AAL002W"
                     /old_locus_tag="AAL002W"
                     /db_xref="GeneID:4618735"
     mRNA            <337035..>337586
                     /locus_tag="AGOS_AAL002W"
                     /old_locus_tag="AAL002W"
                     /product="AAL002Wp"
                     /transcript_id="NM_207893.1"
                     /db_xref="GeneID:4618735"
     CDS             337035..337586
                     /locus_tag="AGOS_AAL002W"
                     /old_locus_tag="AAL002W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCL001W (RER1)"
                     /codon_start=1
                     /product="AAL002Wp"
                     /protein_id="NP_982540.1"
                     /db_xref="GeneID:4618735"
                     /translation="MNFEEEEVTTSNKATFYFNKYKTLYQYYLDQTTPHVRYRWAGLI
                     VLVLLFVLRVVLYEGWYVVCYGLGIYLLNQFLAFLTPKFDMSLQQAEKNNELESGDMA
                     DEFRPFIRRLPEFKFWHNSIRATLLSHFLATFSVFDIPVYWPILLIYFILLFALTMRR
                     QINHMIKYKYLPLDIGKKKYSHK"
     gene            <337894..>339051
                     /locus_tag="AGOS_AAL001W"
                     /old_locus_tag="AAL001W"
                     /db_xref="GeneID:4618795"
     mRNA            <337894..>339051
                     /locus_tag="AGOS_AAL001W"
                     /old_locus_tag="AAL001W"
                     /product="AAL001Wp"
                     /transcript_id="NM_207894.1"
                     /db_xref="GeneID:4618795"
     CDS             337894..339051
                     /locus_tag="AGOS_AAL001W"
                     /old_locus_tag="AAL001W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL001W (DOM34) and YCL001W-A"
                     /codon_start=1
                     /product="AAL001Wp"
                     /protein_id="NP_982541.1"
                     /db_xref="GeneID:4618795"
                     /translation="MKLISQSKGTSSSEVCLVVVAQDKEDLFTLYNIINTDDELIFKK
                     KLTLKLDEAGKKKSTELVRLRVKVVSSEFEPQHEFLKYKGITTEDDAGKANVDVALGK
                     FFSFTVDYQYPFTIIKKDFNSYCQKLINEACNLESRSDMAAVVLQEGLAHICLLSSFS
                     TILKQKVEYSLPKKKRSVDVLKFDEKTEKFYKAIYNAMLKHFDLSQLKAVILCSPGFY
                     AKTLYEKILQYAQTNQEKTVIDNKDKFLVAHCSTGYLQGISEVLRDPAYSQKLQNTKN
                     SGQLQVMDAFLKHLNDDDNKSWYGEAEITKACEFGAIETLLITDDWLRADSVSVRNKS
                     LKLIKDVENMGGKVCVFSSMHSSGEELNSLTGLACILKYPIPDLDEHEDED"
     centromere      339311..339510
                     /note="Chromosome I centromere"
     centromere      339311..339319
                     /note="Chromosome I centromere CDE I element"
     centromere      339320..339485
                     /note="Chromosome I centromere CDE II element"
     centromere      339486..339510
                     /note="Chromosome I centromere CDE III element"
     gene            complement(<340462..>341448)
                     /locus_tag="AGOS_AAR001C"
                     /old_locus_tag="AAR001C"
                     /db_xref="GeneID:4618433"
     mRNA            complement(<340462..>341448)
                     /locus_tag="AGOS_AAR001C"
                     /old_locus_tag="AAR001C"
                     /product="AAR001Cp"
                     /transcript_id="NM_207895.1"
                     /db_xref="GeneID:4618433"
     CDS             complement(340462..341448)
                     /locus_tag="AGOS_AAR001C"
                     /old_locus_tag="AAR001C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR002C (CDC10)"
                     /codon_start=1
                     /product="AAR001Cp"
                     /protein_id="NP_982542.1"
                     /db_xref="GeneID:4618433"
                     /translation="MSSVADSSLITPSSYVGFDTITAQIEHRLLKRGFQFNIMVVGHS
                     GLGKSTLINSLFASHLIDSSTGKDITKEPITKTTEIKVSYHSLVEDKVRLNVNCIDTP
                     GFGDQINNDKVWEPIVKYIKEQHSQYLRKELTAQREKHIVDTRVHAVLYFIQPNGKGL
                     TQLDIAALKRLTDITNVIPVIAKADTLTMDERAKFREIIQHEFKKHNFRIYPYDSDDL
                     TPEELELNDSIRSIIPFAVVGSEKEITVNGEVVRGRKTRWGAINLEDINQCEFVYLRE
                     FLIRTHLQDLIETTALIHYESFRSKQLIALKENASSRATGHGAQSSSTNMLR"
     gene            <341774..>342310
                     /locus_tag="AGOS_AAR002W"
                     /old_locus_tag="AAR002W"
                     /db_xref="GeneID:4618655"
     mRNA            <341774..>342310
                     /locus_tag="AGOS_AAR002W"
                     /old_locus_tag="AAR002W"
                     /product="mitochondrial 54S ribosomal protein YmL32"
                     /transcript_id="NM_207896.2"
                     /db_xref="GeneID:4618655"
     CDS             341774..342310
                     /locus_tag="AGOS_AAR002W"
                     /old_locus_tag="AAR002W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR003W (MRPL32)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL32"
                     /protein_id="NP_982543.2"
                     /db_xref="GeneID:4618655"
                     /translation="MSAQAVWGNVGRALSECTAALFPRLELGSGSVTAPRTLLELLRR
                     AGGSQQAGTAAVGADGLVLAVPKKKVSHQKRRQKLYGPGKKQLQMVHHLGKCPSCGHY
                     KRLNTLCMYCVGEIRHIWKVYTQTKPAEPPQEQDLSELDKRILYPGREETEYMKKLKK
                     KDYLEKRMRTLPVDDKGK"
     gene            <342575..>344317
                     /locus_tag="AGOS_AAR003W"
                     /old_locus_tag="AAR003W"
                     /db_xref="GeneID:4618493"
     mRNA            <342575..>344317
                     /locus_tag="AGOS_AAR003W"
                     /old_locus_tag="AAR003W"
                     /product="AAR003Wp"
                     /transcript_id="NM_207897.1"
                     /db_xref="GeneID:4618493"
     CDS             342575..344317
                     /locus_tag="AGOS_AAR003W"
                     /old_locus_tag="AAR003W"
                     /note="NOHBY104; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F12804g"
                     /codon_start=1
                     /product="AAR003Wp"
                     /protein_id="NP_982544.1"
                     /db_xref="GeneID:4618493"
                     /translation="MNQDAKKQRMLPSYRVSTFTSAPRHPLGVKPSGNAIMEGFGPKE
                     RAEARGKLLGHLAIFPEELLVEVLTYITTPEDLRNLGHASRMLYAYTYDEELWRKMYT
                     NEFIRMEQAARADSKPVVLKPYGCDQWKGSWRKTILKLGDDQEACLQVRDTLYSDLLY
                     RPYQCSQVDYKTIFRKVIDFERRSSNLVCNLNPDFGIDRFDESQFDEEKFRKEYIDKP
                     FILRAKDNDARWPGWDLAYLVSKYPQVKFRQESVTWPLSHYADYFKKNRDESPLYLFD
                     CASEAMEKIKNQYAPPDVFQKDFFTLFQQDGVQCRPDHRWLIAGPARSGSTFHKDPNQ
                     TSAWNAVLSGMKLWVMLPPDVAPPGVSTDKEEEEVTSPVGITEWVLSGYYNDAVNLAQ
                     QGKCRIGVQFASECIYVPAGWWHTVINITDSVALTENFVPEPILPRVLNFFKNKTKQI
                     SGFHMKDLVASIESFLELQRGNIGNKTNLTLLEEFLDQSKTSQLDNEDCGVLNASEIA
                     APLYEFFCELIQQSDYRGALPAAQQALKDIEIRDAQQQQTSRVNIKDSEKWMELTKMS
                     ESPFSFCFDADDDA"
     gene            complement(<345018..>346451)
                     /locus_tag="AGOS_AAR004C"
                     /old_locus_tag="AAR004C"
                     /db_xref="GeneID:4618789"
     mRNA            complement(<345018..>346451)
                     /locus_tag="AGOS_AAR004C"
                     /old_locus_tag="AAR004C"
                     /product="AAR004Cp"
                     /transcript_id="NM_207898.1"
                     /db_xref="GeneID:4618789"
     CDS             complement(345018..346451)
                     /locus_tag="AGOS_AAR004C"
                     /old_locus_tag="AAR004C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR001C (CIT1) and YCR005C (CIT2)"
                     /codon_start=1
                     /product="AAR004Cp"
                     /protein_id="NP_982545.1"
                     /db_xref="GeneID:4618789"
                     /translation="MSSMMKLGSATRSHLVRSLARNTFARVGGASACRAYSNGEKSLK
                     ERFAEIFPAKAEEIKQFKKQHGKVVIGEVLLEQAYGGMRGIPGVVWEGSVLDPHEGIR
                     FRGRTIPEVQKELPKAPNGREPLPEALFWLLLTGEVPTETQTKALSADLMSRSELPGH
                     VEQLLDSLPRDLHPMAQFSVAVTALESESKFAKAYAQGVSKKDYWNYTFEDSLDLLGK
                     LPVIASKIYRNVFKDGKMGKIDVDADYGKNLGHLLGFENPEFVELMRLYLTVHSDHEG
                     GNVSAHTTHLVGSALSSPYLAFAAGMNGLAGPLHGRANQEVLEWLFKLREEVKGDYSP
                     ETIRQYLWDTLKGGRVIPGYGHAVLRKTDPRYTAQREFALRHFPDYDLFKLVSTVYEI
                     APKVLTEHGKTKNPWPNVDSHSGVLLQYYGLTEASFYTVLFGVSRAFGVLPQLIIDRA
                     VGAPIERPKSFSTEKFKELVASKASKA"
     gene            complement(346915..346986)
                     /locus_tag="AGOS_t0011"
                     /db_xref="GeneID:4618624"
     tRNA            complement(346915..346986)
                     /locus_tag="AGOS_t0011"
                     /product="tRNA-Pro"
                     /codon_recognized="CCU"
                     /db_xref="GeneID:4618624"
     gene            347736..347806
                     /locus_tag="AGOS_t0012"
                     /db_xref="GeneID:4618605"
     tRNA            347736..347806
                     /locus_tag="AGOS_t0012"
                     /product="tRNA-Gly"
                     /codon_recognized="GGC"
                     /db_xref="GeneID:4618605"
     gene            347919..347989
                     /locus_tag="AGOS_t0013"
                     /db_xref="GeneID:4618606"
     tRNA            347919..347989
                     /locus_tag="AGOS_t0013"
                     /product="tRNA-Gly"
                     /codon_recognized="GGC"
                     /db_xref="GeneID:4618606"
     gene            <348342..>349493
                     /locus_tag="AGOS_AAR005W"
                     /old_locus_tag="AAR005W"
                     /db_xref="GeneID:4618812"
     mRNA            <348342..>349493
                     /locus_tag="AGOS_AAR005W"
                     /old_locus_tag="AAR005W"
                     /product="AAR005Wp"
                     /transcript_id="NM_207899.1"
                     /db_xref="GeneID:4618812"
     CDS             348342..349493
                     /locus_tag="AGOS_AAR005W"
                     /old_locus_tag="AAR005W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR257W"
                     /codon_start=1
                     /product="AAR005Wp"
                     /protein_id="NP_982546.1"
                     /db_xref="GeneID:4618812"
                     /translation="MSARSSLQQRRLSAIQNAADYNIVPSQHEGHTYSVRKRKKSRFR
                     LWFKILPLFKKDQQEVVLSVASLETEQHTEQHNESTPNTLLKMARNTGEQTDLKNGLG
                     TSAPSLVGLSVRDIDDKENPDFVPEKKDVHPELSSQVLEKIHSQSNLSKSLEGNVSVD
                     DLNREGALLTDDNDVDLEQLISKKLDGITSLKMQLKNKRKQQAHPQQGSTARSSGSPC
                     SAGHHHISPENSNSNHSLVMSTDPIDDFISMGATSNSSLSDKHKEAEQPERIRNSYGE
                     WIPNKSHRPHLCRGDSYQKTITDVDERPGRSSQRASGSSAEYLRSLSRSMQRGSSLQR
                     SSGEQLDDKNATYTTNNYTIPQRDVEMAPLIIREDEEDQYKGNANARHL"
     gene            <349558..>352245
                     /locus_tag="AGOS_AAR006W"
                     /old_locus_tag="AAR006W"
                     /db_xref="GeneID:4618688"
     mRNA            <349558..>352245
                     /locus_tag="AGOS_AAR006W"
                     /old_locus_tag="AAR006W"
                     /product="AAR006Wp"
                     /transcript_id="NM_207900.2"
                     /db_xref="GeneID:4618688"
     CDS             349558..352245
                     /locus_tag="AGOS_AAR006W"
                     /old_locus_tag="AAR006W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR016C"
                     /codon_start=1
                     /product="AAR006Wp"
                     /protein_id="NP_982547.2"
                     /db_xref="GeneID:4618688"
                     /translation="MEEDILLALDFSTGNTEESLEAMLNEVKQATVRTAAGISAAKAA
                     RREGREAKRNIKKQPRGNAKTHLASETTSKRDADNLAKKESPKLQDVVVNKGAVVKES
                     LQGAKAPEDDKTAAVSEEHTAETIKAQPEAIDGPIASSTNIVIPHPVDVATDKAESAN
                     DNVGVPGKSTKGAKPVTVSGGSKDAVTVKGNNPAASKKSLQEANLTETTHLNLSEAAK
                     ESDDKARAQFGSDETGVLAEANISVSNLSTEGAETHVLEGTPSIHNRDAAPDLPLTES
                     GPKRAPALTTDPAVQPLHSKGGSISAREIEGGPITESSGGSTLEISRSTDTAAPAQET
                     PGSPHVTIEEAIKDKPLNSHASVDDGVLVGSESCKKTEACSDLEPPSAKADAITGGTD
                     ARNITTETATEGSVHSKSPVQGTDASKSVSATNLKQVTGLSDRSVATDSHVSPTIRSE
                     QNTTMEPSMKTIEKVPTAESKGSLEKVARNQTAVPKSAPVASSGSGSAEDNTTVASAK
                     PNRESREADPEDKTASSGLGTLPPIEVPGLESGKSNKPNATGTPAAGPVADGATVGKP
                     STLMPPQALSTTLQNASADGSAALGEKTNAVTDVTEDGARDDVFHPKGKKSDDAPKSG
                     FSSNPSAEPNHDVLGHKETRNDQGARACSGPTTEELSSCKQTESASAVSDSPKFQQKG
                     TADADETGNLLLTEKVPAVKGPDALVGQKSSKNHPAKEPGMSHARTSSPTAGAASKTS
                     PLSPRPNSPKLSAAHPNSAEPAAAPAAKHDITKEIDDFMLELGLTDDSATKLLATLDA
                     ESSRDLRGKPVYLLTSLAGGGFHMPSRTNRLATILTANQIDFQYRDCGSDDAARTHWK
                     RQGRGRSLPAIMVGDAVVGNWHEFDEANEEWKVRQLCGL"
     gene            <353413..>355527
                     /locus_tag="AGOS_AAR007W"
                     /old_locus_tag="AAR007W"
                     /db_xref="GeneID:4618679"
     mRNA            <353413..>355527
                     /locus_tag="AGOS_AAR007W"
                     /old_locus_tag="AAR007W"
                     /product="AAR007Wp"
                     /transcript_id="NM_207901.1"
                     /db_xref="GeneID:4618679"
     CDS             353413..355527
                     /locus_tag="AGOS_AAR007W"
                     /old_locus_tag="AAR007W"
                     /note="NOHBY105; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F23111g"
                     /codon_start=1
                     /product="AAR007Wp"
                     /protein_id="NP_982548.1"
                     /db_xref="GeneID:4618679"
                     /translation="MAISAIAKDITRFTLQNVNDVISFKPHLCHEVPARHYDMLRQEY
                     ISYTGTSIRKNKCKLFYLPTNVSDELHIMKQLSPDIGMGSGHGGAVQEHCGVKMENNG
                     AWAPEKNGGYGGNSRTVYYKKRLITELDYENVKRVEKACMLIAYAAVNQCLHIETSDG
                     KSSGGLPYSRSAGDDDDEERDHGPGSGEEYCEECARKSLERGEMLGFRELGYLINITP
                     WHFHRVFKVLAGLTIREYGQLCCDFLKGQEDVLFRVRDRVTLLRECGHSFSCLDDEEF
                     MGEDVSAITSLDCGSLEDESEEASVVVLPDYFIDPNKSKELKKKLKEQKSNGTTSDHG
                     NRIELRKRRYSLMSHRIMKASASSIKNNPTIMDCLENCTITRDEYERRQSQRYLQRSK
                     LKKRGKKPTQLAAVRKPPYHRRTSSESHGILKNAVMDQSTVADMMAAAEQESQDCISH
                     EESLPIFQGPPSGRQLDTSSASSTSASSSALPPSYDYDQDSQSLGHFSSPTQSVLDFK
                     FPPAMATGHQTPDLNSVLNSTTPVPPQTVASAGTSVSSGASSALAVGASAPDPFAGDS
                     YKYSLGVGLSSMGTSDSAMLPGAGPAAGGMFYDPLVMPTFPAAASDFDAATIAAAPGT
                     PSQGGPANYNISSMVYSGLPLQQQPSQQQQQQLFDFGPLFGAPVASQAAPPYTGNPPA
                     LGTMEYLVSSSGGIFKDDEDGL"
     gene            <356281..>358392
                     /locus_tag="AGOS_AAR008W"
                     /old_locus_tag="AAR008W"
                     /db_xref="GeneID:4618816"
     mRNA            <356281..>358392
                     /locus_tag="AGOS_AAR008W"
                     /old_locus_tag="AAR008W"
                     /product="AAR008Wp"
                     /transcript_id="NM_207902.2"
                     /db_xref="GeneID:4618816"
     CDS             356281..358392
                     /locus_tag="AGOS_AAR008W"
                     /old_locus_tag="AAR008W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR258W (GSY2) and YFR015C (GSY1)"
                     /codon_start=1
                     /product="AAR008Wp"
                     /protein_id="NP_982549.2"
                     /db_xref="GeneID:4618816"
                     /translation="MTRDIQNHLLFETATEVANKVGGIYSVLKSKAPVTCAQYKDHYH
                     CIGPLNPDSVQIEVEALDWEDDSVWSREMLPVKRSLQHMRERGVNFVYGRWLVEGAPR
                     VILFDLVSVTHHLNEWKADLWNSCGIPSPQDDQETNNSILLGYTVAWFLGELTAQDQQ
                     HAIVAHFHEWLAGVALPLCRKRRIDVVTIFTTHATLLGRHLCAGNADFYNNLDKFDVD
                     AEAGKRGIYHCYCIERAAAHTADVFTTVSQITAYESEHLLKRKADGILPNGLNVIKFQ
                     TVHEFQNLHALKKERIHDFVRGHFHWNYDFDLDKTLYFFIAGRYEYRNKGADMFIEAL
                     ARLNYRLKAAGSKMTVIAFIIMPAKTRSYTVEALKGQAVVKALESTVKDVTTSIGHRL
                     FEHAMRYPRSGKSEIPTDLGELLKPSDTVLLKKRVFALRRPESSLPPIVTHNMVDDAS
                     DPILNQIRRVQLFNNSSDRVKIIFHPEFLNANNPILSLDYDEFVRGCHLGVFPSYYEP
                     WGYTPAECTVMGVPSITTNLSGFGAYMEDLIERDQAKDYGIYIVDRRFKNPDESVEQL
                     VDYLDDFCKKTRRQRINQRNRTERLSDLLDWRRMGLEYVKARQLALRRAYPEEFRALV
                     GEDLDDHDMDSLAGGQKFKVARPLSVPGSPRDRSSSMSAILMTPGDLGTLQDANNAND
                     YFHLSMQTDDDEEGEDGREDD"
     gene            <358930..>360291
                     /locus_tag="AGOS_AAR009W"
                     /old_locus_tag="AAR009W"
                     /db_xref="GeneID:4618501"
     mRNA            <358930..>360291
                     /locus_tag="AGOS_AAR009W"
                     /old_locus_tag="AAR009W"
                     /product="AAR009Wp"
                     /transcript_id="NM_207903.1"
                     /db_xref="GeneID:4618501"
     CDS             358930..360291
                     /locus_tag="AGOS_AAR009W"
                     /old_locus_tag="AAR009W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL016C (CMK2) and YFR014C (CMK1)"
                     /codon_start=1
                     /product="AAR009Wp"
                     /protein_id="NP_982550.1"
                     /db_xref="GeneID:4618501"
                     /translation="MAVFTSSTGKLGKGVGEHDEDASKPQDRPPSQANMLTKFFHKVT
                     GQPASYVNKADYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYD
                     ELSILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVV
                     QMLTAVEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAG
                     SMGYVAPEVLTTSGHGKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVT
                     FHSPYWNNISKEAKQFILRALTLTPARRPTAAELLTDRWIVSKQSNTADLLPTIREGF
                     NASKKFRDAMQVVILNNRIKKLKQMYGHDESDTDLEENSASTDRRKVGLEVLQNALRS
                     LSLKGSQESPEQKQLKSQVTQQAFVQLVLAAKENKERIREYQSQQSLDSVAAHQNTTD
                     APQ"
     gene            <360805..>361731
                     /locus_tag="AGOS_AAR010W"
                     /old_locus_tag="AAR010W"
                     /db_xref="GeneID:4618665"
     mRNA            <360805..>361731
                     /locus_tag="AGOS_AAR010W"
                     /old_locus_tag="AAR010W"
                     /product="AAR010Wp"
                     /transcript_id="NM_207904.1"
                     /db_xref="GeneID:4618665"
     CDS             360805..361731
                     /locus_tag="AGOS_AAR010W"
                     /old_locus_tag="AAR010W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR017C (MET28)"
                     /codon_start=1
                     /product="AAR010Wp"
                     /protein_id="NP_982551.1"
                     /db_xref="GeneID:4618665"
                     /translation="MSSSVYERPAKQGAEDTEELAPLSPEAYRLKYKGIYSRLISDIW
                     DDAPETAESLGMADSSSQPWSAGDVRNTDSPGAKARAATADVTDKAEGQGGGDDSFEK
                     RPLSSVTLNLSDERQLSMQLQDLIANNSDLGTRLLSLLLVSSGNAVEIISRINSKDRD
                     LSSLDTLRLLKPSSQSPRLSGKEFPSSDADGDRMANRTTCTSIGTNSTTAAKNKDEEE
                     LLKLQLEKRRRNTEASARFRIRKKLREQEKLGKLKQLNGEISSMYKRIDELMEENRYW
                     KRRLDELNERKSKERLDTIRRRNQAARSDGDR"
     gene            complement(<362115..>364358)
                     /locus_tag="AGOS_AAR011C"
                     /old_locus_tag="AAR011C"
                     /db_xref="GeneID:4618809"
     mRNA            complement(<362115..>364358)
                     /locus_tag="AGOS_AAR011C"
                     /old_locus_tag="AAR011C"
                     /product="AAR011Cp"
                     /transcript_id="NM_207905.1"
                     /db_xref="GeneID:4618809"
     CDS             complement(362115..364358)
                     /locus_tag="AGOS_AAR011C"
                     /old_locus_tag="AAR011C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL036W and YIR016W"
                     /codon_start=1
                     /product="AAR011Cp"
                     /protein_id="NP_982552.1"
                     /db_xref="GeneID:4618809"
                     /translation="MSNTLQDIKEEDGEYGLAAAGQAAAGARGEEALLPPLPDIHGVG
                     QAFAEPGGVAAGEGYAGGSGSLLQLDGGALGEAAPLGTPIPFAGSFTTASSPSVIATE
                     SLAVYPDSSFDLSKALEIPTHEHGGNGGLLVAELEGGSAPGSTPMSPLVSAPMASLKR
                     KISFTFNPGAALGSDSMQALPASVAAQQPLDSPLQKTNTKSSTSISRSNSVTGGRTSR
                     SSSNAAHNMLLPTLNTTIESSEESGHQVILEIKRPARKFSVGSHSSSSVSILNNTSNN
                     SSSSSTNVNNHSIGINNSRNSTSTTVEENIYKAHPWIGGRKRSSSNLNTSQRDSSGNL
                     VTSASAVTLISKKTPLLRRASSMILRKATSKRDVHQPEAASVPSSPQVGQFIDFASGD
                     SKSPSHGRSLKPTRSRMILSLRGALSPTSSEFDTDQSSLAPTMVNATNIMTPMTSPLT
                     SITSPLTSSEQPSFGSKVKRGFSRIISGGNTRRHIQPTSVNEATLSPRASFQKSTNII
                     YRGAQMESLQSNCSTDSCPKNSLDGSEYKLPYENGGISQSCVRRSLSAKRALYVGNCR
                     GQSSMIKRQNSQVSTIPGGSSEKETSSELLPSSSTIRRQNSLRSTNTQLTETGEVEVT
                     VDVDEIVKSLPTITITENFGAKNTTPIQIQSNILLDRAYVLESDRPSGIGKNYKPSRI
                     TLKEYIAILMNQQMIEDERFEVLEKTFATSGWCSQKDVLNLRSKRVVINRKWAERISY
                     YQSKLEV"
     gene            complement(<364888..>365710)
                     /locus_tag="AGOS_AAR012C"
                     /old_locus_tag="AAR012C"
                     /db_xref="GeneID:4618714"
     mRNA            complement(join(<364888..365608,365676..>365710))
                     /locus_tag="AGOS_AAR012C"
                     /old_locus_tag="AAR012C"
                     /product="AAR012Cp"
                     /transcript_id="NM_207906.1"
                     /db_xref="GeneID:4618714"
     CDS             complement(join(364888..365608,365676..365710))
                     /locus_tag="AGOS_AAR012C"
                     /old_locus_tag="AAR012C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL038W (PRE6); 1-intron"
                     /codon_start=1
                     /product="AAR012Cp"
                     /protein_id="NP_982553.1"
                     /db_xref="GeneID:4618714"
                     /translation="MSGYDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVL
                     GCERRSTLKLQDPRITPSKISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLED
                     PVTVEYMTRYIAGVQQRYTQSGGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWA
                     AQAIGRNSKTVREFLEKNYSKHTPPASEQDCVKLTVKSLLEVVQTGAKNIEITVVRPD
                     ARIVTLTTAEISRYVDEIEREKQQELEKKKNGD"
     gene            <365968..>366435
                     /locus_tag="AGOS_AAR013W"
                     /old_locus_tag="AAR013W"
                     /db_xref="GeneID:4618805"
     mRNA            <365968..>366435
                     /locus_tag="AGOS_AAR013W"
                     /old_locus_tag="AAR013W"
                     /product="AAR013Wp"
                     /transcript_id="NM_207907.2"
                     /db_xref="GeneID:4618805"
     CDS             365968..366435
                     /locus_tag="AGOS_AAR013W"
                     /old_locus_tag="AAR013W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL026C (MIM1); Newly annotated start codon according to
                     experimentaly determined 5' end of mRNA using 5' RACE"
                     /codon_start=1
                     /product="AAR013Wp"
                     /protein_id="NP_982554.2"
                     /db_xref="GeneID:4618805"
                     /translation="MAEEILGNIAEEAHAALLASAGDEATKKSGAIRLPIEDSLDGDF
                     GSRGTAYTDLSTTTSAGTSGQLVERTGGISFGRLLSVAGSCSINLLLPFLNGLMLGFG
                     ELLAHELSWKFSWFDKERNRGYRIYPEVRKAAELQERERQRALSRAAGPDGFL"
     gene            complement(<366511..>366981)
                     /locus_tag="AGOS_AAR014C"
                     /old_locus_tag="AAR014C"
                     /db_xref="GeneID:4618457"
     mRNA            complement(<366511..>366981)
                     /locus_tag="AGOS_AAR014C"
                     /old_locus_tag="AAR014C"
                     /product="AAR014Cp"
                     /transcript_id="NM_207908.1"
                     /db_xref="GeneID:4618457"
     CDS             complement(366511..366981)
                     /locus_tag="AGOS_AAR014C"
                     /old_locus_tag="AAR014C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR015W (RPR2)"
                     /codon_start=1
                     /product="AAR014Cp"
                     /protein_id="NP_982555.1"
                     /db_xref="GeneID:4618457"
                     /translation="MAKKDKRQSPQTRVDDDGVLQIAPPRTVGNKEQLQRANYLLQLA
                     ALHTMQNKSDQWQALPRAYLGTLDLIQKKTKIALTPALKRTVCKGCRRLLVPYRTVTS
                     RVQNESRLGRENPRGDVLVQTCLCGRAKRFPFGKDTSYKTYTERDGTLLDMSGT"
     gene            complement(<367092..>367778)
                     /locus_tag="AGOS_AAR015C"
                     /old_locus_tag="AAR015C"
                     /db_xref="GeneID:4618425"
     mRNA            complement(<367092..>367778)
                     /locus_tag="AGOS_AAR015C"
                     /old_locus_tag="AAR015C"
                     /product="AAR015Cp"
                     /transcript_id="NM_207909.1"
                     /db_xref="GeneID:4618425"
     CDS             complement(367092..367778)
                     /locus_tag="AGOS_AAR015C"
                     /old_locus_tag="AAR015C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR014W"
                     /codon_start=1
                     /product="AAR015Cp"
                     /protein_id="NP_982556.1"
                     /db_xref="GeneID:4618425"
                     /translation="MKEEPLFLRHLLTVTYILVFLRFLRDQSLLNALLAVQVVSLTKF
                     TANILSTYFDADTPPESAPALKKLLAKALYVLQLFFVLQTAHTLAYHAMLDLDADVCR
                     WVYGYLFTDLLGEFDCKSRGRSMLFVLDALLLLCQLQLATCRLVLLKDGRRVTIEHFS
                     VEEHGILSILMIQAFRLRASDWEIAITTPLRSCGEASGRSAGRSTVSSGEDASDVSQG
                     NSTAYYGSTQ"
     gene            complement(368335..368407)
                     /locus_tag="AGOS_t0014"
                     /db_xref="GeneID:4618554"
     tRNA            complement(368335..368407)
                     /locus_tag="AGOS_t0014"
                     /product="tRNA-Ala"
                     /codon_recognized="GCU"
                     /db_xref="GeneID:4618554"
     gene            <368864..>370444
                     /locus_tag="AGOS_AAR016W"
                     /old_locus_tag="AAR016W"
                     /db_xref="GeneID:4618802"
     mRNA            <368864..>370444
                     /locus_tag="AGOS_AAR016W"
                     /old_locus_tag="AAR016W"
                     /product="AAR016Wp"
                     /transcript_id="NM_207910.1"
                     /db_xref="GeneID:4618802"
     CDS             368864..370444
                     /locus_tag="AGOS_AAR016W"
                     /old_locus_tag="AAR016W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL027C (MDM38)"
                     /codon_start=1
                     /product="AAR016Wp"
                     /protein_id="NP_982557.1"
                     /db_xref="GeneID:4618802"
                     /translation="MLVRRVLVPGIGLQGSAARARMGHIAAAGVWRAPQPQSPCELGS
                     MSFVRRLHDDRKVSDLPKKQDSEDKPKVPKKSAKDPLWARVKHEVRHYVNGTKLLGYE
                     LKISFKLLVKFAKGYELSRRETNQLKRSMGDVFRLVPFSAFLIIPFAELLLPFALKLF
                     PNMLPSTYVSGTERQQKRVKLEEVRRKTSNFLQETLEESSLINYNSVEGSEKRKKFLS
                     FFQKVNSPKDGKTSVFTHEEILSISKMFKNDTVLDNLSRPQLVAMAKYMSLRPFGTDN
                     MLRYQIRYKLKSIMEDDKKIDYEGVESLSTEELYSAAASRGIKAFGVSREDLVDKMNV
                     WLELRLRQRIPSVLLILSSAYTFEGAKNESANQISLETATGLSEKLAKPLDIYYDAIL
                     QVLSSIPDPVYNVAKLDVSESKEQKVAAPVADESTAKAYEGAKSVEHQDATEGILATQ
                     LTAEQPEVEEEYIPSTDDNEFKLNVLKEQEEMIKKEEEEAKLRSSSNIVDDITLDEDE
                     DGSKSDKQHSPAKPERKS"
     gene            371215..371286
                     /locus_tag="AGOS_t0015"
                     /db_xref="GeneID:4618463"
     tRNA            371215..371286
                     /locus_tag="AGOS_t0015"
                     /product="tRNA-Glu"
                     /codon_recognized="GAA"
                     /db_xref="GeneID:4618463"
     gene            <371470..>373704
                     /locus_tag="AGOS_AAR017W"
                     /old_locus_tag="AAR017W"
                     /db_xref="GeneID:4618596"
     mRNA            <371470..>373704
                     /locus_tag="AGOS_AAR017W"
                     /old_locus_tag="AAR017W"
                     /product="AAR017Wp"
                     /transcript_id="NM_207911.1"
                     /db_xref="GeneID:4618596"
     CDS             371470..373704
                     /locus_tag="AGOS_AAR017W"
                     /old_locus_tag="AAR017W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR007W"
                     /codon_start=1
                     /product="AAR017Wp"
                     /protein_id="NP_982558.1"
                     /db_xref="GeneID:4618596"
                     /translation="MLGKIYISQQGEFTDYEGNVVQLRGVNLDPSVKFPQQPRIPTNM
                     PVDDEFWDGATNVSFVNERLDPKEIEEHMIRLKALGYNCIRYLFTWEALEHGGPGIYD
                     EEYMKYTVMVLKKIKEAGGMYVYLDPHQDVWSRFSGGSGAPLWTLHCAGFQPKRFLAT
                     EAAILHNYYIDSETQAEKAQYPEMIWSTNYYRLACQTMFTLFFSGKLFAPKCVINGRN
                     IQDYLQGHFLKAVMTFYKYIQDNAPELFEENCIIGLETMNEPNCGYLDHPNLRELPRD
                     RQLMKGTTPTAYQSFILGEGFACNIDSYDISLIGARKIGKSFVDPKGKSAWLDATERL
                     ELDRAYGWTRPDDWAPGCIWRLHGVWDIESKSSKPVLLLPGYFSKCPSTGEETSMSYF
                     TNKLFLDFYVRYRNQYRELDPDSLLFLEPPVLQEPPYLIGSDIIDKRTVYACHFYDGM
                     SLMFKSWNRRYNVDTFGFMRGKYLSPIFGLVFGEANIKRCFRRQLRAMKLEGRRFLGD
                     SVPIFFTEIGMPYDMEGKKAYRDHDYSSQIGANDALGFALEGSNMSFSLWCYTYINNT
                     TWGDNWNREDFSIWNKEYAMKVPRDVVVKTGDAMPNSSINTIVGAESHLTCESRLSDD
                     ALVLDYSGFRALDAILRPYPVKIHGSFSTAEFDLERKRYFLEIIARTETEGTTSIFLP
                     YYHFPPESTVVSSSSGYYVREQDNNQLLKWCHGGGRQYISIEVTGMGSSYSVQSADSS
                     CVIM"
     gene            <373860..>375170
                     /locus_tag="AGOS_AAR018W"
                     /old_locus_tag="AAR018W"
                     /db_xref="GeneID:4618468"
     mRNA            <373860..>375170
                     /locus_tag="AGOS_AAR018W"
                     /old_locus_tag="AAR018W"
                     /product="AAR018Wp"
                     /transcript_id="NM_207912.1"
                     /db_xref="GeneID:4618468"
     CDS             373860..375170
                     /locus_tag="AGOS_AAR018W"
                     /old_locus_tag="AAR018W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR008C (PRI1)"
                     /codon_start=1
                     /product="AAR018Wp"
                     /protein_id="NP_982559.1"
                     /db_xref="GeneID:4618468"
                     /translation="MSSPEEGSQTSIRTSQADSQSVASTAASSVPASGNGGPSMSDMQ
                     YYYQYLYPFRPIFHWLNHSPKPQRDMVNRELAMAFRSGAYKRYNSFGSVQEFKQQIQK
                     ANPDRFEIGAVYNKPPRDRDSVLKTEMKPLEKELVFDIDMDDYDDFRTCCSGAQVCDK
                     CWKFIFLAMKVMNTSLIEDFGLEQFIWVFSGRRGAHCWISDPRARSLSDMQRKSVLDY
                     MNVVRDRNLEKRISFTRPYHPHLARSLNILKPYFVDFILREQDPWQDDSAAVRLLLPA
                     IQDAQLADQLKKYWKENPGRSSEEKWKDIDLLASGMTKQAKRPDYVARLREAKEDLIL
                     AILYPKLDVEVTKQTIHLLKAPFCIHPATGNVCVPITEDFSPTGVPKLIQLQHEMESN
                     GNKVEQTSLQPYIDAFSKHVSAIVKAELAFRKRNHPEGEDIPEF"
     gene            <375402..>375989
                     /locus_tag="AGOS_AAR019W"
                     /old_locus_tag="AAR019W"
                     /db_xref="GeneID:4618708"
     mRNA            <375402..>375989
                     /locus_tag="AGOS_AAR019W"
                     /old_locus_tag="AAR019W"
                     /product="AAR019Wp"
                     /transcript_id="NM_207913.2"
                     /db_xref="GeneID:4618708"
     CDS             375402..375989
                     /locus_tag="AGOS_AAR019W"
                     /old_locus_tag="AAR019W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER012W (PRE1)"
                     /codon_start=1
                     /product="AAR019Wp"
                     /protein_id="NP_982560.1"
                     /db_xref="GeneID:4618708"
                     /translation="MDIILGIRVQDSVILATSKAVTRGISVLKADDDKTRQLSPHSLM
                     SFSGEPGDAVQFSEYIQANMQLYMIRENYELSPQAQASYVRSELAKSLRSRKPFQVNV
                     LIGGYDTRAEKPELYQIDYLGTKVELPYAAHGYSGFYTFSLLDHHYRPDMTTEEGLKL
                     LKLCVEELQRRMPIDFKGVLVKVVDKDGIRDVEDF"
     gene            <376231..>379566
                     /locus_tag="AGOS_AAR020W"
                     /old_locus_tag="AAR020W"
                     /db_xref="GeneID:4618788"
     mRNA            <376231..>379566
                     /locus_tag="AGOS_AAR020W"
                     /old_locus_tag="AAR020W"
                     /product="AAR020Wp"
                     /transcript_id="NM_207914.2"
                     /db_xref="GeneID:4618788"
     CDS             376231..379566
                     /locus_tag="AGOS_AAR020W"
                     /old_locus_tag="AAR020W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER013W (PRP22)"
                     /codon_start=1
                     /product="AAR020Wp"
                     /protein_id="NP_982561.2"
                     /db_xref="GeneID:4618788"
                     /translation="MSAVEKEILRILDIDDTVVSEFVLNIYAQSDDIQSFKKQLLDLD
                     VGIDEARTDELYCCIEKHKGQIPGDGDASGTTNELQQLLKAELGVDDPVVAEYVADIY
                     SKHKSLTKFHEKLSEIDSGLSSASIFKIHKLLRQTCPTGEKTEAPKADVSALCLPNRE
                     ARWDDIRGEGFMEPELDVTPIEGKIYRAVIRNIKPFGCFARVLGTKRSCEGLIHISQL
                     SHSRVGSPNDVVSVGDHVYVKITKVQDNGKLSLSMREVDQATGQTATVNRGRSDERTV
                     YRRQLSSPERWEIRQMIQSGVSSIDDYPELKEELSHLQQQTQVAGSKHSNESDELIDV
                     ELNTEHEPKFLSGHTATAKKPELPTIVKLPKGSLNNTAMTGSKLLQEHRQEKLALQKS
                     TDKKERLLRELDDSGHKKKAFEDKQRALTAWERKRMAEKVTYGKRTNLSIKQQRESLP
                     VFKMRETLVSAIRDNQFLVIVGETGSGKTTQITQYLDEEGFSVGGMIGCTQPRRVAAV
                     SVAKRVSEEMGCKLGEDVGYTIRFEDQTSRKTRIKYMTDGMLQVEALLDPTMSRYSVI
                     MLDEAHERTVSTDVLFSLLKQAALKRPDLRVIVTSATLDSEKFSKYFLDCPVIKISGK
                     TFPVDVIYSETPQLDYIEAALDTVMEIHINESPGDILVFLTGQEEIDACCEILYERVQ
                     ALKETIQELLILPVYSALPSEVQSKIFEPTPKGSRKVIFATNIAETSITIDGIYYVVD
                     PGYAKLNIYNPKIGIEQLVVSPISQSQADQRKGRAGRTGPGKCYRLFTEAAFHREMVP
                     NSVPEIQRQNLEHTILMLKAMGINDLLNFDFMDPPPRSSMVHALEALYNLQALDEDGY
                     LTQLGKRMSQFPMEPALSKSLIASVEQGCSDEILTIIAMLSVQNVFYRPKDKIQEADN
                     RKARFHHPFGDHLTLLNIYNRWQENNFSKSFCAENFLHERHLRRAKDVKEQLKRIFKN
                     LDLPIRSCHGNVDLIRKTLVSGFFRNAAKRDPQVGYKTIVDETAVSIHPSSCLFGKEC
                     DYVIYHSLVLTSKEYMSQVTLIDPKWLMENAPHFYKLSDPSGEKQKRLKIVPLHNRFS
                     KDQDSWRLSSIRQSKERALGIKR"
     gene            <379870..>381441
                     /locus_tag="AGOS_AAR021W"
                     /old_locus_tag="AAR021W"
                     /db_xref="GeneID:4618485"
     mRNA            <379870..>381441
                     /locus_tag="AGOS_AAR021W"
                     /old_locus_tag="AAR021W"
                     /product="AAR021Wp"
                     /transcript_id="NM_207915.2"
                     /db_xref="GeneID:4618485"
     CDS             379870..381441
                     /locus_tag="AGOS_AAR021W"
                     /old_locus_tag="AAR021W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER014W (HEM14)"
                     /codon_start=1
                     /product="AAR021Wp"
                     /protein_id="NP_982562.2"
                     /db_xref="GeneID:4618485"
                     /translation="MPVPASVLQAGSKVLVVGGGIGGLSYAYFLSRLRPDIKVKLLET
                     RQNCRGSIVSKPTSLPDGSVVNLEKGPRTLRGVSDSAVIIMDLVRQLGESQSIYGIAK
                     DSPANRKFLLDHKGELLQLPNSWKTFRKFMQNPLSDGLVRGILGEPFRRTRPESSADE
                     SAFDLFVRRFGNAQVPNNLLSSLFHGIYGDDIQLLSAQRIARRFYEMEQEHSSFIRAG
                     ISGIFKKPALSLSLDKYQETFGRDKEELLQLKKTLSQFPILGFKGGMEFLPRLILKEL
                     SGMPNVEICTGKLVSAVSPAKDGKIEVVAKDGTRYTGIDHVRLAVSPMSIKRMLSEQS
                     ISSHLERASANTIAVVNFYLPKKDVIADYHSFGYLAPISIPNPHKLLGVIFDSVVERS
                     YTPLFAPSTDRFAQGQYTKMTAMMGGHYFSQQDLQNPPSEDGIIQNIKNVFKRHLHIS
                     EADLAAAHWSVTLAKNCIPHFHVGYNQWETVLRGKIQSEYGHRISLGGMAFSSGPGVP
                     DVFMNGFLDAVSMAK"
     gene            <381732..>382076
                     /locus_tag="AGOS_AAR022W"
                     /old_locus_tag="AAR022W"
                     /db_xref="GeneID:4618732"
     mRNA            <381732..>382076
                     /locus_tag="AGOS_AAR022W"
                     /old_locus_tag="AAR022W"
                     /product="AAR022Wp"
                     /transcript_id="NM_207916.1"
                     /db_xref="GeneID:4618732"
     CDS             381732..382076
                     /locus_tag="AGOS_AAR022W"
                     /old_locus_tag="AAR022W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR009W (MSL1)"
                     /codon_start=1
                     /product="AAR022Wp"
                     /protein_id="NP_982563.1"
                     /db_xref="GeneID:4618732"
                     /translation="MTEEPVTKKKRVEGRDGVRPSPTADEPGMPRSTLYISNLNDQVK
                     ISTLRTNLYLLFSTFGEVLRIAMSPKLRGQAFVVLSTVDEANLAMISLKDESFFGKPL
                     RIQFSKSDMKEV"
     gene            complement(<383019..>383981)
                     /locus_tag="AGOS_AAR023C"
                     /old_locus_tag="AAR023C"
                     /db_xref="GeneID:4618801"
     mRNA            complement(<383019..>383981)
                     /locus_tag="AGOS_AAR023C"
                     /old_locus_tag="AAR023C"
                     /product="AAR023Cp"
                     /transcript_id="NM_207917.1"
                     /db_xref="GeneID:4618801"
     CDS             complement(383019..383981)
                     /locus_tag="AGOS_AAR023C"
                     /old_locus_tag="AAR023C"
                     /note="NOHBY106; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0F03938g"
                     /codon_start=1
                     /product="AAR023Cp"
                     /protein_id="NP_982564.1"
                     /db_xref="GeneID:4618801"
                     /translation="MALSNEVSPLDITSTNIKHVNRMFQEMEVRMAHLQRQVDSLRVR
                     VRREHTKRKRLELRLVSRFGELARRVAESGSSAEEEDEGVGPLGRPLDMFEDMLRERD
                     AGGSEREGERLPRRRGGMLDGLMGAQEELAGEAPGQVLVDTQHPHEDLAALINDALNG
                     CNGSKRRSLSNEFAARRRQPSVGSQTRLPIFPIKPAAPSAALETSRRYDEEDIKLKYG
                     VSFSEKYSKVSEIWNDYVKASDKGISIRSLEASFSNKWRANMKKSVKKKYNRRLIVVR
                     AIETGIKRGRTQEECIEILDAFLRQNNKTVSHFYKKSNLPKELV"
     gene            <384192..>385160
                     /locus_tag="AGOS_AAR024W"
                     /old_locus_tag="AAR024W"
                     /db_xref="GeneID:4618778"
     mRNA            <384192..>385160
                     /locus_tag="AGOS_AAR024W"
                     /old_locus_tag="AAR024W"
                     /product="AAR024Wp"
                     /transcript_id="NM_207918.1"
                     /db_xref="GeneID:4618778"
     CDS             384192..385160
                     /locus_tag="AGOS_AAR024W"
                     /old_locus_tag="AAR024W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER016W (BIM1)"
                     /codon_start=1
                     /product="AAR024Wp"
                     /protein_id="NP_982565.1"
                     /db_xref="GeneID:4618778"
                     /translation="MSGMGESRTELLGWLNDLLRLDYTKVEQCGTGAAYCQIMDSIYG
                     DLPMHRVKFDARAEYESLTNFKILQSCFTKHKIEKTVFVDRLIKCRFQDNLEFLQWMR
                     RFWIQNKDESPYDPESRRKSVRPVSMRAPAQAPPSHAPKRRSLATFAATGTAAAPRPL
                     QKARAAAGGAGGAVATRVPSGGAPARGTATAGAGEQVAALQGELSAAEHKINKLTQEM
                     VQYQDAMSLMERERDFYFGKLRDIEILVQSTQDLFKEGVYNDDPQELNRLLGKVSQIL
                     YSTEEGFEVANGADGNEEYDVEAGTRMENCVEGQVLHNLITDDETF"
     gene            complement(<385305..>387485)
                     /locus_tag="AGOS_AAR025C"
                     /old_locus_tag="AAR025C"
                     /db_xref="GeneID:4618406"
     mRNA            complement(<385305..>387485)
                     /locus_tag="AGOS_AAR025C"
