GenomeNet

Database: RefSeq
Entry: NC_005783
LinkDB: NC_005783
Original site: NC_005783 
LOCUS       NC_005783             870771 bp    DNA     linear   CON 14-SEP-2017
DEFINITION  Eremothecium gossypii ATCC 10895 chromosome II, complete sequence.
ACCESSION   NC_005783
VERSION     NC_005783.5
DBLINK      BioProject: PRJNA10623
            BioSample: SAMN03081415
            Assembly: GCF_000091025.4
KEYWORDS    RefSeq.
SOURCE      Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895)
  ORGANISM  Eremothecium gossypii ATCC 10895
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Eremothecium.
REFERENCE   1  (bases 1 to 870771)
  AUTHORS   Dietrich,F.S., Voegeli,S., Brachat,S., Lerch,A., Gates,K.,
            Steiner,S., Mohr,C., Pohlmann,R., Luedi,P., Choi,S., Wing,R.A.,
            Flavier,A., Gaffney,T.D. and Philippsen,P.
  TITLE     The Ashbya gossypii genome as a tool for mapping the ancient
            Saccharomyces cerevisiae genome
  JOURNAL   Science 304 (5668), 304-307 (2004)
   PUBMED   15001715
REFERENCE   2  (bases 1 to 870771)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 870771)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 870771)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 870771)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2007) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   6  (bases 1 to 870771)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2002) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE016815.
            On Aug 5, 2010 this sequence version replaced NC_005783.4.
            This genome has been completely resequenced to high accuracy (derf)
            and reannotated. Gene names have been maintained, though some genes
            have been added, and many protein sequences have been corrected.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..870771
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /culture_collection="ATCC:10895"
                     /db_xref="taxon:284811"
                     /chromosome="II"
     source          15710..56098
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1580"
     source          24997..85798
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2522"
     source          74742..122144
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1411"
     source          116841..173436
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2125"
     source          164242..237253
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1528"
     source          210905..279269
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1783"
     source          258681..300445
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2001"
     source          274447..349321
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1331"
     source          320307..395009
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2210"
     source          349316..405734
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2158"
     source          395006..447841
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1059"
     source          408971..458407
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1550"
     source          447841..506946
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1244"
     source          459941..538436
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1077"
     source          466277..554563
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2084"
     source          542863..606987
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2327"
     source          599244..672036
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1123"
     source          666667..726304
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1370"
     source          677885..751494
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1053"
     source          739972..805945
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2131"
     source          751489..825651
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1222"
     source          805972..863518
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2245"
     telomere        complement(1..496)
                     /note="chromosome II left end terminal telomere repeat;
                     composed of approximately 20 copies of a 24 base repeat
                     unit, and occasional sequence varients of this repeat"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_type=terminal
                     /rpt_unit_range=5..28
                     /rpt_unit_seq="ggtgtggtgtatgggtctctcagc"
     telomere        complement(497..1950)
                     /note="Chromosome II left subtelomeric sequence. Shares
                     some sequence similarity with other subtelomeric regions."
     gene            <2047..>2991
                     /locus_tag="AGOS_ABL211W"
                     /db_xref="GeneID:9487547"
     mRNA            <2047..>2991
                     /locus_tag="AGOS_ABL211W"
                     /product="ABL211Wp"
                     /transcript_id="NM_001355300.1"
                     /db_xref="GeneID:9487547"
     CDS             2047..2991
                     /locus_tag="AGOS_ABL211W"
                     /note="NOHBY219; No homolog in Saccharomyces cerevisiae;
                     Similar to Ashbya gossypii ADL400W, AGL368W, AGL369W"
                     /codon_start=1
                     /product="ABL211Wp"
                     /protein_id="NP_001342242.1"
                     /db_xref="GeneID:9487547"
                     /translation="MLRDIESTPLIEEHEHLEQLYLFYRYQYRLAICWLFCCVSHLSF
                     CSCILTRTWQLPQDEHVKKFISMLEYYDFYSSTACVAISIPMVPYLIMKRWEFTILPF
                     FLIPLIVYASMLWWVGDCLLNLFPLVKSWSLDDIATYCIWEGCILCAVVVLVPPAASL
                     ILFRKAAPTGERAPELYLGAHLDAPGNDAELNDDSLSMKSARTLPKLKLVKMFLAGLV
                     FPYLLIQVFFVIRAYSGSILRDISGKSELYAHALLVLLYAKVVRLLSMLFCICYSLIS
                     SKTTETVSVYWPLVFLYQSGLVMDSFYGYIVSTVDLVG"
     gene            complement(<7069..>8505)
                     /locus_tag="AGOS_ABL210C"
                     /old_locus_tag="ABL210C"
                     /db_xref="GeneID:4619312"
     mRNA            complement(<7069..>8505)
                     /locus_tag="AGOS_ABL210C"
                     /old_locus_tag="ABL210C"
                     /product="ABL210Cp"
                     /transcript_id="NM_208090.1"
                     /db_xref="GeneID:4619312"
     CDS             complement(7069..8505)
                     /locus_tag="AGOS_ABL210C"
                     /old_locus_tag="ABL210C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YKL217W (JEN1)"
                     /codon_start=1
                     /product="ABL210Cp"
                     /protein_id="NP_982737.1"
                     /db_xref="GeneID:4619312"
                     /translation="MGRIRRYLITRVTELLPGKKLSRERFRHEMDPRRTLSTVKPKTW
                     LFVASAFFALLVEATDFFIVSLNVVKIAEDLNVNDEKVTWGMTIALMTRTIGAVLYGY
                     IGDQFGQKASFMINIGMISILQLLTGFATTFPYFIACRAYFGVELGGCFGTATTQCLD
                     DLPENARSWVSGGFQQAYSLGFLVATILTRVLADTTEKRWRTCFWFLSGLSFLSLLFR
                     ASLGETDAFLARKLMQQEGELHKRHVSTYSQIWNSLWNERYIVIYMILLMTGYNYFSH
                     ASQDLFPTMLIKQLGYSPNQSAVTNCAANVGAIIGGLFISRFSSISSRRVVILVCILL
                     AACLVYPWGFVHDRSIIVSVFFLQFFVQGAWGLVPHHLHCLAPNSDTKTFFVGVAYQL
                     GNLASSPSSLLESSLARNFPLDNGNKELYDYGRVMAYFVWGSIALMFLVVTLGPEFNP
                     NREYEFMEWSEEVSTDESMLPPTKQEIV"
     gene            complement(<11466..>12341)
                     /locus_tag="AGOS_ABL209C"
                     /old_locus_tag="ABL209C"
                     /db_xref="GeneID:4618817"
     mRNA            complement(<11466..>12341)
                     /locus_tag="AGOS_ABL209C"
                     /old_locus_tag="ABL209C"
                     /product="ABL209Cp"
                     /transcript_id="NM_208091.2"
                     /db_xref="GeneID:4618817"
     CDS             complement(11466..12341)
                     /locus_tag="AGOS_ABL209C"
                     /old_locus_tag="ABL209C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR096W"
                     /codon_start=1
                     /product="ABL209Cp"
                     /protein_id="NP_982738.2"
                     /db_xref="GeneID:4618817"
                     /translation="MVRVMQKEDCHFRRLSDGTQIPSVGLGVYQVSEQTVQDLVYEAL
                     EVGYRLFDSAQAYHNEDGVARGIAAWLKHAPGRRREDVYFTTKINTQNHGYEATKKSL
                     EKSLHAAGPLGYIDLVLVHAPMSDRTRRLGTWQALEEAVVEGQVRSIGVSNYGQQHLS
                     ELLGWEGLKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPLMRGKRLDDPILQK
                     VAHQYDKGVAQILVRWSIQMGFIVLPKTAKKERLAPNFDIWDFELSAETMSELTHPDD
                     YFVTVPRWDPTTYEG"
     gene            <12701..>17320
                     /locus_tag="AGOS_ABL208W"
                     /old_locus_tag="ABL208W"
                     /db_xref="GeneID:4618818"