                     /old_locus_tag="AAR025C"
                     /product="AAR025Cp"
                     /transcript_id="NM_207919.2"
                     /db_xref="GeneID:4618406"
     CDS             complement(385305..387485)
                     /locus_tag="AGOS_AAR025C"
                     /old_locus_tag="AAR025C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER017C (AFG3)"
                     /codon_start=1
                     /product="AAR025Cp"
                     /protein_id="NP_982566.2"
                     /db_xref="GeneID:4618406"
                     /translation="MRAMWSQGRWAGALRPALRRGLHGGPRAQFQRTALARAPAGGRG
                     DDGRNDKDDKNKKDEEPGSVGEYLRSKSFARTVCWTVGLSLAFELLSRSGEQPEEALT
                     MQDFKTRYLEKGLVKKLYVVNRQVVEAELLPQAGDGRGEAFGLGMRGPVVGFTIGSVD
                     IFEEQLDQAQDKLGIPQNERIPVTYVERTSVLQGVMPFLPTLLLLGLVYSMTRPRAGG
                     GPGGMGGQGGIFGVGKSRAKLFNQETGVKIKFKDVAGCDEAKMEIMEFVDFLKTPEKY
                     RALGAQIPRGAILSGPPGTGKTLLAKATAGEAGVPFLSVSGSEFVEMFVGVGASRVRD
                     LFENARKMAPAIIFVDEIDAIGKARGKGGEMGGSNDEREATLNQLLVEMDGFTSRDQI
                     VVIAGTNRPDVLDPALLRPGRFDRHIQVDAPDVEGRKAIYKVHLSKLNLDPSLKTTPD
                     TLDNFAGKLAALTPGFAGADISNACNEAALIAARHNDAFVEFRHFDQAIERVIAGLEK
                     KSRVLNPEEKKTVAYHEAGHAICGWFLEHADPLLKVTIIPRGQGALGYAQYLPDEQYL
                     TSEERFRHRMIMALGGRVSEELHFRYVTSGAHDDFKKVTGMARSMVKSLGMSRKVGYV
                     AYEQDDNGGLVVRKPFSEKTARLIDLEVKRLVDEAHASCKQLLTEHLAEVDKVAKLLL
                     DKEVLTREDMIHLLGPRPFPEKHESFEKYLDPKKPASGESQPAT"
     gene            <388801..>389811
                     /locus_tag="AGOS_AAR026W"
                     /old_locus_tag="AAR026W"
                     /db_xref="GeneID:4618694"
     mRNA            <388801..>389811
                     /locus_tag="AGOS_AAR026W"
                     /old_locus_tag="AAR026W"
                     /product="AAR026Wp"
                     /transcript_id="NM_207920.2"
                     /db_xref="GeneID:4618694"
     CDS             388801..389811
                     /locus_tag="AGOS_AAR026W"
                     /old_locus_tag="AAR026W"
                     /note="NOHBY107; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B11495g"
                     /codon_start=1
                     /product="AAR026Wp"
                     /protein_id="NP_982567.2"
                     /db_xref="GeneID:4618694"
                     /translation="MDSNLRLPSISHILTQIPSEQAAGDGDGCAPAPRRRSGEEQRRP
                     LPPPGLQRAPEERAPKVLPAGPQSFSQCGAYRSAQVFPMVARSSGFAAPSVAYTAAEP
                     LRTGEYCAGTYAVHGEYTVPVSPLTPPSTASSSAALPPLAVLPQPASLHSAVLPPHTP
                     LPHAPRALPPAAAHARAPPPGLPPPLAAAQAAGTGSDREPDDDAELRCTCGQKYKHRK
                     SQRQCHIPRPRNAFILFRQHWHQQLFPQERIKQSERGNGSFKTNSQVSVDIGQRWRSL
                     SPEERQKWLDFAKREKEEHMRKYPNYKYVPTRKDKKVLIQGEGRNLASDPKSICRACA
                     RK"
     gene            <390019..>390969
                     /locus_tag="AGOS_AAR027W"
                     /old_locus_tag="AAR027W"
                     /db_xref="GeneID:4618772"
     mRNA            <390019..>390969
                     /locus_tag="AGOS_AAR027W"
                     /old_locus_tag="AAR027W"
                     /product="mitochondrial 37S ribosomal protein MRPS5"
                     /transcript_id="NM_207921.2"
                     /db_xref="GeneID:4618772"
     CDS             390019..390969
                     /locus_tag="AGOS_AAR027W"
                     /old_locus_tag="AAR027W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR251W (MRPS5)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS5"
                     /protein_id="NP_982568.2"
                     /db_xref="GeneID:4618772"
                     /translation="MLFLRRALSCAVPRRMAQDAMRPSTGTKDAYKSMLAQYYPQELL
                     KSIELGEQAIPDDAEYRLSSNVEFAPPYLDDFSKLDPFWDYKPGLPHQHADGPLTAFR
                     PDQQHQPLPERLEVPRGAALLTTGGSNMAAIARGIARQTGLDAEYITRKLVMRPLVVK
                     RVSNQTAKGKIASFYSLVVVGDRNGMVGLGEGKSREDVSESIKKAHWNAIKNLKHIPR
                     YENRTIFGDIDFRFHGVKLHLRSAKPGFGLRVNHVIYEICECAGIKDLSGKVYKSRNE
                     MNIAKGTLEALTKSQKTLEEIAYSRGKKLVDVRKVYYSSD"
     gene            <391164..>392294
                     /locus_tag="AGOS_AAR028W"
                     /old_locus_tag="AAR028W"
                     /db_xref="GeneID:4618414"
     mRNA            <391164..>392294
                     /locus_tag="AGOS_AAR028W"
                     /old_locus_tag="AAR028W"
                     /product="AAR028Wp"
                     /transcript_id="NM_207922.1"
                     /db_xref="GeneID:4618414"
     CDS             391164..392294
                     /locus_tag="AGOS_AAR028W"
                     /old_locus_tag="AAR028W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR112W (SHY1)"
                     /codon_start=1
                     /product="AAR028Wp"
                     /protein_id="NP_982569.1"
                     /db_xref="GeneID:4618414"
                     /translation="MLKFAGITPSLRRCAFQRHQLSLARYQVRGVKTSTVDWKPIHTS
                     KTPEDHERGDHPWARRFFLTLMCAIPVVSFYLGMWQLRRLKWKTELIAKCEDQLTYRP
                     VPLPQKFTPEMCEQWEYRRVVVKGAFRHEEEIFVGPRVRNGVKGYLLFTPFIRKDTGE
                     RLLIERGWVSEDRVLPTQRGLQHLSVPRGDNVEVVCLVRKALPKGRFQWDKTDEESRV
                     WQVADIPAMAAATGTLPVHLQAIEDFHNHHWPVADSDAAAAQSNGVRGTSWWKFWNTN
                     SGSTVSEKEGNAIPASTPVQSRQSDAIEYSEFQFMREGVPVGKVPAVELRNTHTQYML
                     TWFGLSFFSTLLLCFAIRGSRGSAVSQSQLKRSKLKHARKNT"
     gene            <392457..>393476
                     /locus_tag="AGOS_AAR029W"
                     /old_locus_tag="AAR029W"
                     /db_xref="GeneID:4618458"
     mRNA            <392457..>393476
                     /locus_tag="AGOS_AAR029W"
                     /old_locus_tag="AAR029W"
                     /product="AAR029Wp"
                     /transcript_id="NM_207923.2"
                     /db_xref="GeneID:4618458"
     CDS             392457..393476
                     /locus_tag="AGOS_AAR029W"
                     /old_locus_tag="AAR029W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR113W (DAM1)"
                     /codon_start=1
                     /product="AAR029Wp"
                     /protein_id="NP_982570.2"
                     /db_xref="GeneID:4618458"
                     /translation="MSKESVRESKAATEYRLSISSNPGSRRSSFGGSSEHPAGSGIGN
                     NKASNGELREATLVDTLLLPQVQELKDSMITLDANLTHMNFIHESLVDLNESVSALLY
                     GLMCNSWCVDFPNMPHHTARELGISKELARLKEEKQQLLADLQGTAQAPSLVLKEKEP
                     NTSKQKFQLPKPPMVSTRSVVAPVRTISEEEEDDNTAASFVSNPTVMGQPPHAPPPVA
                     RSNNAKGRRRYSILQQIRNHDLTGQKHMVANLGGTVKARAATHPIPESAGEKRKSLAV
                     SAVRIGNNKRLQTSRPPSGGRDVTMARKRSGTQPAILNTNSITHSSTGAVPASSAQGR
                     RPPFR"
     gene            <393761..>394720
                     /locus_tag="AGOS_AAR030W"
                     /old_locus_tag="AAR030W"
                     /db_xref="GeneID:4618466"
     mRNA            <393761..>394720
                     /locus_tag="AGOS_AAR030W"
                     /old_locus_tag="AAR030W"
                     /product="AAR030Wp"
                     /transcript_id="NM_207924.1"
                     /db_xref="GeneID:4618466"
     CDS             393761..394720
                     /locus_tag="AGOS_AAR030W"
                     /old_locus_tag="AAR030W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR124W (CTR1)"
                     /codon_start=1
                     /product="AAR030Wp"
                     /protein_id="NP_982571.1"
                     /db_xref="GeneID:4618466"
                     /translation="MGLESYLGHAMLKHHDADSMPTMTAADATSATEHAGHGSGSSGS
                     GGHGGSGSVHMMNMYLGNNYKGYPVLFKNLKADNGAEAFGIFVLIVVACFAYKSLLFI
                     SWCLEVKWFKNVGKSQPSADGSVGQGKESASAPADIYARDIEHQNPLFPTMPHFLFDI
                     FAPTWKELLQDLVRLVITFLSTLIVYLLMLVAMSYVLTFIFAIAFGLATAEVFYNRCK
                     LVLVRRWDLKRELEKRKGCPGSGNCSCGYHRPEENAVLDDTVSCSTMKDRSVSQADAD
                     CCCAPVAAMEKQQRQQREVSQIARQREENGDMNVDLMPAEKFK"
     gene            <395062..>399360
                     /locus_tag="AGOS_AAR031W"
                     /old_locus_tag="AAR031W"
                     /db_xref="GeneID:4618537"
     mRNA            <395062..>399360
                     /locus_tag="AGOS_AAR031W"
                     /old_locus_tag="AAR031W"
                     /product="AAR031Wp"
                     /transcript_id="NM_207925.2"
                     /db_xref="GeneID:4618537"
     CDS             395062..399360
                     /locus_tag="AGOS_AAR031W"
                     /old_locus_tag="AAR031W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR116W (SPT6)"
                     /codon_start=1
                     /product="AAR031Wp"
                     /protein_id="NP_982572.2"
                     /db_xref="GeneID:4618537"
                     /translation="MSSEGLASARELEERDLGATRDTEEIPSDEEEGEDVFDSSEEDE
                     DLDEDEEEARKVKEGFIVSDDEEDDSSVKQRRRRKHKRRPRHEEDDGKLSEDDLDLLM
                     ENAGVKRTTRPETDATKGRFKRLKRAGSPDESEGQQDTDGRHENRLEDFFSEEEDEEH
                     LGGTENRRLRTGGKDVLDELDDFIEEDEFSDEDEATRQQRRKLKEQRSKQSVQITGLS
                     SDKIDEMYDIFGDGHDYDWALAVENEDDLENLDEYQQEEDDDETSDQKAKKKKITLQD
                     IYDMQDLKKNLMTEEDMVIRRSDIPERYQELRAGLKNYGQLTPEDQLLEQNWISDKIA
                     VDKNFDATYDISEFREAVGDAVRFISKENLEVSFIYAYRRNYISSRDKNGFILSEDDL
                     WDIVFYDIEFHSIIYKRDYVKKFYEQLGIRDSLVDDYFNDESMTELNSLQDIYNYLEF
                     RYAHEINDALLADSSSKTKKHLKNSSYEKFKSSSLYQAVKDVGITAEQIGENIGAETQ
                     IHPVVDHPNLKPSESISQILDAASADLQVFAKNHKLAWDTVQKYFAAEIGNNPKVRQK
                     IRNDFYKYYIVDVVLTTKGRKEIQRSSPYEDIKYAINRTPGHFRSAPDVFLRMLEAES
                     LHLMNIKIHMSSQEQYCEHLFQIALETTNTSEIAIEWNNFRRNAFYQALEKIFEDIAQ
                     EIKDELKKTSQKLVANSVRHRFMSKLDQAPFIPNPREPKIPRVLTITCGQGRFGLDAI
                     IAVLLNRKGDFVKDFKIVQNPFDRDQPQAFEAVLDNIIQEAQPNVIGINGPNPKTQKL
                     FKKIQEVIQKKQIVDNRGHNIPVIFVEDEIAIRYQSSERGAQEFPNKPTLVKYCIALA
                     RYIHSPLLEYTNLSEEELQSLLIHPHQSLLPRHIFKRALETSFVDIVNLVGVEVNKAN
                     DNPYYAKALQYIAGLGKRKAIDFLESLQRLNEPLLARQQLITHDILHKTIFMNSAGFL
                     YISWNEKNQRYEDLEHDHLDSTRIHPEDYHLATKVAADALEYDPDAIREKEEQGAMSE
                     FIELLRDDPDRRMKLESLNLEEYADELERSTGQRKLNNLNTIVLELLEGFEELRNDFH
                     PLQGDEIFTSLTGETDKTFFKGSIIPVRVERFKHNDIICISNSQVECIVNAQRHLGVQ
                     LKRPASDIYEVGKTYPAKIIFIDYENISAEVSLLDHDVKHQYIPVDYSKDPTIWNLKQ
                     ELEDVEEEKKISMAEARAKRTHRVINHPYYFPFNGKQAEDYLRSKERGEFIIRQSSRG
                     DDHLAITWKLDKDLFQHVDILELDKENPLALGKTLIVDNNKYNDLDHVIVEYLQNKIK
                     LLNEITSNEKFKKGTKKEVVKFIEDYSNVNPNRSVYYLSFNYEHPGWFYLMFKINAQS
                     KLCTWNVKLTHNGFSLADYNYPTVIQLCNGFKTLLKSSSRARTQEASGSGYYGY"
     gene            <399751..>401079
                     /locus_tag="AGOS_AAR032W"
                     /old_locus_tag="AAR032W"
                     /db_xref="GeneID:4618693"
     mRNA            <399751..>401079
                     /locus_tag="AGOS_AAR032W"
                     /old_locus_tag="AAR032W"
                     /product="AAR032Wp"
                     /transcript_id="NM_207926.2"
                     /db_xref="GeneID:4618693"
     CDS             399751..401079
                     /locus_tag="AGOS_AAR032W"
                     /old_locus_tag="AAR032W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR125W (YLH47)"
                     /codon_start=1
                     /product="AAR032Wp"
                     /protein_id="NP_982573.2"
                     /db_xref="GeneID:4618693"
                     /translation="MSRILLATRPCKGVTPYALRPVLASRYNLISGRRLMATGPAPKS
                     DSKLPAKPASPAEAAPKPSLWSRVKHEAQHYWDGTKLLGLEVKISFKLVMKMSAGYEL
                     SRREMLQLKRTTTDVVRLVPFSAFVIIPFAELLLPIALKLFPNMLPSTYESKTDKQKK
                     LENLRKTRAVMSEIIKEKKSHFKPSDITESQKMIFNSFYKHVRETGEPESREQLIQVA
                     RLFSDDTVLDNLTRPHLVAIAKYINLQPFGTDVMLRYRIRYKMLQLKKDDFALFYEGV
                     DLLNSAELRTACASRGIRNLNVEDAVLRDNLNIWLNMRLKEKIPSTLLIMATAYTYGD
                     ISSQKTLYDALCDVLSGIPDELYHEVKVNVVEEDDATNKSKMAQLREQEEIMREEEQQ
                     EKDAVVKVRDQLRLDDLDEPAAAIPEPVADKEPTTGDATKDGKPPQHTAK"
     gene            <401399..>402424
                     /locus_tag="AGOS_AAR033W"
                     /old_locus_tag="AAR033W"
                     /db_xref="GeneID:4618499"
     mRNA            <401399..>402424
                     /locus_tag="AGOS_AAR033W"
                     /old_locus_tag="AAR033W"
                     /product="AAR033Wp"
                     /transcript_id="NM_207927.1"
                     /db_xref="GeneID:4618499"
     CDS             401399..402424
                     /locus_tag="AGOS_AAR033W"
                     /old_locus_tag="AAR033W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR127W"
                     /codon_start=1
                     /product="AAR033Wp"
                     /protein_id="NP_982574.1"
                     /db_xref="GeneID:4618499"
                     /translation="MTTTAAQLRKELCRSQTGYGLMGLTWRDVPSEPETAFECMRKAI
                     SCCKQGKILFNCGEFYGGDFLNLHYVRDFFRLHPARERVILCVKGAVDNATLQPVGDP
                     VSVRKSMDNCLREIGGYIDIFECARFDPKAVAPGELYPRASIEAVVEYVKAGKIGAIG
                     LSEVTAEQVRAISRDYGEYLACVEVEFSMLSRDILHNGLAQTCAELGIPILCYSPLAR
                     GLLTNAISTPDDVPAGDLRRLLARFGHDALANNLQAATFLQEHIIKPRAPPPPLPAVA
                     LAWIRSWSGTHKGTHFLPIPGATTPQRVEESLSICELTPEELDSINAFLEQFTAAGRR
                     DEFLARN"
     gene            <402682..>405978
                     /locus_tag="AGOS_AAR034W"
                     /old_locus_tag="AAR034W"
                     /db_xref="GeneID:4618432"
     mRNA            <402682..>405978
                     /locus_tag="AGOS_AAR034W"
                     /old_locus_tag="AAR034W"
                     /product="AAR034Wp"
                     /transcript_id="NM_207928.1"
                     /db_xref="GeneID:4618432"
     CDS             402682..405978
                     /locus_tag="AGOS_AAR034W"
                     /old_locus_tag="AAR034W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR094W (VAS1)"
                     /codon_start=1
                     /product="AAR034Wp"
                     /protein_id="NP_982575.1"
                     /db_xref="GeneID:4618432"
                     /translation="MLRSCLLSDSFHLLKQQLFRSTAPRSIFERIRPQSVAMSTEQQL
                     PEVDANGEIIINPLKEDGSPKTAKEVEKERKKAEKLLKFAAKQAKKAENKANQQKNQT
                     KKEKKKKETEAVVEFVDETVPGEKKILKSLDDPALKAYNPANVESSWYDWWVKSGFFE
                     PELTKDGKIKPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPG
                     FDHAGIATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASY
                     DWSREAFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIA
                     GKTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKLIIATTRPETMFGDTAIAIHPDDPRY
                     KHLHGKFVQHPFLPRKMPIVCDAEAVDMEFGTGAVKITPGHDQNDYNTGKRHDLEIIN
                     ILTDDGLLNENCGPEWQGMKRFDARKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVI
                     EPILKPQWWVSQGEMAKEAINAVKDGRITITPKSSASEYFHWLENIQDWCISRQLWWG
                     HRCPVYFVNIEGKEQSRNEGTYWVSGRNLEEAQKKAAEKFPNEVYTLEQDEDVLDTWF
                     SSGLWPFSTLGWPDKTPDMSTFYPFSMLETGWDILYFWVARMILLGIKLTGNVPFNEV
                     FCHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQK
                     ESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLG
                     DDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICD
                     VYIENSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFISEEMWQHLPKRASET
                     SESIVKAKYPVFRQDFFDEESAADYNLVLSATKEARSLLAEYNIVKNGKVFIEVQGNN
                     DKVFTCLNSQSASIVSLIKAIDQVTVVRSATEIPEGCVLSSVTPDVNVHALVKGQVDI
                     DTEIQKFNKKLDKAQKSKEAIEKVVGSSDYETKANEQAKKANKDRLDSIAAEIESLEA
                     TIANLEKLKL"
     gene            complement(<406067..>406711)
                     /locus_tag="AGOS_AAR035C"
                     /old_locus_tag="AAR035C"
                     /db_xref="GeneID:4618533"
     mRNA            complement(<406067..>406711)
                     /locus_tag="AGOS_AAR035C"
                     /old_locus_tag="AAR035C"
                     /product="AAR035Cp"
                     /transcript_id="NM_207929.2"
                     /db_xref="GeneID:4618533"
     CDS             complement(406067..406711)
                     /locus_tag="AGOS_AAR035C"
                     /old_locus_tag="AAR035C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR095C (RRP46)"
                     /codon_start=1
                     /product="AAR035Cp"
                     /protein_id="NP_982576.2"
                     /db_xref="GeneID:4618533"
                     /translation="MSLGILSHVDGSSKFSTAAASAICGVSGPIEPKARQEIPQHLAL
                     DVIVRPAAGPPTTREKLLEDKVRATITPVVETFLHPRQLCQITLQVLKSVGQHEHMEL
                     AVALNAAYLALLDAGVPLRAVLSAVSIAVSTEGELTQNPSPAELQDARSVFTAAFSVA
                     DGVNTLLLLDGNGTFEESTVSKVLELAEKECVRLAGELRHAVKEKLEKDFIWKK"
     gene            <406863..>407816
                     /locus_tag="AGOS_AAR036W"
                     /old_locus_tag="AAR036W"
                     /db_xref="GeneID:4618442"
     mRNA            <406863..>407816
                     /locus_tag="AGOS_AAR036W"
                     /old_locus_tag="AAR036W"
                     /product="AAR036Wp"
                     /transcript_id="NM_207930.1"
                     /db_xref="GeneID:4618442"
     CDS             406863..407816
                     /locus_tag="AGOS_AAR036W"
                     /old_locus_tag="AAR036W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR096W (TPC1)"
                     /codon_start=1
                     /product="AAR036Wp"
                     /protein_id="NP_982577.1"
                     /db_xref="GeneID:4618442"
                     /translation="MAASSGSPQLATEDHLRKGEAVSGLHAVVAGSVSGLVARSVTAP
                     MDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT
                     YAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQ
                     ARVIWDTEGPAGFFRGGAWAIAATTLTTGLIFGIYETCTIAADTYGLPWLAAAASPTA
                     GLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIA
                     SLYKGLTMALCKSTPTTVITLWVYQRCLRLLEPTRAPQLPA"
     gene            <407860..>408648
                     /locus_tag="AGOS_AAR037W"
                     /old_locus_tag="AAR037W"
                     /db_xref="GeneID:4618505"
     mRNA            <407860..>408648
                     /locus_tag="AGOS_AAR037W"
                     /old_locus_tag="AAR037W"
                     /product="AAR037Wp"
                     /transcript_id="NM_207931.1"
                     /db_xref="GeneID:4618505"
     CDS             407860..408648
                     /locus_tag="AGOS_AAR037W"
                     /old_locus_tag="AAR037W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR113W (PIS1)"
                     /codon_start=1
                     /product="AAR037Wp"
                     /protein_id="NP_982578.1"
                     /db_xref="GeneID:4618505"
                     /translation="MTFLEPRGDEKGFNASFCANFIAVHLTDVIMRIAQAQQETTVTA
                     KQVLRYIPNCIGYMRVATMVVACFLMKNHPAWTTVVYGVSCLLDALDGTMARRYGQTS
                     RFGAVLDMVTDRSTTNALICFLCLLYPRWTPVFQLLIALDLSSHYMHMYGSLSCGDSH
                     KKIEKDQWLLHMYYSRRDVLFAVCFLNELFYFGIYLAGFPQLWHLWLPGLGRLHFGTL
                     VALLCLPGYVFKQITNVVQLNRAALLLAHMDARDATRRLRAKHE"
     gene            408798..408871
                     /locus_tag="AGOS_t0016"
                     /db_xref="GeneID:4618695"
     tRNA            408798..408871
                     /locus_tag="AGOS_t0016"
                     /product="tRNA-Ile"
                     /codon_recognized="AUU"
                     /db_xref="GeneID:4618695"
     gene            <409047..>410747
                     /locus_tag="AGOS_AAR038W"
                     /old_locus_tag="AAR038W"
                     /db_xref="GeneID:4618597"
     mRNA            <409047..>410747
                     /locus_tag="AGOS_AAR038W"
                     /old_locus_tag="AAR038W"
                     /product="AAR038Wp"
                     /transcript_id="NM_207932.2"
                     /db_xref="GeneID:4618597"
     CDS             409047..410747
                     /locus_tag="AGOS_AAR038W"
                     /old_locus_tag="AAR038W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR132C (AGP2)"
                     /codon_start=1
                     /product="AAR038Wp"
                     /protein_id="NP_982579.2"
                     /db_xref="GeneID:4618597"
                     /translation="MQECRPLLMKSTLPNDDRGVAIRRKDSWVPSEHSSEVGDEASSA
                     GFAGKYHSTYRKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPI
                     LCITVSTAEMVCYLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQIPFEIVAVNSI
                     IHYWRDDYSAAITLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLFCFTFVTM
                     VGGNPKRDRYGFRYIGEAPFKQYSPTMEPISSSAGYFQGFLACLIQASFTIAGPDYVS
                     MIAGETKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAG
                     SSPYVIAMNHLGIKILPDIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKR
                     CNRFGVPIYAVSVSVMWSVLSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYF
                     RRAYLAQQDNLPELPFKSWWQPYTAYVGLTCVLLIVVVQGYTVFYSALWNVKDFLFCY
                     LMVFIDIAIYLGYRYIWRRGKDAVIPPTEVDLTTGLLEIELHERHHGFERYSFFHVDD
                     "
     gene            <411513..>412088
                     /locus_tag="AGOS_AAR039W"
                     /old_locus_tag="AAR039W"
                     /db_xref="GeneID:4618671"
     mRNA            <411513..>412088
                     /locus_tag="AGOS_AAR039W"
                     /old_locus_tag="AAR039W"
                     /product="AAR039Wp"
                     /transcript_id="NM_207933.1"
                     /db_xref="GeneID:4618671"
     CDS             411513..412088
                     /locus_tag="AGOS_AAR039W"
                     /old_locus_tag="AAR039W"
                     /note="NOHBY108; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLTH0F11330g"
                     /codon_start=1
                     /product="AAR039Wp"
                     /protein_id="NP_982580.1"
                     /db_xref="GeneID:4618671"
                     /translation="MSSVKTATRCREEDCPQGREQGTAGRMKGAGRRPFHLKGKINKT
                     HFKAKEKVPDVRRGDADMLLIELHDLFDFRHCMQSGNTGEMKVDLDEVASIEYIHDPA
                     CVYKKKGPVPLQPDDDEDVGSETSAEPLDPLTDVEQSGVGFLASGVYSAIPERCSGGM
                     FLESSCHRDVPNKQTLFLLLHDLIQGDAYDE"
     gene            complement(<412119..>414110)
                     /locus_tag="AGOS_AAR040C"
                     /old_locus_tag="AAR040C"
                     /db_xref="GeneID:4618721"
     mRNA            complement(<412119..>414110)
                     /locus_tag="AGOS_AAR040C"
                     /old_locus_tag="AAR040C"
                     /product="AAR040Cp"
                     /transcript_id="NM_207934.1"
                     /db_xref="GeneID:4618721"
     CDS             complement(412119..414110)
                     /locus_tag="AGOS_AAR040C"
                     /old_locus_tag="AAR040C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR131W (CCZ1)"
                     /codon_start=1
                     /product="AAR040Cp"
                     /protein_id="NP_982581.1"
                     /db_xref="GeneID:4618721"
                     /translation="MDFIAVYNPAVYAKEADSEAWRQLLLYHSFKEDAEEPTPQNEKL
                     SLIGMIQGIWQFAHNFSEPETRGSVRYVDTQLERRRVIAVEVEDGHFMAFGVEDGKRY
                     GCEYYVRELLQSYHVFRLHCGSMSEFADRGELTDRLNEHVVGYWQALKLVPEAIYAST
                     LASVCWHDGYKVSELELRDRAWESYIKNEILLDSESFLGLKDMCIYKLPRDGRRSAAE
                     YGLLRSFAPEFLSLPELSNWVYHLDRLFETALSSHVLAGHVRLSIGGDEQEEEGELRH
                     DSQPASDVGARMWRNVTMPISMTYDTMSEVGNLTGINTLMSGLNSLTSGFSSMTSRLV
                     RRADRQNSDTASLSLHVDHGFLISPLALEALPESYRYRRFQLRFSTDEPQWYRLLFWY
                     YKDYLCIFIFHENFDKIWDPDYLQAIDAKLYDAMLQLEGSVVTEDNKPGRFAYGVFNK
                     TTKRIECSLPLLRFSDKRSDEKSRQPLKMVVAGIDETLQFLTAGTFATNMATSRTNDE
                     HMGPSATNTLRMPEPTDAPSSSWTLDITKLNLFQGLNENLRLEKMADTDSGTFLDSLS
                     SEKLLQLNVELCRLYTGIRRSEYNKAGIQEEQLLRLNNGILFYISTSPTEDVLILKNW
                     FMDDKYTKAENKRSTSASLLHSLGGDVRRWWNARTNREQ"
     gene            <414286..>415830
                     /locus_tag="AGOS_AAR041W"
                     /old_locus_tag="AAR041W"
                     /db_xref="GeneID:4618557"
     mRNA            <414286..>415830
                     /locus_tag="AGOS_AAR041W"
                     /old_locus_tag="AAR041W"
                     /product="AAR041Wp"
                     /transcript_id="NM_207935.2"
                     /db_xref="GeneID:4618557"
     CDS             414286..415830
                     /locus_tag="AGOS_AAR041W"
                     /old_locus_tag="AAR041W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR088C (SRP54)"
                     /codon_start=1
                     /product="AAR041Wp"
                     /protein_id="NP_982582.2"
                     /db_xref="GeneID:4618557"
                     /translation="MVLADLGKRINAAVAQALNNDTDDYVAGVETMLKAIVTALLEND
                     VNIKLVSSVRSNIKARLLADKSGRRMGQAQTKQLVQKTVFEELCALVDCQTAAYQPKK
                     KKSNVVMFVGLQGAGKTTSCTKLAVYYSKRGFKVGLVCADTFRAGAFDQLKQNAIKAK
                     IPFYGSYTETNPVRVAADGVAKFKKERFEIIIVDTSGRHHQEDALFQEMVEIAQEVKP
                     NQTIMVLDASIGQAAEQQSRAFKEAADFGAIILTKMDGHAKGGGAISAVAATKTPVIF
                     IGTGEHVHDFEKFSPKSFVSKLLGIGDIESLLEQFQTVSNKEDTKATMENIQQGRFTL
                     LDFQKQMQTIMKMGPLSNLASMIPGMSGMMSGISEDETSRKMKKMVYVLDSMSREELE
                     SDGRVFIDEPARMLRVARGSGTSVFEVEMILMQQQMMARMAQGAKNMGGLPGMPAGPG
                     MPRLSPQMMQHAQQQLRQNPSMMRNMMGMLGGGSGAAMPDMADMMRMMQDPQMQQMAS
                     QFGMGL"
     gene            <416501..>417913
                     /locus_tag="AGOS_AAR042W"
                     /old_locus_tag="AAR042W"
                     /db_xref="GeneID:4618697"
     mRNA            <416501..>417913
                     /locus_tag="AGOS_AAR042W"
                     /old_locus_tag="AAR042W"
                     /product="AAR042Wp"
                     /transcript_id="NM_207936.1"
                     /db_xref="GeneID:4618697"
     CDS             416501..417913
                     /locus_tag="AGOS_AAR042W"
                     /old_locus_tag="AAR042W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR130C (SHE3)"
                     /codon_start=1
                     /product="AAR042Wp"
                     /protein_id="NP_982583.1"
                     /db_xref="GeneID:4618697"
                     /translation="MAATNAVEAGYGGAAENGGCAEGLLGSPMRFSPSSKLKVNHGHF
                     MANINNNAGPGKGGTAAGGTSPTREASYANVSGSGKVIENLHQQVDALTSTNLQLTKQ
                     SNQLLEKLEGCNAREAKYLETISSLKHENENLNSMLNRKTRRVKDLDMELVQLRTSHE
                     EATASHNQLKYQLENKFAHETELEQQCQLLQAQYDAVVDAQRRYREHYQKEIEELREA
                     LEALKKDNDKFLGEHMARLTRSQLDIDKSMSDYNGKFHRMELSQKEAVIELNEKYDRM
                     RADLDVDGWIVLYKQMRDIAFDYAKQLDLSLPKEFAELHGEDGYYAKMLDEDRQSSPV
                     STSSTAVEPMSQPSPSMSAQTLSPPPLRVPKNRTPITKRSSFYGNTMPGANISLTSAT
                     GLLPGVKRTGSIRSFHGRAPSEGLSDTPTIFTASRNASPMEFPQRSALTSAASANATV
                     RHSSVPRHRRNQSSQVGNNK"
     gene            complement(<418277..>419890)
                     /locus_tag="AGOS_AAR043C"
                     /old_locus_tag="AAR043C"
                     /db_xref="GeneID:4618440"
     mRNA            complement(<418277..>419890)
                     /locus_tag="AGOS_AAR043C"
                     /old_locus_tag="AAR043C"
                     /product="AAR043Cp"
                     /transcript_id="NM_207937.1"
                     /db_xref="GeneID:4618440"
     CDS             complement(418277..419890)
                     /locus_tag="AGOS_AAR043C"
                     /old_locus_tag="AAR043C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR030W (ALG12)"
                     /codon_start=1
                     /product="AAR043Cp"
                     /protein_id="NP_982584.1"
                     /db_xref="GeneID:4618440"
                     /translation="MILLLDGAELILLAVLTHLAYSPYTKVEESFTIQAVHDILKYGI
                     SGISEYDHQAFPGAVPRTFVGALIIAGILKPLSWLFGLQGGNEVSSITGIAMQKWARA
                     IVGCLNVLALFRMKRVVERKLTANDEPKKRNPLRHTGYWFVVFLSAQFHLMFYASRPL
                     PNFVVCLPLAVTALSLAIEERYCFSIGLLSFTAVVFRLELGAMCIGLALAALVARKVS
                     VMEIIRFGIIGSGVGLGLSATIDSYFWGRSCVPEMDAFVFNVIGGQSAKWGTEPLLAY
                     FTRYLPRLFFPPMVTVFCIAGVRIASTPFRIVFAASLIHIMLLSLQPHKEWRFIIYSV
                     PAITLLGSMGAAYLFSLANWRQANGFSMRILILISPLLMLMHSVLMSYISSMNYPGGY
                     ALSAFNKYVLDNNISNATVHLDVFTCMTGATLFGQLPDSYGIIYDKTEGDELLDAWSS
                     FDYVITTDPNSSLPPVTGYKWERIQTTEAFDRFDLKTIPEIINSEVAKGFPILKDAIL
                     SADLQPVKAAFTDVIRCRDSVYTYKRVEN"
     gene            <420064..>421296
                     /locus_tag="AGOS_AAR044W"
                     /old_locus_tag="AAR044W"
                     /db_xref="GeneID:4618710"
     mRNA            <420064..>421296
                     /locus_tag="AGOS_AAR044W"
                     /old_locus_tag="AAR044W"
                     /product="AAR044Wp"
                     /transcript_id="NM_207938.1"
                     /db_xref="GeneID:4618710"
     CDS             420064..421296
                     /locus_tag="AGOS_AAR044W"
                     /old_locus_tag="AAR044W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR029C"
                     /codon_start=1
                     /product="AAR044Wp"
                     /protein_id="NP_982585.1"
                     /db_xref="GeneID:4618710"
                     /translation="MPLKNFQYREDEDGELPPLVTGLEENIQELLSELKPDGGLNIVN
                     ERKIEQANKQHQGAGSQKKIPVTVITGYLGSGKSTLLEEITKRGSDMRIAVILNEFGD
                     SSEIEKSLTIKNNGKAYEEWLDLGNGCLCCSLKDVGVKAIEAMVSRSPGKIDYIILET
                     SGIADPVPIVKMFWQDEGLNSCIYIDGIVTVLDAEHVMTWLDEVAPPRQWRGDQVLME
                     NQMTVAHLQLAMADAVVLNKIDRLEGLDDEIAVVEEKVRSINAVAPIYRTKFGDLEIN
                     KVLNLHAFGASDIPDAHVAYHDPRLSTVTLTCRPLRDKAELEWFEEHFLQALLWKDFG
                     RGELTQGQEFEIHRTKALLLVGSEFKIVQGVRDTYEVLRGEPVPGVKQCKLVFIGVHL
                     DKQYIQGIMESALNARIE"
     gene            complement(<421382..>422311)
                     /locus_tag="AGOS_AAR045C"
                     /old_locus_tag="AAR045C"
                     /db_xref="GeneID:4618451"
     mRNA            complement(<421382..>422311)
                     /locus_tag="AGOS_AAR045C"
                     /old_locus_tag="AAR045C"
                     /product="AAR045Cp"
                     /transcript_id="NM_207939.1"
                     /db_xref="GeneID:4618451"
     CDS             complement(421382..422311)
                     /locus_tag="AGOS_AAR045C"
                     /old_locus_tag="AAR045C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR069W (CPR4) and YNR028W (CPR8)"
                     /codon_start=1
                     /product="AAR045Cp"
                     /protein_id="NP_982586.1"
                     /db_xref="GeneID:4618451"
                     /translation="MTVGNGKRLVALSWVVLFGVMSYFGVISAAQAKSVKMYPPNPPI
                     SQRVQMLLRYDGGEKQEELEIGIELYGSVVPDTVKNFREIAKGVKAKIKGTDQVLDIT
                     YKNTVFHRVVPEKYICGGKVLDYRFSIHGQTFKDENFDIKHDRPGRLAMVNDGPDSNH
                     SQFYIVTSLEPLEENDGKNVVFGQVYDGLEELLEKVRHLPLDEQGKPTSNLKIVGIHV
                     DDLSIQNMDELVALYKQSLVKYHAGDTSVGVPETAFLRKGAGENGAVISSFEYSKQRV
                     VVFGLVFALLYIAAKRGRSYLASKANVVSVRNG"
     gene            complement(<422643..>424277)
                     /locus_tag="AGOS_AAR046C"
                     /old_locus_tag="AAR046C"
                     /db_xref="GeneID:4618494"
     mRNA            complement(<422643..>424277)
                     /locus_tag="AGOS_AAR046C"
                     /old_locus_tag="AAR046C"
                     /product="AAR046Cp"
                     /transcript_id="NM_207940.1"
                     /db_xref="GeneID:4618494"
     CDS             complement(422643..424277)
                     /locus_tag="AGOS_AAR046C"
                     /old_locus_tag="AAR046C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR068W (ATG15)"
                     /codon_start=1
                     /product="AAR046Cp"
                     /protein_id="NP_982587.1"
                     /db_xref="GeneID:4618494"
                     /translation="MVADFDSGWYEGAGDELGQGARNGVLRERLGGNEKAQVVRSRRK
                     AVAWNVLMVLGLILYVLYSACFAQARQWWRTNGMARGSQAGRFQLVQVHHHGVGAEHA
                     THLVLDVDAEFRKEAAAEYSVFALHGEGQELWPEAGRRRAANPFEYAYALREERATVV
                     RAQQQVPEFMEPYLDFALERPDLAEQIKMDWGYENMFVPNITDKETVISLALMSSNAY
                     VRLPNTGNWRNVTSWNSSVEGDQIHLGWDENGLRAHVFANEDRSVVVLALKGTSSQVL
                     PGSGDDDETSANDKLNDNLLFSCCCARVSYLWTTVCDCYIKSYTCEESCLESELRRKD
                     RYYQAGLDMYKQVLAEFPDASIWLTGHSLGGALASLVARTYGVPAVTFEAPGELLATQ
                     RLHLPQPPGLPNQLDTVWHFGHTADPIFMGTCNGASSACSIAGYAMETSCHSGKSCVY
                     DVVNDRGWRVNLLHHRIHTVIDKILDDYDAVAACVPPDICHDCYNWNYVRWRDGTTSP
                     MPSSVASKPTPTPTSPGSPSSTCKGRNWFGYCTEYA"
     gene            complement(<424520..>425497)
                     /locus_tag="AGOS_AAR047C"
                     /old_locus_tag="AAR047C"
                     /db_xref="GeneID:4618659"
     mRNA            complement(<424520..>425497)
                     /locus_tag="AGOS_AAR047C"
                     /old_locus_tag="AAR047C"
                     /product="AAR047Cp"
                     /transcript_id="NM_207941.2"
                     /db_xref="GeneID:4618659"
     CDS             complement(424520..425497)
                     /locus_tag="AGOS_AAR047C"
                     /old_locus_tag="AAR047C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR027W (BUD17)"
                     /codon_start=1
                     /product="AAR047Cp"
                     /protein_id="NP_982588.1"
                     /db_xref="GeneID:4618659"
                     /translation="MPKIVHQPHSTIAHGHRASLPGAGMTKKLLSVQSHVVQGYVGNK
                     AAVFPLQCRGWDVDVVNTVQFSNHPGYGTHTGFRTQPEVLGRLVEHSLDGPLGLEHAA
                     VILGYLPDAEGLRRAAAAIARACCARPALAWVVDPVLGDAGRLYVPPEVLPQYRALLR
                     GGGVLAVTPNQFELELLVGAAAGSRAALRHALDAFHEQFPRVPYVVVTDVRLAGDDAL
                     CYTACSDGRAARLFATPRLPAAFAGSGDLFCALLVDALCSGSSPALADAVACALARLG
                     GVLQRTYELACAKNCDEPPPQVVRDLRLVECRDLLVADVAPQLKGEDLP"
     gene            <425637..>428672
                     /locus_tag="AGOS_AAR048W"
                     /old_locus_tag="AAR048W"
                     /db_xref="GeneID:4618434"
     mRNA            <425637..>428672
                     /locus_tag="AGOS_AAR048W"
                     /old_locus_tag="AAR048W"
                     /product="AAR048Wp"
                     /transcript_id="NM_207942.1"
                     /db_xref="GeneID:4618434"
     CDS             425637..428672
                     /locus_tag="AGOS_AAR048W"
                     /old_locus_tag="AAR048W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR026C (SEC12) and YCR067C (SED4)"
                     /codon_start=1
                     /product="AAR048Wp"
                     /protein_id="NP_982589.1"
                     /db_xref="GeneID:4618434"
                     /translation="MKLQSTLYNVGYPVYGARFLNANTLLVTGGGGEGNHGIPNKLTA
                     LQINFSKKKIVKRFRELTLDENDDSPTTLDVAQDVILMGCNENSEKIRQGAPNHHLRK
                     FVYENEHLKFVGAIDLNRSDNPEDYTKLLYMSQDGWVAAVASSAVPTVIRIVNPGNLR
                     ETYEVETGNDVKDLHFSSDGKVLAYITASTLEVISIVTGNFIVRKTDFDKNLSLSKIR
                     FIGEDTLLIAAALKKGTGIVLTKLSLKKGNTQILRTCVITKKFKSVTSMDVDPKGQLA
                     VLAGSDNSLALVKLRNFSVAKFFKQVHTFAVTRVVFSPDSRLLVSVSAANTVHVVQLP
                     EDFATRTTLTENLIKFFTNFVLVVLVALFARFAHQHGLHTKAYNIVSNTLRKPENRRT
                     SFFSDILNQQITLSGDVVSSSTTAVDTVHSSVDTSGWYLDSTRSGTDAVASGDRLDGG
                     AATIESLAKSAGVDSPVEVETLPHANSTTFSEVTAYTGEYPEVVSSATSEVAMESSVD
                     SKFMAIEASTTPAITISTSLQSMSVSDVYTGTSAAEDASSTGSDASVVLEKTAILNPS
                     STNIAEDEFVDAIAEPPSASVDSTPYVTAARDYSSEDTGERSEPTITEYKTAIESPST
                     FGDDNESVFLVTSADLHPSVSSASQTLTTEELQAVANSHQYKTEVQIVKQDEDEVEDV
                     LELDSPPASLYDGDVLKEAEKNDSSNVIPDDSIDIDEYLDENLVKNFTLENALSLDEI
                     FDDDNVVFGEEKLLVDPDLEFPELTGMEQDMESDYLPLIENGTEAVLQLDPNIDDIDL
                     DNNMVYADDAQPVSDGLQNIAIMPDVIDNLEIQTFSEQEKQQLEPSSIESVATSLEVP
                     NEATTYEVEAADLTSSVDPIEIVIETAETAYNDASPDIVNLENTLTSTEQQDSAPDIN
                     EVDDLETEVEVKTEFLEDIVDFQHPVETSAQFNVPKTPALEVIDQPQPVTQVQTVIET
                     VVDGTTRPANALLMNSTVEVITVKEIVKETVFVTEKVTN"
     gene            complement(<428880..>430211)
                     /locus_tag="AGOS_AAR049C"
                     /old_locus_tag="AAR049C"
                     /db_xref="GeneID:4618439"
     mRNA            complement(<428880..>430211)
                     /locus_tag="AGOS_AAR049C"
                     /old_locus_tag="AAR049C"
                     /product="AAR049Cp"
                     /transcript_id="NM_207943.1"
                     /db_xref="GeneID:4618439"
     CDS             complement(428880..430211)
                     /locus_tag="AGOS_AAR049C"
                     /old_locus_tag="AAR049C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR066W (RAD18)"
                     /codon_start=1
                     /product="AAR049Cp"
                     /protein_id="NP_982590.1"
                     /db_xref="GeneID:4618439"
                     /translation="MSIQPGQVVTDPSDFAGTTIPELADLDSLLRCHICKDMLQTPVL
                     TQCGHTFCSLCIREYLNKESRCPLCLAELRQNMLQKEFLVGELAACYMELRARLLETV
                     RIPPKKVAEVVQNNSPIELDSDGEVEIIESCTGAVPGSKRGSPQVEEVEAAAKRQRTK
                     QNGIQYMLQKKPKAVGEKVPCPICNRLYNKEFLERVHLDECLMMGTLRESGESDITVI
                     EQQSYTAEPDSKNSHVAERRGESPVDEVVTHKESYLGSGLRVTKSRLPKLHFTSLSTS
                     QLKQKLSELGLPTAGSRQQMINRYNHYELLWNSNFLDSIQPVGEGELRRSLLSWEATR
                     NTDTPISSGVSSSITNMLKTNNSASTLLKSFKTDKFDKSAWSRLHGKEFRRLIRAAKK
                     SMLEQDRGEAITAQNNELSTKASVDMESTSFRNDTNDTIDTVTDEVHEDLK"
     gene            complement(<430603..>431964)
                     /locus_tag="AGOS_AAR050C"
                     /old_locus_tag="AAR050C"
                     /db_xref="GeneID:4618705"
     mRNA            complement(<430603..>431964)
                     /locus_tag="AGOS_AAR050C"
                     /old_locus_tag="AAR050C"
                     /product="AAR050Cp"
                     /transcript_id="NM_207944.1"
                     /db_xref="GeneID:4618705"
     CDS             complement(430603..431964)
                     /locus_tag="AGOS_AAR050C"
                     /old_locus_tag="AAR050C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR065W (HCM1)"
                     /codon_start=1
                     /product="AAR050Cp"
                     /protein_id="NP_982591.1"
                     /db_xref="GeneID:4618705"
                     /translation="MHVNVAVTRDADATAATPIARERKRRQPLSPEMSSPLRGSKLQR
                     RKQTLEAGPGRASGTHTVDELAAQLERGCEQASERKPPYSYAVLIGVAILQSQEGKLT
                     LSQIYRWISSFFPYYRLCDAGWQNSIRHNLSLNEAFVKGGKSLDGKGHFWEIKGNCEG
                     RFFRDGAEYTGAAIRQRLQRAGATRERVEPENEPVLLPSLAPAPAVAVRSYDVFKRRY
                     RNPDTFDEAGYATDPEARNHEEVATPEHPSVASDVSSEEGPERQRTPDSLDHEGSWNC
                     MGSTSNETLSSSPLMRRYTCSFNTCFDPASPDEGVLLQPQLLETPQSHSPLQTPREQP
                     ASAGKLHTPFFDDFFGSPIILMPAGTPNGYVDESALDNERRIVPRSPRRPLNSSASSS
                     FGLHRPQSILEAPHISTSALFGVDLCSVWRRALGGSEDRNDYASQQRLDILFKPAPDA
                     DRK"
     gene            complement(<432400..>432846)
                     /locus_tag="AGOS_AAR051C"
                     /old_locus_tag="AAR051C"
                     /db_xref="GeneID:4618815"
     mRNA            complement(<432400..>432846)
                     /locus_tag="AGOS_AAR051C"
                     /old_locus_tag="AAR051C"
                     /product="AAR051Cp"
                     /transcript_id="NM_207945.2"
                     /db_xref="GeneID:4618815"
     CDS             complement(432400..432846)
                     /locus_tag="AGOS_AAR051C"
                     /old_locus_tag="AAR051C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR063W (BUD31)"
                     /codon_start=1
                     /product="AAR051Cp"
                     /protein_id="NP_982592.2"
                     /db_xref="GeneID:4618815"
                     /translation="MPRPPRSPPPAGFDKVEPTLAAFAEQLRDLQGVSAPRGPRASAA
                     AWPVFRVTHERSRYVYTMYHRRRAISRALYDWLLRHRYADRYLIAKWRKQGYEKLCCL
                     RCIQPGESQYGHTCICRVPRAALELQSGAAFEQCTRCGCRGCASTD"
     gene            complement(432927..433020)
                     /locus_tag="AGOS_t0017"
                     /db_xref="GeneID:4618777"
     tRNA            complement(join(432927..432971,432984..433020))
                     /locus_tag="AGOS_t0017"
                     /product="tRNA-Ser"
                     /codon_recognized="UCG"
                     /db_xref="GeneID:4618777"
     gene            complement(<433525..>435264)
                     /locus_tag="AGOS_AAR052C"
                     /old_locus_tag="AAR052C"
                     /db_xref="GeneID:4618654"
     mRNA            complement(<433525..>435264)
                     /locus_tag="AGOS_AAR052C"
                     /old_locus_tag="AAR052C"
                     /product="AAR052Cp"
                     /transcript_id="NM_207946.1"
                     /db_xref="GeneID:4618654"
     CDS             complement(433525..435264)
                     /locus_tag="AGOS_AAR052C"
                     /old_locus_tag="AAR052C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR061W"
                     /codon_start=1
                     /product="AAR052Cp"
                     /protein_id="NP_982593.1"
                     /db_xref="GeneID:4618654"
                     /translation="MRNLATVYLTVLAAAVAAQHGSHSAHGSTGQLNNNSIHPVAHES
                     HHMHGMPILETQLTAAERAYWEQYDTMTYFNAPSKRKRGLWMHAAAVAGTALVLYPAS
                     LVLAESESRWYLVCLAAHCLVLWTGLAALAVYAASLPSTLYPGNVYGTLSWIVAIVSV
                     SHAASAVVVRAAKWLAPDAAPYAIPLELLRPERSSSSHEHSQESIDEHEANVGKMYSP
                     GEETAELAPDVEQATGGLRDGYRRERMQAPALLRHPIVQQMAERFGTVFGAVYRITNS
                     LQLLLLLVYAAVGFAIGNRFAQGKYVFNFLAHWIKGGIFFLLGVLSLARYCGFGAAHG
                     WAWNAIAYKARREDVSRWRRLFPQGTTMEGVESFLIFFYGSTNVFLEHLANPGGRWEA
                     KDLQHVSIAFMYIGCGLCGLIVERRLASWRCVAAARVVGDCDEGSPGFSPNPFPALTV
                     FFTGILMSQHAQASEVSTVIHAQWGKLLAYGSFFRIFTFLLLLLLPRKGKGPAHPFPE
                     LVTSFCLVSGGMIFMESTDQVIEALEYRGLTPMFTFNLSVGTTVLVMAWIMLLFSWRD
                     AMCAQSSAHRVAR"
     gene            <435604..>440568
                     /locus_tag="AGOS_AAR053W"
                     /old_locus_tag="AAR053W"
                     /db_xref="GeneID:4618443"
     mRNA            <435604..>440568
                     /locus_tag="AGOS_AAR053W"
                     /old_locus_tag="AAR053W"
                     /product="AAR053Wp"
                     /transcript_id="NM_207947.1"
                     /db_xref="GeneID:4618443"
     CDS             435604..440568
                     /locus_tag="AGOS_AAR053W"
                     /old_locus_tag="AAR053W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YGR032W (GSC2), YLR342W (FKS1), and YMR306W (FKS3)"
                     /codon_start=1
                     /product="AAR053Wp"
                     /protein_id="NP_982594.1"
                     /db_xref="GeneID:4618443"
                     /translation="MEENAYLDGAGDRETGDQETSDQAYDTGGYSSTSDGGSERAHYG
                     QVEERWGPPRDKDSHWEQDSSEQELMGNKALSEYSEETQRLFTHLQEVFQFQKDNCKN
                     IYDYFVALVQSRRRGKRNNFERAVDTLYADYVFGPNSNFHKWYQFVYGEDEMPHWAYG
                     TLDDRITQVALYLLIWGEANNVRFMPELLCYIFSIMCNHYYGNMLHDAKTVGPFLDHA
                     ITPIYDYYYAQLTSGKDHSSVVGYDDINQCFWNRTFIYTLPVKGVGPLKMIPTDEHYV
                     FFNRIVWNQCLVKTYYERRTWFHVVTNFHRVLVLHLSVYWYYLAFNVQPLYTKDYSIV
                     EDNTPPIYVVLLVMSFAGGLASSITLGALIGEAIFVPRRSPVATPMVTRFLVTTMSVI
                     ANTVPAVVLLYLDLDFMGTPLGLLVATAILGFSLITVVYYTLQPLKHLYTRAASDPFT
                     SNIHNLSRHSQTASVGLWSLIFISKFVESYFFLTLSVKDPIRELFMLRIDNCNEDAWL
                     GKWICENHGKILTCLLIITHCVLFFLDTYLWYVLYTTVFSMCRSLHLGVSACVPWKNV
                     FFELPLKFCERLLLKKGDVYDGLSFATMWNEIIFSMYREHILSFEHIKKLRCELDDNG
                     ELRGPPIFMKRKSKAIKATVFKKSAEARRRLGFFSKSLSCPMPEPYPTSEMPMFSVLI
                     PHFKEKIILSIKDIVKGENDSTHVILLEYLKLLYADDWKTFIQETGSLYNDDDEKASN
                     RANALSDHESCATRALFSLPYSFAGFKTDTPEYTLRTRIWASLRTQTLYRTISGFMKY
                     KGAISLLHKYETDCTTEEATEMALSKFRIVCSMQRMAKFTEEELEDRDYLMSLFPNLQ
                     IAYVDEDYDPATGKKVYYSSLIDGYCDTTEDGKWKPRYKIRLSGNPVIGDGKSDNQNH
                     AIIFTRGEYIQLIDANQDNYLEECLKIKSVLSEFENDVPDKTDIRGVLNPVAIVGSRE
                     HVFSEKTGVLGDLAAGKEQVFGTFFARTLSYIGAKLHYGHPDFVNAIFVTTRGGVSKA
                     QKGLHLSEDLFVGMSSILRGGRIKHCEYTQCGKGRDLGFGSILNFATKISAGMGEQIL
                     SREYFYLCSNLPLDRFLSFYYAHPGYYLNNVSIILSITLFMILILSIAVLVDTSEICD
                     DHMTHQELQELNCANIKPVIRWLRRSVLSIFVVSTASSFPMFAEDISEKSISTGVRRI
                     LKHLITGAPMFEIFVCKVYSGSLINDLYAGGARYIATGRGLAVIRVPYANLYSKFAPE
                     SFYFSFCCLLVLLFATTTMWDPVLIYFWFTISSLLLSPFIFNPNQFSWNDFIVDYKNY
                     WRWLSSSRIGANIDSWISYTRNSHLKSTSSQNAIMGTPKVKEIMSVCSRTLWTLMIFI
                     PYIFINSRSTVPFSTNTIRYVVMRIVVLSAMPIVLNAIWLIILSMVSILCSLTLRKAA
                     PGYPKVICSIAHGLGILSHLASFGLLCVLYRWNLRFIIMSLLVVTLLESLFLRIIGLL
                     DFTYNKYAEKSNFAWWSGLWLNEKFSWRYALEPLCEYVRKVMELSWFCSDFVLGHLLL
                     FFQIPILLVPNINKIHSFMLFWKKAGFQIRPLLFSRKIKRKRQRITRLYSCIFIIMLF
                     FFIALLLSPLLLDRVFHLRFDHTVPSRIRILFHSDIRTSNNNPT"
     gene            complement(<440682..>441083)
                     /locus_tag="AGOS_AAR054C"
                     /old_locus_tag="AAR054C"
                     /db_xref="GeneID:4618413"
     mRNA            complement(<440682..>441083)
                     /locus_tag="AGOS_AAR054C"
                     /old_locus_tag="AAR054C"
                     /product="AAR054Cp"
                     /transcript_id="NM_207948.1"
                     /db_xref="GeneID:4618413"
     CDS             complement(440682..441083)
                     /locus_tag="AGOS_AAR054C"
                     /old_locus_tag="AAR054C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR060W (TAH1)"
                     /codon_start=1
                     /product="AAR054Cp"
                     /protein_id="NP_982595.1"
                     /db_xref="GeneID:4618413"
                     /translation="MVAPARNSDHLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVH
                     LANMSMALLKLERWEDALSACDRALEIMKKGPVTDDKILQKVQWRKKLAHEHLAGTER
                     DIKSTAQNVEARYCAIPIEEFDDLPTELQEL"
     gene            <441219..>442037
                     /locus_tag="AGOS_AAR055W"
                     /old_locus_tag="AAR055W"
                     /db_xref="GeneID:4618438"
     mRNA            <441219..>442037
                     /locus_tag="AGOS_AAR055W"
                     /old_locus_tag="AAR055W"
                     /product="AAR055Wp"
                     /transcript_id="NM_207949.1"
                     /db_xref="GeneID:4618438"
     CDS             441219..442037
                     /locus_tag="AGOS_AAR055W"
                     /old_locus_tag="AAR055W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR059C (YIH1)"
                     /codon_start=1
                     /product="AAR055Wp"
                     /protein_id="NP_982596.1"
                     /db_xref="GeneID:4618438"
                     /translation="MALNEEVAEEISAVDAIYPGNLSRLSENRVLIRIPNYEEIAIQI
                     SFPSNYPAEEPPHILEISISHEKVQRYERSDLQPVCEELMASVYSKGFVCLFDFISEL
                     SNVLYERFGAQDDDTEDDELAERMGHLNLDPFDGWIASDPITDRSSTFIAYAAHVNSE
                     EDACLRIDQLKTDNKISKCAHLMTAWRIHGENGVAYKDCDDDGEAAAGSRMLHLLNTM
                     DAWDVVVAVARWFGGVHIGPDRFKHINSCTRDALIKGDFVSQAKAGSASKKTKK"
     gene            complement(<442147..>442614)
                     /locus_tag="AGOS_AAR056C"
                     /old_locus_tag="AAR056C"
                     /db_xref="GeneID:4618696"
     mRNA            complement(<442147..>442614)
                     /locus_tag="AGOS_AAR056C"
                     /old_locus_tag="AAR056C"
                     /product="AAR056Cp"
                     /transcript_id="NM_207950.1"
                     /db_xref="GeneID:4618696"
     CDS             complement(442147..442614)
                     /locus_tag="AGOS_AAR056C"
                     /old_locus_tag="AAR056C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR024W (MPP6)"
                     /codon_start=1
                     /product="AAR056Cp"
                     /protein_id="NP_982597.1"
                     /db_xref="GeneID:4618696"
                     /translation="MANNMAKEVSGKLSSRVMNMKFMRHAEQAEEEQRVEVEQRKFID
                     SSEWSIPGRRERLRQIPTPRPVVAVGHTVIRTIDAQGGQASATPGRRKFGSTPVEAAD
                     ASGSETHTASTAEPKAEDLETLWKSEKRTKRPKTGAAERPGGVKKRNRQGAKN"
     gene            <442797..>445565
                     /locus_tag="AGOS_AAR057W"
                     /old_locus_tag="AAR057W"
                     /db_xref="GeneID:4618420"
     mRNA            <442797..>445565
                     /locus_tag="AGOS_AAR057W"
                     /old_locus_tag="AAR057W"
                     /product="AAR057Wp"
                     /transcript_id="NM_207951.2"
                     /db_xref="GeneID:4618420"
     CDS             442797..445565
                     /locus_tag="AGOS_AAR057W"
                     /old_locus_tag="AAR057W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR057C (PWP2)"
                     /codon_start=1
                     /product="AAR057Wp"
                     /protein_id="NP_982598.1"
                     /db_xref="GeneID:4618420"
                     /translation="MSYTTERSSKARHWTTMKSDFKFSNLLGTVYRQGNVVFSEDGTL
                     LFSPVGNRVSVFDLIGNKSFTFEYEHRRNIARIDVNAQGTLLLSVDVDGRAILVNIKT
                     RNVIHHFNFKDKVNDVKFSTDGKLFALACGRFLQIWRTPGVSAERQFAPFVRYRVHAG
                     HFADITSLTWSRDSRFIISTAKDMTARIYSVNAEEKDLASMTFAGHRDYVMGAFFSAD
                     QEKIYTVSKDGALFQWEYTKNPALAEEDDEDEELDLSKYSWRITKKNYFYAKNAKVKC
                     AAFHADSNMLIVGFSNGEFRMYELPDFTFIQQLSMGQNAVNTVAVNRSGEWLAFGSST
                     LGQLLVYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLA
                     TFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAAD
                     PTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASASWDKTI
                     RVWSIFGRSQQVEPIEAYSDVLDISMRPDGKQVAVSTLNGQLSFFDVETSRQVGNIDC
                     KRDIISGRHLEDRFTSKNSARSKYFTTIHYSFDGLSIVAGGNNNSICLYDIPNEVLIK
                     RFIVSRNMTLNGTMEFLNSSKMTEAGSLDLIDQDAENSDLEDRIDVSLPGSRRGGDMS
                     TRRVRPEIRVTAVRFSPSANAFAAASTEGLLVYSVDDSVLFDPFDLDLDITPQAVLDA
                     LANGDYLHATVMAFRLNEEYLINKVYEAIPPDHISLLCSNLPVVYVPRILKFIGDFAM
                     DSQHLEFNLLWVKFLLAAHGHYMVAHKHQFASALRAVQRFLGRVAKDVAAAARSNTHS
                     HTFLTSTHSSLPMSGFGADDQELNSEHESSDEDMEMLSDTEGTWLGFSDKEKPVPLTN
                     DDSDEDLI"
     gene            <445850..>447454
                     /locus_tag="AGOS_AAR058W"
                     /old_locus_tag="AAR058W"
                     /db_xref="GeneID:4618516"
     mRNA            <445850..>447454
                     /locus_tag="AGOS_AAR058W"
                     /old_locus_tag="AAR058W"
                     /product="AAR058Wp"
                     /transcript_id="NM_207952.1"
                     /db_xref="GeneID:4618516"
     CDS             445850..447454
                     /locus_tag="AGOS_AAR058W"
                     /old_locus_tag="AAR058W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR054C (CTR86)"
                     /codon_start=1
                     /product="AAR058Wp"
                     /protein_id="NP_982599.1"
                     /db_xref="GeneID:4618516"
                     /translation="MAHPSEVAQLGLLAKSVNNESAEFTGLSDALEKLGPIVRNSSLD
                     HNYRKELSEDRAIWKEICDCLNGAHLDRVEEKEPRHLRMRAVRGMILLGRNLSVENQR
                     LPQELALHSRVVELLAQVQCQYDEMEIALHKAAYELLYNLTRASATFDQQSLGNVCRA
                     LRYPLGAHGSRDLALPVSLYFLNMVRDDEFLFAFLKHPDADKIVYQFMLQGVIKNHTE
                     LFDVIDNKTHDLENLSSLGAIQMSIWSCLVTHASFSPYLERLESHNWEAFDTILRFAQ
                     LVVTSSEKWDKEQLTAITVWAFRIFESTASSVEEYTRRGIDDEAEASRLHQKLLVVLD
                     ILSVFSKYESIRKFIMFYNGVEVLINTLRYLQNHCMRINFTKAKSNMAATFKAYNSNY
                     ERVEDEGKIKSIINIETSSIKSTNFPECKSLIIEILGFLTYKNREVQDKCRELHGLEL
                     VLSNCVIDDNDPFIKERSIMCIRFLLEDNAENQSFVAQLEAKKAVNDDVLAEAGYEVK
                     VGADGKIGLTKNPRAAVEDKMDLNLT"
     gene            complement(<447537..>449075)
                     /locus_tag="AGOS_AAR059C"
                     /old_locus_tag="AAR059C"
                     /db_xref="GeneID:4618427"
     mRNA            complement(<447537..>449075)
                     /locus_tag="AGOS_AAR059C"
                     /old_locus_tag="AAR059C"
                     /product="AAR059Cp"
                     /transcript_id="NM_207953.1"
                     /db_xref="GeneID:4618427"
     CDS             complement(447537..449075)
                     /locus_tag="AGOS_AAR059C"
                     /old_locus_tag="AAR059C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR053W (THR4); The sequence of this gene comes from
                     strain ATCC 10895."
                     /codon_start=1
                     /product="AAR059Cp"
                     /protein_id="NP_982600.1"
                     /db_xref="GeneID:4618427"
                     /translation="MSQVYRSTRSSSEDTKSFEEAVIQGLAEDGGLFLPAVIPRLREE
                     TLFEHWAHLSFQDLAMEIMKFYIADWEIPAPELRELIERSYSSFRSEEVTPLRKNVTG
                     DDENLHILELFHGPTYAFKDVALQFVGNLFEYFLERKNRDVSEEERTHLTVVGATSGD
                     TGSAAIYGLRGKQDVSVFILYPHGRISPIQEEQMTTVEDENVHTMAIEGSFDNCQDIV
                     KSIFVDEEFNRKHNIAAVNSINWARILAQITYYFYSYFRATDGQPGRVKFIVPSGNFG
                     DILAGFYAKQMGLPIEKLVIATNENDILDRFLREGVYERSEDVTATHSPAMDILVSSN
                     FERLLWFFAREQLAQGDDQEAGSIVNRWFEQLREERRFDVPEHLLDAIRYHFDSERVD
                     NYNTLASIRHIYEHAQNPERYVIDPHTAVGICAANRQIAHDQNNEIHYISLATAHPAK
                     FADAVNEALSSYDDYNFDDVLPDRLRRLGDLEKRIKYVDNTDVDVIKSIIEEELINMG
                     IYNP"
     gene            complement(<449348..>450718)
                     /locus_tag="AGOS_AAR060C"
                     /old_locus_tag="AAR060C"
                     /db_xref="GeneID:4618467"
     mRNA            complement(<449348..>450718)
                     /locus_tag="AGOS_AAR060C"
                     /old_locus_tag="AAR060C"
                     /product="AAR060Cp"
                     /transcript_id="NM_207954.1"
                     /db_xref="GeneID:4618467"
     CDS             complement(449348..450718)
                     /locus_tag="AGOS_AAR060C"
                     /old_locus_tag="AAR060C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR023W (SNF12) and YCR052W (RSC6)"
                     /codon_start=1
                     /product="AAR060Cp"
                     /protein_id="NP_982601.1"
                     /db_xref="GeneID:4618467"
                     /translation="MNRAAKPSHKPMQQTSPAPVTQPTDTYVQPFLKELIPELKSLES
                     LRDAERRMDVYISRKKIDLHQSITQWTYQKQRDYSESQFLRVFISTIAENQPWQTNSD
                     DLDQGTWTLRIEGRLVNDENVQVPTRPKFSTFLQSIALDFHGQDGRAEDGDGDQLMDD
                     EGVPAVMPQRKYDIVEWHADPNTPVEFDGLDIKRQGTENVDCTITIQPKGYSGDQLQY
                     SDALAFIIGVARGTVHEAIYSLYKYILLNELLVADPSGNAKSTQNDDKMVIKVDAMIA
                     KLLPPAAEPRKYLKLTELPQVVNAHIKPIPPVRINYTIQVDKTSTYGELVFDIRVPRV
                     PVKDPEPASAQNSLAQQGMLLLTEFNTVTSQLEPQLATLEKKTQLLSLQLSSTANKYQ
                     FFNKLADDPVPMLNDYIKATSNALKVLSGDDGFDEDTVRRSNFYQENEAVLFENLGVL
                     LSNGRM"
     gene            <451072..>451503
                     /locus_tag="AGOS_AAR061W"
                     /old_locus_tag="AAR061W"
                     /db_xref="GeneID:4618813"
     mRNA            <451072..>451503
                     /locus_tag="AGOS_AAR061W"
                     /old_locus_tag="AAR061W"
                     /product="AAR061Wp"
                     /transcript_id="NM_207955.1"
                     /db_xref="GeneID:4618813"
     CDS             451072..451503
                     /locus_tag="AGOS_AAR061W"
                     /old_locus_tag="AAR061W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR022C (MRPL50)"
                     /codon_start=1
                     /product="AAR061Wp"
                     /protein_id="NP_982602.1"
                     /db_xref="GeneID:4618813"
                     /translation="MFRPTLRACSAYSKRNNKVRVQILQNFERFQLYRGEVVNVSPSL
                     MRNYLHRNNGARYILWEKDIDQGLVQEAAATRQRMLSQRAAAEASEPDAEPVTIQKTA
                     ETGSPAAEPTEKEAPAEAPAKRSGLSPRPTVADVKIPGLEL"
     gene            complement(<451601..>452830)
                     /locus_tag="AGOS_AAR062C"
                     /old_locus_tag="AAR062C"
                     /db_xref="GeneID:4618678"
     mRNA            complement(<451601..>452830)
                     /locus_tag="AGOS_AAR062C"
                     /old_locus_tag="AAR062C"
                     /product="AAR062Cp"
                     /transcript_id="NM_207956.1"
                     /db_xref="GeneID:4618678"
     CDS             complement(451601..452830)
                     /locus_tag="AGOS_AAR062C"
                     /old_locus_tag="AAR062C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR021W"
                     /codon_start=1
                     /product="AAR062Cp"
                     /protein_id="NP_982603.1"
                     /db_xref="GeneID:4618678"
                     /translation="MTGVFGFLSKGLDAINSLNSHYFALSVDEQKAMTFVERIRYYNW
                     TFEGICVVLLGLMYAVYVAGTKLNERRSDRLFEQLNKFFWEELQFARVGFSSRDKGRL
                     PYISDRNGTWCTAFATGRTCVDHIVVKAHYPARFNPVGLLVEKLLGMFFPQVVDPHGD
                     EFVQVTVTPNGKWTKDENSAVQATEDGLNRFRFIASIVNKNGMNDSRGKNYFLSLTHT
                     SEGETLPMEYVFMSENNQLNKLLVSYMDGEAFRQTLKRAAHFLRFIAFTDLPEEKPVT
                     DKLWEANQKPRCVIQCSAVLTDADVALLRELIAAVVAFYDVTTREIVQQSPSLLLTNE
                     TLRRSVQLRKDELSKIVKIMKQVEREMAQEKKAEEEKKKRRELRDSLSGEQQDKLDQK
                     LKQKRDRRKKNKQALRV"
     gene            complement(<453075..>453737)
                     /locus_tag="AGOS_AAR063C"
                     /old_locus_tag="AAR063C"
                     /db_xref="GeneID:4618729"
     mRNA            complement(<453075..>453737)
                     /locus_tag="AGOS_AAR063C"
                     /old_locus_tag="AAR063C"
                     /product="AAR063Cp"
                     /transcript_id="NM_207957.1"
                     /db_xref="GeneID:4618729"
     CDS             complement(453075..453737)
                     /locus_tag="AGOS_AAR063C"
                     /old_locus_tag="AAR063C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR051W"
                     /codon_start=1
                     /product="AAR063Cp"
                     /protein_id="NP_982604.1"
                     /db_xref="GeneID:4618729"
                     /translation="MNVWVAASDGLTAQVEELLQQTGADANVKDPNGYTPMHAAAAYG
                     HIDLLRLLIANYRGDVNVRDNDGDTPLHHAEDLQTVRVLVEELGADPSLLNADGNTPL
                     AVYEDDAENAELIEYMRARLGGSACGPAAADAAADAAADLELPDIDSGKLAEFRESIR
                     YTLENVPADETDPESVQRRQRLEEIMRSDCPDEQLEAYIRDMVRNQFFPSTDDTNAKR
                     RR"
     gene            <454054..>454797
                     /locus_tag="AGOS_AAR064W"
                     /old_locus_tag="AAR064W"
                     /db_xref="GeneID:4618790"
     mRNA            <454054..>454797
                     /locus_tag="AGOS_AAR064W"
                     /old_locus_tag="AAR064W"
                     /product="AAR064Wp"
                     /transcript_id="NM_207958.1"
                     /db_xref="GeneID:4618790"
     CDS             454054..454797
                     /locus_tag="AGOS_AAR064W"
                     /old_locus_tag="AAR064W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR020C (ATP23)"
                     /codon_start=1
                     /product="AAR064Wp"
                     /protein_id="NP_982605.1"
                     /db_xref="GeneID:4618790"
                     /translation="MSKEPNFPPSEKLEKVEAPADLRSIAGFEWWRRTFEYKTGLGLT
                     PEAKVQYEKDYQYVLQREQCKQCYDNRDWLLKYSPTVVFMTQQIAKLNRRRTGDDSLH
                     FDTSKIICDVCPEWKSGGFNPSLGILLCQNRIRDKWQMEDTLSHELVHQFDELKFEVD
                     WMNLKHHACSEVRASNLSGECRLSQEFFRRGFNGSFGRGHQECVRRRAVLSVMGNPKC
                     KDKAEAEQIVDEVWQSCFNDTRPFEEIYR"
     gene            complement(<454889..>456673)
                     /locus_tag="AGOS_AAR065C"
                     /old_locus_tag="AAR065C"
                     /db_xref="GeneID:4618792"
     mRNA            complement(<454889..>456673)
                     /locus_tag="AGOS_AAR065C"
                     /old_locus_tag="AAR065C"
                     /product="AAR065Cp"
                     /transcript_id="NM_207959.1"
                     /db_xref="GeneID:4618792"
     CDS             complement(454889..456673)
                     /locus_tag="AGOS_AAR065C"
                     /old_locus_tag="AAR065C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR019W (ARE2) and YCR048W (ARE1)"
                     /codon_start=1
                     /product="AAR065Cp"
                     /protein_id="NP_982606.1"
                     /db_xref="GeneID:4618792"
                     /translation="MAQVLAHNKDFLRIQELNADGERERRSLYEDQLQAVEEEECLEG
                     CAQTVVITAAEPTSAEKTREAAVGGRRQTPPPWYTSALMRKERLRFHQGSGEMQSLLR
                     DVQFQCRGTIMDAFVNDPLRIYFSGPCFDSDKNRRLEAEVVEGPAVVRGVALGDGGQV
                     TVQTVTTNFSGFYVLFWLSVAFALVKVTAGYYIKNDGNIMQSEIVHYMTTDLWRVAWF
                     DLLMYLCTYFVFGVQWMCRRGWLRWAGAGWLLTSVYELLFFAYFTYVAEHTMRFKWIS
                     KIFLFLHSCVLVMKMHSYAFYNGYLWQILDELQFSRESLALLKDLDDEVDESVLRTLE
                     KSEKFCQFELNSQSTSELFPSNITLRNYFMYSMFPTVVYQISYPRTDRIRWSYFMEKL
                     AAIAGIIFIMMVVAQLLIYPVTIKAMSLRELGMSFSDRAKLWPNLLIEVVPGFIIMYL
                     LVWYLIWDAILNCIAELTRFGDRYFYGDWWNCVNWGDFSRLWNVPVHKFLLRHVYHSS
                     LSAFCLSTTQATFMTFILSSLIHELAMYVIFGKLRFYLFLFQMAQLPLMALNNSKLLH
                     NKKVLLNVLFWLGICTGPSVICTIYLTF"
     gene            <457143..>457946
                     /locus_tag="AGOS_AAR066W"
                     /old_locus_tag="AAR066W"
                     /db_xref="GeneID:4618660"
     mRNA            <457143..>457946
                     /locus_tag="AGOS_AAR066W"
                     /old_locus_tag="AAR066W"
                     /product="AAR066Wp"
                     /transcript_id="NM_207960.1"
                     /db_xref="GeneID:4618660"
     CDS             457143..457946
                     /locus_tag="AGOS_AAR066W"
                     /old_locus_tag="AAR066W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR047C (BUD23)"
                     /codon_start=1
                     /product="AAR066Wp"
                     /protein_id="NP_982607.1"
                     /db_xref="GeneID:4618660"
                     /translation="MSRPEDLAPPEVFYNDGESQKYTSSTRVQHIQAKMTLRALELLN
                     VPPCSFILDVGCGSGLSGEILTEEGHMWCGMDIAPSMLATALTREVEGDLVLQDIGVG
                     VPFRAGTFDAAISISAIQWLCNADTSYNDPRRRLMRFFNTLFAALKKGGKFVAQFYPK
                     TDEQVEQILGAAKVAGFSGGLVIDDPESKKNKKYYLVLSAGAARDEEQVNLQGVTMNA
                     DLLQQRARKRKEAESRKEYIMRKKDVMKKRGRKVAKDSKFTGRKRRPRF"
     gene            <458109..>458681
                     /locus_tag="AGOS_AAR067W"
                     /old_locus_tag="AAR067W"
                     /db_xref="GeneID:4618507"
     mRNA            <458109..>458681
                     /locus_tag="AGOS_AAR067W"
                     /old_locus_tag="AAR067W"
                     /product="mitochondrial 54S ribosomal protein IMG1"
                     /transcript_id="NM_207961.1"
                     /db_xref="GeneID:4618507"
     CDS             458109..458681
                     /locus_tag="AGOS_AAR067W"
                     /old_locus_tag="AAR067W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR046C (IMG1)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein IMG1"
                     /protein_id="NP_982608.1"
                     /db_xref="GeneID:4618507"
                     /translation="MEPAHRHHHSAYNGDSLRAMLAARLPFAAARPLCRTFQIPTTAS
                     KVIPVYPPVEQRARDVIKQISEAKLAQLDPQGVRRKLLSKAEEGCVKAGDIVRVMYDT
                     AKCNYGTIYGYVLSVDRGKIVEDSSLLLRNHIGKTSVETRVPVFSPLLARIDILRRGD
                     PKRRRNKHYYIRNTRLDVGDLESSMRRRKS"
     gene            complement(<458918..>459583)
                     /locus_tag="AGOS_AAR068C"
                     /old_locus_tag="AAR068C"
                     /db_xref="GeneID:4618544"
     mRNA            complement(<458918..>459583)
                     /locus_tag="AGOS_AAR068C"
                     /old_locus_tag="AAR068C"
                     /product="AAR068Cp"
                     /transcript_id="NM_207962.1"
                     /db_xref="GeneID:4618544"
     CDS             complement(458918..459583)
                     /locus_tag="AGOS_AAR068C"
                     /old_locus_tag="AAR068C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR018W (AIM38)"
                     /codon_start=1
                     /product="AAR068Cp"
                     /protein_id="NP_982609.1"
                     /db_xref="GeneID:4618544"
                     /translation="MKLLTEEEISAHRYHTLSGGIKGMMGGLAISAFIFKVVPMRFPR
                     FNPMNFSYSIRTAILISPPTLLASICAEEASNHFDRLMYGANADPNTLAEAKRWAELP
                     LGDKLLESGLNNKYKIIGSLWAASMYGSWRLVDRDPIMTKVQKAVQARMYAQALTVVM
                     LLASVMLSMYGAKRNPENKEQRRQRQWELLLDQAANEEREFENSRRLSNEERVKGKIY
                     RYD"
     gene            <460792..>463062
                     /locus_tag="AGOS_AAR069W"
                     /old_locus_tag="AAR069W"
                     /db_xref="GeneID:4618529"
     mRNA            <460792..>463062
                     /locus_tag="AGOS_AAR069W"
                     /old_locus_tag="AAR069W"
                     /product="AAR069Wp"
                     /transcript_id="NM_207963.2"
                     /db_xref="GeneID:4618529"
     CDS             460792..463062
                     /locus_tag="AGOS_AAR069W"
                     /old_locus_tag="AAR069W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR045C (RRT12)"
                     /codon_start=1
                     /product="AAR069Wp"
                     /protein_id="NP_982610.2"
                     /db_xref="GeneID:4618529"
                     /translation="MLYKRTVYWLLSVLLLSDGISAEEYVITLKAPKTLSKLLAVKLG
                     NRTLKQILDARIKQKFSFGKFEAITVDIPPFLADTLTENKWISHISLNEEYNLLGDEY
                     AGEEDTGDDNGDEFENESDDDDGDDEDEEEEEEEDGDGEDGDDDDDTEEDDSRGPPRP
                     EYPVAPPSPQRPVFPPEPETPIEVPDPEPEPPVEFPEPEEPIEKPGPKRPVNPPEDEE
                     PYNPPEPEAPAEPQPDHPISPPESEQPSDPDTQPPNDPPSFDPQPDQPVERPDLDRPE
                     PEKPGNDEPSEGAPEFPTNPEEPQPPSDSPETPEPSNPPESDPIVPSDPETPSDPEPE
                     QPVDVPVPAPVTPPGPEEPTSTPDPDSPPDKEQRPDDFDQPRENPNDQQPSPNPDRPE
                     PIRGIPAEPVAGAPGEGLHQYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDE
                     EHLGEGVNVYVLDSGIYKSHPEFDGRAHFGIDTTKEGPGDLNGHGTHVAGLVGSRTFG
                     IAKKANIYEIKVMTVDGRGSTSNIIAGVEFAVKHCQQSGKRCVANMSLGGLSFGHSAL
                     DSAVEAAIEEGLVFVVAAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKC
                     VDIFAPGVAVASLSNSPSNTMRVLNGTSMSAPITAGVVAVLLDQGIEPHEVKDHLLSI
                     STKGLFHKRRLVSSRTPDRALFTGVKREDDSFSTEKFPFVNEEAYLKFIGDDLKKVQG
                     PSLFRKVLRSSLSKVI"
     gene            complement(<463313..>464116)
                     /locus_tag="AGOS_AAR070C"
                     /old_locus_tag="AAR070C"
                     /db_xref="GeneID:4618706"
     mRNA            complement(<463313..>464116)
                     /locus_tag="AGOS_AAR070C"
                     /old_locus_tag="AAR070C"
                     /product="AAR070Cp"
                     /transcript_id="NM_207964.1"
                     /db_xref="GeneID:4618706"
     CDS             complement(463313..464116)
                     /locus_tag="AGOS_AAR070C"
                     /old_locus_tag="AAR070C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR017W (TIM23)"
                     /codon_start=1
                     /product="AAR070Cp"
                     /protein_id="NP_982611.1"
                     /db_xref="GeneID:4618706"
                     /translation="MCHVMNEKFSASSRRATRAQSHHQVKHDGGPTEHRPVEGSHKVS
                     ARQGYQTKELRWDMSFLFGSKKQDSGADDRKLQETLGFDPQQVTNVANIIATPGALDP
                     SRLHPLAGLERGVEYLDLDEEKLSSVEGSQGLIPSRGWTDDLCYGTGSVYLTGLGLGG
                     AYGFFEGLRNIPPNAPGKLQLNTVLNHITRRGPFLGNNAGVLALTYNLINSTIEGLRG
                     KHDAAGSIASGAIAGALFKSSKGLKPMYYASGSMALVAAGWCGLKTLLL"
     misc_feature    complement(464762..465692)
                     /note="pseudo-gene; similar to Saccharomyces cerevisiae
                     TY3B"
     gene            <466766..>473461
                     /locus_tag="AGOS_AAR071W"
                     /old_locus_tag="AAR071W"
                     /db_xref="GeneID:4618419"
     mRNA            <466766..>473461
                     /locus_tag="AGOS_AAR071W"
                     /old_locus_tag="AAR071W"
                     /product="AAR071Wp"
                     /transcript_id="NM_207965.1"
                     /db_xref="GeneID:4618419"
     CDS             466766..473461
                     /locus_tag="AGOS_AAR071W"
                     /old_locus_tag="AAR071W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR016C (ACC1) and YMR207C (HFA1)"
                     /codon_start=1
                     /product="AAR071Wp"
                     /protein_id="NP_982612.1"
                     /db_xref="GeneID:4618419"
                     /translation="MSEGSFTEAMESQKRYEFTDYSAKHARLAPHFIGLNTVEQAEAS
                     PLRDYVRLHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPED
                     LEANTEYIRMADQYVEVPGGTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLP
                     EKLARSKRKVVFIGPPGSAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTK
                     LVSVADDIYQKGCCLSPEDGLNKAKQIGFPVMVKASEGGGGKGIRKVVREEDFISLYQ
                     QAANEIPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPV
                     TIAKPDTFAEMERAAVRLGKLVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTE
                     MVTGVNLPAAQLQIAMGIPLHRIRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIP
                     KGHCTACRITSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGH
                     IFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDDLI
                     SQKISAEKPDPMLAVICGATTKAHIASEQALQEYASYLKRGQVPNKNMLKTMYPVEFI
                     HEEKRYKFTVAKSADDRYNLFINGSRCEVGLRKLSDGGLLIAAGGKSHTVYWKEEVAA
                     TRLSIDHQTTLLETENDPTQLRTPSPGKLVNFLVESGDHLEAGQPYAEIEVMKMQMPL
                     IAQESGVLQLLRQPGSTLAAGDILAILTLDDPSKVKYAMPFEGMLPDLGAPVIEGTKP
                     AYKFRSLVSTLENVLKGYDNQVIMNASLQKLIEVLRDPQLPYSEWKMQVSALHSRLPQ
                     ALDQQLEQLVERCHKRSADFPAKQLGKILENAINERKSDPLFQTVVEPLTSITTRYKT
                     GLQDHEHAVLGSFLENYYSVEKLFSGSKVNEEDVILKLRDENADDLNKVVMTVLSHSR
                     VSAKNNLISAILKHYRPLCKLSSEVAAKISVPLKHIVQLESKATAKVALQAREILIQA
                     ALPSVRERTEQLEHILKSSVVKPTYGATEMNHTDPNIEVLKDLIDSNYVVFDVLTQFL
                     NHRDKYVIAAAAEVYIRRAYRVYTVGDIKYHSGFDTPIFEWKFQLPSAAFTSRPQVTS
                     RLGVNRAISISDLTYVSEAENQPSRTGLLVPAPHLDDVDSILSNALSVIPMQLSHSGP
                     LPDRSAAANPSLSNVVNVVISSTEGFDSEAEVLDRLKEILELNKSELLASAIRRITFV
                     FGYRDGSYPKYYTFRGSDYVEDKTIRHIEPALAYQLELGRMSNFHIKPIFTENRNIHV
                     YEAIGKNSPVDKRFFTRGIIRTGRIRDDITIQEYLTSEANRLMSDILDNLEVTDTSNS
                     DLNHIFINFSAVFDVSPADVEAAFGGFLERFGKRLLRLRVAAAEIRIMIKDPGSGTPV
                     ALRALINNVSGYVVRTELYTEVKNANGDRIFKSLDKPGSMHLRPIATPYPVKEWLQPK
                     RYKAHLMGTTYVYDFPELFRQATLSQWRKHSPKMQLSDDFFIANELISDENGELTEVD
                     REPGTNSIGMVAFKVTVKTPEYPHGRQFVIIANDITYMIGSFGPQEDEFFEKVTNYAR
                     KRGIPRIYLSANSGARIGIAEELVPMFSVAWKTPGNPEKGFDYLYFTTEMYETLKQSG
                     KENVVITERIVEDGEERYAIKAIIGSEDGLGVECLRGSGLIAGATSKAYKDIFTITLV
                     TCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKVLGKEVYSSNLQLGGTQIMYNN
                     GVSHLTAQDDLAGVEQIMEWLSYIPAKRNMPVPILQSEDNWDRDVEYTPTLSQPYDVR
                     WMIEGRQGPDGFEYGLFDKGSFQETLSGWARGVVVGRARMGGIPLGVIAVDTRTIETV
                     IPADPANPASTETLIQEAGLVWYPNSAFKTAQAIADFNHGEQLPLMILANWRGFSGGQ
                     RDMYNEVLKYGSFIVDALVDYKQPVFVYIPPTGELRGGSWVVVDPTINSDQMEMYADS
                     DSRAGVLEPAGMVGIKYRREKLLKTMERLDAKYKELKDSLSDSSLSSEEHQKLANELA
                     AREKLLLPIYQQVSIQFAGLHDKAGRMLAKGVIRKELQWVNARRFFFWRLRRRLNEEY
                     LIRRLESELPNASRLEKFARLRSWYPASVDQENDQQVATWIEENYQVLEDYLQALKLE
                     SFAQNLAKAIRSDHDNAITGLAEVLKLLSAEDKEKIMKSLK"
     gene            complement(<473583..>474737)
                     /locus_tag="AGOS_AAR072C"
                     /old_locus_tag="AAR072C"
                     /db_xref="GeneID:4618403"
     mRNA            complement(<473583..>474737)
                     /locus_tag="AGOS_AAR072C"
                     /old_locus_tag="AAR072C"
                     /product="AAR072Cp"
                     /transcript_id="NM_207966.1"
                     /db_xref="GeneID:4618403"
     CDS             complement(473583..474737)
                     /locus_tag="AGOS_AAR072C"
                     /old_locus_tag="AAR072C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR015W (SMM1)"
                     /codon_start=1
                     /product="AAR072Cp"
                     /protein_id="NP_982613.1"
                     /db_xref="GeneID:4618403"
                     /translation="MANYAGKLVLAPMVRAGELPTRLLALRHGADLVWGPEIIDKKLV
                     QCQRVPNDELQTVDYVLPSTHAGKPPVVVFRTAPALEGGRVIFQLGTASPTLAVRAAN
                     TVIGDVAGIDVNAGCPKHFSIHAGMGAALLRTPDTLCGILRALVDEVGRPHSKPISVK
                     IRLLDDLAATLDLVEKLCATGISNLTVHCRTTPMRNREAPIRSYLASIFELCQASKVS
                     LIMNGALEGRKHFEEVRAELKLPTDVGGMIAEAAEANPTVFSLNPLPWHQAVPEYLQI
                     ADQYRNHTSNTKYMMNRMVPGKSPFYQYFIRCKTSDDFLYVGKQLGPNGECLSDPTEY
                     LAKSRKEEQQEKKATKGKLLQHHDESQSKGKRVLEDENSQESKRTKTEQA"
     gene            <475508..>479134
                     /locus_tag="AGOS_AAR073W"
                     /old_locus_tag="AAR073W"
                     /db_xref="GeneID:4618656"
     mRNA            <475508..>479134
                     /locus_tag="AGOS_AAR073W"
                     /old_locus_tag="AAR073W"
                     /product="AAR073Wp"
                     /transcript_id="NM_207967.1"
                     /db_xref="GeneID:4618656"
     CDS             475508..479134
                     /locus_tag="AGOS_AAR073W"
                     /old_locus_tag="AAR073W"
                     /note="NOHBY109; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F06116g"
                     /codon_start=1
                     /product="AAR073Wp"
                     /protein_id="NP_982614.1"
                     /db_xref="GeneID:4618656"
                     /translation="MFKALKKKIQHGKHHAGKAGSDKALDDGRHRSIFGNCGPRLSGA
                     AALGPEIQLIPKQQTLQRGPTRVKPEVCEELLTAAAIYERLRQEDQANGRLIDAYYVY
                     DREAYKAAPAGQDGRDPAFDVFASACVTPTSGRYVIFQLAAFFIEQLNSQLGTGSNST
                     DMIRAAMEIFKPNLSHYSFSETQQIRQLLASFFPRAGCTLAGTALREAIEREFRNNWN
                     RLILALRILWAELPESIVPWDCFITFKRLEERDGYPTSAFFMLLKQVLPSHDYMCTTY
                     AFLEILVTIVGRTDLLVEKTTQMDLIFTAGQVCFPSCKAVEEYKDANDEGNDDELILN
                     KIYRNRGSALYHLFVAYLRSLADKGKIKDFYLLDNFDVHEYPPGPYRPMTQRALTLTV
                     PRFIPESDMRNDFNQLIKFVAKAGSRIYSSQHAFSKLENSFLDKFEENPLKVVEGLFS
                     KSSKRYLYKFDKHFSTNYFKTLNDRQGWNRALHELDPTNQYAVSTWIESCKQHGFSEF
                     LSMLEDNMGGEGTLALGHPLLASLTEELSFNAKEEEEELAAVRLSKMGVSEWFISSWK
                     YEMFLGKIYNTLVIKLTKRVGDCDWIVISTDDRVSTSAMLQNRPLPTPPTTNPSRSDS
                     KEEVLPKPVKPYCPTVHSTYSDQSSIRMRPPPLDTATDPFDSPMISSPTSAHTRRRSV
                     VSNGKINEGSVSSSKHLSETGDTSSTAGTGKLFITSESPISSSTPIDNRLYFKDKPRQ
                     PPAISNIVIPQPLPVSDPGRQEERLFTPTGGAFVLPRPHIPMKIQNPSMNSFPKSAAD
                     RHISMIREEEVEQVSSPSSVRGPRSVSEPPTVPSHLMQGVPAMVPEAASEDELDKPLI
                     PPAKPVDFRCRELQLIAKMAPDLCKPLPMPKEPSSLMSPVSDASDKEEPAFPEPMQAA
                     VNTLLSENGDLRKPGNRATVIVYPKYDSVPDEEEDEDDEFSEDDSAVDPAEQLPVGVT
                     EKPPQETSAVAPHDGQSTSEWASDDAPSDGLDFSMPPNQGFAKPSPAANGMKTLSLPP
                     EAPASTNDFLEDFIDGYNEHSMLPPASHNPPEAPADETLFERVKRYYEDSPFERVPTI
                     RSATAPVAEDSGVDRHVALERSPTTPKPLTPGPLERPAVKRLSWSQESSVRSAERGAL
                     RRRQASWTYSMASTVPPDEDNGFFDSDASESPDDDGLHISRFKNALLKTKRSINRLNS
                     NHKA"
     gene            complement(<479294..>479845)
                     /locus_tag="AGOS_AAR074C"
                     /old_locus_tag="AAR074C"
                     /db_xref="GeneID:4618690"
     mRNA            complement(<479294..>479845)
                     /locus_tag="AGOS_AAR074C"
                     /old_locus_tag="AAR074C"
                     /product="AAR074Cp"
                     /transcript_id="NM_207968.1"
                     /db_xref="GeneID:4618690"
     CDS             complement(479294..479845)
                     /locus_tag="AGOS_AAR074C"
                     /old_locus_tag="AAR074C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR206W and YNR014W"
                     /codon_start=1
                     /product="AAR074Cp"
                     /protein_id="NP_982615.1"
                     /db_xref="GeneID:4618690"
                     /translation="MADSQNTPVNAQITLCAVADSRPEQWAGADIRAWALQRPLSNSQ
                     KICDLYQCVHCGEVAARRAKRRSARRASETHAEGPWDEPAARSLHITVSYEEVEWRLR
                     RRTLPILPSAQDARGARGAAPLFQASVDEDDAGSCEESESAPGSAGARAGDDVVLTSP
                     CSRHHHRRNSIAVRFTKTCLKTL"
     gene            complement(<480356..>480877)
                     /locus_tag="AGOS_AAR075C"
                     /old_locus_tag="AAR075C"
                     /db_xref="GeneID:4618448"
     mRNA            complement(<480356..>480877)
                     /locus_tag="AGOS_AAR075C"
                     /old_locus_tag="AAR075C"
                     /product="AAR075Cp"
                     /transcript_id="NM_207969.1"
                     /db_xref="GeneID:4618448"
     CDS             complement(480356..480877)
                     /locus_tag="AGOS_AAR075C"
                     /old_locus_tag="AAR075C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR193C (UPS1)"
                     /codon_start=1
                     /product="AAR075Cp"
                     /protein_id="NP_982616.1"
                     /db_xref="GeneID:4618448"
                     /translation="MVLWYKNTHVFERDFQTVSLAFFNRYPNPYAAHVLSIDTIARDV
                     DADGRLHTTRLIKKMGKLPAWARPLLGRISESWIIEMSSVDAARQEMRTYTRNLDHTK
                     VIKVEEYTCYRFRDGATVADSRVRFSSGIRMGIKGRIESWSHRTFDENIKRSRLGMAF
                     VMDKLEERAKLLL"
     gene            complement(<481159..>481818)
                     /locus_tag="AGOS_AAR076C"
                     /old_locus_tag="AAR076C"
                     /db_xref="GeneID:4618521"
     mRNA            complement(<481159..>481818)
                     /locus_tag="AGOS_AAR076C"
                     /old_locus_tag="AAR076C"
                     /product="AAR076Cp"
                     /transcript_id="NM_207970.1"
                     /db_xref="GeneID:4618521"
     CDS             complement(481159..481818)
                     /locus_tag="AGOS_AAR076C"
                     /old_locus_tag="AAR076C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR194C"
                     /codon_start=1
                     /product="AAR076Cp"