     mRNA            <12701..>17320
                     /locus_tag="AGOS_ABL208W"
                     /old_locus_tag="ABL208W"
                     /product="ABL208Wp"
                     /transcript_id="NM_208092.2"
                     /db_xref="GeneID:4618818"
     CDS             12701..17320
                     /locus_tag="AGOS_ABL208W"
                     /old_locus_tag="ABL208W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL242W (ATG2)"
                     /codon_start=1
                     /product="ABL208Wp"
                     /protein_id="NP_982739.2"
                     /db_xref="GeneID:4618818"
                     /translation="MHFVLHCDTTAERTMSSWLPQNVQKRLLIYLLQQISIFSQIDTT
                     NLDVSLGCRSQFAFHDVELNVDHMRVPHITVESGHISELELGLVVSGGLDITGDGLCF
                     VVRPELSEVAGSHDLAQSLARSIMDLTNSMMQPLPEVLEGDEVLANSCSEAGDAQQPA
                     SSSALDKMRNKVLERALSNLTVRIINVRIQVLFPGQQSITVLVGSVELSTVDKTRRVD
                     LQDICISHSELVPSPEQPDEFMSTSASNSIYMSAIDSLPFGSRSKMEENARNVRALLQ
                     MDKLHVTFQGISSVEDISIRDLMLHMGRVDVFLDAIIAVDIGVFEVLVQFVAEFQQDT
                     EVSETSNTLQNYKRFRQEQNLEEDLQITGFTIEELRITLSQSVKVSVIDIQLRNRYIE
                     NSTVTVGRVTICDYDLDLLHIDAGSKPCLELTVDSRKLQRIISVDGDIHMDISSTFVS
                     SLIPLIFRLQELGRGLHFVGTNNCKMSQEFKTQVETKTIILSLPVGDDTLQMIIQPIS
                     YELSLHTVFTDFISISKVQSSETRDIAIIREIKIGYQTANFQVKSYNLKLSETLLTSK
                     LRGSVSSVELYCSDSDIKWLFDGLSPYQDMITPYMHSKPEVRKPIMNKSVRILSASSV
                     IHRQNVFSDMVLLIERITCSLSADSISSFGNVKTELNSSLLSLNTDNSIIFHSSCVKG
                     STVFSDVKYCLFEPIKTKDVTKPALFVQRFENGKLKVNVQNTCIYYHAKWLDILDESK
                     GTKSTPQQESAVPVPLQQRIEVKFHDCALSMHPYRLKSALLICVNRCILDISVPPANF
                     KCIIRSPTFMLADDCSNMKTSITESWESLVRYYSKAGFAVIGKSGLLSCTIKQSGGQI
                     CLDIDVDRIDLSICADSFQCLIQTLIDIKPPVSFPDEKKYRTEPCSIPVFENVDDEFF
                     VPKGTSNLPALNDMHIVDDFINNSNNSFSEVQVIEETEEGSPLKLEDNGLLFDEGHFN
                     KEDIPVATDSKFFPFGPVAIVLHLFVRKASIKLHDGYDWVYTRRSISKVVDDLEDEVH
                     KQDQPGRVETSLFDSIYLYATPDSNIKKAVSSNIQSEDIIAENYSSKMKLRPSKHHKI
                     LIELTNMKLTFSGYSYDEPTEDIADWSTDLLNSIDVEVKTFEIVDNVATSTWNKFLTE
                     LKEAHGGSPSMLALSISLVRPIDFLYATELIISAQVSPLRLHVDQDTLDFLIRFSEFK
                     DARFDLIDDYPDIVYIQRFEVNSIDVKLDYKPKKVDYVGLKSGHTSELMNFFTLDGAK
                     MTLKRVVLYGVDGLGELHNCLSSIWTPDITRSQLSGVLKGVTPLKSIITLGSGVKALV
                     TVPLKEYRQDQRLTRSLQKGARDFLKTTSGELIRLGVRMASGTQAILENTEEFFGGQG
                     ARARCMSARLPEDELSPVPSACDEFDLFRSSIPRKQSPIVPIPSEEDDIEPLKAISLY
                     ADQPQNAQKGVKEAYGSLGKNLTIAYGAVRRAQRDARHSISAQDAATAFARATPIAFI
                     RPMIGATEAVSKTLQGISNQMDRDQLVHMRDKYKQSSHYQRKRER"
     gene            <17676..>20792
                     /locus_tag="AGOS_ABL207W"
                     /old_locus_tag="ABL207W"
                     /db_xref="GeneID:4618819"
     mRNA            <17676..>20792
                     /locus_tag="AGOS_ABL207W"
                     /old_locus_tag="ABL207W"
                     /product="ABL207Wp"
                     /transcript_id="NM_208093.2"
                     /db_xref="GeneID:4618819"
     CDS             17676..20792
                     /locus_tag="AGOS_ABL207W"
                     /old_locus_tag="ABL207W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL240W (LRG1)"
                     /codon_start=1
                     /product="ABL207Wp"
                     /protein_id="NP_982740.2"
                     /db_xref="GeneID:4618819"
                     /translation="MTNIQKPQLLLTYSDHINHRHSASEQVMRTSAEHKPATSSQKTA
                     KICKQCKGVITQNSLKALGDYYHENCLVCHDCGALCRPKFFPYELPDTSEVVLLCQQD
                     YFTRNKLLCYVCNKPLSGVYYNTFGKLYDEEHFCCTVCGTKCKVSSCFHYNDELYCKY
                     HFLKYFSKRCKGCNYPISDQYIEFPRGEEIHCWHPECYGIHKYWHVNLSPEFVGIPEL
                     PLPEEGAGPSTEDTNPTVNEMEKYTESLSGLISKTWNVLYRFEEETASCISDMFQYLT
                     SYDQFKGIDSAALFVLKLECLFKALDSLESVGKYSFVDSKKHEPKNTVLCAPESDANE
                     NMSSKYSKFPRNLSTKIMIYLQLLRKMGSALKEKEVSVGSFMSVITSLAHFLKLLVRY
                     GLYNALEHSKAVHTSNALVKFLREIKKNETYQRDPFNYINVTIHATDCCAACEKYIQE
                     ECVQYQDNRWHLGCFQCSKCKKGIELRDIGDAACNKMLKHIYCAQCSVTDPDSKPGFK
                     PITKLSQLIFLLKIALVRSRVVMALQMKNQEVMQRSNSVKETISMQQTYIRTLNDIKR
                     LKSGRQSVRITNDQQDARKSRILKTAEIDVRNGSRTDMDKELVIETENSKSGHGSDSK
                     VFNGQKSLTLDDISRIVAAEQARELRPNAFTHFTRIKESDDETNTFVAKKSGTYYSEL
                     SIEQFYRLQLVALALLANGTVGLAVSDECIHKLLPQTPKSLNPSGGFWNKLFKTGKEN
                     KVMKYKKVFGTPLEVLSERWGVDSDLSSGPAKLRIPILVDELVSSLHQMDMSVEGIFR
                     KNGNIRRLKDLTAAINENPSEVPDLSKENAIQLSALLKKFLRELPIPLLTFTMYDLWI
                     QAAKLESKFDGQRVFPLLYTLLPSAHRNVAEVLFSFLHWTSSFSHVDHQIGSKMDIHN
                     LSTVIAPNILYQEAPNNGSYGGSADVIHNTYQDAFAQNEGENYFLAIETVDYLINNNE
                     QLSMVPMFLSTLLKEVEDLNLTTYGAVKKHIDMLIEEGKIHVKDFVQKDSIQVKETAS
                     VTKVEIHK"
     gene            complement(<21006..>22544)
                     /locus_tag="AGOS_ABL206C"
                     /old_locus_tag="ABL206C"
                     /db_xref="GeneID:4618820"
     mRNA            complement(<21006..>22544)
                     /locus_tag="AGOS_ABL206C"
                     /old_locus_tag="ABL206C"
                     /product="ABL206Cp"
                     /transcript_id="NM_208094.1"
                     /db_xref="GeneID:4618820"
     CDS             complement(21006..22544)
                     /locus_tag="AGOS_ABL206C"
                     /old_locus_tag="ABL206C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL241C (ZWF1)"
                     /codon_start=1
                     /product="ABL206Cp"
                     /protein_id="NP_982741.1"
                     /db_xref="GeneID:4618820"
                     /translation="MMCGEVTRTDAFEKDVIITVFGASGDLAKKKTFPALYGLYREGY
                     LDDSTKIIGYARSELSDAELRERVKPYLSKPDDAASEAKQAEFLERMSYVAGPYDKEE
                     GYVQLREQIEAYERERGVEKPHRLFYLALPPSAFVSVAEKIKQFLYAEGGVTRLIVEK
                     PFGHDLESSRKLQKQLEPLFREEEIFRIDHYLGKEMVKNLLPLRFGNAFFNASWNKEN
                     IQMIQISLKEPFGTEGRGGYFDSTGIIRDVMQNHLLQVLTLLTMERPVSFDPESIRDE
                     KVKVLKAIVPLDHEDILIGQYGRSEDGTKPAYLDDETVSKDSKCVTFAALTFNIQNER
                     WDGVPIVMRAGKALNEGKVEIRILYKRVARGIFNDIPNNELVVRVQPDEAIYLKFNAK
                     TPGLDSNSQITELDLTYSKRYRDYWIPEAYESLLRDALLGDHSNFVRDDELDISWKLF
                     TPLLNYLEGPDSPRPEIYKYGSRGPDGLTKYLEKHQYVFEKSGLYQWPVSSPKEKASL
                     EPRL"
     gene            complement(<22831..>24186)
                     /locus_tag="AGOS_ABL205C"
                     /old_locus_tag="ABL205C"
                     /db_xref="GeneID:4618821"
     mRNA            complement(<22831..>24186)
                     /locus_tag="AGOS_ABL205C"
                     /old_locus_tag="ABL205C"
                     /product="ABL205Cp"
                     /transcript_id="NM_208095.1"
                     /db_xref="GeneID:4618821"
     CDS             complement(22831..24186)
                     /locus_tag="AGOS_ABL205C"
                     /old_locus_tag="ABL205C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL240C (NAR1)"
                     /codon_start=1
                     /product="ABL205Cp"
                     /protein_id="NP_982742.1"
                     /db_xref="GeneID:4618821"
                     /translation="MSAKLSESDLNDFIGAQVACVKPTRTLHTADEGDEALEVGKEPQ
                     EATKVSISLQDCLACAGCITSSEEILLSRQSHGVFLEAWRSLAPKALAVSVAPQSRLS
                     LAQHFGLSVAELDQCLSGVLGSYFGAKYVVGTQLGRELSVQQTNARLVERKQQGVQGP
                     LLCSVCPGFVLYAEKTKPGLVPYMLDVKSPQQITGALLHAADPNIYHLSLMPCFDKKL
                     EAAREDCAREVDCVLTPREFVALLDELQLDLHSFAGAAVPIAQLTPPGWDPRVSWCSS
                     AGSSSGGYAYQYILHMQRLHPGSTIATQAGRNADLLEHRLLAPSGVLLASAGELYGFR
                     NIQNLVRKLLSPATKRSAKVVRRRLPQASPAPPATDPCNADFIEVMACPSGCINGGGL
                     LNGGLGPSQRRDLVSQLNEGYARLPTLDIPMPTYSQPSYIYNLRPLAPTDDVLTVANA
                     W"
     gene            <24590..>26029
                     /locus_tag="AGOS_ABL204W"
                     /old_locus_tag="ABL204W"
                     /db_xref="GeneID:4618822"
     mRNA            <24590..>26029
                     /locus_tag="AGOS_ABL204W"
                     /old_locus_tag="ABL204W"
                     /product="ABL204Wp"
                     /transcript_id="NM_208096.1"
                     /db_xref="GeneID:4618822"
     CDS             24590..26029
                     /locus_tag="AGOS_ABL204W"
                     /old_locus_tag="ABL204W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL239W (LAP3)"
                     /codon_start=1
                     /product="ABL204Wp"
                     /protein_id="NP_982743.1"
                     /db_xref="GeneID:4618822"