                     /protein_id="NP_982617.1"
                     /db_xref="GeneID:4618521"
                     /translation="MKLYPAAIALFAAYVRAAADDDSDSDSVRPQSRTSASTARNNGQ
                     FAVPPSTTITLTRDGTVYTSYAWWLPEASDAYGSDKPLDYATTTDSRGRTTTSPVWWR
                     AGTESAKPSRSASASVASDAESSTGASRSRRQTTSLAGSSAASSGSASARSASSSASS
                     ASSASARSASSSSLSDISTTTNGSPSPLRALRALPAGSAHYSAGTLASAICVIAAAAL
                     L"
     gene            complement(<482261..>483619)
                     /locus_tag="AGOS_AAR077C"
                     /old_locus_tag="AAR077C"
                     /db_xref="GeneID:4618539"
     mRNA            complement(<482261..>483619)
                     /locus_tag="AGOS_AAR077C"
                     /old_locus_tag="AAR077C"
                     /product="AAR077Cp"
                     /transcript_id="NM_207971.1"
                     /db_xref="GeneID:4618539"
     CDS             complement(482261..483619)
                     /locus_tag="AGOS_AAR077C"
                     /old_locus_tag="AAR077C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR195C (NMT1)"
                     /codon_start=1
                     /product="AAR077Cp"
                     /protein_id="NP_982618.1"
                     /db_xref="GeneID:4618539"
                     /translation="MGDSGDAQKMQRLLEMLALNSGDMSKLTQQQRKAFEEYKFWKTQ
                     PVARFDEKVEEEGPINPPRRVEDVRDEPYPLLEEFEWRTMDITTGQDLEDVFVLLNEN
                     YIEDKDSTFRFNYTREFFNWALKPPGWRKEWHVGVRVRQSGRLVAFISAVPTTLEVRG
                     REMKSVEINFLCIHKKLRSKRLAPILIKEITRRVNKCDIWHALYSAGIVLPSPISTCR
                     YTHRPLNWSKLFDVGFTALPANATKTQMLAKYTLPKKPLVEGLRPMTDADVDGAFDLF
                     NRYQKRFELIQTFDKSEFRHWFLGNEETPSVIYSYVVQNSEGKITDFVSFYSLPFTIL
                     KNPLHKELGIGYLFYYASDADFDYEDRYDPTATELLRKRLTQLINDVCILARDLKMDV
                     FNALTSQDNALFLEDLKFGPGDGFLNFYLFNYRANPIRGGLTEDKKFDAKNRSNQGVV
                     ML"
     gene            <483964..>485652
                     /locus_tag="AGOS_AAR078W"
                     /old_locus_tag="AAR078W"
                     /db_xref="GeneID:4618500"
     mRNA            <483964..>485652
                     /locus_tag="AGOS_AAR078W"
                     /old_locus_tag="AAR078W"
                     /product="AAR078Wp"
                     /transcript_id="NM_207972.1"
                     /db_xref="GeneID:4618500"
     CDS             483964..485652
                     /locus_tag="AGOS_AAR078W"
                     /old_locus_tag="AAR078W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR196W (PWP1)"
                     /codon_start=1
                     /product="AAR078Wp"
                     /protein_id="NP_982619.1"
                     /db_xref="GeneID:4618500"
                     /translation="MLSSTTWVPRGFASEFPEKYELDDAEMARINELAQLQLDDAEEG
                     LEEAGGAQEGAALWAQLDGDDDLKEYDLEHYDEEDAGAGAEVTMFPGLSGEARFHEGE
                     EGQDAYLSLPTVEEEQEERAELQVYPTDNLVLATRTEDDISYLDVYVYDDGAGFHDEA
                     VPQEAGDAQDPDVARGLIRDASLYVHHDLMLPAFPLCVEWVNYRPGSNSDAPANFAAV
                     GTFDPTIELWNLDCVDRAFPDMILGEPADSATASKKSKKKKKGKKQHVATHHTDAVLS
                     LAHNRHFRAVLASTSADHTVKLWDLNHGRAARSLDAVHSATAVSSSQWHPSDGSILLT
                     AGYDSRVALSDVRIANDAGMSKYWKVMKGEEIESATFVSETVFLAGTDSGNVYSFDLR
                     NGEDSAPLWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKTPAEGASAQEGPR
                     MVLSRDFGVGNVLSTSFAPDVEVASTFVVGGTSPGLKLWDAFTNRTVRKSFASELQAV
                     QQRAREEAKQLGKASRIARKYISNSNPDTVVTVDDNGSDEEEQEGAADDWEDEE"
     gene            complement(<485801..>486352)
                     /locus_tag="AGOS_AAR079C"
                     /old_locus_tag="AAR079C"
                     /db_xref="GeneID:4618502"
     mRNA            complement(<485801..>486352)
                     /locus_tag="AGOS_AAR079C"
                     /old_locus_tag="AAR079C"
                     /product="AAR079Cp"
                     /transcript_id="NM_207973.1"
                     /db_xref="GeneID:4618502"
     CDS             complement(485801..486352)
                     /locus_tag="AGOS_AAR079C"
                     /old_locus_tag="AAR079C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL169C (UGX2)"
                     /codon_start=1
                     /product="AAR079Cp"
                     /protein_id="NP_982620.1"
                     /db_xref="GeneID:4618502"
                     /translation="MTNKVFLSECMLQSEKSVAYSTSFASEPYAGSATCQFTISTSES
                     QGFSWNQDIFASQYQQLCKVIYDGHVDSVDKLLQKITPPGNHEENVYMDVFEAERGAE
                     RGAEYGQRFGPAEASPSRRGSNFDEWRSRMSRELSKPRRRSEQSISFASDSKNGTYRA
                     ADVVVIDVEAATPENMHFKELLS"
     gene            <487074..>488789
                     /locus_tag="AGOS_AAR080W"
                     /old_locus_tag="AAR080W"
                     /db_xref="GeneID:4618673"
     mRNA            <487074..>488789
                     /locus_tag="AGOS_AAR080W"
                     /old_locus_tag="AAR080W"
                     /product="AAR080Wp"
                     /transcript_id="NM_207974.2"
                     /db_xref="GeneID:4618673"
     CDS             487074..488789
                     /locus_tag="AGOS_AAR080W"
                     /old_locus_tag="AAR080W"
                     /note="NOHBY110; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F09427g"
                     /codon_start=1
                     /product="AAR080Wp"
                     /protein_id="NP_982621.2"
                     /db_xref="GeneID:4618673"
                     /translation="MAREDMDRGSSWIKETEGGSQTSGPSKGADMQVSVTLDEQQPLV
                     GGQRADEEVLARWRGRWVFPAWLLVCFSTGPTYVMMRSFVPASLQTIAHELGHPKGHP
                     AAHCRPRGDDCYIYVGGRDVQFTAYVLYMRALYTSIEGLIAIVLMGLADFSNYRKWLM
                     TLSIVMYGALATPFVSQGSKTYGALILMSVLYCLMLCCNTIYTITEGSYIPVFMDMAR
                     LAAARDAASAKLGDGVEERTAGEPVNPMLRRGAKVSVLGLIMGNLGSIVAVLVGIIIT
                     YSRGKPQAEGYSAFLLTITIAGCATIVLGSVASLGIPAIHGSRFPFDPQENKLITICK
                     FPFRRFMYILRDLTHYREAFKYVVAWVLWNIAYSNFMQLFQLSFRATLGSTADKEYFV
                     WQLMTSVIACVGSLTWMAVFRHFSARRTLRAQTQLLKTCLYAMMAVGVVVNFWGSLGA
                     SSRVPIGFKHRWEFWFFQVIYVSTSSAIRSLNRVAYSAMLPAGRENQYFGLEIMLGLA
                     TGWSQSLLVSVIQDRTGNARFPYIPNTLLLIVSLGFYYWSDLSHGMLAAGKAELHRAA
                     PQDAS"
     gene            complement(<488829..>490082)
                     /locus_tag="AGOS_AAR081C"
                     /old_locus_tag="AAR081C"
                     /db_xref="GeneID:4618590"
     mRNA            complement(<488829..>490082)
                     /locus_tag="AGOS_AAR081C"
                     /old_locus_tag="AAR081C"
                     /product="AAR081Cp"
                     /transcript_id="NM_207975.1"
                     /db_xref="GeneID:4618590"
     CDS             complement(488829..490082)
                     /locus_tag="AGOS_AAR081C"
                     /old_locus_tag="AAR081C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR122W"
                     /codon_start=1
                     /product="AAR081Cp"
                     /protein_id="NP_982622.1"
                     /db_xref="GeneID:4618590"
                     /translation="MASLSVVDIAAVGAGPPRRPDNCAADWPRGGPISSGRSRARPRR
                     GLYARARRRPLPAAETMIAASIQMEAPAAEPYPGAAAQLKAVRGSVAEQLDAWRDYAC
                     ALLARWLDAGPAHAALGAEAARAVLHMAACYEQLAQELAERAYDDKNAVSEAWRASTA
                     MSKRAIGLAAFIRRLDIPPTAADAALRETYHRVWVLDQQVRVLILAVAKMQRRLGGNR
                     YDELLTLQESDPEKLLENAQVYGRLAQGCAQECRRLGGSAVEPQAARLGVFLEALALA
                     LFSVGQYERGECGVALGMVEAAEEQLVAGDIAPREYLGMLREPRRQARQARLRGKLQQ
                     LRQRVRRRPAARLHPFVQRVADEFLTPLVVLLRYRYGRANDTLYMQPVVRQWQLPQGR
                     VAETAGTRWEFDGELHEVGAEEQYF"
     gene            <490287..>491675
                     /locus_tag="AGOS_AAR082W"
                     /old_locus_tag="AAR082W"
                     /db_xref="GeneID:4618638"
     mRNA            <490287..>491675
                     /locus_tag="AGOS_AAR082W"
                     /old_locus_tag="AAR082W"
                     /product="AAR082Wp"
                     /transcript_id="NM_207976.1"
                     /db_xref="GeneID:4618638"
     CDS             490287..491675
                     /locus_tag="AGOS_AAR082W"
                     /old_locus_tag="AAR082W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR138C (MEP3) and YGR121C (MEP1)"
                     /codon_start=1
                     /product="AAR082Wp"
                     /protein_id="NP_982623.1"
                     /db_xref="GeneID:4618638"
                     /translation="MVRVLEEKYDGATVAFTFMGSALVFVMVPGLGFLYSGLARRKSA
                     LALIWVVFSALIVGIVQWYMWGFSLAFSKTAVDNKFIGNLNSFGLRDVYGKASPDADY
                     PELVFAVFQGLFMCVTLAIIAGATAERGRLLPHMVFLFLFATVVYCPVAYWVWSPGGW
                     AAQWGVLDWAGGGPVEILSGVGGFVYSYFLGARRESLLINFRPHNVSMVTLGTSLLWF
                     GWLGFNGCTSLSPNLRSVYAFLNSMMSAAVGGMAWCVLDFRLERKWSTVGLCSGVISG
                     LVAATPSSGCIPLYASLIQGVVAGVVCNFATKLKYYAKTDDSMDILAEHGIAGIIGLL
                     FNAVFAADWVVGLDGSTEHDGGWLTQNWPQMYKQIAYIVAVSGYSILVTSIICYVLNC
                     IPGMQLRASEAAEERGMDEDQIGEFAYDYVEVRRDYFSWGVQNDQSANPSVASSVAEK
                     NAPGVPDDSEGK"
     gene            complement(491716..491789)
                     /locus_tag="AGOS_t0018"
                     /db_xref="GeneID:4618737"
     tRNA            complement(491716..491789)
                     /locus_tag="AGOS_t0018"
                     /product="tRNA-Asn"
                     /codon_recognized="AAC"
                     /db_xref="GeneID:4618737"
     gene            complement(<492350..>493870)
                     /locus_tag="AGOS_AAR083C"
                     /old_locus_tag="AAR083C"
                     /db_xref="GeneID:4618811"
     mRNA            complement(<492350..>493870)
                     /locus_tag="AGOS_AAR083C"
                     /old_locus_tag="AAR083C"
                     /product="AAR083Cp"
                     /transcript_id="NM_207977.2"
                     /db_xref="GeneID:4618811"
     CDS             complement(492350..493870)
                     /locus_tag="AGOS_AAR083C"
                     /old_locus_tag="AAR083C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR123C (PPT1)"
                     /codon_start=1
                     /product="AAR083Cp"
                     /protein_id="NP_982624.2"
                     /db_xref="GeneID:4618811"
                     /translation="MTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFS
                     NRALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVR
                     AKPGDEAVRRALEVCERMLRRERFERAIRADGDEEQRRLCKTLSLASFAGNADLASYD
                     GPALELEQETDAEGAPAGARVANMSAEFVRYMVEELFVQGKRLPKKYVAAIVSHAERL
                     FAAEPTVVELRTAELGCRVSVCGDTHGQLYDVLNVFQRFGKVGDDHVYLFNGDFVDRG
                     SWSCEVAVLFYSLKILYPGRFFLNRGNHETNNMNKVYGFEDECKYKYSQRIFNLFAES
                     FESLPLATVIDDAYLVMHGGLMSDDSVTLADMKAIDRFHQPPREGAFMELLWSDPQAA
                     EGLGPSQRGLGYAFGPDVTARFLEKNGLKKIIRSHEVRMGGVAFEHAGKLVTVFSAPN
                     YCDTQGNLGGIIHVVPGKGNKGELGNDDENLYVETFAAVPHPDIKPMAYSSGVLGF"
     gene            <494098..>495153
                     /locus_tag="AGOS_AAR084W"
                     /old_locus_tag="AAR084W"
                     /db_xref="GeneID:4618556"
     mRNA            <494098..>495153
                     /locus_tag="AGOS_AAR084W"
                     /old_locus_tag="AAR084W"
                     /product="AAR084Wp"
                     /transcript_id="NM_207978.2"
                     /db_xref="GeneID:4618556"
     CDS             494098..495153
                     /locus_tag="AGOS_AAR084W"
                     /old_locus_tag="AAR084W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YMR303C (ADH2)"
                     /codon_start=1
                     /product="AAR084Wp"
                     /protein_id="NP_982625.2"
                     /db_xref="GeneID:4618556"
                     /translation="MSSPSIPKTQHAIVFDKNGGPLEYREIEVPEPKPTELLINVKYS
                     GVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVRGWQVGDLAGIKWLNGSCM
                     SCEACEQGHESNCPDADLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGI
                     TVYKALKSANLRAGNWVAISGACGGLGSLAIQYARAMGYRVLGIDGGDEKEALFRKLG
                     GEVFVDFRKSKDVVADVVKATGGGAHGVINVSVSEAAIESSTEYVRSNGTVVLVGLPG
                     GAKCKSDVFNHVVKSVSIVGSYVGNRADTREALDFFARGLVQCPIKVVGLSELPDIYG
                     KMERGEVAGRYVVDTSK"
     gene            <495271..>496188
                     /locus_tag="AGOS_AAR085W"
                     /old_locus_tag="AAR085W"
                     /db_xref="GeneID:4618408"
     mRNA            <495271..>496188
                     /locus_tag="AGOS_AAR085W"
                     /old_locus_tag="AAR085W"
                     /product="AAR085Wp"
                     /transcript_id="NM_207979.1"
                     /db_xref="GeneID:4618408"
     CDS             495271..496188
                     /locus_tag="AGOS_AAR085W"
                     /old_locus_tag="AAR085W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR114W"
                     /codon_start=1
                     /product="AAR085Wp"
                     /protein_id="NP_982626.1"
                     /db_xref="GeneID:4618408"
                     /translation="MELVRLALGAPVHPLIGEQLVPFLRRHGVVRSEEMLSHMHLVIY
                     VALFYHCCYLVGKHMLFPGLVRWRRAVAPQRLLVQSAIHWVSLVQSVVILTLCYASWP
                     LHTRATHPRPEDRVFATTPVNSVLASFALGYFLWDTVISLRHSSVAFALHGAVSTVVF
                     LIGMTPYINYYAGMFLLFELSNPFLNGHWFARHYLPLGSQTHPHAGDARLVRWSARFA
                     LANDLVFFTVFFCARIAYGYYKIGELALDFYRVRADPRFMPYGTAFILGGNLVLNVLN
                     AIWFRTMVCMARDQLYGKRSAAAEQKRAT"
     gene            <496576..>498999
                     /locus_tag="AGOS_AAR086W"
                     /old_locus_tag="AAR086W"
                     /db_xref="GeneID:4618703"
     mRNA            <496576..>498999
                     /locus_tag="AGOS_AAR086W"
                     /old_locus_tag="AAR086W"
                     /product="AAR086Wp"
                     /transcript_id="NM_207980.1"
                     /db_xref="GeneID:4618703"
     CDS             496576..498999
                     /locus_tag="AGOS_AAR086W"
                     /old_locus_tag="AAR086W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR097W (ASK10) and YPR115W (RGC1)"
                     /codon_start=1
                     /product="AAR086Wp"
                     /protein_id="NP_982627.1"
                     /db_xref="GeneID:4618703"
                     /translation="MQLDAIEDAESGSSSDDDYLLELADVTEFEGVLPKDHYSSPFYV
                     DVPVPQSLGDHRHLGDDTQSYVREYPTSILADRFDKWRKLLKSLVAYLREVAAAQEQH
                     ARINAHLKSAVKFSFLADLEEGTNKVVEQLKRPSSPSQSGAESAQDSYFQVQEGCSNG
                     FLRYGSGSIQDLQVSLKKYHMTVSNQQLKASRELNNVVIPKLEELRRNLSSKIKEIKE
                     LSNDFKTNIHEQVALTGQLLQKYIASVDLLSTAEDSTSSKSTGQRLKPKHDPYLLKLQ
                     LDLQLKRQLLEENYLQEAYINLQTSGMELEKIVYGQIQTALQKFAHYMDIESCAAING
                     ICQELRRGILSKPTTIEWDDFVGLHPTCLLNWKSSDPVPPPRRLSDIRYPKMKSPMAK
                     CIRAGYLMKKSKLLKNYNKGYFVLTSNYLHEFKSSDFFKMANNGEKPSLKKINFDPLG
                     SIPLNESTVTEALPQKFVLCSTWAGIDSQEAGLSATSSGTSFTSMQGSRSSVSLGKLL
                     KGAAKPGKALTSAKASTSEITKGHVWTFKPSTTQSEKDFKKWCGELRQLAGFNSTLER
                     CRYIEEKIVKAHSRASSKASQSSIGTPPEGPGRAQKPQFIDIKGLSPIGYNIASPINT
                     PAFDDNGNLIMAGDRNMSLLTPSGLSFQGAPSLTNTISSDGTSLQSRSPTPVDTAATF
                     TEGNLNAVQPGVGQSGGGGSISSPRSTESINNSGGYFAIPVNRSQPQRDSVPSSQSRA
                     DRAPPSGSVPLLRVTSQSGNVEQPGRPSLYKQTSSPSLTSIKSRQTQLVLKHKRNLSF
                     QSLAEMVSK"
     gene            complement(<499143..>499841)
                     /locus_tag="AGOS_AAR087C"
                     /old_locus_tag="AAR087C"
                     /db_xref="GeneID:4618711"
     mRNA            complement(<499143..>499841)
                     /locus_tag="AGOS_AAR087C"
                     /old_locus_tag="AAR087C"
                     /product="AAR087Cp"
                     /transcript_id="NM_207981.1"
                     /db_xref="GeneID:4618711"
     CDS             complement(499143..499841)
                     /locus_tag="AGOS_AAR087C"
                     /old_locus_tag="AAR087C"
                     /note="NOHBY111; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0D15103g"
                     /codon_start=1
                     /product="AAR087Cp"
                     /protein_id="NP_982628.1"
                     /db_xref="GeneID:4618711"
                     /translation="MLSRSVITLQRDALRQYYSHYVTQQKFKETMSRISNQVMILTTS
                     SMKGVTLGSATSLALQPRPMIQFNLQLPSFTSQELHKRRKFALHLMAPTEQSVKLARL
                     FSKGAIRRPDSGVMPTRPFEALAAGADFALHKTSASTGGSLEPVVEDEILDHGLDKPA
                     LGARTVELPVLASAERVLICECIRCFRVGDHEIWVGMVEEILSPANNAPNSAVTGGLM
                     YCNRQFFKIGSPIE"
     gene            <500080..>500946
                     /locus_tag="AGOS_AAR088W"
                     /old_locus_tag="AAR088W"
                     /db_xref="GeneID:4618450"
     mRNA            <500080..>500946
                     /locus_tag="AGOS_AAR088W"
                     /old_locus_tag="AAR088W"
                     /product="AAR088Wp"
                     /transcript_id="NM_207982.2"
                     /db_xref="GeneID:4618450"
     CDS             500080..500946
                     /locus_tag="AGOS_AAR088W"
                     /old_locus_tag="AAR088W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR116W (RRG8)"
                     /codon_start=1
                     /product="AAR088Wp"
                     /protein_id="NP_982629.2"
                     /db_xref="GeneID:4618450"
                     /translation="MPRSVPDMSELLVKGVKHVYGRKMRKTRPTLPNVESPLVTHFHR
                     WAGKRIRLSFLAAELGTREGQHILPDWNLRGNLFAGLLAAPMRWDRLGNLRVPKSFLM
                     QTKARALEAPSDGKLVKIISVVEERGPGSSSYVPQSKAALQRAKQAMFVPVALQQSDM
                     RYFSSEEIAVDKDTLLAEYSAQLISKVKEGLEVLLSMSGTSHERVELEDWDVVVTYDP
                     DNANDIELRKCKGIPGDPVVIILNMGCLKCTELEELVNLRLRNHEYGLVLKVLKNERL
                     LKFMYRLITFSR"
     gene            complement(<500926..>505782)
                     /locus_tag="AGOS_AAR089C"
                     /old_locus_tag="AAR089C"
                     /db_xref="GeneID:4618734"
     mRNA            complement(<500926..>505782)
                     /locus_tag="AGOS_AAR089C"
                     /old_locus_tag="AAR089C"
                     /product="AAR089Cp"
                     /transcript_id="NM_207983.2"
                     /db_xref="GeneID:4618734"
     CDS             complement(500926..505782)
                     /locus_tag="AGOS_AAR089C"
                     /old_locus_tag="AAR089C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR098C (ESP1)"
                     /codon_start=1
                     /product="AAR089Cp"
                     /protein_id="NP_982630.2"
                     /db_xref="GeneID:4618734"
                     /translation="MAREKEVLNVINLNTPIMRNSWTGAAGGTTKHEKPLVEAFNSST
                     NRLHFVDRLPFDVTEGFREVQRFVQEGKGEADKVREALTGLYRELKQRHQLGRVAEVS
                     RQHMGVVVRLLEAGQDAAAAREVVALYNQTNYRPAGGLGDVLMADFGVSNERYLSTAK
                     ILAMQLIIRMRQVESHAETVVRIFAADERYILRDPKLKVHTVVKLILNFFSLLPQYKV
                     LFALKFLQYVSQFRLDFSTYIKNMDLAKFQKQVLKFAGAGLESSLPFLDIYYRSYSQH
                     MTSIGKLMWQDFRVPDRGDTKLNPEDPIILQQILHGRRTLDNAEFDAYTKHITTKLSK
                     GVSPTDAFLGALKVYILNCSLKRLRLQKAHVILLDKIAIFINTNVVHVSVESIHTILK
                     SLAEYFIDAKEYKRLNNVVNISFNAYVMYKHESLIRLAADLELFLFMSVKQDWSMFTK
                     FEKFISVASGDISVSLFEQCFNVYVMFADPSLAGLWDVCLNKSLKCFKKLGLTSYTDF
                     KASSEPMLVLVYSGFVSDIFTIPYNGWAPLSKMLFMALNGVYKFGYMDVDCKIKSVDV
                     LAKYEMLIKSTYSLNMEMETHGTLQLSKIANMYVSRWVSSLPTDERISGLEVRFVKAL
                     VQYLRFNKFHKKLIELCQLLKSKGEYYESFKNDIRVWLLEAYTALKMVQATKLQIQSV
                     LKIHSSFSIERATFDSLYEYLYARLLIISWERDNDSFNHLVQELRVSQTNFFDINNNS
                     NLPVSQFLKLLLLNIRIEKLASLLQFHNNNMFESLLEAKKALKLCQSLIKKQQKLSQF
                     HRLEVISLLQDLFAQVIGIYIQVGVSKDCEFYVKDFMRVVGELQDWTPIYDCLCFVYD
                     YYKLTEQNQLASATLSRLNRTFDMLDGSENIDALAKFMYYNDEPDKLRNSLALFFSGD
                     LEDTFLVDEWNLRLGIVIENTREQPQLKALSDVNKSNELYLRILKQMELDPFFSNMCE
                     SVIAIPSCFSPKVEEIRPAVSNVWSPAGSPYHSPRPSSLTPRGKCLRQKFDRSNAINN
                     LQMIKRLIESVNLDEMQNHEVSKTSCLYSLSLSFLSNISSKTDFRHALIKRFTMAELP
                     KYMPMYYDKMFSRMGNEVYGSFMPMEVKSMCTPFFTVQQKVDGIQTNFNSWDEPFQAI
                     SVDICKYNGDLLLSKVVSTTGKHFHLRLPLNRHESRDLSQETLTFALLMEELNDIIEK
                     NNRTTSIEVTSVIKTKEDRREWWEERYSLDKRMCDLMRRIEDSWICGFCGFFSQKQLD
                     KNHFALFKLGFQKVLQQNLPTRRQYGNPSMFLQVDDFILELFLKVDWDALPHEKKVEF
                     MEDLIYFIFDILLFHGEENAYDEIDVHLIHIQLEELIHDYHAKAPEAPRLGHTFLVIS
                     SECSLVPWESLSIFSDASVSRVPSINFLHELLTKFRGEISPKINLDSRLSIVLNPHGD
                     LTRTELRFKEHFTRLCCDLGSTRIVTGSKPEEDEFVRMITNSSTFIYIGHGGGEQYFR
                     SKTLKLQDNAAPSFLLGCSSAYMKQYGKLEPSSVLYSYLLGGSPMVIGNLWDVTDKDI
                     DAFTEAMFQKLGIFPSQRDRFLNVSEAVSSSRDVCHLRYLNGAAPVVYGLPFRYNTTE
                     PMLPGKGY"
     gene            <506057..>508036
                     /locus_tag="AGOS_AAR090W"
                     /old_locus_tag="AAR090W"
                     /db_xref="GeneID:4618723"
     mRNA            <506057..>508036
                     /locus_tag="AGOS_AAR090W"
                     /old_locus_tag="AAR090W"
                     /product="AAR090Wp"
                     /transcript_id="NM_207984.1"
                     /db_xref="GeneID:4618723"
     CDS             506057..508036
                     /locus_tag="AGOS_AAR090W"
                     /old_locus_tag="AAR090W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR099W (TEL2)"
                     /codon_start=1
                     /product="AAR090Wp"
                     /protein_id="NP_982631.1"
                     /db_xref="GeneID:4618723"
                     /translation="MHFQVLETTSNVEVMEQVLSELEQSPMAPEAALVVLQRVVTAYE
                     SLPSRLQAMLRRLCGKSSVLMSQVVVAAQQVRGRPEAGIYQRVLRETLEREPGALAHQ
                     LAGGGPTQRRLVTALFFGSRVFNVLAHTLSAAAYVSLLTPQLQTWFEKGAGAPEDAEV
                     LVALLRFHPTQAADALVDLVLCEVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVE
                     ASNVQAAYDLLLTLDYRLFNLLELHKVNSVHLQSAIVQVLPESGCEALLKICLGMFGT
                     PDTDDEKRCNLFAILIARMAGPELEKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKA
                     VAGESLKYEAAHIKLPVPPLRPKGTICFEEITTPRASAYVNNSAVEPQLGALTLEDSD
                     DSDVDSDGERRGREIVFLKDLLVELEAPDLSERGPLRLLKLTIKLVRQKQAFVSEVSF
                     YAPAMLTAVATISNSQSEQDFEEYRINALVSLLVAVPEKVTDLLHLLFQADLSLQQRM
                     AILSALALAARELRGLEDKYVLKPVFDFPTRRLPRNDAPSRALESRESGTSSEGTISA
                     HHTVWRSRKLDSAPAPERPNAFRKHAPAFFFPLAHAWLNGIDLGTFDALFKKHYLSTL
                     RLILAAANPHAEFDRMSELMSYVLQDAEAHDISIE"
     gene            <508378..>511176
                     /locus_tag="AGOS_AAR091W"
                     /old_locus_tag="AAR091W"
                     /db_xref="GeneID:4618724"
     mRNA            <508378..>511176
                     /locus_tag="AGOS_AAR091W"
                     /old_locus_tag="AAR091W"
                     /product="AAR091Wp"
                     /transcript_id="NM_207985.1"
                     /db_xref="GeneID:4618724"
     CDS             508378..511176
                     /locus_tag="AGOS_AAR091W"
                     /old_locus_tag="AAR091W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR100W (MDR1)"
                     /codon_start=1
                     /product="AAR091Wp"
                     /protein_id="NP_982632.1"
                     /db_xref="GeneID:4618724"
                     /translation="MSFFQALRQKASQISFLDILSDNLTSPLSRDERFRLEYRLPDDE
                     QILKDMNVDISVRGAYTAEGEPSYVYSGRLYLTAHYLVFRDSLDHNTCAFTMNLSTIK
                     RVERAASTSFAFCLNIQLYSGATFMVQFVGPRYASEEFSHLLKVQLRQNIKNTKLLGP
                     FLETCYSEYIISKNLQHKPDLQPPAGGLGQLFKYPGDPIAHKEKAKLRLWFDYFKKNG
                     TNLSLLRNHMFHRLIRVGVPNRLRGEIWELCSGSMYLRFSSQGEYQRIGKENKEKHSQ
                     AIDEIEKDLSRSLPEYAAYQGPEGIERLRNVLVTYSWKDPDVGYCQAMNIVVAALLIF
                     MTEEQAFWCLGKLCDSYLPGYYSKTMYGALLDQKVFESFVENKLPELWDHIVRNDIQL
                     STVSLPWFLSLFFTSMPLIFAFRVLDLFFLNGPKALFQVALAVLKVNLEDLLEVDEDG
                     MFIAILKNYFQTLEHSAYPDATDPKYQRVTKFQELLVVAFKRFDVITAEMVDIERNKH
                     KKVILQNIETFAKRTQMRTIPPVRHLKSEHISNIYDIYYESIESYKIGLGTGSSRMDF
                     PAFVQFLGKFCEWCKKSDSEENLSYQKQKESFLRRLFNNWDITSSGELSLGDVISGVD
                     KLVSNDLMETMNNFFSLYEDSKKGEVQREEILQMSEGLLFLTEPWKTGRCADKITQKA
                     IENDIAENLVQQSELSNLEDIEIPRGVEIDDQKYKQQQLERYLQAASNFLNRCFEYAR
                     PVEPSSAPRDAAPASPTEMTRGDPDTVANKELDPMRANVALHPEKPCVIDLPTFRMII
                     LADETYELFFAHTLRNSVRVDSPVTFFDGKVKALKNVFDGLIADGRRVAHEVRRRVDS
                     VATRGNSSEPLDERQDDLDDFTTEHPDEHSKLLSGDLLDLDMDQDEDNRPQKRLEKVN
                     MPPAGTNGELPNLIEFEA"
     gene            <511431..>512438
                     /locus_tag="AGOS_AAR092W"
                     /old_locus_tag="AAR092W"
                     /db_xref="GeneID:4618513"
     mRNA            <511431..>512438
                     /locus_tag="AGOS_AAR092W"
                     /old_locus_tag="AAR092W"
                     /product="AAR092Wp"
                     /transcript_id="NM_207986.2"
                     /db_xref="GeneID:4618513"
     CDS             511431..512438
                     /locus_tag="AGOS_AAR092W"
                     /old_locus_tag="AAR092W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR101W (PCP1)"
                     /codon_start=1
                     /product="AAR092Wp"
                     /protein_id="NP_982633.2"
                     /db_xref="GeneID:4618513"
                     /translation="MSLSTFTRSYGRCFFLSNAIHLQVRPVQASVPFRNVFTPLLAKL
                     NPVPSTALARAVRNFSSTTSKSNLGGYFGGPQSKYTRLNRFQQYSPGHPNNQLLRITG
                     WGLLFMTGTFFGTPFLFDLPPFSYFKAHPAHLTYAIIGLNCVVFGLWQRPRFWLPLQR
                     YALLQKDHIYSKWSLIGSAFSHQEFWHFGMNMICLWSFGTSLAMSLGPANFASLYMNS
                     ALGASLFSLWYPRIARIALMGPSLGASGALFGMFAMFSYLAPNSKIMLFFLPIPIDAW
                     VGFLGMTTWNLAGCVFRWGTFDYAAHVGGTAMGLLYGWWMSRKIQQQRRARRLISFPR
                     F"
     gene            complement(<512487..>513059)
                     /locus_tag="AGOS_AAR093C"
                     /old_locus_tag="AAR093C"
                     /db_xref="GeneID:4618424"
     mRNA            complement(<512487..>513059)
                     /locus_tag="AGOS_AAR093C"
                     /old_locus_tag="AAR093C"
                     /product="AAR093Cp"
                     /transcript_id="NM_207987.1"
                     /db_xref="GeneID:4618424"
     CDS             complement(512487..513059)
                     /locus_tag="AGOS_AAR093C"
                     /old_locus_tag="AAR093C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR102C (GTF1)"
                     /codon_start=1
                     /product="AAR093Cp"
                     /protein_id="NP_982634.1"
                     /db_xref="GeneID:4618424"
                     /translation="MPLARLVEGEKHDECTYVAASSLLIGRHKMLRSLIYASRRWSSS
                     VGARFSSREELQAYLARPAWQPEDYLPSAEDIARQQLSEEETRKLLKLSGLPEADIQE
                     VRRRLATQLSFVSQLQSVEVDDCADPQYAKAMQRHPAAIGYEELVRRAELDAKDTSLG
                     EKSGSWDSTATATLKKDGYFVLREGLLQKR"
     gene            <513341..>515131
                     /locus_tag="AGOS_AAR094W"
                     /old_locus_tag="AAR094W"
                     /db_xref="GeneID:4618625"
     mRNA            <513341..>515131
                     /locus_tag="AGOS_AAR094W"
                     /old_locus_tag="AAR094W"
                     /product="AAR094Wp"
                     /transcript_id="NM_207988.1"
                     /db_xref="GeneID:4618625"
     CDS             513341..515131
                     /locus_tag="AGOS_AAR094W"
                     /old_locus_tag="AAR094W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR103W (NOP7)"
                     /codon_start=1
                     /product="AAR094Wp"
                     /protein_id="NP_982635.1"
                     /db_xref="GeneID:4618625"
                     /translation="MRVKKKNTTGNARNFVTRSQAVRKLQISLADFRRLCIFKGIYPR
                     EPRNKKKANKGSTAPTTFYYYKDIQYLQHEPVLAKFREHKTFAKKLTRALGRGEVSSA
                     KKLEENKSHYKLDHIIKERYPSFADALRDLDDALNMLFLFANLPATDQVSTRVTKDAQ
                     ELCNQWLALIARERLVRKVFVSIKGVYYQANVRGEEVRWLVPYKFPENIPSDVDFRIM
                     LTFLEFYSTLLHFVLYKLYTDNGLVYPPKLDIKKNKLIGGISAYILESKDAPFLSSVD
                     GSADSENQEVQVLDKKALRHAMKADDKAGSEADEGDADSNEQVTNIELDDFEDKNKNH
                     GDILEQPSQYDSPTSTLFSEFVFYIGREVPVDILEFLIVSCGGSVISEAALDQADAAN
                     VDVSKVTHQLVDRPVVKNKVAGRTYIQPQWVFDSINKGELVPANLYLPGESLPPHLSP
                     WGDSVGYDPAAELAEEEAESEEEEEVSDEAEGDEEATLAAEEDEEDEAEAEELRAQKE
                     LELEAQGVTYSEAADSAAPSKKASKQKKRKTEEEEEKDLKLIMMSNKQRKLFKKMKYS
                     NQQKEQEIETLKQKKKQIAKTKAKLKKLEN"
     gene            complement(<515215..>516081)
                     /locus_tag="AGOS_AAR095C"
                     /old_locus_tag="AAR095C"
                     /db_xref="GeneID:4618488"
     mRNA            complement(<515215..>516081)
                     /locus_tag="AGOS_AAR095C"
                     /old_locus_tag="AAR095C"
                     /product="AAR095Cp"
                     /transcript_id="NM_207989.1"
                     /db_xref="GeneID:4618488"
     CDS             complement(515215..516081)
                     /locus_tag="AGOS_AAR095C"
                     /old_locus_tag="AAR095C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR104C (SRB5)"
                     /codon_start=1
                     /product="AAR095Cp"
                     /protein_id="NP_982636.1"
                     /db_xref="GeneID:4618488"
                     /translation="MEKVHCGDVRIPAVNRTEIRDSYSDSGVTRMVQQLSLYSVIDEG
                     SFDLLIATISALSGRSPVLFANYNHVAHPNPNYAIEKVNAKNQLVEQTRVQLMQEIPF
                     EKLQTEEYSYKLCTKMTGDGPPIETEYLNSLMRSCGDGTRPWSLSLWDIPSAGKDRKV
                     CTQAVVESVVTSTGGAHSSILSFLAELGYVPGYQFVQLGTQFYLENGIVFQISKLWAL
                     HGESGKTSAVTKDGFLIKAYLNVPKATDLESINQGTAHLQQLKRELRDYLELSIPDRK
                     SMDSRVGHLNDF"
     gene            <516142..>516437
                     /locus_tag="AGOS_AAR096W"
                     /old_locus_tag="AAR096W"
                     /db_xref="GeneID:4618561"
     mRNA            join(<516142..516161,516224..>516437)
                     /locus_tag="AGOS_AAR096W"
                     /old_locus_tag="AAR096W"
                     /product="AAR096Wp"
                     /transcript_id="NM_207990.1"
                     /db_xref="GeneID:4618561"
     CDS             join(516142..516161,516224..516437)
                     /locus_tag="AGOS_AAR096W"
                     /old_locus_tag="AAR096W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR105W (VMA21); 1-intron"
                     /codon_start=1
                     /product="AAR096Wp"
                     /protein_id="NP_982637.1"
                     /db_xref="GeneID:4618561"
                     /translation="MAVDVPTSVIVKLMFFTLAMVSFPVLTFFVSQQYTSNTLVNGGL
                     AALAANVVLFAYVIMAFSEDVPQSDGKESKKQQ"
     gene            complement(<516540..>517337)
                     /locus_tag="AGOS_AAR097C"
                     /old_locus_tag="AAR097C"
                     /db_xref="GeneID:4618555"
     mRNA            complement(<516540..>517337)
                     /locus_tag="AGOS_AAR097C"
                     /old_locus_tag="AAR097C"
                     /product="AAR097Cp"
                     /transcript_id="NM_207991.1"
                     /db_xref="GeneID:4618555"
     CDS             complement(516540..517337)
                     /locus_tag="AGOS_AAR097C"
                     /old_locus_tag="AAR097C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR106C (VOA1)"
                     /codon_start=1
                     /product="AAR097Cp"
                     /protein_id="NP_982638.1"
                     /db_xref="GeneID:4618555"
                     /translation="MHLRIVFLALLEAAVAAAGVASFVSVKAERYRNGLEIKGAQDLR
                     ELVRLGTEQEPVVVVQFGAYRLFSELEKAGAGTQRFLHRLLASDSLNVLNGDEALQPH
                     SSTRVAEFEELPVELPAEVRGGAGSLLLHLKAPDYALDEVDGFLQRCHEQLPSLDNIV
                     LQFPHDILLVAADVQESAARQKKDSVEVTDPEGDSKPKPSDHDKAPDGHKETDELSAI
                     WTEGLLSCLLVSLLLFGILATAVSWILSVEVSYGALEKSTNPLKKTN"
     gene            517845..517925
                     /locus_tag="AGOS_t0019"
                     /db_xref="GeneID:4618804"
     tRNA            517845..517925
                     /locus_tag="AGOS_t0019"
                     /product="tRNA-Leu"
                     /codon_recognized="CUC"
                     /db_xref="GeneID:4618804"
     gene            <518070..>519281
                     /locus_tag="AGOS_AAR098W"
                     /old_locus_tag="AAR098W"
                     /db_xref="GeneID:4618528"
     mRNA            <518070..>519281
                     /locus_tag="AGOS_AAR098W"
                     /old_locus_tag="AAR098W"
                     /product="AAR098Wp"
                     /transcript_id="NM_207992.1"
                     /db_xref="GeneID:4618528"
     CDS             518070..519281
                     /locus_tag="AGOS_AAR098W"
                     /old_locus_tag="AAR098W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR118W (MRI1)"
                     /codon_start=1
                     /product="AAR098Wp"
                     /protein_id="NP_982639.1"
                     /db_xref="GeneID:4618528"
                     /translation="MSLQAIQFQRGDKSQVSVRVLDQLLLPYVSRYIPIQTVDDGFAV
                     IRSMQVRGAPAIAIVGVLSVLVECQLLCNEDFVAVQAFYDLSSYAAFGRTMRMRLAHL
                     LGSRPTAVNLSHALRDVERLLDSATSLSQFRDRMYDYACELLDMDVANNVRMGDNGAR
                     FLLDALIAEGFDGSFAVLTICNTGSLATAGYGTALGAIRSLWQHAEAGLTAPKKQKAS
                     ACAPRMTHVFPLETRPYNQGSRLTAYELLHDAIPATLITDSSVAYRIQTSPVPIKAAF
                     VGADRIARNGDTANKIGTLQLALVCRHFGIRFFVVAPRSTVDGTTAAGTDIPVEERCP
                     DEFRVVTGAAAGATGDPTTASVAIAPRDMPVWNPAFDVTPHAYIDAIVTETRVFTKDA
                     AGNFDLDELFT"
     gene            complement(519302..519391)
                     /locus_tag="AGOS_t0020"
                     /db_xref="GeneID:4618707"
     tRNA            complement(join(519302..519337,519355..519391))
                     /locus_tag="AGOS_t0020"
                     /product="tRNA-Lys"
                     /codon_recognized="AAA"
                     /db_xref="GeneID:4618707"
     gene            <520459..>522126
                     /locus_tag="AGOS_AAR099W"
                     /old_locus_tag="AAR099W"
                     /db_xref="GeneID:4618511"
     mRNA            <520459..>522126
                     /locus_tag="AGOS_AAR099W"
                     /old_locus_tag="AAR099W"
                     /product="AAR099Wp"
                     /transcript_id="NM_207993.1"
                     /db_xref="GeneID:4618511"
     CDS             520459..522126
                     /locus_tag="AGOS_AAR099W"
                     /old_locus_tag="AAR099W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR119W (CLB2) and YGR108W (CLB1)"
                     /codon_start=1
                     /product="AAR099Wp"
                     /protein_id="NP_982640.1"
                     /db_xref="GeneID:4618511"
                     /translation="MSSVNKENYRGVPSGRGMKNPVLAGAKRAVLNNVTNTTLSQEAA
                     NSNAHSGSGYTNSFGKVLRQAKSKLQSARVAGSLIPQMKREGLASSQEDKENVVPTGV
                     APAAVAAAAAAAQMAPAIAKPILQSISEESHQECQSLLKDGGSDEGASTVSTKSSDTE
                     LAPSSSSSLQSAPANSEEPVVLESGTQLVERRRPQTLNTTLTGSVASSSDCTTSTGQL
                     TESTAGELTTTQNQLRPSVAVAESKKKRPISTIVEPEELKKFKISDQGNQCEWEDLDA
                     EDINDPFMVSEYVNDIFEYLHKLEVMTLPNRHDLFKHANIQQNRDILVNWMVKIHNKF
                     GLLPETLYLALNIMDRFLGKELVQLEKLQLVGTACLFIASKYEEVYSPSVKHFAYETD
                     GACDEEEIKEGEKFILKTLQFNLNYPNPMNFLRRISKADDYDIQSRTLAKYLLEISVV
                     DFKFIGILPSLCAAASMFLSRKMLGKGKWDGNLIHYSGGYSTTELAPICNMLMDYLVQ
                     PVVHDELFKKYASRRFMKASVISRQWAKKVMTRSYDIMTLHETQTEY"
     gene            complement(<522980..>524194)
                     /locus_tag="AGOS_AAR100C"
                     /old_locus_tag="AAR100C"
                     /db_xref="GeneID:4618699"
     mRNA            complement(<522980..>524194)
                     /locus_tag="AGOS_AAR100C"
                     /old_locus_tag="AAR100C"
                     /product="AAR100Cp"
                     /transcript_id="NM_207994.1"
                     /db_xref="GeneID:4618699"
     CDS             complement(522980..524194)
                     /locus_tag="AGOS_AAR100C"
                     /old_locus_tag="AAR100C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR120C (CLB5) and YGR109C (CLB6)"
                     /codon_start=1
                     /product="AAR100Cp"
                     /protein_id="NP_982641.1"
                     /db_xref="GeneID:4618699"
                     /translation="MSPVGETRRVSDENEAAGARRRGELAKKRGNTVLGVPRKALGAV
                     GVNTRKQERDGAATGSGAGGARGAGTKRMVYHDSEGEETQEPEEKRVSKKAKAERQCP
                     SPAAQTESPEAARGALVREPHPHRDLDALEADDLTMCVDYTNEIFAHLLQREQETTCV
                     VNYVQERQCAFYIRPSMRAILVDWLIEVHLKFQLLPEALYLAINIMDRYLSTNKVSLS
                     KLQLVAITSLLIAAKFEEVNLPKLSNYVYITDNAYTVEEVKQSECNILNALEFNIGWP
                     NPMNFLRRISKADNYNHNTRNYAKVFLEYAMCCPKFVAITPSVLAAMSMRCAMMLNYG
                     AEGFEWDDTMEWYSSMATTSAKFDFQKLCDDLIKDIQEPSTQLNALIYKYKKLGLWVA
                     VKTWCDEQKIVR"
     gene            524771..524842
                     /locus_tag="AGOS_t0021"
                     /db_xref="GeneID:4618436"
     tRNA            524771..524842
                     /locus_tag="AGOS_t0021"
                     /product="tRNA-His"
                     /codon_recognized="CAC"
                     /db_xref="GeneID:4618436"
     gene            <525273..>525797
                     /locus_tag="AGOS_AAR101W"
                     /old_locus_tag="AAR101W"
                     /db_xref="GeneID:4618512"
     mRNA            <525273..>525797
                     /locus_tag="AGOS_AAR101W"
                     /old_locus_tag="AAR101W"
                     /product="AAR101Wp"
                     /transcript_id="NM_207995.1"
                     /db_xref="GeneID:4618512"
     CDS             525273..525797
                     /locus_tag="AGOS_AAR101W"
                     /old_locus_tag="AAR101W"
                     /note="NOHBY112; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AAR101Wp"
                     /protein_id="NP_982642.1"
                     /db_xref="GeneID:4618512"
                     /translation="MQGILVMGLVAAASAASLTTTSTSTITTTTTIYYGADGVNSVVL
                     DMAKGLMAVGMSASVNTSSTVSAWNSQLWSAGNTTTATANHTSAATHGSTVQLTTHNK
                     TSTAVTAPPASVTPTAALSSSAAPSSSNASGPASAPASSPGPSVSSSAGAALLDARGA
                     ILLGALGAVVLDLC"
     gene            complement(<526032..>527807)
                     /locus_tag="AGOS_AAR102C"
                     /old_locus_tag="AAR102C"
                     /db_xref="GeneID:4618731"
     mRNA            complement(<526032..>527807)
                     /locus_tag="AGOS_AAR102C"
                     /old_locus_tag="AAR102C"
                     /product="AAR102Cp"
                     /transcript_id="NM_207996.1"
                     /db_xref="GeneID:4618731"
     CDS             complement(526032..527807)
                     /locus_tag="AGOS_AAR102C"
                     /old_locus_tag="AAR102C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR137W (RRP9)"
                     /codon_start=1
                     /product="AAR102Cp"
                     /protein_id="NP_982643.1"
                     /db_xref="GeneID:4618731"
                     /translation="MRKALSPLVSRNSHIARTMARGSDSASRKRTRQKTTEKNNVVDE
                     EISGVSSNEEGSSSDEQELEDVADAELDSDEEFANENPADKRRRLAKQYLENIKEEAN
                     EIMHGDSEAHADDAQGQGFADAYNNFDARDLDRDIISARLKQDVAEQRGSVYRWIADK
                     LLLSEAKKSFTRVGEKNLTALSCYQQAMNKFSHREIQSKSKGLMFAYTVSKDMQLTKY
                     DITDFNARPTKVKYTKGGRKYIPEGNQGFQNTTEGHYDEILTVAASPDGKYVVTGGRD
                     KKLIVWSTESLAPVKVIPTKDRRGEVLGLAFRRNTDQLYAACADYKIRTFAINQFSQL
                     EVLYGHQDIVADISALNMERCVTVGSRDRTCMLWKIADETRLTFRGGDDPEKLLRRWQ
                     KANSEQENKDADDNTPAEPPVFYGEGSIDCITMLDDSHFISGSDNGNISLWSLSKKKP
                     LFVQRVAHGVQPQPDNTKISGERDPAVRTQQAQGNRLAQPYWITALHAVPYSNVFFSG
                     SWNGTMKVWKLHENMRSFEPLGELDGCKGLVTKIQTVEAGKSGRETLRVLASVSKEHR
                     LGRWMGKLPGARNGLFSAVIDQAGF"
     gene            complement(<527935..>530571)
                     /locus_tag="AGOS_AAR103C"
                     /old_locus_tag="AAR103C"
                     /db_xref="GeneID:4618677"
     mRNA            complement(<527935..>530571)
                     /locus_tag="AGOS_AAR103C"
                     /old_locus_tag="AAR103C"
                     /product="AAR103Cp"
                     /transcript_id="NM_207997.1"
                     /db_xref="GeneID:4618677"
     CDS             complement(527935..530571)
                     /locus_tag="AGOS_AAR103C"
                     /old_locus_tag="AAR103C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR135W (CTF4)"
                     /codon_start=1
                     /product="AAR103Cp"
                     /protein_id="NP_982644.1"
                     /db_xref="GeneID:4618677"
                     /translation="MPEIIDKLVFASGGKTLVTYQNDRDTLFAVNKNQLTKILQLDKP
                     EDEPEILSTCNEPTSIHLCSDRRLLVTSANGDVHLYSANGKDDLLFRSPLPIRDCAAI
                     HDETMCVVGGDDLELTFIELKTAGNKETLKLDEQVSQLSYSPHMNILAVTLVNGNVHF
                     YSLTSATPNEVKKLEDYAVSNFYSDSSDTASQTDGVQYCDENRICTRVAWHPRGLHFA
                     IPCKDYTVKIFNLSDFSISKTLASGSTSHFTNLSFDPFQGRYVAAVDLSNNLLVWELS
                     SGQISYSKRLDYKVSNVCWKLDGDSMHLLLGTWDGELLTVKDIGQYDRTAGKLAADNA
                     SAQTKKPKNALFLDSDDENDSDVSPASPTLIGEQGRNTISADIPTDTEHGDENEKGAY
                     NYEDDEQFIDDDDNAGYVPIKRKSAYVPSLVSNSKRPRIADSGPVFRYKPISPGGTPF
                     GSSDKRYLTMNGIGYVWTVRGTEGQYSVTVSFFDVGRYREYHFEDLFGYDLCSLTDEG
                     TFFGQSKTGELLYRVHSFNGTKWTKRIPLAPSEIITGIASTGKKLVVATSLGYIRTFN
                     EHGLPLALEKMTPIVALAAQEHKIFAVHYSIYHGLSYSLFEQNPETGSKYYQRECSLP
                     LTLPLFGPENKYISTGDTFNDFNPIGIKSLFFSTFGDPCIFGSDNVLLVLCKWRNSME
                     SRWVPIVDSNLEIWKLSGGKQPEDIHVWPLGLNYDMLNYILIKGKNLWPGFPLPLPSE
                     MEIRLPLLDKTQVLKNDTSPDEEVVIPPALAAEEEFLRSQVLAGLLADTLKYDGEFFG
                     NENEILANLNGVRDKSLLRLFASACSDHNTEKALSLVKELKQDKALNAAQKIAERAEL
                     LRLVSSINDIRNSRFESELNNL"
     gene            <530968..>531735
                     /locus_tag="AGOS_AAR104W"
                     /old_locus_tag="AAR104W"
                     /db_xref="GeneID:4618543"
     mRNA            <530968..>531735
                     /locus_tag="AGOS_AAR104W"
                     /old_locus_tag="AAR104W"
                     /product="AAR104Wp"
                     /transcript_id="NM_207998.1"
                     /db_xref="GeneID:4618543"
     CDS             530968..531735
                     /locus_tag="AGOS_AAR104W"
                     /old_locus_tag="AAR104W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR120C (COG2)"
                     /codon_start=1
                     /product="AAR104Wp"
                     /protein_id="NP_982645.1"
                     /db_xref="GeneID:4618543"
                     /translation="MEQALEDLELLVVGDVTRDLFTEAVAQQHLDTGEQLDVSQFLLA
                     NNLQYVFIDDLHKQLKQLEQDISNALLNEVKHSYAEYASLCAQFGGKHNSEILDSLQQ
                     VRYEVAAFENKLRQLVHVELRSTRDNVESKIEYLKALDTLDTLLQKHVALDSIFQFSA
                     RLSRSLEVACQDAPAIDDELVSELLKELYKLLQCAHSILIEFQDLSSPLVTRFRNNYQ
                     NNVHVFHSIVSILIDKCSEKSAEFPSMTSTLVAVAKR"
     gene            <531949..>534018
                     /locus_tag="AGOS_AAR105W"
                     /old_locus_tag="AAR105W"
                     /db_xref="GeneID:4618431"
     mRNA            <531949..>534018
                     /locus_tag="AGOS_AAR105W"
                     /old_locus_tag="AAR105W"
                     /product="AAR105Wp"
                     /transcript_id="NM_207999.1"
                     /db_xref="GeneID:4618431"
     CDS             531949..534018
                     /locus_tag="AGOS_AAR105W"
                     /old_locus_tag="AAR105W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR119C (NUP57)"
                     /codon_start=1
                     /product="AAR105Wp"
                     /protein_id="NP_982646.1"
                     /db_xref="GeneID:4618431"
                     /translation="MFNFGANSGMNSNTGSTGGGLFGSTTNGGGFSFGNNNASQNNTN
                     VFSNTGTGVPPAGQGTSNGGLFGNNNQTTNTGIGGGNSGGLFGGAANTQNNTAGGGLF
                     GQGTQNATTGGGLFGQNTQGNAGTGLFGQNTQSGTTGGGLFGQNSQAGNTGGGLFGQN
                     TQGGNAAGGLFGSSAQTGNASSNLFGQSNTQAGTTGTGTGLFGQSNTQSGTTGTGTGL
                     FGQANTQSRTTGTGTGLFGQSNTQTGTTGTGNGLFGQANTQSGTTGSGTGLFGQSNTQ
                     AGATGTGTGLFAQSGARSGPTATTGSLFGNSMSGTSTIGGNNATTGGLFGQNTQSGTT
                     GTGLFGQGTNTTQQPPTSLFSTGTANTSQPTFAWSQQPLQNMSNSMPQQQGQAQSQAL
                     PQQAQSSQLQFSGQQPLINQQQPNQQASNYPQQIQEQVLKCKESWDPNNQRSKLRTFV
                     YNKCNETEAMLYSKPANVTQEDWDKALLHKPNANVIPVEVKGFEELIQRHNLQRDHVA
                     QARIILTQILDKLTCISQRHELDTATRILKAQARNSTIQHRIMLLANQLAVLKNKGLP
                     LNVQEETLITEFRKLLERSNDPAGLGKNNELWARLAVLKERAKTLSSQLDSTLVVIAE
                     NGGGRAAAGSANGDHPDSEERRVDEEVVNSVNKIADILMNQQRGLIYLNDIIEKDAQI
                     VDRYLKK"
     gene            complement(<534676..>534828)
                     /locus_tag="AGOS_AAR106C"
                     /old_locus_tag="AAR106C"
                     /db_xref="GeneID:4618663"
     mRNA            complement(<534676..>534828)
                     /locus_tag="AGOS_AAR106C"
                     /old_locus_tag="AAR106C"
                     /product="AAR106Cp"
                     /transcript_id="NM_208000.1"
                     /db_xref="GeneID:4618663"
     CDS             complement(534676..534828)
                     /locus_tag="AGOS_AAR106C"
                     /old_locus_tag="AAR106C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR133W-A (TOM5)"
                     /codon_start=1
                     /product="AAR106Cp"
                     /protein_id="NP_982647.1"
                     /db_xref="GeneID:4618663"
                     /translation="MFGFPQQQPSEEELKKHQEQTNSTVMTAAYAAAFLWVSPIVWNF
                     IRKQWK"
     gene            <535055..>536167
                     /locus_tag="AGOS_AAR107W"
                     /old_locus_tag="AAR107W"
                     /db_xref="GeneID:4618445"
     mRNA            <535055..>536167
                     /locus_tag="AGOS_AAR107W"
                     /old_locus_tag="AAR107W"
                     /product="AAR107Wp"
                     /transcript_id="NM_208001.1"
                     /db_xref="GeneID:4618445"
     CDS             535055..536167
                     /locus_tag="AGOS_AAR107W"
                     /old_locus_tag="AAR107W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR133C (SPN1)"
                     /codon_start=1
                     /product="AAR107Wp"
                     /protein_id="NP_982648.1"
                     /db_xref="GeneID:4618445"
                     /translation="MSGSSSVHSGTAASEEWGMPSVGEIGAAGEAVETNEVERAQHQE
                     RQRKHIATSDNDEEESGNKWSVSTLPITSYGGDGDAAGGSGRRQALEAKMERLLKKPK
                     ARHSRQDEEDLEQYLDEKILRLKDEMNMAAQKDIETLNRRLETGDNRLIAMEKVTLLP
                     KVISVLNKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAAIENLPIKTEH
                     LKESGLGKVVIFYTKSKRVEHKLARLADRLVAEWTRPIIGASDNYRDKRVLKMDFDVE
                     KHRKKAALDSAKSKKRRKAAVDEEKHKSLYELAAAKRNRAAAPAQTTTDYKYAPVSNI
                     SNVQTGIRTAGVGSTLNNNDLYKRLNSRLAKSKRSK"
     gene            complement(<536316..>536885)
                     /locus_tag="AGOS_AAR108C"
                     /old_locus_tag="AAR108C"
                     /db_xref="GeneID:4618617"
     mRNA            complement(join(<536316..536688,536821..>536885))
                     /locus_tag="AGOS_AAR108C"
                     /old_locus_tag="AAR108C"
                     /product="40S ribosomal protein S23"
                     /transcript_id="NM_208002.1"
                     /db_xref="GeneID:4618617"
     CDS             complement(join(536316..536688,536821..536885))
                     /locus_tag="AGOS_AAR108C"
                     /old_locus_tag="AAR108C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR132W (RPS23B) and YGR118W (RPS23A); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S23"
                     /protein_id="NP_982649.1"
                     /db_xref="GeneID:4618617"
                     /translation="MGKGKPRGLNSARKLRVHRRNNRWAEQTYKKRLLGTAFKSSPFG
                     GSSHAKGIVLEKIGVESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEV
                     LLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS"
     gene            <537757..>537987
                     /locus_tag="AGOS_AAR108WB"
                     /old_locus_tag="AAR108WB"
                     /db_xref="GeneID:9487882"
     mRNA            <537757..>537987
                     /locus_tag="AGOS_AAR108WB"
                     /old_locus_tag="AAR108WB"
                     /product="AAR108W-Bp"
                     /transcript_id="NM_001355298.1"
                     /db_xref="GeneID:9487882"
     CDS             537757..537987
                     /locus_tag="AGOS_AAR108WB"
                     /old_locus_tag="AAR108WB"
                     /note="NOHBY121; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E23211g"
                     /codon_start=1
                     /product="AAR108W-Bp"
                     /protein_id="NP_001342241.1"
                     /db_xref="GeneID:9487882"
                     /translation="MLRRLTWNPRRGLRHFASTSPPLHHWNNASVLYGCYLTVGFTVP
                     FLLSYYETYSQHASTYPSKHRCCARAIFARWI"
     gene            <539185..>539397
                     /locus_tag="AGOS_AAR108WA"
                     /old_locus_tag="AAR108W-A"
                     /db_xref="GeneID:4618573"
     mRNA            <539185..>539397
                     /locus_tag="AGOS_AAR108WA"
                     /old_locus_tag="AAR108W-A"
                     /product="AAR108W-Ap"
                     /transcript_id="NM_208003.1"
                     /db_xref="GeneID:4618573"
     CDS             539185..539397
                     /locus_tag="AGOS_AAR108WA"
                     /old_locus_tag="AAR108W-A"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR020W-A"
                     /codon_start=1
                     /product="AAR108W-Ap"
                     /protein_id="NP_982650.1"
                     /db_xref="GeneID:4618573"
                     /translation="MGQAYNIFGKPVQPHVLVLGTLFTLFGGVSLYKARGRASQQPAV
                     AAPAKTTSDDIDFEQLLGEMLKEEKN"
     gene            complement(<539504..>540142)
                     /locus_tag="AGOS_AAR109C"
                     /old_locus_tag="AAR109C"
                     /db_xref="GeneID:4618650"
     mRNA            complement(<539504..>540142)
                     /locus_tag="AGOS_AAR109C"
                     /old_locus_tag="AAR109C"
                     /product="AAR109Cp"
                     /transcript_id="NM_208004.1"
                     /db_xref="GeneID:4618650"
     CDS             complement(539504..540142)
                     /locus_tag="AGOS_AAR109C"
                     /old_locus_tag="AAR109C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR021C"
                     /codon_start=1
                     /product="AAR109Cp"
                     /protein_id="NP_982651.1"
                     /db_xref="GeneID:4618650"
                     /translation="MKYIIEHMESGFSEWVTLEYAQIIRDVGAENLILSSLPEGTTAS
                     DIPQLLTDLGLQWTTQPLDKVHLALPNVAPLMDGRVCLLDPRASGDLAPSDKDQFDYF
                     VFGGILGDHPPRDRTSELKESYPSLLVGKRLGDKQMTTDTAVRTTQLIVEKQLPLEKI
                     SFIDYPEFRFNSNEATEMPFRYVLDAAGRPILPSGMLELIKKDSEQSLDDLL"
     gene            complement(<540226..>542160)
                     /locus_tag="AGOS_AAR110C"
                     /old_locus_tag="AAR110C"
                     /db_xref="GeneID:4618611"
     mRNA            complement(<540226..>542160)
                     /locus_tag="AGOS_AAR110C"
                     /old_locus_tag="AAR110C"
                     /product="AAR110Cp"
                     /transcript_id="NM_208005.2"
                     /db_xref="GeneID:4618611"
     CDS             complement(540226..542160)
                     /locus_tag="AGOS_AAR110C"
                     /old_locus_tag="AAR110C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR022C"
                     /codon_start=1
                     /product="AAR110Cp"
                     /protein_id="NP_982652.1"
                     /db_xref="GeneID:4618611"
                     /translation="MFLSQHKRSIVRRICWPSAKRYHSELVRWFYATDSPLEKPYEPN
                     YKPVKPPVNFIPFSKSDSDRLERFYSLERPSENPISVNEDYLFEVYLEARRLKPAYWD
                     GPVYEVRRGTWFNSDGMPLSEDLSAELAELSAKCDEEKDFFKLEGKYDEGRYVLFKGE
                     KKDEALLIPELYGGTLQLSLLRKSTLIPIGFVKVTKGYSESLTKGVIQKAAEGLETQV
                     LDQTKQMGKLSDLLGWEFMDLLLGSASSSSGDKLNEAMTHKMDREEVKQNINTRAQAT
                     KFQTNYREIDHLILCVHGIGQNLGKKYQYVNFAHTVNLLRSNLKRLYNNGDSWKAYNR
                     DVVKRPDWEFNSRVQVLPITWRHDIGFSTDEFVKEKEQPELPTLADITVDGIRPLRRV
                     FGDVALDVLLYGEEYYRNRIMEKVASRLNNVYDKFCHKNPSFNGRVSLIGHSLGSLIL
                     FDILAQHEKYHLHFDVENYFAIGSPIGVLKLIQQTKIAHYGGPLQTDFGLRIDRPKCN
                     RFYNLFHSCDPIAYRVEPLIDTKLGQYRQKIVPAVRESQLEVRVRELGDTFTSDSGLE
                     MVKMPDSLLKKVTKLNHLGRVDFSFEPRLWEVDALNAIKAHVSYFEEELAASFFLDQL
                     LRPVEPVTEVYCQALKKPAL"
     gene            complement(<542362..>543990)
                     /locus_tag="AGOS_AAR111C"
                     /old_locus_tag="AAR111C"
                     /db_xref="GeneID:4618622"
     mRNA            complement(<542362..>543990)
                     /locus_tag="AGOS_AAR111C"
                     /old_locus_tag="AAR111C"
                     /product="AAR111Cp"
                     /transcript_id="NM_208006.1"
                     /db_xref="GeneID:4618622"
     CDS             complement(542362..543990)
                     /locus_tag="AGOS_AAR111C"
                     /old_locus_tag="AAR111C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR023C (AHC1)"
                     /codon_start=1
                     /product="AAR111Cp"
                     /protein_id="NP_982653.1"
                     /db_xref="GeneID:4618622"
                     /translation="MTLTGTLRNKRQHSRIQHRSSEEFHGAEEPIAHSDSGQLISSPQ
                     VLLMDSEDITGRPHIGAGPAYYQVATPKSPHELSLGDDEYSGLRAEEGPLGRESEETE
                     RIKYEIAKREILEQLHLQVMIKHREMDDLEAESRGLGAKLEVLEMLHDDPELLAKVDA
                     HQEQQAQLRLAQLEARRRREQQMAALPPAPLSSSSGGEYYYHTRSKSMNSHQGRSSTL
                     RPADGNVIGLRVLGSKTVADASSPGTTSPPFSSFQQADPFAPQHFNQHHRRNYSSNCI
                     SSNSGVVGKTDSGDAIFRRLDGLLIVITCCKCGKSGFTSAQGIVNHSRLKHANSYSSQ
                     PLAVLHNQRILPEEQQNKIVMDKFKELHLDPQTEYLPNPTVVSQSPSSSANSNACITA
                     TEGRDISPTHISSSLSPTCVQPVSQFHSTKHLEKLYGKEGFQQIVDYVKESKDDLDVI
                     MRVDSDIEDDPTPLHMEDQSDLLSQHNSERSTDLKRRASPNMDKALRERMRPAEKRVR
                     PDAMALVELPAEEKRSSHYNLRARSKLKSLSKHE"
     gene            544323..544404
                     /locus_tag="AGOS_t0022"
                     /db_xref="GeneID:4618657"
     tRNA            544323..544404
                     /locus_tag="AGOS_t0022"
                     /product="tRNA-Ser"
                     /codon_recognized="UCU"
                     /db_xref="GeneID:4618657"
     gene            complement(<544497..>545774)
                     /locus_tag="AGOS_AAR112C"
                     /old_locus_tag="AAR112C"
                     /db_xref="GeneID:4618586"
     mRNA            complement(<544497..>545774)
                     /locus_tag="AGOS_AAR112C"
                     /old_locus_tag="AAR112C"
                     /product="AAR112Cp"
                     /transcript_id="NM_208007.1"
                     /db_xref="GeneID:4618586"
     CDS             complement(544497..545774)
                     /locus_tag="AGOS_AAR112C"
                     /old_locus_tag="AAR112C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR155C (ISN1)"
                     /codon_start=1
                     /product="AAR112Cp"
                     /protein_id="NP_982654.1"
                     /db_xref="GeneID:4618586"
                     /translation="MSSRYRVEYQLKAHRKDAFIEWIKGLLAVPFVLHSVTERDNAQE
                     KYRRVFEDVETLINEKITVDSDESLTRAAGVSRLDKLVPTIGTFFTPLPLTEAFLRQN
                     ARRAISERAYVSPSFNDIRHILNTAQIVQLARAGELSLVTFDGDVTLYEDGASLAAED
                     KVIGRLLRLLGAGMHVGIVTAAGYDDAENYERRLFGLLRRLERADLPNEAKRRLCVMG
                     GESNFLFRCYERDGRAGFERVPESVWMSAELHQWNQQDINATLDLAEVMLRALREKLR
                     LPAETQIIRKVRAVGIVPGQRFDPELGREIRVPLLRETLEEIVLTVQGRLENFPPAQR
                     VQFSCFDGGSDVWCDIGGKDLGVAFLQRFYSPERPIRPEQSLHVGDQFAPVGSANDFK
                     ARLAGCTAWISSPQETVALLDDLLAELEAQKNM"
     gene            <546188..>547849
                     /locus_tag="AGOS_AAR113W"
                     /old_locus_tag="AAR113W"
                     /db_xref="GeneID:4618709"
     mRNA            <546188..>547849
                     /locus_tag="AGOS_AAR113W"
                     /old_locus_tag="AAR113W"
                     /product="AAR113Wp"
                     /transcript_id="NM_208008.1"
                     /db_xref="GeneID:4618709"
     CDS             546188..547849
                     /locus_tag="AGOS_AAR113W"
                     /old_locus_tag="AAR113W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR161C (PNS1)"
                     /codon_start=1
                     /product="AAR113Wp"
                     /protein_id="NP_982655.1"
                     /db_xref="GeneID:4618709"
                     /translation="MYGKSGPPPEGYVPQHPPAQGYAPHNPPPGYVHENPFQEPVPQG
                     QEYSPQGQQYQFRKDQYYNLDHQGSGAPIGDASFEDKFPTEAGNRLKFNDWPFTIIFL
                     LTVGAFIAVAVLTLRGWSLSPTSNGSGIYDGDNTHTLNTNAAILLLISCGVAVALSVF
                     GLVLAGMYTKFFIYAAMILNTVVGLGTAITYLVLRHWSAGIVFMIFTILTAVCYWLMR
                     SRIPFSVAVLRTVMSVMKKHPQTWLVSLLGTIVSAAFSVIFSVVLVATYIKYDPKSEN
                     GGCDVSGGSCSRGKLIGILVLVFFCGFYISEVIRNVIHCTIAGIYGCWYYFSKSDQGM
                     PRWPAFGSLKRALTTSFGSICFGSLIVSLIQLLRQIIQLLRNGIISGISDSGWMQCLW
                     LILDAVVGVFEWMAEYFNHYAYCFIALYGKPYLRAAKETWHMLREKGIDALINDNLIN
                     LALGFYTLFVGYTTALFSYLFLRFTKPDYNSGGGFNAVLMAFSFLIAIQLTHVATETI
                     RSGTATFFVALGNDPEIFRVSYPQRFDEIFRAYPDVLNKLSHQHV"
     gene            <548273..>548794
                     /locus_tag="AGOS_AAR114W"
                     /old_locus_tag="AAR114W"
                     /db_xref="GeneID:4618588"
     mRNA            <548273..>548794
                     /locus_tag="AGOS_AAR114W"
                     /old_locus_tag="AAR114W"
                     /product="AAR114Wp"
                     /transcript_id="NM_208009.1"
                     /db_xref="GeneID:4618588"
     CDS             548273..548794
                     /locus_tag="AGOS_AAR114W"
                     /old_locus_tag="AAR114W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YLR224W"
                     /codon_start=1
                     /product="AAR114Wp"
                     /protein_id="NP_982656.1"
                     /db_xref="GeneID:4618588"
                     /translation="MKHINEFPTEIKLILLSLAPELGSASRDYYYLLKGRMPRALPQI
                     ELLPDDIKLRILWFAPKMRFASRNWYCLHNELYRSKCKSLDTERWTYKHMRLAKLVQV
                     HSPDIQPLRRLCYNYHLRILKKVTRAQAERSVMPFISDSWYFLYRNSSLLLEGEHSQF
                     PRMICSGTPKAFD"
     gene            complement(<549026..>551920)
                     /locus_tag="AGOS_AAR115C"
                     /old_locus_tag="AAR115C"
                     /db_xref="GeneID:4618421"
     mRNA            complement(<549026..>551920)
                     /locus_tag="AGOS_AAR115C"
                     /old_locus_tag="AAR115C"
                     /product="AAR115Cp"
                     /transcript_id="NM_208010.2"
                     /db_xref="GeneID:4618421"
     CDS             complement(549026..551920)
                     /locus_tag="AGOS_AAR115C"
                     /old_locus_tag="AAR115C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR160W (MTR10)"
                     /codon_start=1
                     /product="AAR115Cp"
                     /protein_id="NP_982657.2"
                     /db_xref="GeneID:4618421"
                     /translation="MAYQLADIKQALQCVSSNMGQKEKASALQYLEQFQKTTDAWQLC
                     HSVLAGGEGEALEIQVFAAQTLRNKVTYDLNQLEESLGPFKESLLQLLVQHQHRLIVT
                     QLSVTIARLSIQYLAWRNPIGEIISVLNPYPDKLLGFLKILPEETLDMKSTPLSEDEF
                     KSRTHELINQIAEDVLSFLIKCIDAAQDTGSVQVEQILSCLSTWIYEFPIEQLLTVTP
                     LINLVFRVLMESHDDYPDAFEAAVDCLSVLLRETRDVANVQMIQMLYEQLMQLQSRLL
                     PPVEKVDDWSEYEDVMDALTRLFVEAGESWCVFIGKEPQTFKPLVQVILLLTCKNTDL
                     DVVKYTFPFWFNLKQMLVLARYNEQKLQYQDIYVGLINGIIKHLEYPEESFTSKEEED
                     KYREFRYDMGDVLKDCTAVAGPENALSQPFQLLKSHLALDASNIRWQKLEAPLFSLRT
                     MGQEIPTTENNILPQIFQMLCNLPEHPKLRYAVTLVLGRYTEWTSKHSEFLEMELNYI
                     FNGFQTGNNDKDLFTASSHALMYFCQDCSSLLSGYVEQLISFTWKIEPMVDMLCMFEV
                     CQGLSSVINEQPLDKLTYSFELFYKPNSEKLQQAIEVWKGHSTDNEAAIKVADLVDLL
                     FALFESLRPRYEYPSQGAEPLVPYIKSLWLTLSDLLNYPGCGSNTIIVERVMKLLRRL
                     FEKYHVFLQDILPAVVDMLAKNYAETGLGSYLWCSGSLIYVFGDDESYPVPPELKNAV
                     WLFACSQCGTFLENFAKINPSELDLYFENIQDFFLMMLDVLMFYPKQFITTSALVESV
                     ADCALSSVDKLNNFDSYITVIRCLDEILSWGFPTPPISTMEIETVPMEWRANVLNIMV
                     LQKGGRMVSAIVNGLTSNLNSNAHPEAIGLLVKLFKLATQANNDDPSICMQWLSNSLE
                     QLRPVSANEKNKLMSIGSALTQGDYRRVRTNIKDFIGWYLRKHVSPRLYK"
     gene            <552310..>552603
                     /locus_tag="AGOS_AAR116W"
                     /old_locus_tag="AAR116W"
                     /db_xref="GeneID:4618582"
     mRNA            <552310..>552603
                     /locus_tag="AGOS_AAR116W"
                     /old_locus_tag="AAR116W"
                     /product="AAR116Wp"
                     /transcript_id="NM_208011.1"
                     /db_xref="GeneID:4618582"
     CDS             552310..552603
                     /locus_tag="AGOS_AAR116W"
                     /old_locus_tag="AAR116W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR159C (SME1)"
                     /codon_start=1
                     /product="AAR116Wp"
                     /protein_id="NP_982658.1"
                     /db_xref="GeneID:4618582"
                     /translation="MSGKQQKPMMPPINCIYNYLQQQTTVTFWLFQQTQMRIKGRISG
                     FDEFMNVVVDEAVEVPVDEKSGEEQVGRSTRLGRILLKGDNITLITAAEEEGV"
     gene            complement(<552612..>553502)
                     /locus_tag="AGOS_AAR117C"
                     /old_locus_tag="AAR117C"
                     /db_xref="GeneID:4618589"
     mRNA            complement(<552612..>553502)
                     /locus_tag="AGOS_AAR117C"
                     /old_locus_tag="AAR117C"
                     /product="mitochondrial 37S ribosomal protein PET123"
                     /transcript_id="NM_208012.1"
                     /db_xref="GeneID:4618589"
     CDS             complement(552612..553502)
                     /locus_tag="AGOS_AAR117C"
                     /old_locus_tag="AAR117C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR158W (PET123)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein PET123"
                     /protein_id="NP_982659.1"
                     /db_xref="GeneID:4618589"
                     /translation="MGKVIAKFGFKSGILPKPRPILKHPTVNMTAKVQEALAPKPKGP
                     SGVGYADNIAHPAGSRREPEPVKFIDVEQMIKATVPEPQQARQPASEQQAAKNRIAAM
                     RREYLSDAFRAEERRLLRQEELLRQRQQLLEEESQRQLAEATRERASDLTIPTLEELV
                     NEPLMRQRTPEEQKLVDMKRKHNREVLALRIQERRMAQLVSLYHAAEEYIVTEPQLLR
                     HIDEVFSSENAHTLKNRPLVSASGRENENERAVLDTLFGTVAAGRFDGLPAVRDFLAG
                     EQRAAASAPAPDSASQPPVN"
     gene            complement(<553656..>557252)
                     /locus_tag="AGOS_AAR118C"
                     /old_locus_tag="AAR118C"
                     /db_xref="GeneID:4618668"
     mRNA            complement(<553656..>557252)
                     /locus_tag="AGOS_AAR118C"
                     /old_locus_tag="AAR118C"
                     /product="AAR118Cp"
                     /transcript_id="NM_208013.1"
                     /db_xref="GeneID:4618668"
     CDS             complement(553656..557252)
                     /locus_tag="AGOS_AAR118C"
                     /old_locus_tag="AAR118C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR407C (TRS120)"
                     /codon_start=1
                     /product="AAR118Cp"
                     /protein_id="NP_982660.1"
                     /db_xref="GeneID:4618668"
                     /translation="MEGVCGPARVRVLVVPASDGWRRGEFLGYVERLRESPEVRLVDI
                     TPIADSMFNPQGFPQGKLLFEIEVEAKDESSMLFLYDFEPYRKTFVVVGLCQGTAGAE
                     AAGRLAKLEAKFPHCIGHCLIYQTAGAANERVLGFGASSETLMCDVGRCFLRALHTYY
                     LSYKHVTLRSPGAVGGNAVLKTTFMCRPAGPNAKRLSATLENGTGSKKGSLKGAKVAA
                     PDRSQQRAKGRQLKILANFQLLAGQYMSALANFSEAAHTAHKVRDHLWLGSALEGVFI
                     SMILLSYLAVPFQIPAVVVQLCPPKSYVVASASSSQRSSSSSISGSPNSGANGAFQSP
                     RPSMSGPNAPVLHSNEVLLGNLLKCLNERVLHYYELSLTQSVEYTPQVVYCQSLLRML
                     QFMSECHKSNSLGEPALRSMVLGVTHEPEAPADTMEPILFSKMEIYQLSNRFFELQLK
                     DLDLITQVRFYITLASVYGNLSLERKRAFVLRILFVSLLPNIEALPWRDEYDNLMEEL
                     LRTYGIASWEPENKIQDALSVHWVTLQKNVLILLINIVKKAGRARKVLKFSRWAITRY
                     SHILTHTEQTRLFKDFLLPAAQQHPEEFEYCDPFLLRNISLLKLEHHRQVPTVEHLEI
                     ASNSENKGEIFNPFKYNDVAAPEASNDDIENFMVSERAEFICSFQNPFNYDLDITSLS
                     LCQEDVKYLRICGNQVSSEAPFIVKAHSMRALHLTVEFLQDTPGHKLRALNIGLFKLP
                     ARKYPICNSEQKSVFASSRAVLGECKLVIIEDQPQLDFLSSDLPRASCMLLTGVKKRL
                     QCKVHNTSLSKTANYFRFCINTNVSSQLKDDYWRTIAADDLYDMELQLEQLKEKCIKV
                     TNFPDEIKPNEVVLFDLEIDSTCAPLHLDHFDLVINYGNNHSGNNAVYVRKLVIPFNV
                     TLKRSVEVTNMEIVQIHEELPSTVDVDWINYIRAQMREQQLSFSAFALMLLDIRNSWT
                     SKVVLELGYDDFSASPHEIGSCQTIRIIVPIKKLRGNSDLSDRPIPSIVRGRQFVHSG
                     LSDDQLHDLQTHFWCREHLLSKLHCTWKGSSFAGTVNFRLFMPKLSNNAIAVMYRSKK
                     TPYTLELRTSDPHVSVCEEVTITATIDASLEHDSTSTVFVQFQFFERRTGKQIPNSNK
                     QLLYNGTLMNSIDLRTQQELTLKVLPIESGDYEFHGSIVGTDAAAYSLVHVT"
     gene            <557409..>558188
                     /locus_tag="AGOS_AAR119W"
                     /old_locus_tag="AAR119W"
                     /db_xref="GeneID:4618563"
     mRNA            <557409..>558188
                     /locus_tag="AGOS_AAR119W"
                     /old_locus_tag="AAR119W"
                     /product="AAR119Wp"
                     /transcript_id="NM_208014.1"
                     /db_xref="GeneID:4618563"
     CDS             557409..558188
                     /locus_tag="AGOS_AAR119W"
                     /old_locus_tag="AAR119W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR157C (PUP1)"
                     /codon_start=1
                     /product="AAR119Wp"
                     /protein_id="NP_982661.1"
                     /db_xref="GeneID:4618563"
                     /translation="MAGLSFDNYQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIA
                     ADTRSTQGPIVANKNCEKLHRIAPRIWCAGAGTAADTEAVTWLIGSNLELHSLYTGRE
                     PRVVSALQKLKQHLFKYQGHIGAYLIVAGVDPTGAHLFSVHAHGSTDVGQYQSLGSGS
                     LAAMAVLEAQWREGMGRADAMALAAAAIEAGIWNDLGSGSNVDLCVMEVGKDAELFRN
                     YITPNTREAKQNSYKFARGTTAVLRESTLQIYDEEIVDTAA"
     gene            complement(<558247..>558894)
                     /locus_tag="AGOS_AAR120C"
                     /old_locus_tag="AAR120C"
                     /db_xref="GeneID:4618719"
     mRNA            complement(<558247..>558894)
                     /locus_tag="AGOS_AAR120C"
                     /old_locus_tag="AAR120C"
                     /product="AAR120Cp"
                     /transcript_id="NM_208015.2"
                     /db_xref="GeneID:4618719"
     CDS             complement(558247..558894)
                     /locus_tag="AGOS_AAR120C"
                     /old_locus_tag="AAR120C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR408C (ADE8)"
                     /codon_start=1
                     /product="AAR120Cp"
                     /protein_id="NP_982662.2"
                     /db_xref="GeneID:4618719"
                     /translation="MSGPKVTVLISGSGSNLQALLDAQRQGKLPVEFVRVISSSAKAY
                     GLTRAAQHDIPATVHSLYKYNAGIEKEQTAERAAARRRFEEDLASLVLQDGPDLVVCA
                     GWLLILGPTFLQRVRGVPIINLHPALPGAFDGTTHAIELAWNKCQQDGAPLRAGCMVH
                     YVIEQVDKGTPLVVKELEIVPGAETLDEYEQRVHRTEHVAIVEGVAAALRAQGKL"
     gene            <559401..>562094
                     /locus_tag="AGOS_AAR121W"
                     /old_locus_tag="AAR121W"
                     /db_xref="GeneID:4618779"
     mRNA            <559401..>562094
                     /locus_tag="AGOS_AAR121W"
                     /old_locus_tag="AAR121W"
                     /product="AAR121Wp"
                     /transcript_id="NM_208016.1"
                     /db_xref="GeneID:4618779"
     CDS             559401..562094
                     /locus_tag="AGOS_AAR121W"
                     /old_locus_tag="AAR121W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR409W (SIZ1) and YOR156C (NFI1)"
                     /codon_start=1
                     /product="AAR121Wp"
                     /protein_id="NP_982663.1"
                     /db_xref="GeneID:4618779"
                     /translation="MSTPIKYDIQQTCHEMSLLRVPELKAVCRSIGLPLSGRKADLQA
                     RIKEYVENSLRPNHVDPFRPKAIMALIQKSKVGDVLPTYESILQALRTGAFTHPVATG
                     HAPPSSLFPSDSVDGAPHDESGDQHQTARAVGRKGSPSSVFYPSPFYNLKRMVSGSPK
                     MAAKSPGRGTCNMKFRLSETESKFILDSKDTKLLLFCGPVSQGNRVHIQFPHPNEIKL
                     NDNMIKDNVRGLKNKIGTAKPADLTPFVKHNAENYLQLVYAFTKEDFLVYLYIVTMNT
                     PEKILEGVLARPKIVKPATLAYIKKILSEDEDDDLMTTSTIMTLQCPISYSRMKYPVK
                     SVRCDHLQCFDAMSFILSQMQIPTWQCPVCQKQIEIKDLAVCDYVDDIIKSSNENVEQ
                     VVINSDGSWVAKEEEPENRPGKSTDTEQPAQTNIKDEDIDQVILDEEMSTKKAANDPI
                     VISLDSDDEDDDVSLAEELAKLKNHPQSHSNSHTSPQKQSRTPDSLLNGKVSRASSVP
                     LAVEQTSSFSPNERSISSNGGNAPLDRTISTEGSARVISLPSRSAGVLSTGSGSLSNH
                     PVTTLNHTLQDNGISTITRLPRDMPATNLHRVLTDYNPSGHLNSQHDATLSNLSSKTG
                     DVHRPSNSSSSFNGAQKRASIPNILGSAPLSNQSRTPDNRLTHGTSIHENPRLELNGD
                     QSLLFGGNTGQASGNLAGVSPAENSRRSNSHDQSQYRLHSNAFHSTAPPNEPSKNTSP
                     GTTVAPASVVGTNTRNTQRGPTGDVSQESVEQPQSASRASDESSARIMSPSHHTEPVV
                     SVSTISSNTRPPILPPLPSIHRPLISPSPPVDDAPSGYYPTRQDHSKAYPSTNPRNKK
                     PPVSPFIPRKYSSVVPKKRLLSTSDGAAKGDTNNACTNHGD"
     gene            complement(<562339..>563091)
                     /locus_tag="AGOS_AAR122C"
                     /old_locus_tag="AAR122C"
                     /db_xref="GeneID:4618428"
     mRNA            complement(<562339..>563091)
                     /locus_tag="AGOS_AAR122C"
                     /old_locus_tag="AAR122C"
                     /product="AAR122Cp"
                     /transcript_id="NM_208017.1"
                     /db_xref="GeneID:4618428"
     CDS             complement(562339..563091)
                     /locus_tag="AGOS_AAR122C"
                     /old_locus_tag="AAR122C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR410C (STE14)"
                     /codon_start=1
                     /product="AAR122Cp"
                     /protein_id="NP_982664.1"
                     /db_xref="GeneID:4618428"
                     /translation="MTTGNGAASHEEEPLVIDGAVYPDIVKNPLDEISCTSYVLGILF
                     GASVALLPIARFWNFNLYVAALCAFHFLEFYITARYNPGKVEVGSFVLRNGKSYFLAQ
                     ALSVCEVWLELWLFPNWKNTWRSTGHTACVVVGIVLLLFGQYVRSQAMVTAGQSFSHL
                     IKTTKEPDHVLVTTGIYRISRHPSYLGYFWWTLGTQLVLLNPVTFVVFAIILCKYFSD
                     RIRYEEHYLLQFFGKVYVSYRESTGVYIPFIP"
     gene            complement(<563378..>564154)
                     /locus_tag="AGOS_AAR123C"
                     /old_locus_tag="AAR123C"
                     /db_xref="GeneID:4618700"
     mRNA            complement(<563378..>564154)
                     /locus_tag="AGOS_AAR123C"
                     /old_locus_tag="AAR123C"
                     /product="AAR123Cp"
                     /transcript_id="NM_208018.1"
                     /db_xref="GeneID:4618700"
     CDS             complement(563378..564154)
                     /locus_tag="AGOS_AAR123C"
                     /old_locus_tag="AAR123C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML041C (VPS71)"
                     /codon_start=1
                     /product="AAR123Cp"
                     /protein_id="NP_982665.1"
                     /db_xref="GeneID:4618700"
                     /translation="MGFVEEINLKTYDPDVYFTSIHARTSSARNRIPKSLSTGSETNR
                     PNRRVNYSLADLENRIYNQRGSSQGADDTDKADSYSAERYTQAELLKSNKRFMELDTE
                     NFGDARDVPYLMSALTGINKDRIDQAATGISGGAVPTQSSSNRARNKFELPKNMQMMY
                     RCTRPPIPKRKNTNRIVALKKTLSSRRPLSSYLDALDHVNRSIIYNNVYNKKFTKVLP
                     VVTVCSICGGYRSLSSCVKCMDKICSLKCYTLHNETRCSS"
     gene            564328..564401
                     /locus_tag="AGOS_t0023"
                     /db_xref="GeneID:4618510"
     tRNA            564328..564401
                     /locus_tag="AGOS_t0023"
                     /product="tRNA-Val"
                     /codon_recognized="GUU"
                     /db_xref="GeneID:4618510"
     gene            complement(<564485..>566437)
                     /locus_tag="AGOS_AAR124C"
                     /old_locus_tag="AAR124C"
                     /db_xref="GeneID:4618632"
     mRNA            complement(<564485..>566437)
                     /locus_tag="AGOS_AAR124C"
                     /old_locus_tag="AAR124C"
                     /product="AAR124Cp"
                     /transcript_id="NM_208019.1"
                     /db_xref="GeneID:4618632"
     CDS             complement(564485..566437)
                     /locus_tag="AGOS_AAR124C"
                     /old_locus_tag="AAR124C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML042W (CAT2)"
                     /codon_start=1
                     /product="AAR124Cp"
                     /protein_id="NP_982666.1"
                     /db_xref="GeneID:4618632"
                     /translation="MIRCRQAQVILRRSMATRAFAFETGNGEQYVAREANQHYQQQRP
                     GFKGVTFAQQGKLPSLPVPALGETLQRYLQSVEPLCGSQEELARQRELCAEFEAGAGQ
                     ELHARLEAFARDKRNWMSEFWDNQSYLEYNDPIVPYVSYFYGHRPLAGPQRVLEQDHL
                     VKATALVSAVVKFIEVLKDEALPAEQVRGAPFCMNSFNLMFNTSRLPGKGRDSNVFYS
                     LYENDFITVAYRGQFYKVVTHEGGRPLGPGAIWQQLYDVVNKAAVGKGAGDHAGVGLL
                     TTLPRDEWYVAHRHLEVNAVSRASLETIHRSSFLLALDTDQHPISLEDKAHNNWHGDG
                     VNRFNDKALQFFVCGNGVSGFLAEHSKMDGTPTLFLNQYVMSELSRLDAADFINQIKT
                     TAPGSNYQPKHLPFVVTPALQEMIRDAEGQFRDVIGEHDLRVWNYVKYGKKAIKAFGF
                     SPDAYIQQIIQLAIYKYVGRQLPTYEAGSTRKFFKGRTEAGRGVSPASAKFVKTWQSP
                     EASPSEKIAALRESAKNHSSLLKMAADGQGVDRHFFGMKNMLRDGEEHPALFRDPLFQ
                     HSCTWYVSTSQLSSEYFEGYGWSQVNENGFGLAYMINNDWLHINIVTKPKKSGYSVHE
                     LHYYLTEAANEMYELLSNETKVSSKL"
     gene            complement(<566727..>567884)
                     /locus_tag="AGOS_AAR125C"
                     /old_locus_tag="AAR125C"
                     /db_xref="GeneID:4618720"
     mRNA            complement(<566727..>567884)
                     /locus_tag="AGOS_AAR125C"
                     /old_locus_tag="AAR125C"
                     /product="AAR125Cp"
                     /transcript_id="NM_208020.1"
                     /db_xref="GeneID:4618720"
     CDS             complement(566727..567884)
                     /locus_tag="AGOS_AAR125C"
                     /old_locus_tag="AAR125C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR411C (DFM1)"
                     /codon_start=1
                     /product="AAR125Cp"
                     /protein_id="NP_982667.1"
                     /db_xref="GeneID:4618720"
                     /translation="MPSMTSTVHSNGGIGRFLSEIPLVTRGLLLALLLWCFNAFMRFS
                     QLQVLVFAWNFRRHDYEFWRLYGRFIAVNSNSAAALLALYQIYRNSSSLELDYFQANP
                     VDYAFYLAFCTTTCAALTAACHALLGIEPGSLFPALDGMLLYTWALLNANVTVNYIVF
                     NIRGKYLPLLNLFVHMLGGEPSGVLIILLGYAAAYIYCCLETRTAGPLYGKLAGLPHY
                     GYPTLRDSHFRGSALLAPLIATQSGGPPSAAAAVSGNFRGKGRRLHDGKAVAAPRHAA
                     RAAGTGAVVPLTSTSALAAALAGPGLAVIDFYAVWCGPCKQLAPLLDQYAAKHTAVRF
                     YKIDVDRFPGVAATHEVHAMPTVLFFRAGKEVARVQGANPSAIRAALQSYS"
     gene            <568087..>568872
                     /locus_tag="AGOS_AAR126W"
                     /old_locus_tag="AAR126W"
                     /db_xref="GeneID:4618452"
     mRNA            <568087..>568872
                     /locus_tag="AGOS_AAR126W"
                     /old_locus_tag="AAR126W"
                     /product="AAR126Wp"
                     /transcript_id="NM_208021.1"
                     /db_xref="GeneID:4618452"
     CDS             568087..568872
                     /locus_tag="AGOS_AAR126W"
                     /old_locus_tag="AAR126W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR412W (RRP17)"
                     /codon_start=1
                     /product="AAR126Wp"
                     /protein_id="NP_982668.1"
                     /db_xref="GeneID:4618452"
                     /translation="MVCDYRLGGCSSVSLDMKIFYIGAGDAISSRAARLEHRLEKVPA
                     SIRSLTMERKNRQILSRGQKYKQKAARTHGATEVVFDKDSRLEYLTGFHKRKLERQKK
                     AQEFAKEQERLARVEERRKQREQRRSEMEQQLESARAAMAGSLDSDGDAGEEDSWHGF
                     SDSEEGVRPILKRHQDVYDDATVEIETLEPNDNFAYLARMNNVALERSEKVLDDSIDR
                     AKKYAEFLGVADKPKQKKKKFRYLTKAERRTNQRKATSNKRRK"
     gene            complement(<568932..>570077)
                     /locus_tag="AGOS_AAR127C"
                     /old_locus_tag="AAR127C"
                     /db_xref="GeneID:4618409"
     mRNA            complement(<568932..>570077)
                     /locus_tag="AGOS_AAR127C"
                     /old_locus_tag="AAR127C"
                     /product="AAR127Cp"
                     /transcript_id="NM_208022.1"
                     /db_xref="GeneID:4618409"
     CDS             complement(568932..570077)
                     /locus_tag="AGOS_AAR127C"
                     /old_locus_tag="AAR127C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR414C (ERD1)"
                     /codon_start=1
                     /product="AAR127Cp"
                     /protein_id="NP_982669.1"
                     /db_xref="GeneID:4618409"
                     /translation="MPGTKGAEGGSPLPVDIWSVLLLAPQHVVLLALVGLWLWYWELA
                     VLSKKIDLSRVILCNEPYDIRPQPSSLRILQSTRSCVARITKIVVPMYIGASYVAYRA
                     ALGAELPWWQVLAANTAALVQLAALVWVILRSSRMVRRCVARMLLGGGIEGKPLRTNY
                     ILLADTLTSYGKPLMDFTAYLVLLFRTPLADPLAVRDLPSNAALHIDLVVGAIPSVIR
                     LVQCLREYRRKEDAWAARRASLFNALKYSSQLPILVHALLSRSGAAHGGQRWVRWAML
                     LNSVYSFWWDVTMDWKLGLFNFSSAGMERDEVLRHRRLYSVKYYYGAVLYDFVMKFMW
                     LWELHVGRALFRRDLNPVWLHLLEVIRRWIWTFFKIEAEYFSANAKK"
     gene            570248..570278
                     /locus_tag="AGOS_AgSNR53"
                     /old_locus_tag="AgSNR53"
                     /db_xref="GeneID:4618410"
     ncRNA           570248..570278
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR53"
                     /old_locus_tag="AgSNR53"
                     /product="AgSNR53"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR53; start and end coordinates are
                     approximate."