                     /translation="MVASVSRRGQTFARALRRGLTTSVRQPNRYRAMSIEITDLARWD
                     QELKADINHGLASTVLKNYNADEVLLDKTQLLKHYPRVFNVGLSEEVGPVTNQRSSGR
                     CWLFAATNELRLNVAQKLNLKEFELSQAYLFFYDKLEKANYFLDQIVDTANEEVESRL
                     VQYLLTSPVQDGGQYSMFVNLVRKYGVLPKDLYADLAFSTTNSAKWNSLLTTKLREFG
                     QELREAAARGEDVSGRRTSMQKELVRLMSLFMDLPPYRPDEEFTWEYTDKDGKTQSLF
                     TTPLQFAREHAGLDIAKPVSLINDPRHPYGSLIKIDRLGNVLGGDEVRYLNVDNDTLS
                     ALVVKRLRNKRPVFFGSHTPKFMSKQHGVLDTRLWNYRGIGYEFTQDKASRIRYGESL
                     MTHAMLITGVHVDSADKPIRYKVENSWGKDIGKDGYFVMTQEYFEEYSFQIVVDIDEL
                     PEELAAKFQTKEEKPIVLPIWDPMGALAQ"
     gene            <26254..>28563
                     /locus_tag="AGOS_ABL203W"
                     /old_locus_tag="ABL203W"
                     /db_xref="GeneID:4618823"
     mRNA            <26254..>28563
                     /locus_tag="AGOS_ABL203W"
                     /old_locus_tag="ABL203W"
                     /product="ABL203Wp"
                     /transcript_id="NM_208097.2"
                     /db_xref="GeneID:4618823"
     CDS             26254..28563
                     /locus_tag="AGOS_ABL203W"
                     /old_locus_tag="ABL203W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL238W (KEX2)"
                     /codon_start=1
                     /product="ABL203Wp"
                     /protein_id="NP_982744.2"
                     /db_xref="GeneID:4618823"
                     /translation="MRFATVAGLLPLLQYVTGQVVPAKDHINREYFAVEADGSLEELL
                     EAHPGWQFEHAVRGLERHYVLSRVRSELQPRAQVQHKAGGARAWHELVPHRLAKRMPI
                     RDAELGDQLSQRAVLKKELNIKDPLFDEQWHLLNTRYPKNDMNVTGLWQKNITGHGIV
                     VAVVDDGLDYESEDLKDNFCAEGSWDFNSNTALPKPMLSDDTHGTRCAGEIAAAKNQF
                     CGLGVAFNSKVSGIRILSEDITPEDEAASLVYGLDINDIYSCSWGPTDNGEELQAPSD
                     LVKKAIIRGVTEGRDRKGALYVFASGNGGALGDNCNYDGYTNSIYSITVSALDHRGLH
                     PTYAESCSAVLVVAHSSGSGNFIRTTDVNGQCFDHHGGTSAAAPLAAGVYALLLQVNP
                     NLTWRDVQYLTILTSIEVNPDDSDWQEGSLGRRYSHKYGYGKLDAYNIVELAKSWKNV
                     NPQAWYYHPTIIANQTIATPDVYIDSTTSVSRDALDKANLKRVEHVTVTVDIEASIRG
                     FTTVDLIAPNNHISHLGVVRKKDKSHAGFRNWTFMSVAHWGYAGEGDWKLQVRTTSKK
                     NTVHLKGWRLKLFGESIDASKAVAAEFGNDQEDLQDTPTGTSDEPVSSTSTPNSTSTS
                     QDELNTGASKIVPTHHAKNYYLMIFVVGAVILVLYLFFFSKTRRIRRSRAEAFEFDII
                     DTDSEYDSTVDNHDPTARMLSDNDLNDFDFDLSDLEAPESPSDTGSATAAPHSKNDRS
                     LSTIAENPFEAGDEGIPQSEQGANHKYTK"
     gene            <28895..>31711
                     /locus_tag="AGOS_ABL202W"
                     /old_locus_tag="ABL202W"
                     /db_xref="GeneID:4618824"
     mRNA            <28895..>31711
                     /locus_tag="AGOS_ABL202W"
                     /old_locus_tag="ABL202W"
                     /product="ABL202Wp"
                     /transcript_id="NM_208098.2"
                     /db_xref="GeneID:4618824"
     CDS             28895..31711
                     /locus_tag="AGOS_ABL202W"
                     /old_locus_tag="ABL202W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL236W (SIN4)"
                     /codon_start=1
                     /product="ABL202Wp"
                     /protein_id="NP_982745.2"
                     /db_xref="GeneID:4618824"
                     /translation="MHLEHLMSSTTAVSWSKIGLIAYGDAQSQDGNLCITFLETVNGS
                     NWRFHPPKKYVIHPQLHEDQSSNGNPKSPLFFHDLRSMHWNNWGLLNGELLAVCDELG
                     NMTVLAAGQGLNGNGAYDRLSVLFQDNIFKIHNQVLPLESVPKKDATPKVERKHTKKE
                     YYSTILDFQWIGNQKPSVAQVAAQRDRTNNIFKNQMHQCPPYGVFHPASIKSACIAIR
                     RNGYIDLWYQFSNTLDFKKISLQLSKDKESEWLQYAQIAHTDKEQCFLIGVFSNVAKS
                     FAFYELLINWNVNTTNQAMFHDPKLTLRHILRVRPDALGPNGELLKLENFHVISKTAL
                     PGTRPEILISYNILGTERSLVRRFQMVLSNPDMVFLSSLGLAITALHNNHSVLRYSMK
                     HVQDLTFDSKIMDIQSHSLDALVCFRLHNGRFQLYNRHTWAVESETADAKQIGGYTKD
                     TIISIFGSGFNYPLLPPADAIEWCAISPSSGGIILKLKCKPQPTFYALEQSVLTDPSR
                     DIVHATAFAFEFVRFNNMIHSGEDLAIAAKTHVFRLQRLSEERAVNFIASVIGAILSL
                     YGIHFDGPKEILEKLLQSKAIQKIFLLQMELGSHLKNKNVYSMAYASMKLRSINLAMN
                     GVARNVHAMIQHTAVVNSLPNGRAFQFAFSKQDLIYSLIPSVNWFVSFVTFLTQQLIM
                     LVNNPMDNTHSLVLGILSCITTRHLMLKVILELKNMIGLITKFPETTYTVLNESSRFL
                     RKALGDSPVNLEKFEVFLNEINNKFLSLLDDHGAQSMDREPSFMVKAEIPPALGHVRE
                     FLLSFAGSALLAQTNLAEVFFASTHNLRIFDHQHFHPSVANLLQPPEKGLVVDDAILP
                     DACRGSSSFSPLDYDDISSEWVDMSALVRIKRCVRCGCVTRAGNPVAKNNTILETSIV
                     TKRWTALYSRYCQCTGLLYELDTP"
     gene            <32112..>33422
                     /locus_tag="AGOS_ABL201W"
                     /old_locus_tag="ABL201W"
                     /db_xref="GeneID:4618825"
     mRNA            <32112..>33422
                     /locus_tag="AGOS_ABL201W"
                     /old_locus_tag="ABL201W"
                     /product="ABL201Wp"
                     /transcript_id="NM_208099.1"
                     /db_xref="GeneID:4618825"
     CDS             32112..33422
                     /locus_tag="AGOS_ABL201W"
                     /old_locus_tag="ABL201W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL234W"
                     /codon_start=1
                     /product="ABL201Wp"
                     /protein_id="NP_982746.1"
                     /db_xref="GeneID:4618825"
                     /translation="MSSETRNTLYNPLDRSQISFIPAELSSINDSLGDSAYDTSSAEK
                     DYFDSMSLKRTVTNNTSSVKTFPGSSQEESDRLTKLSTRDSLGSDIIDRIRYKIVLNL
                     SPREIQLIRNSWTMMLTDDISTERTTALFRKLDKLPTVQQPQPPATSQPGGVAAAAGV
                     PSAQRRPASTTASSVAPSLSSGAASMVSQPATPAPALDNVNTNTIASSLFCAQFYANL
                     LDMDANLEKLYPSIKHQAVAYAGVLTTAISHLENLSLMDGYLSDLGKRHNRILGIEPP
                     HFELMGIAFLKTIQDRFGIYCTIELTETWSRLYSYLANSILQFGIDPVLELNHMEEEI
                     IFPIPNLIEQTPTTKAPLTPAEIPQAETPAHNPPALSIPAQKATAPSLVPPHHPAISP
                     SVSPASSSPKSLPSKQVDSPSANKRVNFYKMKRKDGGDKDCILM"
     STS             32546..32576
                     /locus_tag="AGOS_ABL201W"
                     /old_locus_tag="ABL201W"
                     /standard_name="D10Bir17"
                     /db_xref="UniSTS:141482"
     gene            <33855..>36224
                     /locus_tag="AGOS_ABL200W"
                     /old_locus_tag="ABL200W"
                     /db_xref="GeneID:4618826"
     mRNA            <33855..>36224
                     /locus_tag="AGOS_ABL200W"
                     /old_locus_tag="ABL200W"
                     /product="ABL200Wp"
                     /transcript_id="NM_208100.1"
                     /db_xref="GeneID:4618826"
     CDS             33855..36224
                     /locus_tag="AGOS_ABL200W"
                     /old_locus_tag="ABL200W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL233W (BNI4)"
                     /codon_start=1
                     /product="ABL200Wp"
                     /protein_id="NP_982747.1"
                     /db_xref="GeneID:4618826"
                     /translation="MGDFYSSESNDNVRHARSLRNSVLLEGDVGERGAGSHGTGTETF
                     YESTWESSLHDVGFSDDECEDGEETATQAFMTASPSLSALAGILSEKSKQAEEKMRSR
                     SSTLLGTTIEEDGEDDGLPGAPRVERSSVESALRSRQPLGGHALHSQTHLRHNSVLEA
                     DDNGSIASSFQAGSMLSRTINRVRSRSVTSTITDQANSSGSGAVSMLKKRFPSMSQPK
                     GDATPEKTQRKRRSVFSFLRRKSSAASLAESNASGEPPGIPTSSTFSVTKSASKESLT
                     SATKLTKKSYSSSSLFSTFKRNKDNNRSTENISRELRESLNTKKRTVTRPILEDNDDV
                     AVRIDISDPNALFQQTPSKYNKESRTSISYSTAQTTPKQELPMTPKPALGFPRAESPS
                     STLLENMHKVDSGEAVFPKSLNPLEVESIVSMERSRSHKSNRNSMASYRRSLTDNISI
                     KAQNEGMFVTEASEVILSTPDLTKSPTNSILRNGTFESLDGIPKSSDISLDDYTYSLT
                     IPHKDGEEGMNFSFSSIQEKLNELTMDTDEEEEEIKEVKVTPVQTPILPPNTDPDFMS
                     DIAEFANIIDFGDEVDFDLELGTGDLKYKTLNPKDILQSDTLRADIRITSSSEYLREA
                     HEPLGDEPRRVTIGCDLTHDLSLKTMDYYDEDIDNEHFALDGEEMHPETVDPYLPAQS
                     LAVNRPLSMSFRGLTGPQFNRTHDLPRLNSEIGLNSYTMGDNDRSVHFSTRILLHDTY
                     TEDEYDRRPDIATCNQLTPQLAQLIKEELNQVKSEMEIHEDSRCYTHFY"
     gene            <36555..>37421
                     /locus_tag="AGOS_ABL199W"
                     /old_locus_tag="ABL199W"
                     /db_xref="GeneID:4618827"
     mRNA            <36555..>37421
                     /locus_tag="AGOS_ABL199W"
                     /old_locus_tag="ABL199W"
                     /product="ABL199Wp"
                     /transcript_id="NM_208101.1"
                     /db_xref="GeneID:4618827"
     CDS             36555..37421
                     /locus_tag="AGOS_ABL199W"
                     /old_locus_tag="ABL199W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL232W (CSL4)"
                     /codon_start=1