                     /transcript_id="NR_149398.1"
                     /db_xref="GeneID:4618410"
     gene            complement(570375..570451)
                     /locus_tag="AGOS_AgSNR67"
                     /old_locus_tag="AgSNR67"
                     /db_xref="GeneID:4618460"
     ncRNA           complement(570375..570451)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR67"
                     /old_locus_tag="AgSNR67"
                     /product="AgSNR67"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR67; start and end coordinates are
                     approximate."
                     /transcript_id="NR_149412.1"
                     /db_xref="GeneID:4618460"
     gene            <570939..>572096
                     /locus_tag="AGOS_AAR128W"
                     /old_locus_tag="AAR128W"
                     /db_xref="GeneID:4618642"
     mRNA            <570939..>572096
                     /locus_tag="AGOS_AAR128W"
                     /old_locus_tag="AAR128W"
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /transcript_id="NM_208023.1"
                     /db_xref="GeneID:4618642"
     CDS             570939..572096
                     /locus_tag="AGOS_AAR128W"
                     /old_locus_tag="AAR128W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL050C (RML2)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /protein_id="NP_982670.1"
                     /db_xref="GeneID:4618642"
                     /translation="MLMFSSLRASLALTGAGFQSQLRLLSRTAVARQTAGDAEAKPSV
                     QVSPSLLKIVPDTSDIVLLEKQDELIQRRRKLSKEITKMRKLKPVSPGLRWFRAPIYP
                     HLHKGKPERSLTVALKAKGGRNHSGKITVRHRGGGHKRRIRIVDMLRWENGDQTVQRI
                     EYDPGRTAHIALIKHNETGKLSYILACDGLRAGDTVASYRKGVPESMKTEMGGVVDPA
                     ILSVRTAQRGNCLPISMIPVGSIIHNVGITPVGPGKFCRSAGTYARVMSKIVEQKRAV
                     IRLQSGEHRYVSLEACATLGVVSNIDHQNASLGKAGRSRWRGIRPGVRGVAMNKCDHP
                     HGGGRGKSKSNKLSMSPWGTLAKGYKTRRGKRVNKMKVKDRPRGKSSRSRT"
     gene            complement(<572267..>573394)
                     /locus_tag="AGOS_AAR129C"
                     /old_locus_tag="AAR129C"
                     /db_xref="GeneID:4618612"
     mRNA            complement(<572267..>573394)
                     /locus_tag="AGOS_AAR129C"
                     /old_locus_tag="AAR129C"
                     /product="AAR129Cp"
                     /transcript_id="NM_208024.1"
                     /db_xref="GeneID:4618612"
     CDS             complement(572267..573394)
                     /locus_tag="AGOS_AAR129C"
                     /old_locus_tag="AAR129C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR415C"
                     /codon_start=1
                     /product="AAR129Cp"
                     /protein_id="NP_982671.1"
                     /db_xref="GeneID:4618612"
                     /translation="MKLALILTAIGAASALPLEGRRRLQFNETYIADVTEEEKLAYAL
                     SGKSFFDITGLKQTQQLHGVSGLARSSSAAPGRQYEYPANLTHVSEVNSIIGGIDTKY
                     MYDKLDKFSSFFTRYYTSPTGAQSARWLFDTLKTATAPISGKVILRQFKHDWDQFSII
                     VSIPGSARPDKIVAFGAHQDSIAGPDPATTRSPGADDDGSGVITNLEALRLYAKYIAD
                     TGKWPENTIEFHFYSAEEVGLLGSLQIMTEYHDDPKKNVVAFFQHDMTGYVKNAADAH
                     IGVIVDYTDHNLTTFMEKLIGQYLTIPGRVTKCGYACSDHASATKQGFPSAFAFESVF
                     EDSSEFIHSPQDTIDRVNITHMAEFSKLAIGAVVELSDWVA"
     gene            complement(<573696..>574529)
                     /locus_tag="AGOS_AAR130C"
                     /old_locus_tag="AAR130C"
                     /db_xref="GeneID:4618572"
     mRNA            complement(<573696..>574529)
                     /locus_tag="AGOS_AAR130C"
                     /old_locus_tag="AAR130C"
                     /product="AAR130Cp"
                     /transcript_id="NM_208025.1"
                     /db_xref="GeneID:4618572"
     CDS             complement(573696..574529)
                     /locus_tag="AGOS_AAR130C"
                     /old_locus_tag="AAR130C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL051W (VMA8)"
                     /codon_start=1
                     /product="AAR130Cp"
                     /protein_id="NP_982672.1"
                     /db_xref="GeneID:4618572"
                     /translation="MSNNREQVFPTRMTLGLMKSKLKGANQGHSLLKRKSEALTKRFR
                     EITRRIDESKQRMGAVMQTASFSLAEVTYATGENIGYQVQESVANARFKVGARQENVS
                     GVYLPQFESQLDSDINDFKLTGLGRGGQQVQRAKNIYTKVVESLVQLASLQTAFVILD
                     EVIKVTNRRVNAIEHVIIPRTENTIAYINSELDELDREEFYRLKKVQEKKQRDVVALD
                     AEMKRKRLEKAATSTDAAVADAVPDDDIRGEGELDEHGQPDVEVGNQDILAEQEEDVI
                     F"
     gene            <574770..>577181
                     /locus_tag="AGOS_AAR131W"
                     /old_locus_tag="AAR131W"
                     /db_xref="GeneID:4618715"
     mRNA            <574770..>577181
                     /locus_tag="AGOS_AAR131W"
                     /old_locus_tag="AAR131W"
                     /product="AAR131Wp"
                     /transcript_id="NM_208026.2"
                     /db_xref="GeneID:4618715"
     CDS             574770..577181
                     /locus_tag="AGOS_AAR131W"
                     /old_locus_tag="AAR131W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR416W (SYF1)"
                     /codon_start=1
                     /product="AAR131Wp"
                     /protein_id="NP_982673.2"
                     /db_xref="GeneID:4618715"
                     /translation="MDEFVTAEDLVHEYSVLQEPDSVVNWSRYIAAKRDDPCSVSWVY
                     ERCLQALPAQWEVWREYLQFRMRLLDGVCAVQHAAEFEKVNRLFWRCVEHNAAVVEAW
                     RLFLGHAQRQGALALVRQVVDAALRGVGLAKHRTVWEDVVAYIEELLPAEETDLGEEQ
                     DLHELVRGALFGGAGAEDAGADIWSSAMLRRYIQVAEDAEAVLALLQRTHDYATVVAV
                     YEKHVLPVTRAKHKGRQSYESQFRYLVALDHTGATAKLEDAVARCAQLFPERAPSLTI
                     FLAKHYVKQGNYNRCTDVLTDSLKHTAKSSEFASLYDFLVVFEESLIEVVLEHLQEHP
                     ENEERWGADLERHTDQLDGLLADHALLLNDLKLRQEPDNVKHWLDRVELFDKAASKAS
                     VYADAIASINYKSQTVPGQLGTLWWQYAQLYIDDGQYETAKTILDKALNVPYNFLQDP
                     ELIWTKWAEEELKRAGLDAAMQVLSHALQIPDDHELLRDKFESHEKMPAQTVIFSSLK
                     LWSFYIDLLEASSESDEHLERTKAAYEATIQLKIATPLLFVNYAHYLQDKGNHVESFS
                     IYERAVDIFPAETAFEIWDIYIGEALKYGLPKEQIRDLFESSLKMANEGVECKPFFLL
                     YAKFERDNGMIETAANILHRACRAAQTMDAKRSLWTLCLNWCRQELGGSYARALYEEC
                     IQALPNHVAVVYVLEYAKVEEGLKQVKRARALLQYGARLLHPANNADLWEYWELFELR
                     HGNKDTYKDMLQLKRKVEELLEGDGLPVPNQIGNIAFVASTDGLQNPGGESTNINNDE
                     LELDM"
     gene            complement(<577314..>578762)
                     /locus_tag="AGOS_AAR132C"
                     /old_locus_tag="AAR132C"
                     /db_xref="GeneID:4618549"
     mRNA            complement(<577314..>578762)
                     /locus_tag="AGOS_AAR132C"
                     /old_locus_tag="AAR132C"
                     /product="AAR132Cp"
                     /transcript_id="NM_208027.1"
                     /db_xref="GeneID:4618549"
     CDS             complement(577314..578762)
                     /locus_tag="AGOS_AAR132C"
                     /old_locus_tag="AAR132C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL052W (AFG1)"
                     /codon_start=1
                     /product="AAR132Cp"
                     /protein_id="NP_982674.1"
                     /db_xref="GeneID:4618549"
                     /translation="MGTVWLRGARGWRAAVQLAGQMRRNATAATPLLEYDRRVGAGQL
                     RDDTHQRRIIASLAHLHEQLAAYEPPAVQTPSPLEQVGWRTSVLGRLLRRREQYSSEG
                     VCKGIYLYGDVGCGKTMLMDLFYATVPRHLSKRRIHFHQFMQYVHRRSHEIVREQNLD
                     ALGEAKGRTIDPIPLLAAEIATQWRVLCFDEFQVTDVADAMILRRLLTLLLSNRYGVV
                     LFTTSNRRPDELYMNGIQRESFVPCIELLKRRTEVIFLDSPTDYRKIPRPVSSVYYFP
                     ARGVRYRSATCEAARARHVRDWYDYFAQLQSEEQPVPAARPQILHDFRVNTWGRELVV
                     PSCIPGRVAQFSFKQLCAQPLSAGDYLALANSFNAFIVTDIPYLSIFVRDEVRRFITF
                     LDAVYDSGGKLATTGAASFSELFVEPEQLLNDYQLKEEPQTPHNADESPSDIAKRSTM
                     FILDEERFAFARALSRLSHMSTSEWVEKKRAE"
     gene            <579222..>581513
                     /locus_tag="AGOS_AAR133W"
                     /old_locus_tag="AAR133W"
                     /db_xref="GeneID:4618534"
     mRNA            <579222..>581513
                     /locus_tag="AGOS_AAR133W"
                     /old_locus_tag="AAR133W"
                     /product="AAR133Wp"
                     /transcript_id="NM_208028.1"
                     /db_xref="GeneID:4618534"
     CDS             579222..581513
                     /locus_tag="AGOS_AAR133W"
                     /old_locus_tag="AAR133W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL053C (MAK10)"
                     /codon_start=1
                     /product="AAR133Wp"
                     /protein_id="NP_982675.1"
                     /db_xref="GeneID:4618534"
                     /translation="MGEIESSLRALSICDDEELVDITEHVRQLASQLRAETIVRLADF
                     DLFEGTHALEINNGKLDSVLLELTAAEEDFDCAQAYGAGAAEQLGYVTGTVERLSQSL
                     MDWLHDYQSLPTTVLSCRYVEHLSQRQGAEAGLAAARLATGSELYDRVLSSCVFATLA
                     WVNFVGNLLRAGVVYEEEDLNCNTMGLDVLADVAVADVLAELAAARALLEQKYAGAAR
                     LLLLVRLFECLLHIPNYRPSAEHEPSDDVGPMHELIRIAAELARSPCAAEAPPGTFSQ
                     GIQKRLSNQFPPKQLYEPVGHEFAAYQTMAEDILKVLDVRHATSVIEVRQFAWFFNRC
                     SQRHVVARALFPLYLMRDDQSIIGIYSFADFTHQTLLNFSCCGTELDRRLADPGNSRA
                     LKDLDAFYQEISGILFEWYQNMSQNVCRYRQGYNRQLLLWDSLQAKLEPFETRLVDEG
                     IADLVSELDNAPLMPVNSWVYFMKLSAMLEFLLKGFDLEVYKPWEFFTIYWYAYYLSH
                     HLESCLKRVHSFAQQRIASIVAMGKKVKKSKAGPKKESLRAAYQYQSQNVLPQLRLNV
                     NFLDYLLADCVVTKSLALSQTFQFGILKSYGAVSNSSPGASIFSSDSYLHQLRFKTFS
                     SIGVPDLPSYETFKSSLEAFTISEPGLSMKLKTSLQLMNNELDTSRKALQSILKEVEE
                     ASAGPVHGLFAGTRLVTDSAKQWYTSLDKTVDAIALNGRTIEATLGAVESAQETEQKV
                     ELIYPSDSCRYFPILQLHNSSDK"
     gene            <582009..>582506
                     /locus_tag="AGOS_AAR134W"
                     /old_locus_tag="AAR134W"
                     /db_xref="GeneID:4618584"
     mRNA            <582009..>582506
                     /locus_tag="AGOS_AAR134W"
                     /old_locus_tag="AAR134W"
                     /product="60S ribosomal protein L12"
                     /transcript_id="NM_208029.1"
                     /db_xref="GeneID:4618584"
     CDS             582009..582506
                     /locus_tag="AGOS_AAR134W"
                     /old_locus_tag="AAR134W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR418W (RPL12B) and YEL054C (RPL12A)"
                     /codon_start=1
                     /product="60S ribosomal protein L12"
                     /protein_id="NP_982676.1"
                     /db_xref="GeneID:4618584"
                     /translation="MPPKFDPNEVKFLYLRAVGGEVGASAALAPKIGPLGLSPKKVGE
                     DIAKATKDFKGIKVTVQLRIQNRQATASVVPSASSLVITALKEPPRDRKKEKNVKHTG
                     NLQLDDIIEIARQMREKSFGKNLASVTKEILGTAQSVGARVNYKNPHDIIEAINAGEI
                     EIPEN"
     gene            582740..582923
                     /locus_tag="AGOS_AgSNR80"
                     /old_locus_tag="AgSNR80"
                     /db_xref="GeneID:4618477"
     ncRNA           582740..582923
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR80"
                     /old_locus_tag="AgSNR80"
                     /product="AgSNR80"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR80; start and end coordinates are
                     approximate."
                     /transcript_id="NR_149428.1"
                     /db_xref="GeneID:4618477"
     gene            <583189..>584073
                     /locus_tag="AGOS_AAR135W"
                     /old_locus_tag="AAR135W"
                     /db_xref="GeneID:4618530"
     mRNA            <583189..>584073
                     /locus_tag="AGOS_AAR135W"
                     /old_locus_tag="AAR135W"
                     /product="AAR135Wp"
                     /transcript_id="NM_208030.1"
                     /db_xref="GeneID:4618530"
     CDS             583189..584073
                     /locus_tag="AGOS_AAR135W"
                     /old_locus_tag="AAR135W"
                     /note="NOHBY114; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0A01870g"
                     /codon_start=1
                     /product="AAR135Wp"
                     /protein_id="NP_982677.1"
                     /db_xref="GeneID:4618530"
                     /translation="MSDDSVDIVFEKAIATIQTLSSVKGYHALPRPPASTRIQLYALF
                     KQSTEGDVERILPRPQGNPNVPEFNIALKKWETWKSKEGMSSTEAKKRYIQLLINTMK
                     TYAMGTLAARELLSELEFLWWQVSRNKEDGSEVVSDTHAESESMVLLSRGDRLDPQTL
                     RMKEEIYYALLKERNSHFGLLKARALARRDDDKPDPDITDKVRRRLVWLTGAILRHAW
                     KVLRRLAQWLLVVAAVFVLGRLSTGGRPLKLVFKPASPAPRTNLLSYVGRAVLWAFQL
                     LNSRLGRYQLHTLYIKLE"
     gene            <584182..>586035
                     /locus_tag="AGOS_AAR136W"
                     /old_locus_tag="AAR136W"
                     /db_xref="GeneID:4618631"
     mRNA            <584182..>586035
                     /locus_tag="AGOS_AAR136W"
                     /old_locus_tag="AAR136W"
                     /product="AAR136Wp"
                     /transcript_id="NM_208031.2"
                     /db_xref="GeneID:4618631"
     CDS             584182..586035
                     /locus_tag="AGOS_AAR136W"
                     /old_locus_tag="AAR136W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR419W (RAD30)"
                     /codon_start=1
                     /product="AAR136Wp"
                     /protein_id="NP_982678.2"
                     /db_xref="GeneID:4618631"
                     /translation="MSSFYWRDLLAINSSHATHLSPLACVAHIDVNAFFAQVEQVRCG
                     YGKDDPVVCVQWSSVIAVSYACRKYGITRLDSVAEAMKKCPTLIPIHTAVFKKGEDFW
                     QYHDGYGPWNTDPSRQLDPAIHKVALDPYRRESRKLLKMIQKRCPIVEKASIDEVFVD
                     LGPQCFAQLLLGDDGAEFQELRRLFVEGSYSLDEPLPPLPRSVKLQFAGDVYGADAER
                     TSFLDWDDVIMCLGSRLALALRQEVEDALGYTTSCGVSRTKSVSKLASNYRKPNAQTI
                     VRNAAVETFLDQGGFELPSFWTLGGAIGKELLDLLELPPAGSIPALRALCPESPEQLH
                     ACLLRRIRDRPLPHDAAPYLIDEQAAEALATKLFYLVRGTHCVPVNPRPTVSSMTSRK
                     NMRGNACKSLADCHPWLEVFSAELAGRLQDLHQEYDRIYLPRTLTVAAQGRAHQRVSR
                     STGLHAPTANVTALTLLKAGARLVNELDERFCGADMYPLSALSMSLANFDVLQPGKTI
                     VDLLPRAPATPPSPPARAASPASLPAAAAAACPQCRAPLPSQRALQVHLDGHLAQKLS
                     DSLNGVSDASALSYGERRLLLRPKHGGPAAPKKQRRTTKDIASYFGPTGQP"
     gene            <586596..>589262
                     /locus_tag="AGOS_AAR137W"
                     /old_locus_tag="AAR137W"
                     /db_xref="GeneID:4618540"
     mRNA            <586596..>589262
                     /locus_tag="AGOS_AAR137W"
                     /old_locus_tag="AAR137W"
                     /product="AAR137Wp"
                     /transcript_id="NM_208032.1"
                     /db_xref="GeneID:4618540"
     CDS             586596..589262
                     /locus_tag="AGOS_AAR137W"
                     /old_locus_tag="AAR137W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR058C (ASE1)"
                     /codon_start=1
                     /product="AAR137Wp"
                     /protein_id="NP_982679.1"
                     /db_xref="GeneID:4618540"
                     /translation="MQQLININERPDPRMERGLSSPSPDPLRSFQTVHNNSCTRDTAR
                     TPSTEVISDSLEKVSSDLLKLTPVNIGCFSSPAKEAAEAAGSAMHPALYRENFNLISR
                     QLENLLNNLNVVYREIGYSNTEISAREKMIFNKLSSSISSFFYQADEEKAKLSQENEV
                     CQEVLRRLLEVINDPKGVRTIPDLYTRNSIMGMESQSPNKKPISLLNRKRVLTTAKLF
                     VMKKYTPQLLCFLESSMKLRRLIDSMADYTPEDDKALIKKVPPIDTCKFFKSYFMEHM
                     DDVDLNYQFLLDNREVLLQSINFTDVTEAMVGNIMDVAKLYQKELSNRLGKAKRTCHG
                     LLKLLQTLGMNIMDLGDEIKDKIRIYTQKSEETICDLSHSTLSMLEDVVAEYEAIKTK
                     RAFEKETLVKRCESLWEKLKISPCYIDKFKQENDSLTVQHLNNFVKELDRLESMKKKL
                     IRSLIEDSWARIKDLWNLMHFNDNERTEFTILYENMVSTSSSLEENEKVLDLCEKQIR
                     VLEKKYALVKPMLELVDEFKVLHKERLQLEESSKDSSRLLSRNSHKILLQEEKARKRV
                     TRHFPSVIYQLKMKLVQYVEEFREDFLVDGRPFLEIVNEEQEQLHSKYPRMRFTSGAR
                     KPLLRSKSLPIRYSIQKKSKLVRGANSSISKSFAEKTPLRSTENVNVIRAKPDGSTQA
                     PNNKIVNFPSLPRTIQGTQVVSPQKKAEKAYSASLLDKSSPTKIPALTRASSHIILRS
                     PERKEDNGTSSKYTQLSALSTHKLNKRTLIPILSTHINTFPLNQEDKENNCTLESPAI
                     ITKKYRQQLLSSPIKGNGQPIYATTEGEDTKASSTIEDIKVNTMAGDESSMMEDKNFT
                     EWKRLQLAKLNDSSIRSGNELTTRINWEHDVF"
     gene            complement(<589403..>590509)
                     /locus_tag="AGOS_AAR138C"
                     /old_locus_tag="AAR138C"
                     /db_xref="GeneID:4618604"
     mRNA            complement(<589403..>590509)
                     /locus_tag="AGOS_AAR138C"
                     /old_locus_tag="AAR138C"
                     /product="AAR138Cp"
                     /transcript_id="NM_208033.1"
                     /db_xref="GeneID:4618604"
     CDS             complement(589403..590509)
                     /locus_tag="AGOS_AAR138C"
                     /old_locus_tag="AAR138C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR057W (SGT1)"
                     /codon_start=1
                     /product="AAR138Cp"
                     /protein_id="NP_982680.1"
                     /db_xref="GeneID:4618604"
                     /translation="MPIEVDLKNAYRLLYDEKEPEKALELYDNVLQQSSTNLIALIYK
                     AAALEKLYYSTKSWHSDGTLEEARGLLEKALDLAEQRGDRGKLALVNFRAFVYHFNRR
                     EYAAAEPYMTRAKQLGYDDATLGIWEANLEKKLKKAAAPGAAENRDEPKAPTEEPASA
                     EQHAPVKSRMEWYQTTQKVTISLFVSKLPRSHSEVIVQVVNGKDLTVSYPITAGGSEF
                     QYSLTLAHPVDSECYSVVVLTKKVEVVLQKKDSIHWKTLEDVGQGDVQSFPAEHASVD
                     SAPSNSSNLQYPSSSRKKINWDALELDEAEDDQQSADAFFQSLYANADPDTKRAMMKS
                     FLESGGTALNTDWNEVSKGRIEPSLPDGVEMKEF"
     gene            <590796..>592112
                     /locus_tag="AGOS_AAR139W"
                     /old_locus_tag="AAR139W"
                     /db_xref="GeneID:4618587"
     mRNA            <590796..>592112
                     /locus_tag="AGOS_AAR139W"
                     /old_locus_tag="AAR139W"
                     /product="AAR139Wp"
                     /transcript_id="NM_208034.1"
                     /db_xref="GeneID:4618587"
     CDS             590796..592112
                     /locus_tag="AGOS_AAR139W"
                     /old_locus_tag="AAR139W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR056C (NOB1)"
                     /codon_start=1
                     /product="AAR139Wp"
                     /protein_id="NP_982681.1"
                     /db_xref="GeneID:4618587"
                     /translation="MASIPHVHSLVLDATPLITQPYAHYKGYAQNFYTTPTVFHEIKD
                     ENAKKNLDIWQAAGALKLRHPSESSIKRVSDFAKLTGDASVLSANDIHILALTYELEV
                     ELNGDKGRLRRYPGEALVPKAAPPPEQPAGEKKKRRRGGKKQRAKREEAAQQAAARDE
                     PVETADGTESPEKSAETPVEGLEEPALAAQAAEELTEEYDEADDDGDWITPDNLTEIM
                     IQDSGEDTTGNEGVAASDSALYNQVALATGDFAIQNVALQINLNLMNFTSGMRIKKLR
                     NYMMRCHACFKLLPTPRDGRPVHFCPSCGGAGTVLRCAVSVDAETGAISPHLKANFQW
                     NNRGNRYSLPSPLSKASQKRFGNKGFVHTRHQQEVPLLREDQKEFQQAMKQEDWTRRH
                     NEKVLNSWIGGGSADNYMSPFAITGLKHHSVRVGRGRHVNSSNKRK"
     gene            <592500..>594446
                     /locus_tag="AGOS_AAR140W"
                     /old_locus_tag="AAR140W"
                     /db_xref="GeneID:4618698"
     mRNA            <592500..>594446
                     /locus_tag="AGOS_AAR140W"
                     /old_locus_tag="AAR140W"
                     /product="AAR140Wp"
                     /transcript_id="NM_208035.1"
                     /db_xref="GeneID:4618698"
     CDS             592500..594446
                     /locus_tag="AGOS_AAR140W"
                     /old_locus_tag="AAR140W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR054C (VHS3) and YKR072C (SIS2)"
                     /codon_start=1
                     /product="AAR140Wp"
                     /protein_id="NP_982682.1"
                     /db_xref="GeneID:4618698"
                     /translation="MSDSSGKQQGIISPHVTNAVKRANLEGCLTPGAGPGHGASGIGS
                     PGPSVSACVSPTQAVTKSIMNASGTSGAVVSNTPEPGLKRVPTVTFSDPKQLPAKQSG
                     TGQGGRVISGDSTTSGATASEDTDTQSHLQMKVASPIHHPTAQHSTPPPLLSHGGGNG
                     AAAVGMSHIRSTSPTSGSEVHPPKQAVGNIVHKLLHQFDGSGAGTPTSDVEKLHLHDE
                     HPHFFVSDPLHTSPTVLRSRSNSISPKPISVLSETKPADILNLDSAIESTQQQQIAPN
                     IPKRDPGKNVDPRLPQDDGKLHVLFGATGSLSVLKIKSMIKKLEEIYGWDHISIQVIL
                     TQAAAQFFANKNPKKKNLYVSSETNSFSNSVAHQGNLQQNNSDASYTAVNSVSNTPAV
                     GGRTPTPADLLQGAAPQGAGSGLSQGAAAAKIELPPHIQVWTDQDEWDVWKQRTDPVL
                     HIELRRWADILVVAPLTANTLSKIALGLCDNLLTSVIRAWNPMFPIFLAPSMVSGSYN
                     STITKRHLKMIKEEMPWITVFKPSEKIMGIHGDIGLGGMMDGNEIVDKVVMKLGGYPK
                     DADEDDDEDDKAGKTNGKEDDDDDDEEELDEDDEDDDDDDDDDDDDDDDDDDDDDDDD
                     DDSSQSPLKNAAATSPSHSSTAHT"
     gene            <594741..>595652
                     /locus_tag="AGOS_AAR141W"
                     /old_locus_tag="AAR141W"
                     /db_xref="GeneID:4618404"
     mRNA            <594741..>595652
                     /locus_tag="AGOS_AAR141W"
                     /old_locus_tag="AAR141W"
                     /product="AAR141Wp"
                     /transcript_id="NM_208036.1"
                     /db_xref="GeneID:4618404"
     CDS             594741..595652
                     /locus_tag="AGOS_AAR141W"
                     /old_locus_tag="AAR141W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR071C (DRE2)"
                     /codon_start=1
                     /product="AAR141Wp"
                     /protein_id="NP_982683.1"
                     /db_xref="GeneID:4618404"
                     /translation="MTHSRTALVLIHPATTTRPELLTAAKQHSSLSGANIEQHLVNKL
                     NDGSLQLQDNSYDVIFYVTPEAADEILFPRRLIGVLAAALRAGGSLHGLYDKYQVDAL
                     LSGFDIVREPTYHWQKRAVTASAPVKLAPRQPVSAAGLPRFKRASAPSPAAVTPTLDE
                     VPPAAVDPVKAALLDSAAGDAPIAENDLVVGHDSTPITLLTCGRTQTRRRKACKDCTC
                     GLREENEKEISDTHARQEKLLLGDAVKFSEPELAEIDFTIEGKKVGGCGSCSLGDAFR
                     CSGCPYLGLPAFKPGQPINLSAISDDL"
     gene            complement(<595981..>596619)
                     /locus_tag="AGOS_AAR142C"
                     /old_locus_tag="AAR142C"
                     /db_xref="GeneID:4618646"
     mRNA            complement(<595981..>596619)
                     /locus_tag="AGOS_AAR142C"
                     /old_locus_tag="AAR142C"
                     /product="AAR142Cp"
                     /transcript_id="NM_208037.1"
                     /db_xref="GeneID:4618646"
     CDS             complement(595981..596619)
                     /locus_tag="AGOS_AAR142C"
                     /old_locus_tag="AAR142C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR298C (YHC1)"
                     /codon_start=1
                     /product="AAR142Cp"
                     /protein_id="NP_982684.1"
                     /db_xref="GeneID:4618646"
                     /translation="MARYYCDYCHAYLTHDSLSVRKSHLIGKNHIRLTADYYYNKAQQ
                     QAKPFLFPKVRSRPQGGIQLPAQRRTLHCETNRVKRQRRLIHQVAPAATPLRELYAHS
                     PGFHKVFTPECRLDVGDTLRVSKLPQRANQKVKTAAPAAGRSEVYAPRYAANPVLPPP
                     SALTLWGGNISNNSNIYAADETLLRTVSKVREKLTSSRTEKVGRTMQSIRRH"
     gene            <598502..>599794
                     /locus_tag="AGOS_AAR143W"
                     /old_locus_tag="AAR143W"
                     /db_xref="GeneID:4618514"
     mRNA            <598502..>599794
                     /locus_tag="AGOS_AAR143W"
                     /old_locus_tag="AAR143W"
                     /product="AAR143Wp"
                     /transcript_id="NM_208038.1"
                     /db_xref="GeneID:4618514"
     CDS             598502..599794
                     /locus_tag="AGOS_AAR143W"
                     /old_locus_tag="AAR143W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR187W (TUF1)"
                     /codon_start=1
                     /product="AAR143Wp"
                     /protein_id="NP_982685.1"
                     /db_xref="GeneID:4618514"
                     /translation="MSFLASRLSTRFLARPAVSAGVRSFVSTPLRRATFDRSKPHLNI
                     GTIGHVDHGKTTLTAAITKTLASRGGADFLDYSSIDKAPEERARGITISTAHVEYQTE
                     KRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHI
                     VVFVNKVDTIDDPEMLELVEMEMRELLNHYGFDGDNTPVVMGSALCALEGRQPEIGEQ
                     AIMKLLDAVDEYIPTPARDLEKPFLMPVEDIFSISGRGTVVTGRVERGNLNKGEEIEI
                     VGHNATPFKTTVTGIEMFRKELDKAMAGDNAGVLLRGVRRDQLKRGMVLCKPNTIKAH
                     TKFLASLYVLTKEEGGRHSGFGENYRPQIYVRTADVTVVLKFPESVADHSMQVMPGDN
                     VEMVCELVHPTPIEAGQRFNIREGGKTVGTGLVTRIIE"
     gene            <600201..>602102
                     /locus_tag="AGOS_AAR144W"
                     /old_locus_tag="AAR144W"
                     /db_xref="GeneID:4618486"
     mRNA            <600201..>602102
                     /locus_tag="AGOS_AAR144W"
                     /old_locus_tag="AAR144W"
                     /product="AAR144Wp"
                     /transcript_id="NM_208039.1"
                     /db_xref="GeneID:4618486"
     CDS             600201..602102
                     /locus_tag="AGOS_AAR144W"
                     /old_locus_tag="AAR144W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR299W (ECM38)"
                     /codon_start=1
                     /product="AAR144Wp"
                     /protein_id="NP_982686.1"
                     /db_xref="GeneID:4618486"
                     /translation="MLWNSQVCQNGRASPWGFIRLICSVSLFSVLVREGAALYIQPQK
                     ARLNGGNTHNIDIGPLNRSATLTPAAYYRKVGVNGAISSDLELCNRMTVHDILLGIPG
                     ANAADAAVTMSLCIGMINFFNSGIGGGGFAVYTDGQDPERHLAFDFREMAPELAHKEM
                     YASDPNASKIGGLAIAIPGELAGLYEMYEKRGSGVARWEELLRPVIELGFQGWAVGPA
                     LAASLQEYEAYFKAHLDDWSFVYNHKEGRVLRAGEWISRPELAKTLQNLAASGGVKPF
                     YDAESDLVKTMVNKIQSAGGVLSESDFENYEVDVTRPLSLKIRSSWEYLPNNDLTVLT
                     TSGSSSGAALLSALKILDQFPNKEDGDFQPEQAYQLIEAMKWMASARSRLGDFGGGEE
                     LAPQVRDVLGDAWTDYAVNLIKAGYIDGHFGTLVDWHDYLPEYELNDPHGTAHISIVD
                     HFNNAVSLTTTVNLLFGSLVHDPSTGIVFNNEMDDFSQPGRPNAFGLQPSRYNFPEPF
                     KRPLSSTCPTVVLNDVGLPDLVVGAAGGSRILTSVLQLIVRTYWYNMPLLEAVAYPRI
                     HHQLLPEVLEVESLALLGPDTVDAIRRMGHSIVEVTPKSVVNAIRHWHGTWHAVSDYW
                     RKRGISVAY"
     gene            <602560..>605823
                     /locus_tag="AGOS_AAR145W"
                     /old_locus_tag="AAR145W"
                     /db_xref="GeneID:4618798"
     mRNA            <602560..>605823
                     /locus_tag="AGOS_AAR145W"
                     /old_locus_tag="AAR145W"
                     /product="AAR145Wp"
                     /transcript_id="NM_208040.1"
                     /db_xref="GeneID:4618798"
     CDS             602560..605823
                     /locus_tag="AGOS_AAR145W"
                     /old_locus_tag="AAR145W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR188W (MSB1)"
                     /codon_start=1
                     /product="AAR145Wp"
                     /protein_id="NP_982687.1"
                     /db_xref="GeneID:4618798"
                     /translation="MDKIQQPPHPQMTGQAGAEGEIGRQEREEEFEFYQAFAAESVKG
                     VVHMITLQLKAEGVADSYVLLPFRPEHANRKLLAFLNAVFPLGNGQAVPRAKARHVIG
                     ETDSWTLVQALKYIWCRLPGEQVIGWETYWRFRAEERKLGYPSDAFMQVLPGCLSSSS
                     HASIVYDFFDLLVAVAANVSENRMSGRKVAKMSAIWAFGDYRHPDGGGNNSFQEGLAQ
                     WRRGANAMFHLFLAFLRAFAVDEQKSGKFTRELEAILFQNAYPPPEDLQEDPAKLISV
                     PVLTLKTDRFSRKPWELFERCNSLFQTAGHYGGPLEDYTLLQSLFMRKNQANALSKKM
                     TGETRRLLKEMSTKHSTFQAGWGNRNPLPNRLNLTESISWTRTEISDYFIWTWMSTLS
                     HEQISSKKKIFGRSFIAEFELDGFKKCIIVEESDITLDRMRTGAPATEPEKATANVMA
                     SPNELHLSPGYLKFQESVEDASKSASPPDIDPSHRQSSSSYSSRCSVRSRGSRGSNGK
                     PYSNNSSTSSRCSINGNGHTAAYSTIALPKRQMNTKPATPSSCGNSPASLAGPGFTIT
                     TSSNYDTESERSLHIESDISVIRAPNTELPPCSPLSADVPQRKSYLDASGRFDRDMDR
                     LLQRTDALNLQGQAAPAGRRPNEYMGREAIPEKPRSYDLLQPAQSSKNFYAGLDTGSS
                     VMLATESCVMGKELPESGSQGRSTGGASWMPHSNNVADESFVSSSSGGTQATPRTTQA
                     PSDPSFLQGRAQWQRPAQVPKGSAHRNPYGTACNNFAGEEGAPSQLTVGNRSPPDPSP
                     PAHVQGAAAEDALGSPGFAAPRHKRQSALAATGYTHSTSASSEYVGPATASSDVRRPY
                     TYYDVPPGRASPPSPQKLDPAQTSHVRMPPQLAAVRTLQAASGGDTAAPHTYQHVGQA
                     YDQTAYQQRSPPESPSLPEQAYVPEQAYAPEQAYAPEQAYAAAHAPRRSTHGFPNHPQ
                     MLQPHSQRHPYALSHGSPTHHPSHAVPSVYPEPQSFGRPTSAASAPKTHLPNAARPAS
                     PVKADPMATTQQPHGNAVPMNYAPVVLPSNRLHGGNMTKQQGRKQLYKDIRDGNFGL"
     gene            complement(605847..605918)
                     /locus_tag="AGOS_t0024"
                     /db_xref="GeneID:4618585"
     tRNA            complement(605847..605918)
                     /locus_tag="AGOS_t0024"
                     /product="tRNA-Glu"
                     /codon_recognized="GAG"
                     /db_xref="GeneID:4618585"
     gene            <606034..>606288
                     /locus_tag="AGOS_AAR145WA"
                     /old_locus_tag="AAR145W-A"
                     /db_xref="GeneID:4618793"
     mRNA            <606034..>606288
                     /locus_tag="AGOS_AAR145WA"
                     /old_locus_tag="AAR145W-A"
                     /product="AAR145W-Ap"
                     /transcript_id="NM_208041.1"
                     /db_xref="GeneID:4618793"
     CDS             606034..606288
                     /locus_tag="AGOS_AAR145WA"
                     /old_locus_tag="AAR145W-A"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR189W (IES4)"
                     /codon_start=1
                     /product="AAR145W-Ap"
                     /protein_id="NP_982688.1"
                     /db_xref="GeneID:4618793"
                     /translation="MSQEQPPADPTPQASPAAPGPKSLAPPGARPARPAHWLAATIPV
                     KSFSGYSLQFAGWAADPAAKPENANSAQPKPTGPRPPAAA"
     gene            <606915..>608243
                     /locus_tag="AGOS_AAR146W"
                     /old_locus_tag="AAR146W"
                     /db_xref="GeneID:4618635"
     mRNA            <606915..>608243
                     /locus_tag="AGOS_AAR146W"
                     /old_locus_tag="AAR146W"
                     /product="AAR146Wp"
                     /transcript_id="NM_208042.1"
                     /db_xref="GeneID:4618635"
     CDS             606915..608243
                     /locus_tag="AGOS_AAR146W"
                     /old_locus_tag="AAR146W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR300W (EXG1) and YOR190W (SPR1)"
                     /codon_start=1
                     /product="AAR146Wp"
                     /protein_id="NP_982689.1"
                     /db_xref="GeneID:4618635"
                     /translation="MMRTVTSSTLMLALGMALWCLSGVAARPLPALTPNSIQVVTNTK
                     RYFDYENKTMRGVNLGGWLVLEPYITPSLFEPFRKNPDNDDGIPVDEYNLCKTLGREK
                     AHERLSKHWSTFYTEKDFHAMKAAGLNIVRVPIGYWAFELLEDDPYAQGQEEYLDKAI
                     EWSRAAGLKVWVDLHGAPGSQNGFDNSGRRDQIEFLKPHNLELLHKVLEHTLGKYSQD
                     EFADVVIGVEVLNEPLGPAVDIQGVRDLYYYAYDLMRNKFKRDQVVVIHDAFMPSQFW
                     NSDLTLDKGYWGVVVDHHHYQVFSPGELARSMDDKVKTACAWGHDVISESHWPVCGEW
                     SAALDDCAKWLNGVGVGARWDGTFNKNGDKAPYQGDCHQFYESWPEEKKKNTRRYIEA
                     QLDAYELRGGWIFWCWKTETLTEWDFQRLLAHGLMPQPLEDRKYPNQCPF"
     gene            <608839..>613581
                     /locus_tag="AGOS_AAR147W"
                     /old_locus_tag="AAR147W"
                     /db_xref="GeneID:4618553"
     mRNA            <608839..>613581
                     /locus_tag="AGOS_AAR147W"
                     /old_locus_tag="AAR147W"
                     /product="AAR147Wp"
                     /transcript_id="NM_208043.1"
                     /db_xref="GeneID:4618553"
     CDS             608839..613581
                     /locus_tag="AGOS_AAR147W"
                     /old_locus_tag="AAR147W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR191W (ULS1)"
                     /codon_start=1
                     /product="AAR147Wp"
                     /protein_id="NP_982690.1"
                     /db_xref="GeneID:4618553"
                     /translation="MASQVPVVDLTSDEAEDNGRNGQQDPPGALRRLYEDFGDGKERN
                     EMGREEPGANEATRRLASLNRAASSAMRSGAASPTGMGLYNPKPADVRLPWRSPGVDM
                     AEPEHKPSAWAPAGGVKRRRLSVAPGAPAVRCAEAGSNDGQDYDEDFSGLESSPETPD
                     PEILVDTEEDPLLRRVLDDRGEVRLYRAQSVPSTQGSNDTPILLLSSDDEAGRPSGER
                     EPNSASAKAAQSSWKMTTMKSSSDREIEYPSQDALLQHLARREQDYYDKLVQLKTTKQ
                     ILQSKISRRETQIRAKGDSNEKLIDANRNTQGKLTNAEALLRRTELDYAAFQRQKREA
                     LLRMQLSMVDQKADKVRYQQTKMALLRVQLDNAPHTFGDEAELKNELRRIRSELSSLS
                     VSEETHADRSEASHGIFKRTCMKALELLEASDRSQENRQAVQRLIKEVLRLEEHFLSK
                     SLSAGERERGSKISQELQRQGIRMPFVYNRLQSICDTPESVVANINENLGAAEFISAL
                     NSALSSGNTMTEKSQTANSAAFFYTISKVRSILASSNRSPELKTDINNNLLAIEAYQQ
                     LVFCGLTPDDERKSAVLKAIRMLYKQGVKMPLVYQVLEEQGLNWRYDPTGALKNISDA
                     RDLIAQNTKRSAETKQKIYNLLDEVEKTIKETMQNVTPTIYKTTNISLNLTALKNLGV
                     KMPVVDRTVAAYLKRMKKSSQQPQKSVKVESETSTDSINGDEEMRYFQSIQQAVSTYS
                     TALNRARLGYDRVRRILLALEALRAYRELFHRADAPLFWNQKVQDSLNTLMDINLQLP
                     PVFRYLKQRGFHTGDNKYVNSDDIDKDGVIEPLMIQGDPEDADLKELGDLAAGNQLQM
                     ANIYTSRDHQSLNELLESLKQAETSIDGEELTPPDMTVNLLKHQRQGLYWLLKTESSK
                     FKGGLLADDMGLGKTVQAIALMLANRSADSTCKTNLVVGPVAVLRVWHDEINTKVKKQ
                     AQFSVMIYGGFGGKKVENFKAMHNYDVVLVSYQTLAVEFKKHWPARLQGTSENGGQLP
                     EVASIKAMNSMKLRNEYWSPFFSDDSNFYRIILDEAQNIKNKQTQAAKACCTLNGTYR
                     WALSGTPIQNNILELYSLLRFLRIAPYNREQKFKEDIGNALLSRGGDFDSMDTKRALK
                     KVRVLLRAIMLRRAKTSQINGQPILELPAKHIRKKEDILDGQDLEFYKSLEHETAIQA
                     RALLNERKASSSSNILTLLLRLRQACCHQELVKLGKAKAIGTRVVNGMDFIKDWLRLY
                     NVAKRIGTEGKGTVSQSLENMICPFCMEQMEIESLSVLTPCGHLLCDACVEPYLEDAR
                     ESEYARKGPKGTRSTFVPCLVCEKLINDHEIISYQLYHQAVVKGISTDELREEYENEM
                     TKRRHKLKYDYQLNFENLHQSKKVQQCLGIIKTVLDNSTDEKLIVFSQFTTFFDILQF
                     FIKKVLNVSYLRYDGTMNGNVRASVIERFYREKNERLLLISMKAGNSGLTLTCANHVI
                     LVDPFWNPYVEEQAMDRCYRISQQREVYIHRLLLKNTIEDRIVELQNRKRTLVENAMD
                     PTELREVNRLGRQELGFLFGINSLPGRE"
     gene            613850..613921
                     /locus_tag="AGOS_t0025"
                     /db_xref="GeneID:4618456"
     tRNA            613850..613921
                     /locus_tag="AGOS_t0025"
                     /product="tRNA-Glu"
                     /codon_recognized="GAG"