                     /product="ABL199Wp"
                     /protein_id="NP_982748.1"
                     /db_xref="GeneID:4618827"
                     /translation="MDFKSKLPKDVYPGHLICPIYHGVEENGTEFVYQFIPGPGTVQQ
                     QYTINGQQIDAIAATLLGKVKLREETNALDGSESAKPDAEADPKAENTTEASQGRRVV
                     KKMLVSVSKRASEEDLGSSVDTDFANHLPKEGDVVLTRVTRITLQRANVEILAVENTN
                     SPIDYGVGSKGSGIVASNGGNTGFSMSQVPSDLGETFRGIIRSQDVRATNRDQVKMVE
                     AFRPGDIVRAQVLSLGDGSNYYLTTARNDLGVVFAKASNGAGGLMYAVDWHTMVAPST
                     GVTELRKCAKPF"
     gene            complement(<37527..>38552)
                     /locus_tag="AGOS_ABL198C"
                     /old_locus_tag="ABL198C"
                     /db_xref="GeneID:4618828"
     mRNA            complement(<37527..>38552)
                     /locus_tag="AGOS_ABL198C"
                     /old_locus_tag="ABL198C"
                     /product="ABL198Cp"
                     /transcript_id="NM_208102.1"
                     /db_xref="GeneID:4618828"
     CDS             complement(37527..38552)
                     /locus_tag="AGOS_ABL198C"
                     /old_locus_tag="ABL198C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL231C (PDR16)"
                     /codon_start=1
                     /product="ABL198Cp"
                     /protein_id="NP_982749.1"
                     /db_xref="GeneID:4618828"
                     /translation="MVLFKRTKTVSDGDWDVKNLIAVRKPIIEPAPGCVPRAEEPLTA
                     EEEQKYKEVLQHFQLPELQLPTTEKHATEARVLSMEEKAWLTRECMIRYLRASKWVVR
                     DAINRITMSIGWRREFGISCFGEENGDSLLAATVSDENETGKEVVLGYDREARPILYL
                     KPGRQNTKTSHRQVQHLVFMLERVIDMMPSGQHQLALLIDFSDHEDVPKVSGNSKTPP
                     ISVGKEVLHILQTHYPERLGKALLTNIPWLAWTFLKMIHPFIDPLTREKLVFDQPFVN
                     FVPEEQLDKLYGGLLDFTYVHEQYWPSLLQRTRENRAHYMARFRELGGHIGLSEYALR
                     AHGDKST"
     gene            complement(<38926..>39924)
                     /locus_tag="AGOS_ABL197C"
                     /old_locus_tag="ABL197C"
                     /db_xref="GeneID:4618829"
     mRNA            complement(<38926..>39924)
                     /locus_tag="AGOS_ABL197C"
                     /old_locus_tag="ABL197C"
                     /product="ABL197Cp"
                     /transcript_id="NM_208103.1"
                     /db_xref="GeneID:4618829"
     CDS             complement(38926..39924)
                     /locus_tag="AGOS_ABL197C"
                     /old_locus_tag="ABL197C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL230C (ELA1)"
                     /codon_start=1
                     /product="ABL197Cp"
                     /protein_id="NP_982750.1"
                     /db_xref="GeneID:4618829"
                     /translation="METGHPPSLQELCVVVLMRHHAQLEDIGHMPYALVRRVLLKMSA
                     EQLLRLERASPALLLEDEEAWQQLLKKDFPTNVHEVWVARKKDVYEYYLESVRELGPQ
                     VLEDRALVRSLLRAAVCKDPVLFKYRVPSRQLYQRYVHEDARRQELSAARLRQSTLQL
                     QQEKQKTRITQLEDPLYLERELNAGRQRAAPQRSSIYLKSFKELRQRQAHFRSGGYDP
                     TQRRIVRVQTPSAQPAASLHPPPQSAPMAGSPQKPAPPEQPLAASPTPEAPGPLAQRR
                     RPSARRQPPPASPAKRRSALFSSPALSTLLPQQDDTDSDTGGRPPKKPRVYIHTPR"
     gene            complement(<40216..>40317)
                     /locus_tag="AGOS_ABL196C"
                     /old_locus_tag="ABL196C"
                     /db_xref="GeneID:4618830"
     mRNA            complement(<40216..>40317)
                     /locus_tag="AGOS_ABL196C"
                     /old_locus_tag="ABL196C"
                     /product="ABL196Cp"
                     /transcript_id="NM_208104.1"
                     /db_xref="GeneID:4618830"
     CDS             complement(40216..40317)
                     /locus_tag="AGOS_ABL196C"
                     /old_locus_tag="ABL196C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YNL145W (MFA2)"
                     /codon_start=1
                     /product="ABL196Cp"
                     /protein_id="NP_982751.1"
                     /db_xref="GeneID:4618830"
                     /translation="MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV"
     gene            complement(<40853..>41917)
                     /locus_tag="AGOS_ABL195C"
                     /old_locus_tag="ABL195C"
                     /db_xref="GeneID:4618831"
     mRNA            complement(<40853..>41917)
                     /locus_tag="AGOS_ABL195C"
                     /old_locus_tag="ABL195C"
                     /product="ABL195Cp"
                     /transcript_id="NM_208105.1"
                     /db_xref="GeneID:4618831"
     CDS             complement(40853..41917)
                     /locus_tag="AGOS_ABL195C"
                     /old_locus_tag="ABL195C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL229C (URE2)"
                     /codon_start=1
                     /product="ABL195Cp"
                     /protein_id="NP_982752.1"
                     /db_xref="GeneID:4618831"
                     /translation="MQQEIRNSNTPNTGSGNPVSNLSSALRQVHLGNSNTTTDQSNIS
                     IDYTSRAPQQQPLDELSRGAAGGPAAGGGPEGSNMVGASSAAQVTAFGGPSVVDSSRI
                     TKFFQNQPMEGYTLFSHRSAPNGFKVAIVLSEMGLNYNTIFLDFNLGEHRAPEFVAIN
                     PNARVPALIDHSLDNLSLWESGAIILHLANKYYRETGTPLLWSDNLAEQAQINSWLFF
                     QTSGHAPMIGQALHFRYFHSQKVPSAVERYTDEVRRVYGVVEMALAERREALIMDLDS
                     ENAAAYSAGTTPLTQSRFFDYPVWLVGDHITIADLSFVPWNNVVDRIGINIKVEFPEV
                     YKWTKHMMRRPAVIKALRGE"
     gene            complement(<42211..>43869)
                     /locus_tag="AGOS_ABL194C"
                     /old_locus_tag="ABL194C"
                     /db_xref="GeneID:4618832"
     mRNA            complement(<42211..>43869)
                     /locus_tag="AGOS_ABL194C"
                     /old_locus_tag="ABL194C"
                     /product="ABL194Cp"
                     /transcript_id="NM_208106.1"
                     /db_xref="GeneID:4618832"
     CDS             complement(42211..43869)
                     /locus_tag="AGOS_ABL194C"
                     /old_locus_tag="ABL194C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL227C (JJJ1)"
                     /codon_start=1
                     /product="ABL194Cp"
                     /protein_id="NP_982753.1"
                     /db_xref="GeneID:4618832"
                     /translation="MKTCYYELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNVQQAT
                     EIFASIRAAYEVLSDAQERAWYDAHREQILNDDFENDEEDYTVDSAVTGVTTEEILHF
                     FNSGLYTRIDDTPAGLYQIAGKVFAKLAKDELICGRRQGLAEYSALNDDQFEKDIIEL
                     GYVQACEKYQYPDQTVFPVFGYSATSYEDLRAFYKAWGSFNTVKSFSWEDEYMYSRNY
                     DRRTKREINKRNEKKRTQAKNEYNKTVRRFVTFIKKFDRRMKEGAKRAEAEKKRKLQE
                     TLRKQIEKDRLANEQSTGQFKLQSWQTVDQQCLDDLEKHFAGSESELKSADEEVTVLI
                     YDCFVCNKNFKSERQLQNHNNTRSHRKAVRQIQWEMKKDSLELGLDEISDLEEFDSAY
                     EDAMSSGPLQAAPASDLADIMAELAEIEQQLQQPASPSAQPCFEIDDQVESGEPSVAG
                     DTEEPAVKHTDPELDRLLASLVADEQSDDWDALPNKRSRKKQTKSAKRASATQTASRP
                     FTAAGHRCASCSQSFESRNKLFQHVQSLGHGAPPQKVKKQQRKA"
     gene            complement(<44012..>46600)
                     /locus_tag="AGOS_ABL193C"
                     /old_locus_tag="ABL193C"
                     /db_xref="GeneID:4618833"
     mRNA            complement(<44012..>46600)
                     /locus_tag="AGOS_ABL193C"
                     /old_locus_tag="ABL193C"
                     /product="ABL193Cp"
                     /transcript_id="NM_208107.2"
                     /db_xref="GeneID:4618833"
     CDS             complement(44012..46600)
                     /locus_tag="AGOS_ABL193C"
                     /old_locus_tag="ABL193C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL225C (CNM67) and YDL239C (ADY3)"
                     /codon_start=1
                     /product="ABL193Cp"
                     /protein_id="NP_982754.2"
                     /db_xref="GeneID:4618833"
                     /translation="MLAVGNSFDEIRSSGKIPLSLSEEKFDYTESEFDENDDSAVSEG
                     HIKLDKSFNFRGFMDMLTGKQKAFELAHQLDVKRGVSSGMDELVSPDALTEQPSNDEK
                     APVGAIRRVPSGARHATVGPTLEATPVRQTTQGRGSDLLLMQSTPLAKPATLSRTQPK
                     DLLREKLIENHHRKASGNSVGSGQAQRDMVQEQKDLREEMSRLQEELAALENRQLKKD
                     GEISQLNRTLNDKDMQLAELKKQLESKTGEVISQELKAANAHQRAKTLENELEQQKNK
                     VRVLEKAMETTAMEVEAERTRLNKDLEQVTLEYKKYKVETGLRSNETSNTLQQIKGKN
                     KILKDDLEKKTNEVNELRDNISTKEKEVSNLKNLLADLKVLVNELRADKSTVDVQLDI
                     QKKELEAASSKLNSLRVEFDQLKNEKDTEINTLKADIENNWKKKQVRLEEVEAKCNDL
                     TALLQKSYETNKELSVQLKRKDTEIGKINDQLKRTTVEKDSLRDFLEKAKWFEIPVGT
                     ILLDLFKKQRRPANGYKTILSEKYEIVGFRLTSDDELLNNLRQKVGSLENSNNLLQEE
                     LESKIKNTQEMFGSQEASMKNDIIKLSEDLKARSAMIDKLQSVIDSLQKDAAALLKEK
                     DESVNKNIELSQHIAQLQEDQLQRDNTTFLELCQKNQEILQYNHEMMEKMHVMEAELR
                     SVVKASNDLQFSISEKEAVLKEKQQIITDLQMNINQLRKNLEKLKGNPADMISFESAQ
                     RIYHNLDRKMYNTLMVDQVNQLDLVELQNVVKNIILLLETPFSKLSKKMPLVSIYLRY
                     EKSLCFHFANKLHFQVYQEPIDIKKFTNDAYSQYLERHDITKIKHPLEICLEKLYDEV
                     RSRLKY"
     gene            complement(<46987..>49026)
                     /locus_tag="AGOS_ABL192C"
                     /old_locus_tag="ABL192C"
                     /db_xref="GeneID:4618834"
     mRNA            complement(<46987..>49026)
                     /locus_tag="AGOS_ABL192C"
                     /old_locus_tag="ABL192C"
                     /product="ABL192Cp"
                     /transcript_id="NM_208108.1"
                     /db_xref="GeneID:4618834"
     CDS             complement(46987..49026)
                     /locus_tag="AGOS_ABL192C"
                     /old_locus_tag="ABL192C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL224C (SQS1)"
                     /codon_start=1
                     /product="ABL192Cp"
                     /protein_id="NP_982755.1"
                     /db_xref="GeneID:4618834"
                     /translation="MAKRHKHYENRGSSGRGRRGGRAGHRGRGGRRRYAERNNSERAA
                     PVWAGSGDLGNPEMVDDYYFGRQADRRLWKKDSMRMGGFRPGDMGASEQPQSHLPARK
                     RPVTFTLARDVYDPSHNLNQLLNKQLDEGAEEEDSNSSSPSASGDDEPEGEYEPNPEP
                     KMYRISELNDDALFFVDEQGKLPTKIPAVEVAQQETPRSVEFNDTLTVGKVQLQLRQD
                     SNGGTFVDAPHAKRIFRDDLYGDVSEEEDEPETPKTEQLDNSKSVRTMQPPSPVPQLL
                     STNIGRLTLSELASESESDTEKPTAEAGAEPPKGEPGFGFLDEDHLADMSEIQVTNIR
                     LGAAAHSYFVASPRTFGDSVARWVDHDTMVDIALELGLPEGRLHAYLRHVYEQLVPPE
                     EPADDGADDHYGDENYDDSEEDEQDDEYENDGLIALVEHTLANDPYRNRDYNTKSLEY
                     RGHGSRKRLIIDKESMIDETVRTLLEDKAAQRSAKRAAKRHAKEDYIAEEARMSSDLF
                     RKYPYGFHIENIIDELEAFLVSPRAALEFPPLDPHGRRTLKNLACAFALICKQVGQST
                     HTRVLVQKGGRYEPDYDAVNRIRRQRRVFMRVDVRRPRDDITPREPRAKFHVREGAIV
                     GGDAPTIGQDNVGRRLLEKLGWTHGEGLGVHGNKGISEPLMARVKKNRSGLRYTE"
     gene            <49057..>50622
                     /locus_tag="AGOS_ABL191W"
                     /old_locus_tag="ABL191W"
                     /db_xref="GeneID:4618835"
     mRNA            <49057..>50622
                     /locus_tag="AGOS_ABL191W"
                     /old_locus_tag="ABL191W"
                     /product="ABL191Wp"
                     /transcript_id="NM_208109.1"
                     /db_xref="GeneID:4618835"
     CDS             49057..50622
                     /locus_tag="AGOS_ABL191W"
                     /old_locus_tag="ABL191W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL223W (ATG4)"
                     /codon_start=1
                     /product="ABL191Wp"
                     /protein_id="NP_982756.1"
                     /db_xref="GeneID:4618835"
                     /translation="MGFLIAYVFNLSPCSGDEMFETIGLAIIHFEGLNTNRVSKCNQN
                     WHQESKQVAMELIQKVSQGLWELENCDTVNSVVVLGKEYPPVPEQRQEERHENGVNMF
                     QHIFTRQGRWNEEFLADVHTRLHFTYRTRFVPIPRHPNGPSPMSISVMLRDNPLNVIE
                     NVLNNPDCFQTDIGWGCMIRTGQSLLANALQRACLGRDFRIDDNAANEHELRIIKWFE
                     DDPKYPFSLHKFVQEGFSLSGKKPGEWFGPSATSRSIQALVAKFPACGIAHCVISTDS
                     GDVYMDEVEPLFRADPSAAVLLLLCVRLGVDVVNEVYWEHIRHILSSEHSVGIAGGRP
                     SSSLYFFGYQDEHLFYLDPHKPQLNLASYQQDLDLFRSVHTQRFNKVHMSDIDPSMLI
                     GILLNGKDDWQLWQQHIASSQIIHLSDSKPVDLMLDHQLESAILGDRYLSEDGQGPSS
                     KVDTGDYIDVGSFVPCTDSSCKINESEDEYQDVKCKNQRIVVVGETTTNGSPEVEVEK
                     VLVEKETIPVRSK"
     gene            <50695..>51540
                     /locus_tag="AGOS_ABL190W"
                     /old_locus_tag="ABL190W"
                     /db_xref="GeneID:4618836"
     mRNA            <50695..>51540
                     /locus_tag="AGOS_ABL190W"
                     /old_locus_tag="ABL190W"
                     /product="ABL190Wp"
                     /transcript_id="NM_208110.1"
                     /db_xref="GeneID:4618836"
     CDS             50695..51540
                     /locus_tag="AGOS_ABL190W"
                     /old_locus_tag="ABL190W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL222W (SSU72)"
                     /codon_start=1
                     /product="ABL190Wp"
                     /protein_id="NP_982757.1"
                     /db_xref="GeneID:4618836"
                     /translation="MAPKRGSSPAIAGHCSLILSRGLPSVRVTDSNRQKKLIRHLHTF
                     LLYLPADTSCGYRPECGAASFRTRQSSLMVSSEMPNTSTLRLCTVCASNNNRSMESHR
                     VLKEAGYDVSSYGTGSAVRLPGLSIDKPNVYPFGTPYNDIYNDLLAQSAERYKSNGLL
                     EMLDRNRRIKKAPEKWHDSQKVFDFVFTCEERCFDSVCEDLMNRGGQLNKIVHVINLD
                     IRDDNENAKIGGRAMLELVKALNSKMQECDQQGVPFEDTIMDVVADWQQAHPQLPLLY
                     SPAYY"
     gene            <51850..>53019
                     /locus_tag="AGOS_ABL189W"
                     /old_locus_tag="ABL189W"
                     /db_xref="GeneID:4618837"
     mRNA            <51850..>53019
                     /locus_tag="AGOS_ABL189W"
                     /old_locus_tag="ABL189W"
                     /product="ABL189Wp"
                     /transcript_id="NM_208111.1"
                     /db_xref="GeneID:4618837"
     CDS             51850..53019
                     /locus_tag="AGOS_ABL189W"
                     /old_locus_tag="ABL189W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL237W (AIM6) (AIM6); Tandem gene duplication in this
                     organism"
                     /codon_start=1
                     /product="ABL189Wp"
                     /protein_id="NP_982758.1"
                     /db_xref="GeneID:4618837"
                     /translation="MMLLSQPGIWLLVSLFLCSSVNSISLWKSHPLVAGSNEPDQKRP
                     DTPSSPRPLGITGAALLNYFEQNLRTMEVPDTAGVPQDSAYYTALTHYLGLCGARSEN
                     CDPGQSAVAKLTRDVPVLTRVHSHNDYWRRVPLLQALAYGVASVEADVWLENNGTTLL
                     VGHNRVFLEPAHDLGRLYIEPITRMLQEVNCKSENKGDPYGIFYNAPEEQLLLYIDFK
                     SLDRKLTYKLLLDYLKPLIDNNFISYYDMDAKRFVSRPVTVVLTGNYPSDEEIGVPSP
                     RRYTFLDAPLGRLSSVGDEFTANNVSVVASSSLLELMLRCGKASNPSLTEQTAWESYG
                     CLVEYVREAHRRDLRARIWGLPDWPVSTRENLWDMLTDMGVDYLNVDDLDAVSKF"
     gene            <53440..>54468
                     /locus_tag="AGOS_ABL188W"
                     /old_locus_tag="ABL188W"
                     /db_xref="GeneID:4618838"
     mRNA            <53440..>54468
                     /locus_tag="AGOS_ABL188W"
                     /old_locus_tag="ABL188W"
                     /product="ABL188Wp"
                     /transcript_id="NM_208112.1"
                     /db_xref="GeneID:4618838"
     CDS             53440..54468
                     /locus_tag="AGOS_ABL188W"
                     /old_locus_tag="ABL188W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL237W (AIM6) (AIM6); Tandem gene duplication in this
                     organism"
                     /codon_start=1
                     /product="ABL188Wp"
                     /protein_id="NP_982759.1"
                     /db_xref="GeneID:4618838"
                     /translation="MPFLRPIIYFLLSNIGAALELPGTNSEHLTSFEDDSAVYGMQST
                     SVPSNFKNTEVHRLTGNVTVHSWVHSHNDYTRDRPLFDAISYGVVSIEADVYLRGNNR
                     LAVAHVPMDVRDAKDLRELYLEHLERLLDEVNQQGQDSWQGIFYKYPTQSLQLLIDLK
                     KDDDKLYTVLMDDYLKPLIDKGYLSYIEIKTEEIVRRPLTVVLTGERPKDQRTVDGDR
                     NEGYFSDGRRYVFIDFEIGRMVCDKALYGPSVLASGNLVLTLAKCLKSMDIGKFASDP
                     TDEQIRCLRNVIKSGTAHMNTRLWGGPSAPDSLRDRLWKLQLEAGINMLNADNLAAAV
                     KIGQEYFG"
     gene            complement(54597..55079)
                     /locus_tag="AGOS_AgSNR19U1"
                     /old_locus_tag="AgSNR19_U1"
                     /db_xref="GeneID:4618839"
     ncRNA           complement(54597..55079)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR19U1"
                     /old_locus_tag="AgSNR19_U1"
                     /product="AgSNR19_U1"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR19_U1; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149369.1"
                     /db_xref="GeneID:4618839"
     gene            complement(<55351..>57858)
                     /locus_tag="AGOS_ABL187C"
                     /old_locus_tag="ABL187C"
                     /db_xref="GeneID:4618840"
     mRNA            complement(<55351..>57858)
                     /locus_tag="AGOS_ABL187C"
                     /old_locus_tag="ABL187C"
                     /product="ABL187Cp"
                     /transcript_id="NM_208113.1"
                     /db_xref="GeneID:4618840"
     CDS             complement(55351..57858)
                     /locus_tag="AGOS_ABL187C"
                     /old_locus_tag="ABL187C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL221C (POP1)"