                     /db_xref="GeneID:4618456"
     gene            complement(<614067..>614759)
                     /locus_tag="AGOS_AAR148C"
                     /old_locus_tag="AAR148C"
                     /db_xref="GeneID:4618794"
     mRNA            complement(<614067..>614759)
                     /locus_tag="AGOS_AAR148C"
                     /old_locus_tag="AAR148C"
                     /product="AAR148Cp"
                     /transcript_id="NM_208044.1"
                     /db_xref="GeneID:4618794"
     CDS             complement(614067..614759)
                     /locus_tag="AGOS_AAR148C"
                     /old_locus_tag="AAR148C"
                     /note="NOHBY115; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0C05456g"
                     /codon_start=1
                     /product="AAR148Cp"
                     /protein_id="NP_982691.1"
                     /db_xref="GeneID:4618794"
                     /translation="MIVKHDKNHFNWHEEMLSPLPSLPSLEQDSDGDSDVDMELESPI
                     AFQDCTDNIQLICTPYEGLKAARVHLDPATDSNLRRLSDTLQLECNSLKDQRLCVVHQ
                     VKLVKTTVQAIKLDFFWSDDEDLSPSMPVDGFNFYTVSIKLPRNDPLIWKHYLLKSQY
                     NQMVEFLSPFEQRPRYESSYLMKSERLVDFVMQQVWLQDVREHNAQDESQLFELPQLY
                     TCLYQEVQSRYN"
     gene            <615201..>615608
                     /locus_tag="AGOS_AAR149W"
                     /old_locus_tag="AAR149W"
                     /db_xref="GeneID:4618780"
     mRNA            <615201..>615608
                     /locus_tag="AGOS_AAR149W"
                     /old_locus_tag="AAR149W"
                     /product="AAR149Wp"
                     /transcript_id="NM_208045.1"
                     /db_xref="GeneID:4618780"
     CDS             615201..615608
                     /locus_tag="AGOS_AAR149W"
                     /old_locus_tag="AAR149W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL054C (ERV14) and YBR210W (ERV15)"
                     /codon_start=1
                     /product="AAR149Wp"
                     /protein_id="NP_982692.1"
                     /db_xref="GeneID:4618780"
                     /translation="MGAWLFVFAFVMNAVSMFLQVHFTIMYADLEADYVNPIELCSKV
                     NRLITPEAGVHAFISLLFLLNGYWFVFLLNLPVLFYNAKKIYHKMQLLDATEIFRTLS
                     KHKRESFLKLGFYLLLFFFYLYRMIMALIAEDN"
     gene            complement(<615667..>616413)
                     /locus_tag="AGOS_AAR150C"
                     /old_locus_tag="AAR150C"
                     /db_xref="GeneID:4618522"
     mRNA            complement(<615667..>616413)
                     /locus_tag="AGOS_AAR150C"
                     /old_locus_tag="AAR150C"
                     /product="AAR150Cp"
                     /transcript_id="NM_208046.1"
                     /db_xref="GeneID:4618522"
     CDS             complement(615667..616413)
                     /locus_tag="AGOS_AAR150C"
                     /old_locus_tag="AAR150C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR211C (AME1)"
                     /codon_start=1
                     /product="AAR150Cp"
                     /protein_id="NP_982693.1"
                     /db_xref="GeneID:4618522"
                     /translation="MERRVKLLYRQRGSALRRVEQEVVIQDGAPAAATAAEESVEPPE
                     EPADLPQLEAGDWAVGSPGDAAAWEPPEAVDEAPSAAGSPAAGGEAPGEAADEASRFA
                     GLSATQLATSITSVATVEVLSEVVTALFSQQLAPQCAERFRRARTRAERLSYKLELRI
                     FERLEAQVRADLRDIVDIHRSNNELCYQMKQILRLRHELTEELVAVRAQRAELDLAAA
                     RDSAQAQDLAALLRLNARLHGLRTAAARSL"
     gene            <617408..>618853
                     /locus_tag="AGOS_AAR151W"
                     /old_locus_tag="AAR151W"
                     /db_xref="GeneID:4618503"
     mRNA            <617408..>618853
                     /locus_tag="AGOS_AAR151W"
                     /old_locus_tag="AAR151W"
                     /product="AAR151Wp"
                     /transcript_id="NM_208047.2"
                     /db_xref="GeneID:4618503"
     CDS             617408..618853
                     /locus_tag="AGOS_AAR151W"
                     /old_locus_tag="AAR151W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR212W (NGR1)"
                     /codon_start=1
                     /product="AAR151Wp"
                     /protein_id="NP_982694.1"
                     /db_xref="GeneID:4618503"
                     /translation="MADTQIPEPPSTTVQTSSEPPRTLWMGDLDPSFDEATIQHVWLT
                     VGHQVQVKLIRAKKNLLIPCSTSSTLSASHVDEERIQINGVSFIDPNTTQLHHAGYCF
                     VQFANLQEAQAGLQLNATPLPNVVSPTTRNPTNPTGKRNFRLNWASGATLQSDIPATP
                     EFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERR
                     RALAEMNGVWCQGRQLRVAYATPRNNLLQQQQAHPAPPAPPSPPAPPAQTLPDSLGLL
                     VGVPSLAQLDAASLGRAQQPLLLGAAGSLVGSNSLPLAAPRQLPADTANTTVFIGGLS
                     NMISEGQLHALFMPFGNILSVKVPPGRGCGFVRFENRMDAEAAIQGMQGFIVGGNAIR
                     LSWGRTHSHSGSSGSSGSSGSSGSLAIDHHPYHQHPQQQRLAWASQQLGDGVNLRFSG
                     TGSMAAAATAATGLLQSAAPQQTAIHPSLLP"
     gene            <619088..>619876
                     /locus_tag="AGOS_AAR152W"
                     /old_locus_tag="AAR152W"
                     /db_xref="GeneID:4618786"
     mRNA            <619088..>619876
                     /locus_tag="AGOS_AAR152W"
                     /old_locus_tag="AAR152W"
                     /product="AAR152Wp"
                     /transcript_id="NM_208048.1"
                     /db_xref="GeneID:4618786"
     CDS             619088..619876
                     /locus_tag="AGOS_AAR152W"
                     /old_locus_tag="AAR152W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR213W (MET8)"
                     /codon_start=1
                     /product="AAR152Wp"
                     /protein_id="NP_982695.1"
                     /db_xref="GeneID:4618786"
                     /translation="MLSLPLAHQMGGRHVLLVGCGAVGMTRVDKLVPTGCKLTVVAPE
                     VDAGLAAYMPGGMEVAAGATWVNKGWEPGQVYRVARREFAAGDEGLEAFAFVLACVPA
                     GGLGARVHALSHARGVQCNVADVPALCDFYFGSQCALGERGLQVLVSSNGAAPRLTAL
                     LRADIERRYAALDWDEMCGRLRALRERARALSTQAGLPAEEALRFRMDWMRQVTDAFG
                     LEHCAAMDVERLAGLFGEMAAAAAAGRPRALPADLVSVYTESST"
     gene            complement(<619927..>621363)
                     /locus_tag="AGOS_AAR153C"
                     /old_locus_tag="AAR153C"
                     /db_xref="GeneID:4618504"
     mRNA            complement(<619927..>621363)
                     /locus_tag="AGOS_AAR153C"
                     /old_locus_tag="AAR153C"
                     /product="AAR153Cp"
                     /transcript_id="NM_208049.1"
                     /db_xref="GeneID:4618504"
     CDS             complement(619927..621363)
                     /locus_tag="AGOS_AAR153C"
                     /old_locus_tag="AAR153C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL055W (OLE1)"
                     /codon_start=1
                     /product="AAR153Cp"
                     /protein_id="NP_982696.1"
                     /db_xref="GeneID:4618504"
                     /translation="MEQVDLPNANKIAAGANKASVRVVNGLGALMGSKAMAAVDFEKD
                     SMAEMLARDQREKEHYRHHKHISEQPWTLNNWHLHVNWVNIVLVVVVPIIGLYLALSG
                     RVPPRFEVLALAIVYYSLGGLGITAGYHRLWAHRSYSARWPLRVMYALFGASSVEGSI
                     KWWGHSHRIHHRYTDTPRDPYDARRGLWYSHMGWMLLQPNPRYRARADIEDLMNDWVV
                     RLQHRHYVLIMAFMAFLLPAIICHFIFRDFWGGLVYAGILRVFAIQQATFCINSLAHY
                     LGDQPFDDRRTPRDNWITALVTLGEGYHNFHHEFPTDYRNAIRWYQYDPTKVFIYCAS
                     LVGLAYDLKKFSQNAIQQGLIQQKQKKLDNARSRLNWGTPLSQLPVWDRSEFVRASRE
                     NSGLVVISGIVHDVSGYITEHPGGETLIQAALGKDATRAFNGGVYMHSNAAHNILATM
                     RVAVVKEGQDAATRFAARRGEALEKKTA"
     gene            <623890..>625353
                     /locus_tag="AGOS_AAR154W"
                     /old_locus_tag="AAR154W"
                     /db_xref="GeneID:4618713"
     mRNA            <623890..>625353
                     /locus_tag="AGOS_AAR154W"
                     /old_locus_tag="AAR154W"
                     /product="AAR154Wp"
                     /transcript_id="NM_208050.1"
                     /db_xref="GeneID:4618713"
     CDS             623890..625353
                     /locus_tag="AGOS_AAR154W"
                     /old_locus_tag="AAR154W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR214W (SDS24) and YGL056C (SDS23)"
                     /codon_start=1
                     /product="AAR154Wp"
                     /protein_id="NP_982697.1"
                     /db_xref="GeneID:4618713"
                     /translation="MREKQQGTTGAGGMSSGAAAASPGQRHASIVEMLSTPPPAIVVQ
                     TGMEDENVRATGGETAADGDERRTLSRQSSTSSTESHASATSCLTKVHAQKWQHIELS
                     QLVEENKLVFINAEMSVEEAFNTLVEHNLTSLPVERYPGDMDCVTFDYNDLNSYLLLV
                     LGKTTVADEEITRQCQSGQPVPVGRIVKLTPKNPFYKVPETEDLSTVMGILGSGVHRV
                     AIVDSTSSSIRGILSQRRLMKYLWDNARQFSNLEVLLNSSLQKLGIGVLDPHTPPTSR
                     QSRVISILDTEPLLVALHKMHTERISSIAVIDHQGMLLGNISVTDVKQVTRTSQYPLL
                     HNTCRHFISVILNNRGLEMGKDSFPIFHVYPTSSLARTVAKLVATKAHRLWIVQPVEQ
                     GVLVSPPVAPTTIDGSSEFSSRHVSPSPAPSPAGSHGPLTTSASPLGTLDKEYSTGKL
                     IGVVSLTDILGLLARKHTENKLVDPLSARRQRGSVAR"
     gene            <625556..>626260
                     /locus_tag="AGOS_AAR155W"
                     /old_locus_tag="AAR155W"
                     /db_xref="GeneID:4618489"
     mRNA            <625556..>626260
                     /locus_tag="AGOS_AAR155W"
                     /old_locus_tag="AAR155W"
                     /product="AAR155Wp"
                     /transcript_id="NM_208051.1"
                     /db_xref="GeneID:4618489"
     CDS             625556..626260
                     /locus_tag="AGOS_AAR155W"
                     /old_locus_tag="AAR155W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL057C (GEP7)"
                     /codon_start=1
                     /product="AAR155Wp"
                     /protein_id="NP_982698.1"
                     /db_xref="GeneID:4618489"
                     /translation="MKRTCALASRAVPKSLLERQARRTGSKVGASQEASKFVVASLRD
                     IGSLFSGSSSGDDEEQEALRLHSDTVSKLNSGELTEVVRQRYCVDNKDRCETRMLLTK
                     YPGPAREREMLQVATAELSARDWRKMPRVWQQVSYYHAFGSWGPRTGLSFVGRRPEDF
                     FVTDQKGLWTCSAPRRAEYERSSRALDPASRAVLYAAALVAAVAALGDLWRRQDADRQ
                     VTVAELDLAEPTSSPT"
     gene            complement(<626346..>626858)
                     /locus_tag="AGOS_AAR156C"
                     /old_locus_tag="AAR156C"
                     /db_xref="GeneID:4618613"
     mRNA            complement(<626346..>626858)
                     /locus_tag="AGOS_AAR156C"
                     /old_locus_tag="AAR156C"
                     /product="AAR156Cp"
                     /transcript_id="NM_208052.1"
                     /db_xref="GeneID:4618613"
     CDS             complement(626346..626858)
                     /locus_tag="AGOS_AAR156C"
                     /old_locus_tag="AAR156C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL058W (RAD6)"
                     /codon_start=1
                     /product="AAR156Cp"
                     /protein_id="NP_982699.1"
                     /db_xref="GeneID:4618613"
                     /translation="MSTPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPA
                     DTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDV
                     ASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSWEDDLKDMDDGD
                     DDDDDDDDDD"
     gene            complement(<627104..>628615)
                     /locus_tag="AGOS_AAR157C"
                     /old_locus_tag="AAR157C"
                     /db_xref="GeneID:4618459"
     mRNA            complement(<627104..>628615)
                     /locus_tag="AGOS_AAR157C"
                     /old_locus_tag="AAR157C"
                     /product="AAR157Cp"
                     /transcript_id="NM_208053.1"
                     /db_xref="GeneID:4618459"
     CDS             complement(627104..628615)
                     /locus_tag="AGOS_AAR157C"
                     /old_locus_tag="AAR157C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL059W (PKP2)"
                     /codon_start=1
                     /product="AAR157Cp"
                     /protein_id="NP_982700.1"
                     /db_xref="GeneID:4618459"
                     /translation="MLHSRAARVLQRSGSEAQMQQLRAQHHKRYSMASPTISQVPDFS
                     KYFPTWPVTELAPFINEVMRAYPRNSKYVNQQHYYHNRKVLVERYLQRQPHAVSLKHL
                     AQYYDDSNRLTKQKVIRSGQFAKEELTVRMAHKLRELQDLPFNVVNNFHFVQVYESYY
                     NIFERFRRFPAIRTLEDNERFAELLHQIMSDFNSLNLPHLIMGALESCILDLYPQDAM
                     DRLMSSFLRARISRRLIVEEHLSVTSNYMSGKSENTLVLGDIFQECSAREYLLHAARI
                     CENAIRDMFYPDIPLPDFIIDGCADLRFYFLPSQLHYLFGETLRNSYEATVKEAIRRG
                     LPKPDPITVTVVQNPESYLFRISDRGGGIPHPDRTIWSFGKSKLLAQQALDNFHKLPG
                     AQTVSLYDHMYDADARRVAAACKLSNTSLQSMAETNLTKGRYKFDFPRPLVGLLERPF
                     RYKLGIGLAMCKVYAEYWNGDLTVHSIHGHGTDTVLKLGNLMYHTDHLQLDRV"
     gene            <628866..>630665
                     /locus_tag="AGOS_AAR158W"
                     /old_locus_tag="AAR158W"
                     /db_xref="GeneID:4618506"
     mRNA            join(<628866..628884,628969..>630665)
                     /locus_tag="AGOS_AAR158W"
                     /old_locus_tag="AAR158W"
                     /product="AAR158Wp"
                     /transcript_id="NM_208054.1"
                     /db_xref="GeneID:4618506"
     CDS             join(628866..628884,628969..630665)
                     /locus_tag="AGOS_AAR158W"
                     /old_locus_tag="AAR158W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR215W (HPC2); 1-intron"
                     /codon_start=1
                     /product="AAR158Wp"
                     /protein_id="NP_982701.1"
                     /db_xref="GeneID:4618506"
                     /translation="MIPGREVIEDEERQAGTSGGAAKRALDSGGTEVDGMKKQKSIPN
                     IANELAKNRAEVRAPISSINKTLVQPVARPRMHAIPLSSLLSPSVDYGYPKLSPSPQF
                     PALSPTVVPKLESPAEQVLGAPHAPQVPAFQLPVLDSGAIGGGARAGVAPAAEASVNN
                     PSGQAEAAVANAPARKSAPRKKKADGAGAAAKKKAEGSRPAAKKASSRPVKKEEPAAV
                     PSDASAGGAGTNKVVLPSQEGGQANDSPLPSDANTEDQGATPLRASPPANKTNKSLKR
                     TQSNLSSGQKAGSQESQKARKSLSASNLGNGTTSTSPPPAAGASTAPASKKASGTSGA
                     KKESKGKSKSAASKKKETAAASTTVPDTSSAAAIASHTPKVLAPAQPIKSPSVMDVLD
                     QKFIGTQAAEEDDPVIVVDVPLYQVDTNDYLDENGQVVFNFYNLVHEKFNTQQNSQSR
                     TTSSATKDRLEQGDDIAMADDDDDDDEDDEDDDDPSASGAAGASPSKSKKKSNPMKGK
                     SRVGKYDIEDPFIDDSELLWEEQRAATKDGFFVYFGPLIQKGQYATFERVDGTMKKGG
                     VRNPR"
     gene            complement(<630834..>632675)
                     /locus_tag="AGOS_AAR159C"
                     /old_locus_tag="AAR159C"
                     /db_xref="GeneID:4618559"
     mRNA            complement(<630834..>632675)
                     /locus_tag="AGOS_AAR159C"
                     /old_locus_tag="AAR159C"
                     /product="AAR159Cp"
                     /transcript_id="NM_208055.1"
                     /db_xref="GeneID:4618559"
     CDS             complement(630834..632675)
                     /locus_tag="AGOS_AAR159C"
                     /old_locus_tag="AAR159C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR216C (YBP1) and YGL060W (YBP2)"
                     /codon_start=1
                     /product="AAR159Cp"
                     /protein_id="NP_982702.1"
                     /db_xref="GeneID:4618559"
                     /translation="MKRHATTEGESLGVLFAEQAGDVISLAAGIELCAEQALASGNAG
                     RVASFLEALWEQLREHPALVGDLGWDIPKVLVRCIRADNFNLNEGLGDDMVWRLLVGC
                     FREVGREGNARECFLTGCQQLAELSVAAEEEEDADLREEMFALKFHMLMEFVTTTLGR
                     TTTAYPSRFLGEIIGVLVKLVERNADELCDVHLLLRRLYTFCRDYTAPVSSSEDEELR
                     AQEDYLQRTLFRSFLAYALAQLLRRQSVRWAPEYFAKSHGLEFKLHDDHVELRETLGR
                     YFQLAHSFDIDIEGAFQKQCILESRDVYACVSADADKADGAEVIYQLAYTYELKKIAE
                     LQSMPIDARGIFVLAVLHHFETGKPICLSLRLDDAIYMFLRFNTPEIYSKSFGNIAVT
                     DASLYFVLLALEGNSHEENHKLVREFPQTVFAVFIQVLLLNMCRLPSREIGRMTHSIL
                     ARVLFLASETTAFDFVIDTLLQCPYETAKQIILEIAKIMMVSDQYTICTRDVPSHTRT
                     DTKAPPLPPRPFIKLNDDRMAAFHTLAMMSAKFCTETEDPKQLTTLLSYLNLITVLRK
                     KWDQVLLRELTVAVSNCIEPRKEDIPEIGFIKIANDGLKEFLGGNST"
     gene            <632781..>633350
                     /locus_tag="AGOS_AAR160W"
                     /old_locus_tag="AAR160W"
                     /db_xref="GeneID:4618739"
     mRNA            <632781..>633350
                     /locus_tag="AGOS_AAR160W"
                     /old_locus_tag="AAR160W"
                     /product="AAR160Wp"
                     /transcript_id="NM_208056.1"
                     /db_xref="GeneID:4618739"
     CDS             632781..633350
                     /locus_tag="AGOS_AAR160W"
                     /old_locus_tag="AAR160W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR217W (ATG12)"
                     /codon_start=1
                     /product="AAR160Wp"
                     /protein_id="NP_982703.1"
                     /db_xref="GeneID:4618739"
                     /translation="MVPLLESETENSISQSQFDSESASAEPTPPQHTQESLQNRLEEY
                     HERLSRLQLPSSSDSECSDIEQESLELEQEVPLSTSVYLAGARSAGGLPSSSELSETP
                     EPPKVAIRFQPIGSVGQVMPQVCRISSAQSFGAVLVFLRRRLRLDTVHCYVSNSFAPT
                     PQQNVGQLWEQFKVNDELVVSYCATVAFG"
     gene            <633414..>633998
                     /locus_tag="AGOS_AAR161W"
                     /old_locus_tag="AAR161W"
                     /db_xref="GeneID:4618740"
     mRNA            <633414..>633998
                     /locus_tag="AGOS_AAR161W"
                     /old_locus_tag="AAR161W"
                     /product="AAR161Wp"
                     /transcript_id="NM_208057.2"
                     /db_xref="GeneID:4618740"
     CDS             633414..633998
                     /locus_tag="AGOS_AAR161W"
                     /old_locus_tag="AAR161W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL061C (DUO1)"
                     /codon_start=1
                     /product="AAR161Wp"
                     /protein_id="NP_982704.2"
                     /db_xref="GeneID:4618740"
                     /translation="MNANGEANGGVDSAALDELIPQIFDQMRTNQLDGSGAAAWGTAA
                     VSTATLLKEMEQLDQIIPVLQQLNESLRRSTGENLSRIRRTCEAVNRVLDTWIKIQSQ
                     AGYVGELMDDSEYLSYMEKTRGDEGQQQAYMESLRKQVEELRRKVDERRAVEAAAAAP
                     RAPERTRGASGIPRGGSRITKRGGTTVRGRRMFR"
     gene            complement(<634041..>637556)
                     /locus_tag="AGOS_AAR162C"
                     /old_locus_tag="AAR162C"
                     /db_xref="GeneID:4618741"
     mRNA            complement(<634041..>637556)
                     /locus_tag="AGOS_AAR162C"
                     /old_locus_tag="AAR162C"
                     /product="AAR162Cp"
                     /transcript_id="NM_208058.2"
                     /db_xref="GeneID:4618741"
     CDS             complement(634041..637556)
                     /locus_tag="AGOS_AAR162C"
                     /old_locus_tag="AAR162C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL062W (PYC1) and YBR218C (PYC2)"
                     /codon_start=1
                     /product="AAR162Cp"
                     /protein_id="NP_982705.2"
                     /db_xref="GeneID:4618741"
                     /translation="MGSQLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMAT
                     VAVYSYEDRLSMHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYG
                     FLSENAEFAAKVEGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSV
                     EEAEEFVQKYGYPVIIKAAFGGGGRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFV
                     ERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILT
                     DAVKLAKASGYRNAGTAEFLVDKQNRHYFIEINPRIQVEHTITEEITGVDIVAAQIQI
                     AAGASLEQLGLMQDRITTRGFAIQCRITTEDPSKNFQPDTGRLDVYRSAGGNGVRLDG
                     GNAFAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLT
                     HPVFISGDYWTTFIDDTPQLFEMVASQNRAQKLLQYLSDLAVNGSSIKGQMGVPKLLA
                     QPSIPQLHNAKGEVIDVQSQPPAGWRQVLLEHGPEVFAKKVREFDGTLLTDTTWRDAH
                     QSLLATRVRTYDLAAIAPTTAHALAGAFALECWGGATFDVAMRFLHEDPWERLRTLRK
                     LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENGVDIFRVFDALNDLEQLKVGV
                     DAVKKAGGLVEATICYSGDMLQPGKKYNLDYYLELTEKIVAMGTHILGIKDMAGTMKP
                     GAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISGADVVDVATNSMSGLTSQ
                     PSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEADLKGPDPEVYKHEIPG
                     GQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKVVGDLAQFMVSNRL
                     NSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRKLKVRPGLELA
                     PFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVLPTHNFLSPP
                     KIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADKSQKLETV
                     SKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPSDGQV
                     KDVFVSDGETVEASDLLVQLEVSQP"
     gene            complement(<637934..>638224)
                     /locus_tag="AGOS_AAR163C"
                     /old_locus_tag="AAR163C"
                     /db_xref="GeneID:4618742"
     mRNA            complement(<637934..>638224)
                     /locus_tag="AGOS_AAR163C"
                     /old_locus_tag="AAR163C"
                     /product="AAR163Cp"
                     /transcript_id="NM_208059.1"
                     /db_xref="GeneID:4618742"
     CDS             complement(637934..638224)
                     /locus_tag="AGOS_AAR163C"
                     /old_locus_tag="AAR163C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YPL187W (MF(ALPHA)1) and YGL089C (MF(ALPHA)2)"
                     /codon_start=1
                     /product="AAR163Cp"
                     /protein_id="NP_982706.1"
                     /db_xref="GeneID:4618742"
                     /translation="MKTTHILSLATLAACAPVQPAPVQPTDLAAAANVPEKAVLGFFQ
                     LYNVGDVELLPVDDGAHSGILFVNRTLADVDYSSEHVVQKWFRLSLHHGQSM"
     gene            complement(<638719..>639102)
                     /locus_tag="AGOS_AAR164C"
                     /old_locus_tag="AAR164C"
                     /db_xref="GeneID:4618743"
     mRNA            complement(<638719..>639102)
                     /locus_tag="AGOS_AAR164C"
                     /old_locus_tag="AAR164C"
                     /product="AAR164Cp"
                     /transcript_id="NM_208060.1"
                     /db_xref="GeneID:4618743"
     CDS             complement(638719..639102)
                     /locus_tag="AGOS_AAR164C"
                     /old_locus_tag="AAR164C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL127C (SOH1)"
                     /codon_start=1
                     /product="AAR164Cp"
                     /protein_id="NP_982707.1"
                     /db_xref="GeneID:4618743"
                     /translation="MSAKSSEPPFEPSSEGEQLPSRFEVELEFVQSLANIPYVTFLLT
                     QHQIWQDPRFKAYLKYLEYWCEPPYTQFIVYPNCLFVLKLLNSFLDKAVENEDGILEG
                     AEDLPKVIQMQGGEWMNQMVERWRG"
     gene            <639305..>640393
                     /locus_tag="AGOS_AAR165W"
                     /old_locus_tag="AAR165W"
                     /db_xref="GeneID:4618744"
     mRNA            <639305..>640393
                     /locus_tag="AGOS_AAR165W"
                     /old_locus_tag="AAR165W"
                     /product="AAR165Wp"
                     /transcript_id="NM_208061.1"
                     /db_xref="GeneID:4618744"
     CDS             639305..640393
                     /locus_tag="AGOS_AAR165W"
                     /old_locus_tag="AAR165W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL126W (SCS3)"
                     /codon_start=1
                     /product="AAR165Wp"
                     /protein_id="NP_982708.1"
                     /db_xref="GeneID:4618744"
                     /translation="MSTVRRERSRFLWVQLSLCPVIIVVGTVMRIFSEPNSWNADKDS
                     TVNIWFIKQGWAWTSAVCWWCVVRYKGLGGRSLRQTALRYVALTAWWYAFTQAIWFGI
                     APIMDQVFTSTGGHCSFDVFDTGMGLNSGFHDSEGRRTRSLQKLLQWFTAHGAQGDEL
                     RERTMYWIRCMLTGGQCENTGLDPTELNSYIQDSVTASAIRSSHACSRLGGHWMGGHD
                     PSGHVFLITLMCMFMLGELQVFGRRAIGKLSADCQQLQGAPGKIVARILQASPIRELI
                     NSEAPQHILRRLFVQLPLESLAILVSAVVFGFRFIVLENPILLLVGLILTWTWSLLVT
                     ILSFHSFAEHLTGLLFAYLLVLALYWYI"
     gene            complement(<640431..>642188)
                     /locus_tag="AGOS_AAR166C"
                     /old_locus_tag="AAR166C"
                     /db_xref="GeneID:4618745"
     mRNA            complement(<640431..>642188)
                     /locus_tag="AGOS_AAR166C"
                     /old_locus_tag="AAR166C"
                     /product="AAR166Cp"
                     /transcript_id="NM_208062.2"
                     /db_xref="GeneID:4618745"
     CDS             complement(640431..642188)
                     /locus_tag="AGOS_AAR166C"
                     /old_locus_tag="AAR166C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR220C"
                     /codon_start=1
                     /product="AAR166Cp"
                     /protein_id="NP_982709.2"
                     /db_xref="GeneID:4618745"
                     /translation="MCRVRDPQIFCRTSQNLHLSLKSSQALWMTPGGNMEVHKASSQL
                     AAHDVPQFYLLVALYFLQGIPVGLAFGTVPFLLKSIAKDTSFTKLGLFGIATYPYSLK
                     ILWSPLVDSVFSKKIGRRRSWIIPVQLASGVMLWCVGHAVAQGWVFEGVDASYGAPSL
                     GDGAKINITSLTVCFLVLVFFCATQDIAVDGWALTILSRQSLSYASTAQTVGLNTGYF
                     LSFSIFLAFNSGDFVNRYFRALPLDHGIISFSSYLKLSGWMYLILTAYVVFFTQEYPY
                     AHSGLPVVSTKPKDDDEKGHIVTSTTKNSAHIEYNEDSSISKTSLGAVYRSFVKVLRL
                     PAVRSLIILHFVSKFPFQCSEGATNLKLLEKGLKKEDLAITVLVDFPFEIIFGYYVAK
                     WSSESHHSHQRKLPAFLTLLIGQPGILTPWIIGYIGRLIASMLGSFILSQFPENGNIT
                     KGYFLLVVTQNLLGSFMSTVQFVGVSAFHTRIADPAIGGTYMTLLNTLSNLGGTWSRI
                     VVMAMIDFFTSKVCQNSAIGMFPPEAKCLESGGTLVILRDGYYMTNLLCIGFGLLIFP
                     HIRRKAQHLQSLPISSWRV"
     gene            complement(<642594..>643673)
                     /locus_tag="AGOS_AAR167C"
                     /old_locus_tag="AAR167C"
                     /db_xref="GeneID:4618746"
     mRNA            complement(<642594..>643673)
                     /locus_tag="AGOS_AAR167C"
                     /old_locus_tag="AAR167C"
                     /product="AAR167Cp"
                     /transcript_id="NM_208063.1"
                     /db_xref="GeneID:4618746"
     CDS             complement(642594..643673)
                     /locus_tag="AGOS_AAR167C"
                     /old_locus_tag="AAR167C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR221C (PDB1)"
                     /codon_start=1
                     /product="AAR167Cp"
                     /protein_id="NP_982710.1"
                     /db_xref="GeneID:4618746"
                     /translation="MSSRFSLVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAE
                     EMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFAGLAVGAALKG
                     LKPIVEFMSFNFSMQAIDHVVNSAAKTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQD
                     YTAWYGSIPGLKVLCPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEEVLSP
                     DFTLPYTSKVEREGTDISIITYSRNVQFSLAAAEILDKQYGVSAEVINMRSIRPLDID
                     AIIKTVKKTNHLITVEATFPAFGVGSEIIAQIMESEAFDHLDAPVQRVTGADVPTPYA
                     KELEDFAFPDPDTIVRAAKQVLSIE"
     gene            complement(<644094..>645689)
                     /locus_tag="AGOS_AAR168C"
                     /old_locus_tag="AAR168C"
                     /db_xref="GeneID:4618747"
     mRNA            complement(<644094..>645689)
                     /locus_tag="AGOS_AAR168C"
                     /old_locus_tag="AAR168C"
                     /product="AAR168Cp"
                     /transcript_id="NM_208064.1"
                     /db_xref="GeneID:4618747"
     CDS             complement(644094..645689)
                     /locus_tag="AGOS_AAR168C"
                     /old_locus_tag="AAR168C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR222C (PCS60)"
                     /codon_start=1
                     /product="AAR168Cp"
                     /protein_id="NP_982711.1"
                     /db_xref="GeneID:4618747"
                     /translation="MSTFNEAIRCTDSRAVIEPDSGLSLSYRELSHIVGHLQLMFLDP
                     KSPLAGIPRQAAIGISLPNGLEFVAAFLAVTMDAKVAAPLNPNYKAEELDFYLEDLQT
                     SMILVPKGSTSAGNTEIQKAAQKWQTMLVELAFSPERNRVEFQVFSPKDNYKSPIYDS
                     VKHVARFFNVEPMFPGKPKAEDVALILHTSGTTSKPKTVPLLHRNIVTSMQNISRTYR
                     LSPKDNSYVVMPLFHVHGLIGVLLSSFYAQASVIVPPRFSAGRFWADFVKYKANWFSC
                     VPTISQIMLNVEKPSPLPEIRFIRSCSSALAPSTLHQLEEVFRAPVVEAYAMTEASHQ
                     MTSNELPPGKRKPGTVGKPQGVEVVILNEKDEVMPQGQQGEVSIRGSNVTPGYRNNPK
                     ANQENFTRAEHYFRTGDQGFFDEDGFLVLTGRLKELINRGGEKISPLELDAVMLSHPA
                     VNEAIAYGVANTKYGQVVHAAVVLRAGQKLDYEGLAAYMKEKVASFKVPERVFFVDKL
                     PKTATGKVQRRMLAEVFSSKSKL"
     gene            complement(<645854..>647476)
                     /locus_tag="AGOS_AAR169C"
                     /old_locus_tag="AAR169C"
                     /db_xref="GeneID:4618748"
     mRNA            complement(<645854..>647476)
                     /locus_tag="AGOS_AAR169C"
                     /old_locus_tag="AAR169C"
                     /product="AAR169Cp"
                     /transcript_id="NM_208065.1"
                     /db_xref="GeneID:4618748"
     CDS             complement(645854..647476)
                     /locus_tag="AGOS_AAR169C"
                     /old_locus_tag="AAR169C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR223C (TDP1)"
                     /codon_start=1
                     /product="AAR169Cp"
                     /protein_id="NP_982712.1"
                     /db_xref="GeneID:4618748"
                     /translation="MGQSAREAVRARWARVGYTSLGTADKSSVQTKSEAVEVVVLDSE
                     EEASTAEDTGTEEAERHNLWPMWLVHSALYDGETAGTAGGNGICGLEVVLGDTDLERV
                     YLFSFQYEMNWLLDLIPEHVQVVVTAQKGTVQEADGGRAARVRYRMVWMPPFSSHHSK
                     MVIAFYQDQRCRVVLPSANFTALETSLPQQMMWMTPQLAHSRAAEQQPSRFRSGLQDY
                     LQMYPEPDRELLQRLRKIDFAPVDATGAAFVYSAPGARTRAKTGLAQLAAQLDEGPAA
                     GGRHSHYFCQSSSIGGPLNSRSAENPRNLFVHLMVPLLSGHTQGLPKSVKDCLGEKEA
                     YALLQRERLHPYILYPTVEDFNECFTGWLASGWFHFHHSRTAATRNHYSSLRDNGCFV
                     KQREYELRPGGRTALPIIRRDRVPCHTKFYIKFASASATSWNSLTDCEWFLFTSANLS
                     THAWGAPPSYQPKNYECGVLYTKSENVALRVHCAKDVVYASDSAWSDPEYFDAREGEH
                     ITVNLMTPFWLPAENYGPTDVAFCASDKPDDM"
     gene            <647750..>649561
                     /locus_tag="AGOS_AAR170W"
                     /old_locus_tag="AAR170W"
                     /db_xref="GeneID:4618749"
     mRNA            <647750..>649561
                     /locus_tag="AGOS_AAR170W"
                     /old_locus_tag="AAR170W"
                     /product="AAR170Wp"
                     /transcript_id="NM_208066.2"
                     /db_xref="GeneID:4618749"
     CDS             647750..649561
                     /locus_tag="AGOS_AAR170W"
                     /old_locus_tag="AAR170W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL125W (MET13)"
                     /codon_start=1
                     /product="AAR170Wp"
                     /protein_id="NP_982713.2"
                     /db_xref="GeneID:4618749"
                     /translation="MRISQKLKQRAGAADEEQPKASFSFEFFVPKTLQGVQNLYDRMD
                     RMYQTQPEFIDITWNAGGRLSQRTSELVATSQGVLGLETCMHLTCTNMSTALVDEALE
                     RAYEAGCENILALRGDPPLQGTWEPCAGGFRYAKDLVAHIRARYGDHFDVGVAGYPEG
                     HEEASGAELIGYLKEKVDAGADFIITQMFYDADLFLKWCDAVRAAGISVPIIPGIMPI
                     TSYAALLRRAKWCQVRLPPEFLERLEPVKDDDQAVREIGTVLVADMCRKILASGHVTH
                     LHLYTMNLERASLMILERLQLIDTGGAGVRRRPSTNETLPWRKSLNPTRRKEGVRPIF
                     WQRRPYSYVARTSQWSADEFPNGRFGDSSSPAYGDLDLCGHTVLRQTYQRSLELWSTP
                     RTLLDLAALVISYLKGDLKCLPWSDVPLHQEADALLDSLIRLNEHLVLTINSQPKVNG
                     APSADPIVGWGPANGYVYQKQYLEFLLPKHHLPAFHAALTADFPTLTYFAVDADDNLA
                     SNHPDDTQANAVTWGIFPGREVLQPTIVEKASFLAWKDEFYRILDDWRLSFDENGAAD
                     SAALLAHLTSDYALVNIVDNDFVATADNIYCLLARFF"
     gene            <650194..>652317
                     /locus_tag="AGOS_AAR171W"
                     /old_locus_tag="AAR171W"
                     /db_xref="GeneID:4618750"
     mRNA            <650194..>652317
                     /locus_tag="AGOS_AAR171W"
                     /old_locus_tag="AAR171W"
                     /product="AAR171Wp"
                     /transcript_id="NM_208067.1"
                     /db_xref="GeneID:4618750"
     CDS             650194..652317
                     /locus_tag="AGOS_AAR171W"
                     /old_locus_tag="AAR171W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR225W"
                     /codon_start=1
                     /product="AAR171Wp"
                     /protein_id="NP_982714.1"
                     /db_xref="GeneID:4618750"
                     /translation="MREKAVLAIGDAYEVPWDTVPLAALEARKRASSSQSRKGAGSAL
                     KRQYGSQSSSASLTSPQRTKYTRRHSASGSSTEPGVRSPLAPVPPAPQEYTGPTRDWN
                     VLPQCCGGEHARGPGSTGQDVYSELDNFLLFNLETSTKDALLRARERLSAYIRFLELD
                     YGTAGTERLCAACLEATRELVQLWFHQANRLTVRTGTYFIMSEKNMYSFNQNSSRKHD
                     LLVLHFRGLCSLGWQVAFDEPNLRVLECNLKPPKEVLEVSDIKTPKSTVTEGVDEPPA
                     RELSPAPIQPVRTRGQEDVESTGHRPSLRDYIERDLEKRGHKSATALLGEQGASPQYE
                     AGNFSSNDEYPDSDDYSMMSFESADGNKDIQQKYKLTSAVHAMTTGIAGLFKKRGPHG
                     EVYSRSGSSSREQRNSVDRDNTPASVRPSSLPQTWDMIPLGGGPRPAAQAYSADLASH
                     SDPQERKNLYIINQWLEECYSKTLYNYDRLEVDLSESRLPYPEASSTEDGKGSAAGSR
                     RQSLAESSTTTIRLPFESNTFPAIFCPGILYMLTFPQWLPFLNEIKRCMVPGAPVTAV
                     LYDFNDSNMDDDGSKVMFPTTLELKKVFQAIRFEAIKRGLQVFPIRNIAPIFRQVGFK
                     NVKYTVLTFKRGDFVNEMGFVNELLATFHYDFLVRTFLTDRSKYPVGTDPQTLPRRYI
                     DEHMGQIDDNAGCLRLIAITAEKPE"
     gene            <652596..>653501
                     /locus_tag="AGOS_AAR172W"
                     /old_locus_tag="AAR172W"
                     /db_xref="GeneID:4618751"
     mRNA            <652596..>653501
                     /locus_tag="AGOS_AAR172W"
                     /old_locus_tag="AAR172W"
                     /product="AAR172Wp"
                     /transcript_id="NM_208068.1"
                     /db_xref="GeneID:4618751"
     CDS             652596..653501
                     /locus_tag="AGOS_AAR172W"
                     /old_locus_tag="AAR172W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR228W (SLX1)"