                     /codon_start=1
                     /product="ABL187Cp"
                     /protein_id="NP_982760.1"
                     /db_xref="GeneID:4618840"
                     /translation="MASRKQLNPNQEFKRQKVRNARQIRSEAAAASPEEFSETGHMLK
                     VGEFVTSRQFELEQLQSAIHRSRNSSSTRVFQSLPRRLRRRTASHNVRRIPKRMRNRA
                     LREMSKSDQLITSGTRQKPKHGISAGKLYKMKMAVSLLRLASRNTAMRLALPAGVTPA
                     TSKLRQTIRSLHRQIKDAERGKQVHKLNNSMGSYDNTGVDELAPKPLGRIKYMRRQRF
                     FTWLPTHVWNAKRSHMMKRWGYQIPWSPTQKCFRMTHRLLGPTIASNGAMCADTSYMG
                     TMVVSADNSGTVAAFADRLTDGRASKPKYRELQYLFEGLVYSTTASSPLGPGIILWVD
                     ANMLLVRLHPAIYECVFKDAKEQGLRVHDCRYSISSFVIGGSKALQALSHIIRTPPGS
                     NSESFQQFQRVCKISDSSVFPERTAFVFKAYDPRHLSKPTKLGTVPPPSASTIIKLQN
                     EYPKTEISDVLHALCDPASRQESYKNQQTLKQLARRRRKLLTKEASRNLIPFDPAIDP
                     EIPIAIVRQPASMNWLVMLPWFWLLPFWYQLHRVPHVYHMGLKQLHQQHFERGKLMFP
                     NDYPFTPAGQDENSVYKAEASRNTWGRKPVGKRLNFDAIKAVHASECPGFDGEIGDHF
                     SSDWKLLQILQNGTALLGSEIETHNPARTTQYDSETGLPQLNYVRDLLELHRSSVLQQ
                     DSSLKLPVTLYNKPVVSFSKPPMDTGLPVQLAVVTTQLPVIAVVCTALERGHFRDNAR
                     LYAVPVKHLAHWQAVASRKYNAAGKRTHDADQPLPRVQDLVGFITSGTYHLGEGKSTG
                     NGLISAEFAHRAEHNLLLVRNVGTNRYRLAQWRQIYV"
     gene            <58557..>59858
                     /locus_tag="AGOS_ABL186W"
                     /old_locus_tag="ABL186W"
                     /db_xref="GeneID:4618841"
     mRNA            <58557..>59858
                     /locus_tag="AGOS_ABL186W"
                     /old_locus_tag="ABL186W"
                     /product="ABL186Wp"
                     /transcript_id="NM_208114.2"
                     /db_xref="GeneID:4618841"
     CDS             58557..59858
                     /locus_tag="AGOS_ABL186W"
                     /old_locus_tag="ABL186W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL220W (ADE12)"
                     /codon_start=1
                     /product="ABL186Wp"
                     /protein_id="NP_982761.2"
                     /db_xref="GeneID:4618841"
                     /translation="MVNVVLGSQWGDEGKGKLVDLLVSKYDIVARSAGGNNAGHTIVV
                     GGIKYDFHMLPSGLVNPNCQNLIGNGVVIHVPSFFGELEQLEAKGLRDARGRLFISSR
                     AHLVFDFHQRTDKLRELELSGKSKDGKNIGTTGKGIGPTYSTKASRSGLRVHHLVSEQ
                     PEAWAEFETKYRRLLETRQQRYGPFEHDAEEELARYRRYREELRPFVVDSVVFMHNAI
                     QQKKKILVEGANALMLDIDFGTYPYVTSSSTGIGGVLTGLGIPPRCIDEIYGVVKAYT
                     TRVGEGPFPTEQLNEAGDKLQTIGAEYGVTTGRKRRCGWLDLVVLKYSTLINGFTSLN
                     ITKLDVLDTFKEIKVGISYSLNGKKLDLFPEDLLVLSKVDVEYVTLPGWDEDITKISR
                     YEDLPENAKSYLKFIEDFVGVPVEWVGTGPGRESMLHKEVS"
     gene            complement(<59995..>61653)
                     /locus_tag="AGOS_ABL185C"
                     /old_locus_tag="ABL185C"
                     /db_xref="GeneID:4618842"
     mRNA            complement(<59995..>61653)
                     /locus_tag="AGOS_ABL185C"
                     /old_locus_tag="ABL185C"
                     /product="ABL185Cp"
                     /transcript_id="NM_208115.1"
                     /db_xref="GeneID:4618842"
     CDS             complement(59995..61653)
                     /locus_tag="AGOS_ABL185C"
                     /old_locus_tag="ABL185C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL219C (ALG9)"
                     /codon_start=1
                     /product="ABL185Cp"
                     /protein_id="NP_982762.1"
                     /db_xref="GeneID:4618842"
                     /translation="MPINVRAAGLLAALAVLRLYVQPLYSLISDCDETFNYWEPLNLL
                     VRGFGKQTWEYSPEYSIRSWAFLMPLQVLLLGVRRLVQAREWPTATLFYAGRAALGLL
                     SLVFEKNLYLELVKTTNTEVAEMWLAFQLLNPGWFHASVELLPSSLAMVLLLGYLKDS
                     LRYLSTDKEKPFVSALFYLFLAGLLGWPFVLVLGLPLVLHYVLSHRMIVTLRTGFSSV
                     LVLSMILGCVFVVDSIFYRRLTLVPWNIVKYNVLGTSADSGPHIFGTEPWYYYVFSLL
                     LNLPLPTLIFAIVALLHTNLWPVWCSLFAWLVVFIAQPHKEERFMYPIYAFVTLASSI
                     GFTKVSKLLWRSKLYRHSFKGAVFAVLICQSVLRITALVNNYTAPLHVYSTLEPSDAP
                     VNVCTGREWYHFPASFFLPDSHRLRFVNSGFDGLLPGDFPEEMPLLEVISQVPEGMNQ
                     FNKFDPGKVVSIDMCDYYVDIMMQSDPEQDVFDPTDMPLGWEISTCAPFIDGANSSFL
                     GRAFQIPASVLSRLPKSVRALVERYHKAKHLQYCVFKNSAAELA"
     gene            <62110..>63039
                     /locus_tag="AGOS_ABL184W"
                     /old_locus_tag="ABL184W"
                     /db_xref="GeneID:4618843"
     mRNA            <62110..>63039
                     /locus_tag="AGOS_ABL184W"
                     /old_locus_tag="ABL184W"
                     /product="ABL184Wp"
                     /transcript_id="NM_208116.1"
                     /db_xref="GeneID:4618843"
     CDS             62110..63039
                     /locus_tag="AGOS_ABL184W"
                     /old_locus_tag="ABL184W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL236W (PHO13)"
                     /codon_start=1
                     /product="ABL184Wp"
                     /protein_id="NP_982763.1"
                     /db_xref="GeneID:4618843"
                     /translation="MTGQQAPVKLDTPAGVHSFLDQYDTFLFDCDGVLWLGTHLLPLV
                     KETLAMLTAKGKQLYFVTNNSTKSRAAYAKKFASFGITVGVEQIFTSSYAAALHVRDE
                     LRLAPGADKIWVFGEAGIQDELQLMGYETMGGADERLDAPFAADASPFLEGGLDPAVR
                     AVVAGLDTHLNYHRLSVTLQYLQQPEVAFVATNLDNTLPQKGLKLPGAGTMIQCLVTA
                     SGREPQACGKPNQNMLKSIVAATGLDRTRTCMVGDRLNTDMRFGADGGLGTLLVLTGI
                     ETEAGALAPSAEHPQPAYYADKLGSLYEFSEIV"
     gene            <63194..>64837
                     /locus_tag="AGOS_ABL183W"
                     /old_locus_tag="ABL183W"
                     /db_xref="GeneID:4618844"
     mRNA            <63194..>64837
                     /locus_tag="AGOS_ABL183W"
                     /old_locus_tag="ABL183W"
                     /product="ABL183Wp"
                     /transcript_id="NM_208117.1"
                     /db_xref="GeneID:4618844"
     CDS             63194..64837
                     /locus_tag="AGOS_ABL183W"
                     /old_locus_tag="ABL183W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL218W (MGS1)"
                     /codon_start=1
                     /product="ABL183Wp"
                     /protein_id="NP_982764.1"
                     /db_xref="GeneID:4618844"
                     /translation="MSSRTGENLIKCPVCGRRVAFISINSHLDACTAGGGRKERGTTS
                     VSEMLGRKHKLEDEDSVTVISDVNMEDSEVIEMDDSPQRKRARATGTVNSDQRELQKM
                     AHLPLSEKLRPRELREYVGQQHILSQESGALYKYVSQGTIPSMILWGPPGVGKTSLAR
                     LLSKTVNARPQAKITYQLVETSATKANAQELRTVFDNAKKEFRLTKRMTVLFVDEIHR
                     FNKGQQDLLLPYVESGGIVLIGATTENPSFQLNNALLSRCQVFVLNKLTEDEMNRVLT
                     RGIAMLNKCRRLLWENPRPLKLEMECIEYINRVAVGDTRKALNILEMVEVSTRQIPTD
                     KSLQLQDMKSLLQNDSNVVRSYYDAGGENHYDTISAFHKAIRGSDENAALYYLARMLQ
                     GGEDPLFIARRMVRIASEDIGLADNTMLPLAVSAHDAVMKVGLPEADLSLAHCAVALA
                     RAPKSVLLYRGWKQLKGMLSENKYQMASSEIPLHLRNAPTKLMKDLGYGAGYKYNPTY
                     KDGKVKQEYFPLEVLANCTDRNELRFLAGPHLGTEVDPD"
     gene            complement(<64955..>65371)
                     /locus_tag="AGOS_ABL182C"
                     /old_locus_tag="ABL182C"
                     /db_xref="GeneID:4618845"
     mRNA            complement(<64955..>65371)
                     /locus_tag="AGOS_ABL182C"
                     /old_locus_tag="ABL182C"
                     /product="ABL182Cp"
                     /transcript_id="NM_208118.1"
                     /db_xref="GeneID:4618845"
     CDS             complement(64955..65371)
                     /locus_tag="AGOS_ABL182C"
                     /old_locus_tag="ABL182C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL235C (YPD1)"
                     /codon_start=1
                     /product="ABL182Cp"
                     /protein_id="NP_982765.1"
                     /db_xref="GeneID:4618845"
                     /translation="MSSVPIPTTVVNWDILNEVVSMDEDDPGFSQSLFVQYFDQADTT
                     FQQIQRELESEAPELAALSSLGHFLKGSSASLGLQRVAWACERIQNYGKRGEGAASAH
                     EPDAHYVQLISDTLQLARAEVQAARKELSEYYHTEL"
     gene            <65825..>66754
                     /locus_tag="AGOS_ABL181W"
                     /old_locus_tag="ABL181W"
                     /db_xref="GeneID:4618846"
     mRNA            <65825..>66754
                     /locus_tag="AGOS_ABL181W"
                     /old_locus_tag="ABL181W"
                     /product="ABL181Wp"
                     /transcript_id="NM_208119.1"
                     /db_xref="GeneID:4618846"
     CDS             65825..66754
                     /locus_tag="AGOS_ABL181W"
                     /old_locus_tag="ABL181W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL217W"
                     /codon_start=1
                     /product="ABL181Wp"
                     /protein_id="NP_982766.1"
                     /db_xref="GeneID:4618846"
                     /translation="MIIIRLSALVLMATLLVSCAATTCPLPLPVVETVRQVTMGPGQR
                     ILFVGDVHGMYDQFHKLLAQAGTDADTTVVLLGDFLTRGTNPKGMLHYLLTNSHADCV
                     LGNNDIAVLFAAANPDRIKLFNRQLKSDHVNASDFCAIEFSSGAFLPPTTIKKEHVRV
                     AAELGLSACAQLAARCSALTRYDLPSGDTVFAAHAGLLPGAWHAPRVYDLAWMKYVDP
                     DDWDRTAKDEFEGAVRWTDLWECPATPPNVSVVYGHDAKRGLTLANHTLGLDGACVAG
                     GQLAALDYHVSVGGYKRTLHVVSCDYVTGGYPV"
     gene            <66978..>69023
                     /locus_tag="AGOS_ABL180W"
                     /old_locus_tag="ABL180W"
                     /db_xref="GeneID:4618847"
     mRNA            <66978..>69023
                     /locus_tag="AGOS_ABL180W"
                     /old_locus_tag="ABL180W"
                     /product="ABL180Wp"
                     /transcript_id="NM_208120.1"
                     /db_xref="GeneID:4618847"
     CDS             66978..69023
                     /locus_tag="AGOS_ABL180W"
                     /old_locus_tag="ABL180W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL216W (RAP1)"
                     /codon_start=1
                     /product="ABL180Wp"
                     /protein_id="NP_982767.1"
                     /db_xref="GeneID:4618847"
                     /translation="MSDSQDDFETAPDHFSEELKSHHGIFHGLKFYFADDINKDYYKS
                     AVSKLGGVVLEEPPKEVQRDQYIVSHVNTFDLPTVDPLFISNSLDQNTLLNVGPFLLP
                     PVNERSEYDVDVSDTSRIDSRIRQASAAQAEEEDARGTQHDDVASAAVAAAEAASLAH
                     EHTHATGRDVVRQKIDDARQELASSTRSGALDTNTAQSGQVGAVGEPAKAMLTRSSNL
                     PPHNKSSFTEEEDEFILDVVRKNPTRRTTHTLFDEISHYVPNHTGNSIRHRYRVYLSK
                     RLNYVYKVDENGKLLRDEKGEFIKTDVLPQGLKRKFTADEDYQLALNIKKQFYKDIYQ
                     VDPDTGESLIRDDDEPSTVAKRKMVMDPTFIPGKEPSFQDYNVGDRRGPLSREFFKTY
                     GEKYPSHTENAWRDRFRKFLLNYGIDEYIAYYENEQAHNRVPEPMKNMTNRVKRPGPA
                     PGNYNNAKKVKFMSPTSQQAHSASTNQYTIPQDDLLDEETLSFITGLKRDLSRMESHQ
                     NQAPDIPFEYTQELAESIRNNFTMEETQFDNINPDEIPFPPQIATTDLFMPEFFHFAT
                     TRDFLNKVHEIVNRTYHTSQAEKLVEDLRDECGIRKAFSTSILTALSGDLMVLPRYFL
                     CAFRYSANPPMNVPGIWTKEDDEMLKNNSDEDMKLLIKKHGSGRIEMRKRFHQNDLV"
     gene            complement(<69346..>71571)
                     /locus_tag="AGOS_ABL179C"
                     /old_locus_tag="ABL179C"
                     /db_xref="GeneID:4618848"
     mRNA            complement(<69346..>71571)
                     /locus_tag="AGOS_ABL179C"
                     /old_locus_tag="ABL179C"
                     /product="ABL179Cp"
                     /transcript_id="NM_208121.2"
                     /db_xref="GeneID:4618848"
     CDS             complement(69346..71571)
                     /locus_tag="AGOS_ABL179C"
                     /old_locus_tag="ABL179C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL234C (GYP7)"
                     /codon_start=1
                     /product="ABL179Cp"
                     /protein_id="NP_982768.2"
                     /db_xref="GeneID:4618848"
                     /translation="MSTSLLFCKSQVLVRLSGSSKDQKSGVLLISKDEQQVAHDAMVA
                     WIAVDEMSAQEAEQLLKGEMKLAQDSQARVKIPKEVVVQAMYGTWSFAVKLGYIRSIQ
                     MMPPDPNGWYQGSLSISSRNQNEEIPVLFLADDKCPSTRERSRQLIDTFQPFQSATGV
                     YWGGVDFKAAVERLAQLTVAPLDQTVFLLNATEEDLRQYTGRPAGSGVGSDGTAPVGD
                     IINGWTWSALASLASATTKATSFVEGLVRKHPLVQLAERNSSNPYVRQMLENPRVQEV
                     QREYDSAKIYLARWSLGVKEQAEKYRKSNEHYRRLLAKEFNSDGDIEISEDELNTAME
                     RTHPLSKAEWDSLFDGMGRLSLSAQEIKERIFHGGIKDNQLRRRVWPFLLGVFPWDST
                     QVDRERIERDLREKYEKEYKNRWLSRETSPNQEEEAYWQDQLCRIEKDVKRNDRHLAL
                     YKYNTPDAKPPAQASQESDSQCNEQSVTEESGENDDWEIKNPHLLILRNILISYNLHN
                     DNLGYVQGMTDLLSPLYAILEDEAMSFWCFVMFMDRMERNFLRDQSGIRDQMLTLSEL
                     CQYMLPKFSAHLQQCESSNFFFCFRMLLVWFKREFEFADICTIWEILWTDYYSSQFQL
                     FFLLAILQKNSRPVMAHLTQFDEILKYFNDLKCVMDCNDLLIRAELLFVHFKRSIDMF
                     ERTTSHIPPSNNSTATGFRRRPSVERDASADVISDSLRAVLSTRLIIKRESERTKDSI
                     K"
     gene            <71627..>72502
                     /locus_tag="AGOS_ABL178W"
                     /old_locus_tag="ABL178W"
                     /db_xref="GeneID:4618849"
     mRNA            <71627..>72502
                     /locus_tag="AGOS_ABL178W"
                     /old_locus_tag="ABL178W"
                     /product="ABL178Wp"
                     /transcript_id="NM_208122.1"
                     /db_xref="GeneID:4618849"
     CDS             71627..72502
                     /locus_tag="AGOS_ABL178W"
                     /old_locus_tag="ABL178W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL215W (IES2)"
                     /codon_start=1
                     /product="ABL178Wp"
                     /protein_id="NP_982769.1"
                     /db_xref="GeneID:4618849"
                     /translation="MVCSPSKIPTKASVAASLLPTDTYNGHRRSQLAQLAMKSDMSDE
                     NGYEDGSAEDYSLQEVAEDDLYAEGDNDDGDYQYDEGEDDEESAPSAKRTSRSARQRV
                     VYDYGEAEEEYEELDEEEVATDEVVSPRKKVSAITFADDEDDDDEEDDEEAAVVARAR
                     ANSRNKMVLDLMDENNVRKRGTDHLTEEELQLRRAENARKRRNLSEKKLEEEKQDTIN
                     KLLKRRAGKSRSNLQASEKEASVDEAAYSKPRRPYHAIGMLRVLRTASEDRFAIAPRP
                     VDDSAAQRSPTASEG"
     gene            <72794..>74305
                     /locus_tag="AGOS_ABL177W"
                     /old_locus_tag="ABL177W"
                     /db_xref="GeneID:4618850"
     mRNA            <72794..>74305
                     /locus_tag="AGOS_ABL177W"
                     /old_locus_tag="ABL177W"
                     /product="ABL177Wp"
                     /transcript_id="NM_208123.1"
                     /db_xref="GeneID:4618850"
     CDS             72794..74305
                     /locus_tag="AGOS_ABL177W"
                     /old_locus_tag="ABL177W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL233W"
                     /codon_start=1
                     /product="ABL177Wp"
                     /protein_id="NP_982770.1"
                     /db_xref="GeneID:4618850"
                     /translation="MNIPAVQPQQHQQSAQQPQQGHMEPQGQSMGGSSQHGYQFMQGG
                     GGQLLGSHMNMMASQHPYVIPPPFGNVHFAAQRQPGVPPQPVPVSPQGPGPEQQEAQA
                     PPGAGVGGRGPRARVAEAQPQAQFSGGGLPRRIPMSHMLSSYPVRKYLSNMALLRAHE
                     VVNQVNQSMGKVDDYEYWSRFTKDIFAPDGVLRYARKNGDDTRLFEFAMPIIPSLLKF
                     LGSTGVVRIEMVPQQLHVQVLSNGTIFFEHPRCPVTYFYPDGSYMANFSRIKGIFDAS
                     LKIEWCDVCTYSFVPGIEWNSLERVLSDQKVSQKIFQALAGSNAPPDTVPDGNKDYSL
                     KMDQQMPANFSAITQLRSQFKVFHNISSFGLHESLMRVLQVNDVMSYLKNLKVYQRVN
                     NIQSPLESLRSFVAAAEERRRMSQPTTSPTKTTASAPMHGSAQQNPQANPSGLFMATM
                     AYNPAVPKNERKSFKKRPSSEVLLPLSSDDAMKSPMDGSDPDRSSNPYKKMKF"
     gene            <74515..>75138
                     /locus_tag="AGOS_ABL176W"
                     /old_locus_tag="ABL176W"
                     /db_xref="GeneID:4618851"
     mRNA            <74515..>75138
                     /locus_tag="AGOS_ABL176W"
                     /old_locus_tag="ABL176W"
                     /product="ABL176Wp"
                     /transcript_id="NM_208124.1"
                     /db_xref="GeneID:4618851"
     CDS             74515..75138
                     /locus_tag="AGOS_ABL176W"
                     /old_locus_tag="ABL176W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL214W (PEX17)"
                     /codon_start=1
                     /product="ABL176Wp"
                     /protein_id="NP_982771.1"
                     /db_xref="GeneID:4618851"
                     /translation="MNHIKWPNEANIVPYKRPKTLQQITGLFYNAGFLFSAMYLLTSL
                     ILRPLLLRSHNQRLEMSYITLLRLRKLVNDLAKRLKTTPVTVIGFNERVAEGTNSGVK
                     YVDRCSQTSQEDFEQANMHLPHTDPSTENWERINGRISQAITSLNSFAYENAHTLDHC
                     DRFSFEAKLLADSLDQHRDTSFNKKCTEISDTIIELKSWFIRGSVPS"
     gene            complement(<75222..>75866)
                     /locus_tag="AGOS_ABL175C"
                     /old_locus_tag="ABL175C"
                     /db_xref="GeneID:4618852"
     mRNA            complement(<75222..>75866)
                     /locus_tag="AGOS_ABL175C"
                     /old_locus_tag="ABL175C"
                     /product="ABL175Cp"
                     /transcript_id="NM_208125.1"
                     /db_xref="GeneID:4618852"
     CDS             complement(75222..75866)
                     /locus_tag="AGOS_ABL175C"
                     /old_locus_tag="ABL175C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL213C (RRG9)"
                     /codon_start=1
                     /product="ABL175Cp"