                     /codon_start=1
                     /product="AAR172Wp"
                     /protein_id="NP_982715.1"
                     /db_xref="GeneID:4618751"
                     /translation="MGDDIGTAGVPAFYCCYLLRSIPKRLSYYIGSTPNPVRRLRQHN
                     GLLTKGGAYRTKRQGTRPWELAASVSGFPSKIAALQFEHAWQHPYQTRFIKSEDRIVK
                     KKGGGRSIHQRLAVLKLLLHHPFFKVMSLVVHLFSEDIQRVWFLDKYKLEAPFIHVEV
                     DEDALSEPTGEDEESVIEHAKKNLRLVELFYGRSLKEDSECLEEYRRRLQNGAMRCAI
                     CEKIVDYVKDSDSFSSEKELVAFCYNSVCDYFSCLSCLYNVFASDEELRTGEIPLIPT
                     SGQCPNCNIELSWARIVRYSMFLSA"
     gene            complement(<653624..>656362)
                     /locus_tag="AGOS_AAR173C"
                     /old_locus_tag="AAR173C"
                     /db_xref="GeneID:4618752"
     mRNA            complement(<653624..>656362)
                     /locus_tag="AGOS_AAR173C"
                     /old_locus_tag="AAR173C"
                     /product="AAR173Cp"
                     /transcript_id="NM_208069.1"
                     /db_xref="GeneID:4618752"
     CDS             complement(653624..656362)
                     /locus_tag="AGOS_AAR173C"
                     /old_locus_tag="AAR173C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR229C (ROT2)"
                     /codon_start=1
                     /product="AAR173Cp"
                     /protein_id="NP_982716.1"
                     /db_xref="GeneID:4618752"
                     /translation="MHWNRILFWGCALLLQQLADAFDEGVLRKCNESGVCHRNRHYGE
                     KIASSGAVYYTVDWDSLELFTSGHTVQGKITKRLPRGKDKGSIALPFTLDVLENSLVR
                     LRIDEDRDVTGLPEILSPRRYNGTSDWMFEDGVVLRASACNQSTAIVGDGKKMVIENS
                     DDEVKVELFQNPFKLDVYHHDKLLVTINDRSFLNLEHWRLPRTNYQNSLPEESDYDSF
                     YDNFHGAGNDTLPFGPESVALDVTLHGFKNVYGIPEHADSLKLRDTSGGEPYRLFNAD
                     CFEYPVKSTSPMYGSIPLMVSHAPHSSVGLFWVNSADTWIDVNYSENNVKTHWMSEAG
                     VLDIIILLQESPAKVTESYTNITGKPAFPPISALGYHQCRWNYNDEQDLMTVNNEMDK
                     AEMPLDFLWLDIEYTDEKKYFTWKKDAFPDPLGLFQKLANITRNLVTIIDPHLKLNYN
                     LTDIMVANDGAIKNSTGQPFIGECWPGTSIWIDTFSPVAKNLWASFYHNFVEGAKNLF
                     IWNDMNEMAVFDGIESTAPRDAIVHGGFEHRAVHNLYGMTVHQASYQGLRERYAEDNK
                     RPFLLTRSYSAGSQRTAAGWSGDAVGTWDYLKITIPIILANNIVGMPFFGGDVPGFTG
                     DPDPVLTVRWYQAGMWFPLFRGHGHKDTKRREPYLLEEPYKSIVRDVLRARYALLPTL
                     YTAFHESNATGVPIINPMFYEKPDLEEAFDIDDQFYLGRSGLLVKPVVNNSTTTTVFF
                     PPGRYYDYFTLETFAITDAKRLTIDTPLSKIPAYLESGKLIVTRDRYRRTTKLMERDP
                     YTLVVAPDDENKAYGVQYIDDGATFAYQDGRYVKVEYSYFESGMSAKILKTTDELKDL
                     MIEKIVIAKHPSFKLPGICVFKQEQATWTARITEDENKYTIHNSGVKVGVEWSIKF"
     gene            <657572..>658954
                     /locus_tag="AGOS_AAR174W"
                     /old_locus_tag="AAR174W"
                     /db_xref="GeneID:4618753"
     mRNA            <657572..>658954
                     /locus_tag="AGOS_AAR174W"
                     /old_locus_tag="AAR174W"
                     /product="AAR174Wp"
                     /transcript_id="NM_208070.1"
                     /db_xref="GeneID:4618753"
     CDS             657572..658954
                     /locus_tag="AGOS_AAR174W"
                     /old_locus_tag="AAR174W"
                     /note="NOHBY117; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F09757g"
                     /codon_start=1
                     /product="AAR174Wp"
                     /protein_id="NP_982717.1"
                     /db_xref="GeneID:4618753"
                     /translation="MQNLILTPPNISSPALSNVCSINNLVGDGSSNPTASTSMRATPV
                     LPPVKGLLFHNNQLPPPGPFNYGSMANSALPHGLPAGAKYEQMTPPPLFHSRSVPPQM
                     PSAQPQAAQPQRFANPFDQLSQLLTHIESSSSSSLKVITGHLMADKIIRDNGDYSLQL
                     KEIFGSLREIHLSLLNWPMVQYSQDIPNGEIMRELVSFIEYRDLEKLDFLIDKFKRQL
                     DLVKYWKDKLGHLYVEKIDSGTWCSPGERLRQENGTPIPVIHSAAVGSSASRLASPSP
                     SVSTGPGVIQGGSTATSSRSVSFSIPAEERVGYIPEHVGEFRNDFFQDLIVPSWFIVI
                     RDPKTMNCLQCGSRDTSEWRSGPLGRKSMCNACGIWYMKLKQRFGEEDAAVIMEYRRL
                     TNRHDDRRVPKKFEVPLPEVEKVKRAIRARVVEYLNDVEIPVKTRRRALLHKGKPGSA
                     LKTEMKTPAA"
     gene            complement(<659159..>660904)
                     /locus_tag="AGOS_AAR175C"
                     /old_locus_tag="AAR175C"
                     /db_xref="GeneID:4618754"
     mRNA            complement(<659159..>660904)
                     /locus_tag="AGOS_AAR175C"
                     /old_locus_tag="AAR175C"
                     /product="AAR175Cp"
                     /transcript_id="NM_208071.2"
                     /db_xref="GeneID:4618754"
     CDS             complement(659159..660904)
                     /locus_tag="AGOS_AAR175C"
                     /old_locus_tag="AAR175C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL124C (MON1)"
                     /codon_start=1
                     /product="AAR175Cp"
                     /protein_id="NP_982718.2"
                     /db_xref="GeneID:4618754"
                     /translation="MSTSGSRDSASTRESARETRAGPQALPLGSVVSLSSMRSASPTH
                     APWVAKPTTSVDLTNHFMEVAARGGEEERSLASPGEEMQYELAHSMKAAPALPRELPS
                     PFRAAGGRGALPQEKQFFVLTAAGKPIYSMHGPEELVMGLMGIAHTLLNYFELDGPRE
                     RLRTITTYDAHGVLQRFAFLRKKHVVLLAMTTRNEAEAELQQQLDLLYSYLVSSLSLR
                     QMSRLFERANFDLRSFLTESDFHNLDQLCRAMCDGTHLGWTLGALECITLKHSVRQRI
                     NSIMLRATRGLAVGTLLYGMIVAPDHRLVSVLRPKGHTLHTTDLQLLFSMVENQLQLL
                     HSSQEVWVPLCFPKFNGNGFLYCYIKFLPTDTDSASNETTLEGNMHIKPTLILISPQK
                     SSFYDLHTCASEILDNLAVAGIMPHITAPSRFTINDIPAPLVHHFIYKSKKYVQYVMP
                     ETSSTTDWSTLMKYYSHLRSNALDSHGNPLSENVVAFARWCASSGQVQVEYCDSSEEL
                     QVEDQPSSIFSESFVEESLNMTGLSWITPSFELYLLCNNGEIPKAVVMKSARNVVGWC
                     SRNGHKLFVSEGAVF"
     gene            complement(<660987..>661448)
                     /locus_tag="AGOS_AAR176C"
                     /old_locus_tag="AAR176C"
                     /db_xref="GeneID:4618755"
     mRNA            complement(<660987..>661448)
                     /locus_tag="AGOS_AAR176C"
                     /old_locus_tag="AAR176C"
                     /product="AAR176Cp"
                     /transcript_id="NM_208072.1"
                     /db_xref="GeneID:4618755"
     CDS             complement(660987..661448)
                     /locus_tag="AGOS_AAR176C"
                     /old_locus_tag="AAR176C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR230C (OM14)"
                     /codon_start=1
                     /product="AAR176Cp"
                     /protein_id="NP_982719.1"
                     /db_xref="GeneID:4618755"
                     /translation="MSDNKIDESIDKARSGAKNLIDKASDGSKKLAKDAKKGLEKGES
                     ELQRAAERVGEWLSGAAAGTWDVAAKTAGAARDVASKVFVELQNPVVAVNAVLGGGAL
                     MAWLHGYAEHQSRYLQGKTDRAILATVGGVAALVAADGLLSYKYYRQFDRK"
     gene            <661912..>662667
                     /locus_tag="AGOS_AAR177W"
                     /old_locus_tag="AAR177W"
                     /db_xref="GeneID:4618756"
     mRNA            <661912..>662667
                     /locus_tag="AGOS_AAR177W"
                     /old_locus_tag="AAR177W"
                     /product="40S ribosomal protein S2"
                     /transcript_id="NM_208073.1"
                     /db_xref="GeneID:4618756"
     CDS             661912..662667
                     /locus_tag="AGOS_AAR177W"
                     /old_locus_tag="AAR177W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL123W (RPS2)"
                     /codon_start=1
                     /product="40S ribosomal protein S2"
                     /protein_id="NP_982720.1"
                     /db_xref="GeneID:4618756"
                     /translation="MSAPEQRRGGFGARNKGRQGRKGRREVEEKGWVPVTKLGRLVKA
                     GKVTSVEEIFLHSLPVKEFQIVDTLLPGLKDEVMNIKPVQKQTRAGQRTRFKAVVVVG
                     DSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGSNLGQPHSLATKTSGKSG
                     SVTVRLIPAPRGSGIVASPAVKKLLQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNT
                     YGFLTPDLWPENQLPASPLDVYADEAVAQKKRF"
     gene            complement(<662992..>664452)
                     /locus_tag="AGOS_AAR178C"
                     /old_locus_tag="AAR178C"
                     /db_xref="GeneID:4618757"
     mRNA            complement(<662992..>664452)
                     /locus_tag="AGOS_AAR178C"
                     /old_locus_tag="AAR178C"
                     /product="AAR178Cp"
                     /transcript_id="NM_208074.1"
                     /db_xref="GeneID:4618757"
     CDS             complement(662992..664452)
                     /locus_tag="AGOS_AAR178C"
                     /old_locus_tag="AAR178C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL122C (NAB2)"
                     /codon_start=1
                     /product="AAR178Cp"
                     /protein_id="NP_982721.1"
                     /db_xref="GeneID:4618757"
                     /translation="MSAIQDDISGSLKTVVAEKLKTLQNFSEDVNYVAEYIVLLLSNG
                     GTHDSVLQELVGLFDSVPQQALADVVQTSFQALQLLRSGDNIETVYQKLTNPGMMAPE
                     PPAEAMSVSAPSEPSVSTEATSMPRSAFEGMVDLSASKYATKNPTSSRGGLKRGGKQG
                     GINKSASGPRKGNQQTGGKHRMNALARALGMEGEDAANNAQVNIIPKKEGRCQLFPRC
                     PLGKFCPHAHPTKVCRDYPNCPNAPGTCEYLHPNEDVELMKEIEKTREEFREKRIALA
                     QSRAKPIQTGIVLCKFGIMCSNPMCPFGHPTPANEDAKVIQFIWCPQNLTCDKKDCDK
                     AHSSLSKIRDVQPIAAAPRPSKPAAFAPAERSLEQCKFGVKCTNKRCKYRHARSHIMC
                     REGAACTRIDCFFGHPINEPCKFGAECRNAHCLFQHPPGRSLPDKSQAATGAPSWPAH
                     AAGGNQSANERPYAVAESAGIEQAPIQESDGDATMA"
     gene            complement(<664695..>665456)
                     /locus_tag="AGOS_AAR179C"
                     /old_locus_tag="AAR179C"
                     /db_xref="GeneID:4618758"
     mRNA            complement(<664695..>665456)
                     /locus_tag="AGOS_AAR179C"
                     /old_locus_tag="AAR179C"
                     /product="AAR179Cp"
                     /transcript_id="NM_208075.1"
                     /db_xref="GeneID:4618758"
     CDS             complement(664695..665456)
                     /locus_tag="AGOS_AAR179C"
                     /old_locus_tag="AAR179C"
                     /note="NOHBY118; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AAR179Cp"
                     /protein_id="NP_982722.1"
                     /db_xref="GeneID:4618758"
                     /translation="MFEKDEILPLDEARSQKIKEFLSLSLGLITESIEKKEYDSIARS
                     VSVLNMQLGLTELEEILEDRIVDFYTEHRLLQDAMAIYEPAMIHALVDRVSKLREKYY
                     DPDTQAVDPSSPDFDLINLLNMQSLIMMRRSRRLYEKIAGSYNRLIAVDLTLDDFETI
                     VHRYRDGLMLLKSINLEMVYFVPYCKHFENITIFVKEFGTGLTNINEKYKSAYRFLVQ
                     ARNYQRKIRRVSLDSLIDGMRKKCESMGNKRQGLA"
     gene            complement(<665685..>667985)
                     /locus_tag="AGOS_AAR180C"
                     /old_locus_tag="AAR180C"
                     /db_xref="GeneID:4618759"
     mRNA            complement(<665685..>667985)
                     /locus_tag="AGOS_AAR180C"
                     /old_locus_tag="AAR180C"
                     /product="AAR180Cp"
                     /transcript_id="NM_208076.1"
                     /db_xref="GeneID:4618759"
     CDS             complement(665685..667985)
                     /locus_tag="AGOS_AAR180C"
                     /old_locus_tag="AAR180C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL120C (PRP43)"
                     /codon_start=1
                     /product="AAR180Cp"
                     /protein_id="NP_982723.1"
                     /db_xref="GeneID:4618759"
                     /translation="MAKRRLSSEGHADPVKTSVPEHAAEVAEELSATHRQTPVEPMVH
                     HDAGEFTDMERHKTTASQARQLEDGENNPFTGKPFSENYVKILKVRRDLPVHAQRDEF
                     LKMYQENQVMVFVGETGSGKTTQIPQFVLFDEMPHLRNTQVACTQPRRVAAMSVAQRV
                     AEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLKRYSCIILDEAH
                     ERTLATDILMGLIKQVVLRRPDLKIIVMSATLDAEKFQRYFNNSPLLAVPGRTHPVEI
                     YYTPEFQRDYLDSAIRTVLQIHATEGEGDILLFLTGEEEIEDAVRKISLEGDQLIREQ
                     GCGPIKVYPLYGSLPPHHQQRIFEPAPASHNGRPGRKVVVSTNIAETSLTIDGIVYVI
                     DLGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFKKELI
                     EQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEG
                     NLTPLGRLASQFPLDPMLAVMLIGSNEFHCSEEILTIVAMLSVPNVFVRPSKDRKRAD
                     DAKSVFAHPDGDHITLLNVYHGFKSDEAYNYGIHQWCRDNFLNYRSLAAADNIRSQLE
                     RLMKRYSLELNTTEYDDPRYFDNIRKALAAGFFMQVAKKRSGGKGYITIKDNQDVLIH
                     PSTVIGHDAEWVIYNEFVLTTQNYIRTITSVRPEWLIELAPAYYDLDNFQKGDIKLSL
                     ERIKQKMDRIEELSKEQSKKHRQSRA"
     gene            <668342..>670026
                     /locus_tag="AGOS_AAR181W"
                     /old_locus_tag="AAR181W"
                     /db_xref="GeneID:4618760"
     mRNA            join(<668342..668626,668680..>670026)
                     /locus_tag="AGOS_AAR181W"
                     /old_locus_tag="AAR181W"
                     /product="AAR181Wp"
                     /transcript_id="NM_208077.1"
                     /db_xref="GeneID:4618760"
     CDS             join(668342..668626,668680..670026)
                     /locus_tag="AGOS_AAR181W"
                     /old_locus_tag="AAR181W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL119W (COQ8); 1-intron"
                     /codon_start=1
                     /product="AAR181Wp"
                     /protein_id="NP_982724.1"
                     /db_xref="GeneID:4618760"
                     /translation="MGTRESLYHAYRVLISSKDVFCGSVDIARESFYIWASTSSLTRP
                     LLSKSRWFHDPEWNRARQLSDKTRQEAAGQLRRNASAPRGTRQYSTSSKRNEDDAEVR
                     HMESSSVPSSRISRLFHYGSLAAGVGISAASQGLSQMSRGQSPTLKSLLLSDTNIARI
                     TKKFSQMRGAALKIGQMMSFQDSKVLPAELYQILSRVQNSAHYMPQRQLDRLMARELG
                     VEWRNKFASFENVPIAAASIGQVHKAVLPNGDDCVVKVQYPGVKDSIDSDLNNILVLL
                     TASSLLPKGLFLEKTVANAKTELGWECDYIREATALKHFEKLLADDSVFVVPHVYDSL
                     TTPNIIVMSRMRGTEIMKLPADVASQEVRDFICENIMRLCLKEIAEFKYMQTDPNWAN
                     FLYNPTTRKIELLDFGASRGFPDEFIRNYRKLLTYATQGDREGVHQMSEQLGYLTGLE
                     SRAMINAHVDSVMTLGEPFSGEVDKTFDFSDQDVTDRIRGNIGLMLNERMCPPPEETY
                     SLHRKFSGVFLLCARMGARVHCAKLFDEIFALNEK"
     gene            complement(<670194..>670997)
                     /locus_tag="AGOS_AAR182C"
                     /old_locus_tag="AAR182C"
                     /db_xref="GeneID:4618761"
     mRNA            complement(<670194..>670997)
                     /locus_tag="AGOS_AAR182C"
                     /old_locus_tag="AAR182C"
                     /product="AAR182Cp"
                     /transcript_id="NM_208078.1"
                     /db_xref="GeneID:4618761"
     CDS             complement(670194..670997)
                     /locus_tag="AGOS_AAR182C"
                     /old_locus_tag="AAR182C"
                     /note="NOHBY119; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B00517g"
                     /codon_start=1
                     /product="AAR182Cp"
                     /protein_id="NP_982725.1"
                     /db_xref="GeneID:4618761"
                     /translation="MLSTSYGSLQRHNKECFAPASSSKGTLRSCVEFTDPFSPMSARS
                     PDWSVRNGSVSGVELPDSPELANSDYHAYSQSTLPTPVNSSPVAPISKGFGMQPSLYP
                     YLAPMTVVAPQEGEPITSTIGPFTVSMPLPESVGTCNPSMSPVRCLITPLGENKIISY
                     YELSPMARVIKQIEDINKQLLYYFSEENLPRDPFLRDRMDPEGFVDIDTFLQFPRIVS
                     MTRDLPNRLQKLVVLVNAFKCSEPDVFEIRHNSKVRLRVSWDRWVQKYS"
     gene            671647..671718
                     /locus_tag="AGOS_t0026"
                     /db_xref="GeneID:4618762"
     tRNA            671647..671718
                     /locus_tag="AGOS_t0026"
                     /product="tRNA-His"
                     /codon_recognized="CAC"
                     /db_xref="GeneID:4618762"
     gene            complement(<672065..>674011)
                     /locus_tag="AGOS_AAR183C"
                     /old_locus_tag="AAR183C"
                     /db_xref="GeneID:4618685"
     mRNA            complement(<672065..>674011)
                     /locus_tag="AGOS_AAR183C"
                     /old_locus_tag="AAR183C"
                     /product="AAR183Cp"
                     /transcript_id="NM_208079.1"
                     /db_xref="GeneID:4618685"
     CDS             complement(672065..674011)
                     /locus_tag="AGOS_AAR183C"
                     /old_locus_tag="AAR183C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIL014W (MNT3)"
                     /codon_start=1
                     /product="AAR183Cp"
                     /protein_id="NP_982726.1"
                     /db_xref="GeneID:4618685"
                     /translation="MVQSPSIAILVAWGLQCKGLPDAILRTVIALLLATDRSGMVSYG
                     LMGNFSKKMVHRGMGRWRFRGHRWSLRYIRICVRTVMVFSMLALVLQYSGKILVASIL
                     HNSVRPSSKTPLHTVHAVEQLQFGRWPLEKKCQWYFAKEKRQQWLNEIIERSRGRMKD
                     ASVTAAMLERLRVFDTCFMQGDIGLREVFGEDINLYSLHHELFPFLKKVRDWSELLPQ
                     VLDLNDGSRYLLGNKLPEQAFKVDNDLPFWENLRRSSSGRGIVATVADIHLDQLKRLL
                     HVLDELGNKLPIELVYKGNDFSRLPIKRLKRYVRQHTKQRVRLVDCSRVLRSTHIPKI
                     KRFMNKWLATIFNSFEEIILLDVDVVPLVPIDSYFKLPGYTKTGALFFKDRTLPEYLP
                     VSCTKAILLLPPSSEENKLWGHSMRYRTPMTKAGALDRTNSAETEVMYNYFIERYRHQ
                     VETGLVVLNRKQRLFSLVTSFMIHLNLRFSECFHGDKEVFWLGQLLTGNEYSIHPMPA
                     AIIGELQQGERKLAATEYRICSTQIAHPDTDGTVLWINGGMWNCKDNKAAEEDFSDYN
                     RYFTRKFGSQQKLADWYKQTLKVTGVFSPELKNSKWIPAKECKQSAFCSSVFVHDDEE
                     LQSLKDADISVCNHLASVWGSLPE"
     gene            complement(674092..674163)
                     /locus_tag="AGOS_t0027"
                     /db_xref="GeneID:4618763"
     tRNA            complement(674092..674163)
                     /locus_tag="AGOS_t0027"
                     /product="tRNA-Asp"
                     /codon_recognized="GAC"
                     /db_xref="GeneID:4618763"
     gene            <674621..>677131
                     /locus_tag="AGOS_AAR184W"
                     /old_locus_tag="AAR184W"
                     /db_xref="GeneID:4618686"
     mRNA            <674621..>677131
                     /locus_tag="AGOS_AAR184W"
                     /old_locus_tag="AAR184W"
                     /product="AAR184Wp"
                     /transcript_id="NM_208080.1"
                     /db_xref="GeneID:4618686"
     CDS             674621..677131
                     /locus_tag="AGOS_AAR184W"
                     /old_locus_tag="AAR184W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR017C (KCS1)"
                     /codon_start=1
                     /product="AAR184Wp"
                     /protein_id="NP_982727.1"
                     /db_xref="GeneID:4618686"
                     /translation="MEAARGVTATEAGQSTGEARAGPCREPVAPGLTGAAHVIHGRKA
                     STYLGIFDSPPPPDGSGKSGKAGKTGKKVLTGASGDEGVTAAEDPWKKKKKKKREERE
                     SEWGGAKLAALASEAQHDLELYTQRSSAIVSSHESLGKPISSATYFPHKYKEDASGGV
                     AGQGRKVLSVELDSEVSSLSASDEEAIEDSEEDEEDEKSDGNRTQEDEFEDDDERDVI
                     SSSETREFPLKVELQPFTDNVGGHTAIFRFSERAVCKALVNQENSWYETIELKHPDLL
                     QFMPRYFGVLNVRQHFTSKGEFLNSIQAKDRKVADIGNPPPSPDNVEAPATPRLEPLH
                     HTTSLPLVEENPLPEVCLNDNKHIIPDSLWSKYSHSPSSLPSQESWAAKSECLVNSNT
                     QGRTGNDTAGHSSYPTGSTLINTRLKELIIEEVFGQSSNRTQQPIFHDNHAHQHRNFR
                     NSSIPIDKNSGDTMRIQSSDCLTNFPKSKQSRSSSTSSSTANKFISKKKRHDSHNSLV
                     DLREMHRGLYCGPENELFKLEDDLSLTASVPNSPQSKSQHESVSYEEHSHTVVSKFIL
                     LEDLTRKLNKPCVLDLKMGTRQYGVDAKRSKQLSQREKCRNTTSRKLGVRICGLKIWN
                     KDYYITRDKYFGRRVRIGWQFVRVLARFLYDGVSRRSILKQLPCLVRQLETLYSEAIK
                     LKSYRMYGSSLLLMYDGNNPSSKRCKVKLNLIDFARCVTKKDIDTSIGTFRIPPKNPE
                     LEDRGFLRGLRSLKFYLLVIWNHLTGDHPLVYDEESLQEFLDSDDSFQKPWDWIEEFD
                     KEDEARVHDPNDELRKKWRKYELIFDVEPRCADDDVSE"
     gene            complement(677462..677544)
                     /locus_tag="AGOS_AgSNR161"
                     /old_locus_tag="AgSNR161"
                     /db_xref="GeneID:4618764"
     ncRNA           complement(677462..677544)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR161"
                     /old_locus_tag="AgSNR161"
                     /product="AgSNR161"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR161; start and end coordinates are
                     approximate."
                     /transcript_id="NR_149363.1"
                     /db_xref="GeneID:4618764"
     gene            <677746..>678090
                     /locus_tag="AGOS_AAR185W"
                     /old_locus_tag="AAR185W"
                     /db_xref="GeneID:4618765"
     mRNA            <677746..>678090
                     /locus_tag="AGOS_AAR185W"
                     /old_locus_tag="AAR185W"
                     /product="AAR185Wp"
                     /transcript_id="NM_208081.1"
                     /db_xref="GeneID:4618765"
     CDS             677746..678090
                     /locus_tag="AGOS_AAR185W"
                     /old_locus_tag="AAR185W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR016C (DAD1)"
                     /codon_start=1
                     /product="AAR185Wp"
                     /protein_id="NP_982728.1"
                     /db_xref="GeneID:4618765"
                     /translation="MIMSKDIATTPELSEPDKYFVEQRDLLLQEITSTLDSILNNLNG
                     LNISLENSIAVGKEFESVSELWKVFYDGLANGAAPGVAAANPSSQDLPTEPVAAHQNA
                     AAGNSDAPAPSQ"
     gene            complement(678174..678974)
                     /locus_tag="AGOS_AgTER1"
                     /old_locus_tag="AgTER1"
                     /db_xref="GeneID:4618766"
     ncRNA           complement(678174..678974)
                     /ncRNA_class="telomerase_RNA"
                     /locus_tag="AGOS_AgTER1"
                     /old_locus_tag="AgTER1"
                     /product="AgTER1"
                     /note="similar to Saccharomyces cerevisiae TLC1
                     (Telomerase RNA component); end coordinates are
                     approximate"
                     /transcript_id="NR_149439.1"
                     /db_xref="GeneID:4618766"
     misc_feature    complement(678275..678305)
                     /locus_tag="AGOS_AgTER1"
                     /old_locus_tag="AgTER1"
                     /note="Telomeric repeat RNA template"
     gene            <679183..>679851
                     /locus_tag="AGOS_AAR186W"
                     /old_locus_tag="AAR186W"
                     /db_xref="GeneID:4618767"
     mRNA            <679183..>679851
                     /locus_tag="AGOS_AAR186W"
                     /old_locus_tag="AAR186W"
                     /product="AAR186Wp"
                     /transcript_id="NM_208082.1"
                     /db_xref="GeneID:4618767"
     CDS             679183..679851
                     /locus_tag="AGOS_AAR186W"
                     /old_locus_tag="AAR186W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR035C (PDX3)"
                     /codon_start=1
                     /product="AAR186Wp"
                     /protein_id="NP_982729.1"
                     /db_xref="GeneID:4618767"
                     /translation="MEEQPIIFAPETFQYDKSSLSVEDVVADPIDQFTMWFEDARKDP
                     TEDIPEAITFSTAELPSGRVSSRVLLFKELDHRGFTVYSNWGTSKKAADVRSNPQAAI
                     VFFWRNLQRQVRVEGIVEHVSRATSERYFKTRTRGSKVGAWSSLQSQTLADRKELEDR
                     YKANEARFAEEEDVPCPEHWGGVRVVPLEIEFWQGRPSRLHDRVVYRRKTEHDDWEIS
                     RLAP"
     gene            complement(<679901..>681586)
                     /locus_tag="AGOS_AAR187C"
                     /old_locus_tag="AAR187C"
                     /db_xref="GeneID:4618768"
     mRNA            complement(<679901..>681586)
                     /locus_tag="AGOS_AAR187C"
                     /old_locus_tag="AAR187C"
                     /product="AAR187Cp"
                     /transcript_id="NM_208083.1"
                     /db_xref="GeneID:4618768"
     CDS             complement(679901..681586)
                     /locus_tag="AGOS_AAR187C"
                     /old_locus_tag="AAR187C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR014W (RAD61)"
                     /codon_start=1
                     /product="AAR187Cp"
                     /protein_id="NP_982730.1"
                     /db_xref="GeneID:4618768"
                     /translation="MPMKVYGRHGRYNRLVTTFGKTHGEEDSWFSSDDENHGRPVSDD
                     TTKLSLSQDRCSELPEETIGANRKRPAERTQTDPVWEFLERPASGQKRRRRATCDSTE
                     YRESASQEFLNAVNVVQGIVSSLKPAKEVVEHWAELEDVPEDRGNNGQAVYGKTRTML
                     AKAEEDSDTEAAAHESDERAAQGDEALSRHFNELRTMGETLKYSEDLDFILSDNSMTT
                     PEHRRNNMLRLCLDMMNNEDLCQYIVKYRHREVWEWCFQGTDPKQKVTSLLQCFIADK
                     IPLLRHDKRWAMLSLENFILPLATDEVFPKKIAGSRLVKLNYQDLLRKLKFTNTCEYA
                     LYIWATYLLYTEAVYGAVPALARLISRGQLKDWDTACSLLENNIVAAPSGSDIEEYAQ
                     AFQTLAGLSREKLTNEGVLKCLIKLTNHTTVLELSADLLPSLVRSLAMSVQLHQNNIV
                     SSISEIKTNLLILQLGLLLNIVSEATTAASTEELTNFGAVFRSVFVKKPTEMSFVLQL
                     FLLVYAYSAGAAGVQLPPAEADFLKSELEAFATDVSSYNHNIHTRITRVLETL"
     gene            <681721..>682332
                     /locus_tag="AGOS_AAR188W"
                     /old_locus_tag="AAR188W"
                     /db_xref="GeneID:4618769"
     mRNA            <681721..>682332
                     /locus_tag="AGOS_AAR188W"
                     /old_locus_tag="AAR188W"
                     /product="AAR188Wp"
                     /transcript_id="NM_208084.1"
                     /db_xref="GeneID:4618769"
     CDS             681721..682332
                     /locus_tag="AGOS_AAR188W"
                     /old_locus_tag="AAR188W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR013W (PSF1)"
                     /codon_start=1
                     /product="AAR188Wp"
                     /protein_id="NP_982731.1"
                     /db_xref="GeneID:4618769"
                     /translation="MYGDVANKLVLEAKRTDHLANGSATLQLPMFQDEMVRVILKEVS
                     QLQRNAEYLKLQEDSGKLSKCQYFVTMLCMERNKRCLLAYQKTRSEILDAIAWENNGL
                     DTMDLLSNKGHDSGNLSPYEQEYLREYSQLISDLTAGELMDIDLAGSLTPPSDVFIDV
                     RVLKDAGEIQTEYGVFNLIKDSQFFVRQADVERLIQQGYLQKL"
     gene            complement(<682327..>683511)
                     /locus_tag="AGOS_AAR189C"
                     /old_locus_tag="AAR189C"
                     /db_xref="GeneID:4618770"
     mRNA            complement(<682327..>683511)
                     /locus_tag="AGOS_AAR189C"
                     /old_locus_tag="AAR189C"
                     /product="AAR189Cp"
                     /transcript_id="NM_208085.1"
                     /db_xref="GeneID:4618770"
     CDS             complement(682327..683511)
                     /locus_tag="AGOS_AAR189C"
                     /old_locus_tag="AAR189C"
                     /note="NOHBY120; No homolog in Saccharomyces cerevisiae;
                     Homolog of DUF890 family protein in Schizosaccharomyces
                     pombe CAA15827 and Yarrowia lipolytica YALI0D10329g"
                     /codon_start=1
                     /product="AAR189Cp"
                     /protein_id="NP_982732.1"
                     /db_xref="GeneID:4618770"
                     /translation="MRVDYEQLVSQFPRLKQYWDDGRYHIANNESLVLLNQAILKQYF
                     GLEILDKRVKDENLFPRVPGRALYCEYVATSLVWPLLWLSGATSYSCIDVGTGAYAIY
                     AMLLVKMLPHTVQVFATDISTSSLENAAAVVRDNGLESQIRLLRKGREDNMFDVGLAG
                     GAPLLVMCNPPFYATRDEIEARRHSKTLTKALVPLRGTDEELVTEGGEVGFGKRMITD
                     SSLRTSETPAWFTTLVAKYESLAPLVAELIQSRATDYHVVELLCGDTRRWILCWNFNN
                     MKALNLCRQLPAFSKHTTVRKVRVRAELQLGWLGEQIVRECSGRLEYRDVGNGRLFIR
                     APNGAVWTRRYRRNRTAREEPSAFVLVLDTSGMRVHWLEGSDPKTFQSFSCFVERVSA
                     KL"
     gene            <683689..>684729
                     /locus_tag="AGOS_AAR190W"
                     /old_locus_tag="AAR190W"
                     /db_xref="GeneID:4618771"
     mRNA            <683689..>684729
                     /locus_tag="AGOS_AAR190W"
                     /old_locus_tag="AAR190W"
                     /product="AAR190Wp"
                     /transcript_id="NM_208086.1"
                     /db_xref="GeneID:4618771"
     CDS             683689..684729
                     /locus_tag="AGOS_AAR190W"
                     /old_locus_tag="AAR190W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR034C (HMT1)"
                     /codon_start=1
                     /product="AAR190Wp"
                     /protein_id="NP_982733.1"
                     /db_xref="GeneID:4618771"
                     /translation="MANITASATDKSSLNEYEQHYFNSYDHYGIHEEMLQDTVRTLSY
                     RNAIVQNRDLFKGKVVLDVGCGTGILSMFAARNGAKHVIGVDMSSIIEMAKKIVDING
                     LSDKITLLRGKLEDVVLPYEKVDIIISEWMGYFLLYESMMDTVLYARDKYLVEGGLIF
                     PDKCSIHVAGLEDVEYKNEKLNYWQDVYGFDYSPFMPLVMREPLVDTVDNASVNTTRS
                     KLIEFDLNTVTIPDLAFKRKFSITAKRQDFINGLIAWFDIEFPAPEGMRPITFSTGSH
                     APYTHWKQTVFYLSDDLEAENGDVLEGELTCTPNKLNSRDLDIKIAYNFKAQGPDGEE
                     RSRKNENTYLMH"
     gene            complement(<685550..>686722)
                     /locus_tag="AGOS_AAR191C"
                     /old_locus_tag="AAR191C"
                     /db_xref="GeneID:4618681"
     mRNA            complement(<685550..>686722)
                     /locus_tag="AGOS_AAR191C"
                     /old_locus_tag="AAR191C"
                     /product="60S ribosomal protein L4"
                     /transcript_id="NM_208087.1"
                     /db_xref="GeneID:4618681"
     CDS             complement(685550..686722)
                     /locus_tag="AGOS_AAR191C"
                     /old_locus_tag="AAR191C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR031W (RPL4A) and YDR012W (RPL4B)"
                     /codon_start=1
                     /product="60S ribosomal protein L4"
                     /protein_id="NP_982734.1"
                     /db_xref="GeneID:4618681"
                     /translation="MPDRGHRLVDSSISSFGSFLHHHHEQVMSRPQVTVHALTGESSS
                     AALPLPAVFSAPIRPDIVHSVFTSVNKNKRQAYAVSEKAGHQTSAESWGTGRAVARIP
                     RVGGGGTHRSGQAAFGNMCRGGRMFAPTKTWRKWNVKVNHNEKRYATASAIAASAVAS
                     LVLARGHRVEKIPEIPLVVSSDLESIKKTKEAVAALKAVGAHSDVVKVLKSKKLRAGK
                     GKYRNRRFTQRRGPLVVYAEDNGIVNAFRNIPGVETANVASLGLLQLAPGAHLGRFVI
                     WTESAFAKLDQIWGSESVASAKSGYSLPSNIISTSDVTRIINSSEIQSVVRPAGQATQ
                     KRSHVQKKNPLKNKQVLLRLNPYAKVFSAEKLGSKKAEEAKKIQPSQTFLETLKHD"
     gene            complement(<686856..>688358)
                     /locus_tag="AGOS_AAR192C"
                     /old_locus_tag="AAR192C"
                     /db_xref="GeneID:4618682"
     mRNA            complement(<686856..>688358)
                     /locus_tag="AGOS_AAR192C"
                     /old_locus_tag="AAR192C"
                     /product="AAR192Cp"
                     /transcript_id="NM_208088.1"
                     /db_xref="GeneID:4618682"
     CDS             complement(686856..688358)
                     /locus_tag="AGOS_AAR192C"
                     /old_locus_tag="AAR192C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YKL217W (JEN1)"
                     /codon_start=1
                     /product="AAR192Cp"
                     /protein_id="NP_982735.1"
                     /db_xref="GeneID:4618682"
                     /translation="MGKVGYYLKTRVTELFPEKRPSWEEFKYTMNPANVLSNVKLKTW
                     LFIASAFLALTVEATDFFLVSLNVVKIAEDLHVREDKVTWGITVALMTRTIGAIVYGY
                     VGDRFGQRTSFLINIGMISVLQLVTGFATSFPYFLACRAYFGVELGGCFGTATTQCLD
                     DLPKSAHSWVTGGFQQAYAFGFLLATVLTRALADTTAPGWRSCFWFLSGVSFLSFVFR
                     ACLGQTEAFKERQRIKEEGRKRNEKVSTLSQILRSLKKEWYIAIYMVCLMAGYNFFSH
                     ASQDLFPTMLLKQLGYSSNQSTLTNIMANVGALLGGLLLSRFSSVSSRRFIILMCVFS
                     AAILVYPWGFVQGSGMTAYAFLLQFFVQGAWGLVPYHLHSLAPDSQTKAFFVGVAYQM
                     GNLISSPSSTMESSIARKFPIGHDANGKTIYDYGRVMAYFVWGSTALMFIFVFLGPEF
                     NPNRAHEFIDDIESVDEQVHEVVEDKVEASPSIQSQTSSLSVSKRIHHTV"
     gene            complement(<688662..>690179)
                     /locus_tag="AGOS_AAR193C"
                     /old_locus_tag="AAR193C"
                     /db_xref="GeneID:4618683"
     mRNA            complement(<688662..>690179)
                     /locus_tag="AGOS_AAR193C"
                     /old_locus_tag="AAR193C"
                     /product="AAR193Cp"
                     /transcript_id="NM_208089.1"
                     /db_xref="GeneID:4618683"
     CDS             complement(688662..690179)
                     /locus_tag="AGOS_AAR193C"
                     /old_locus_tag="AAR193C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR030W (RKM3)"
                     /codon_start=1
                     /product="AAR193Cp"
                     /protein_id="NP_982736.1"
                     /db_xref="GeneID:4618683"
                     /translation="MSATQQADVDDILSFVQESGGRFLRPQCSIQLSPEGGLGVFAAE
                     DIAANTVLLRVPKSAVFSAPNSSIANLLLEEGLHGMLALVIAFIYETTGFRNASHWCK
                     YLHSIRYTDARGNLVLPPSFWPAKSKHPLRVTALNTLHHALDAEPEVVDGYERAVACA
                     YKWRTEADLPIPPLLRRPETDDQRTRGLRRFVAVTYALASRAFDIDDFHGNGLVPIAD
                     LFNHHVTRPHVRFEAAADVCVICGESGPCGHSHTGLQAESQPLLPNAELCVREPVERP
                     VSLTAKIQEDHAADTSTGTPPEASWLSFPADDCVDIRAVADIRRDTEIYNTYGELSNP
                     LLLARYGFRVLHNPHDVAHFAPEVRRLCNQGGQGLVSRLRWWQQTGYALYCKVTGASD
                     DGDSWQDAVYADSSGEPSPALWALAELLSGAGNGWRMMRRSPVTAASVWSRRNANGGR
                     NRRALTVLRRLAALKRALLLAALPERHSMGTELLEDEISIVNRLLEKLGRSRKAL"
     gene            complement(690282..690354)
                     /locus_tag="AGOS_t0028"
                     /db_xref="GeneID:4618684"
     tRNA            complement(690282..690354)
                     /locus_tag="AGOS_t0028"
                     /product="tRNA-Lys"
                     /codon_recognized="AAG"
                     /db_xref="GeneID:4618684"
     telomere        690400..693413
                     /note="Chromosome I right subtelomeric sequence. Shares
                     some sequence similarity with other subtelomeric regions."
     telomere        692952..693414
                     /note="Chromosome I right end terminal telomere repeat.
                     Composed of approximately 20 copies of a 24 base repeat
                     unit, and occasionally sequence variants of this repeat."
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_type=terminal
                     /rpt_unit_range=693370..693393
                     /rpt_unit_seq="ggtgtggtgtatgggtctctcagc"
CONTIG      join(AE016814.2:1..693414)
//
DBGET integrated database retrieval system