                     /protein_id="NP_982772.1"
                     /db_xref="GeneID:4618852"
                     /translation="MLGSYFANLPHLYVHAAGLRALSTSAQLRTKAPSARKLIKMVTE
                     SSLSKKELESGTPIETQVGKGHEEVPEWKKQKLALHKKLNGEHWNPKKKLSRDQQDAV
                     RMLKQRYPDMTNSNLADYFKVSAESIRRILKAKWQPNEDEMLEMQERWKRRGTRIKEE
                     LRESGAIPERRIRIASDGNAFRVRSVETPGEKSSKGISTPLQKNLHRLLRNTRK"
     gene            complement(<76213..>78054)
                     /locus_tag="AGOS_ABL174C"
                     /old_locus_tag="ABL174C"
                     /db_xref="GeneID:4618853"
     mRNA            complement(<76213..>78054)
                     /locus_tag="AGOS_ABL174C"
                     /old_locus_tag="ABL174C"
                     /product="ABL174Cp"
                     /transcript_id="NM_208126.2"
                     /db_xref="GeneID:4618853"
     CDS             complement(76213..78054)
                     /locus_tag="AGOS_ABL174C"
                     /old_locus_tag="ABL174C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL209W (SSB2) and YDL229W (SSB1)"
                     /codon_start=1
                     /product="ABL174Cp"
                     /protein_id="NP_982773.1"
                     /db_xref="GeneID:4618853"
                     /translation="MAEGVFSGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFV
                     AFTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQSDMKTWPFKVIDANGS
                     PMIEVEYLGETKSFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQAT
                     KDAGAIAGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLNIAGG
                     VYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGLDISGDARALRRLRTAAERAKRT
                     LSSVTQTTVEVDSLFEGEDFETSITRARFEDINAALFKSTLEPVEQVLKDAQISKSQI
                     DEVVLVGGSTRIPKVQKLLSDFFEGKQLEKSINPDEAVAYGAAVQAAILTGSNLSDDT
                     KDLLLLDVAPLSLGVAMQGDVFACVIPRNTTVPTIKRRTFTTVHDGQTTVTFPVYQGE
                     RVNCKDNTLLGEFDLKGIPPLPAGEPVLEAIFEVDANGILKVTAVEKSTGKTANITIS
                     NAIGRLSSEDIEKMVSQAEEFKAADEAFAKRHEARQRLESYVSSIEQTVSDPVLSAKM
                     KKGAKSKVEAALADAFSALQIEESSAEDYRKAEIGLKRVVTKAMATR"
     gene            complement(<78295..>79203)
                     /locus_tag="AGOS_ABL173C"
                     /old_locus_tag="ABL173C"
                     /db_xref="GeneID:4618854"
     mRNA            complement(<78295..>79203)
                     /locus_tag="AGOS_ABL173C"
                     /old_locus_tag="ABL173C"
                     /product="ABL173Cp"
                     /transcript_id="NM_208127.1"
                     /db_xref="GeneID:4618854"
     CDS             complement(78295..79203)
                     /locus_tag="AGOS_ABL173C"
                     /old_locus_tag="ABL173C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL210W (MER1)"
                     /codon_start=1
                     /product="ABL173Cp"
                     /protein_id="NP_982774.1"
                     /db_xref="GeneID:4618854"
                     /translation="MTNKRRAPLEDISNAIIGQVLETKDARIGRGNGEDFSVDRPQVT
                     AAALDGLFLDGRQLRIGGGQARSIGGWVRLRVARWSLRKALNTGHVLAAERGQAALIA
                     RAHDSQTVELSGRSLDCTTLSLLRVVGQVAVTVTPALLTQLRCRQLKLRSAIRAWQDT
                     VLLPTHDSEALLADLRIIVSSGVYPASGPMLIHSCPPLPTPVAPLHAALALPTITQEL
                     ELNKPQVSFLIGENGSRIEYIKVASSAIVKVLPIKNKLQNSELKNPSCVRQSLAITGD
                     LCAVARALTSIQAFLDLYHANAKHKF"
     gene            complement(<79449..>80531)
                     /locus_tag="AGOS_ABL172C"
                     /old_locus_tag="ABL172C"
                     /db_xref="GeneID:4618855"
     mRNA            complement(<79449..>80531)
                     /locus_tag="AGOS_ABL172C"
                     /old_locus_tag="ABL172C"
                     /product="ABL172Cp"
                     /transcript_id="NM_208128.1"
                     /db_xref="GeneID:4618855"
     CDS             complement(79449..80531)
                     /locus_tag="AGOS_ABL172C"
                     /old_locus_tag="ABL172C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL230W (PTP1)"
                     /codon_start=1
                     /product="ABL172Cp"
                     /protein_id="NP_982775.1"
                     /db_xref="GeneID:4618855"
                     /translation="MNRYALKFHKRGNNRQPSVPLPVTNRRSAECPEDDKCAMQKPRY
                     LAQPDRTLSEKFRYIQCLEDERLRDATLYPEASKWSLGPAVDKFNQYRNRYVNIIPYD
                     RTRVRLQVESGSDYINASYTHVDVPGQSVRRGNYISTQGPTRRTWQQFWQMCYQQCPG
                     PDVVVVMVTPLVEQGREKCHLYWPQSRSGVTTLHVPQVQSPSGLPGDVIAFATDLHVE
                     LVSESRHEHFVETQLLLRPGDPQLPVKRVHHFYFDQWRDMTRPDTVLPVLELSRRSHS
                     ASSPENPIIVHCSAGVGRTGTYITLDHLIHDTRDFTEGVCEDYSHDLIEQIVMQLRMQ
                     RLKMVQLLQQYEFIYHLAGCIYGHTA"
     gene            <80672..>83833
                     /locus_tag="AGOS_ABL171W"
                     /old_locus_tag="ABL171W"
                     /db_xref="GeneID:4618856"
     mRNA            <80672..>83833
                     /locus_tag="AGOS_ABL171W"
                     /old_locus_tag="ABL171W"
                     /product="ABL171Wp"
                     /transcript_id="NM_208129.2"
                     /db_xref="GeneID:4618856"
     CDS             80672..83833
                     /locus_tag="AGOS_ABL171W"
                     /old_locus_tag="ABL171W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL231C (BRE4)"
                     /codon_start=1
                     /product="ABL171Wp"
                     /protein_id="NP_982776.2"
                     /db_xref="GeneID:4618856"
                     /translation="MEVLKGSYKQKSFQSLKDLGQQGSSAAPGVRPTKSLQTSPIGSW
                     TSLSHLRLEKLAEGSGWEELQDYGLEELRDGFFDASYSRPQRVAATEPPVSTSPKAQS
                     PLAVRCKAFRDRLRVHWKAVVKFTVAYLAAMFLCLVRPASDWIGDVYSCFLPVAVLIH
                     HPVRTVGVQLEITVQSIVGLALGQGWSALWWYVCSVARVGRHEGALLFLSLVLSGLWS
                     SWLAAAYGRLVYMSVSFGITATFFATSMPPSEGSLPIWRHFWDQGMSYLFGLLLSLLV
                     CIFLFPRFGHATIGRGFSSAANDLKHLLDYLVDARYCNDIPMLVEAQENAVSAIDVRL
                     SEGYREFANQFSITRFDGKLLEQLRNSLTIAASPLRSLPLGHGLLTNVELERFHQARP
                     QSAPENTICVRDADDHYEDQAIKTEESANLGLACGSTDLCSAIIRDKFSETIFDLIME
                     LIHALNSLQVGLNNISESNVSASERADIKANILACLSNLHDRIRRLDIKYKEFGRAGL
                     FTSELLLNPKSSDALVFLRYIRQCAKHMTKVLEVFLQLNASVHWRVIPPKYQWHRAIH
                     RLSHQCALDQGASFLWNYFQTKRDVDDAFEMIYNSYTSKHHEVSDLFSRQGMRPRIRA
                     FDHKDFAVHSTSNPIRYKLWQLNNSLLGPESRWARKFTVVLVALCLPGWLPGSKVWYR
                     EYHCLWAPIIYVILSNRRNSSNWRALYKRLAGCVLGVFWAWCANQAKHYSNPFIIATF
                     SVLLCIPLAFNYFAYNRRKSTLAALICFTVPALVTFFLEEHTTASLWKQAWTTGVALL
                     IGTFCSIPINWFIWTFTARSELSLAVSGLLMHLSQSYQIVAGRYLYRDTDDHPNDLTR
                     SLASIREVRLSQSLLATRALVRSAVSEPNIVSEFRAYLFDELLDHFSVLLERLIEARR
                     LGQHFQVWDRDPNTETTRALLSLRRDNVASVIFIFYMLSNCFSSGSKVPKYLPNPIFV
                     RKKLFDTFMKLAEDASARGTSAHSSTPAAPNNTDPSSPSSAGQDHWDEVYAICFSRAF
                     TDISVELQRIIDLAKEILGQEGD"
     gene            complement(<83965..>84090)
                     /locus_tag="AGOS_ABL170C"
                     /old_locus_tag="ABL170C"
                     /db_xref="GeneID:4618857"
     mRNA            complement(<83965..>84090)
                     /locus_tag="AGOS_ABL170C"
                     /old_locus_tag="ABL170C"
                     /product="ABL170Cp"
                     /transcript_id="NM_208130.1"
                     /db_xref="GeneID:4618857"
     CDS             complement(83965..84090)
                     /locus_tag="AGOS_ABL170C"
                     /old_locus_tag="ABL170C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL232W (OST4)"
                     /codon_start=1
                     /product="ABL170Cp"
                     /protein_id="NP_982777.1"
                     /db_xref="GeneID:4618857"
                     /translation="MITDSQLNNLAISFGLAMFASIVLYYFVCSMSGDDTENKKS"
     gene            <84308..>84568
                     /locus_tag="AGOS_ABL169W"
                     /old_locus_tag="ABL169W"
                     /db_xref="GeneID:4618858"
     mRNA            <84308..>84568
                     /locus_tag="AGOS_ABL169W"
                     /old_locus_tag="ABL169W"
                     /product="ABL169Wp"
                     /transcript_id="NM_208131.1"
                     /db_xref="GeneID:4618858"
     CDS             84308..84568
                     /locus_tag="AGOS_ABL169W"
                     /old_locus_tag="ABL169W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL211C"
                     /codon_start=1
                     /product="ABL169Wp"
                     /protein_id="NP_982778.1"
                     /db_xref="GeneID:4618858"
                     /translation="MAHIPPIFEEWLFRKLLYSRGFQSFVRTVYCKINGIKPRAPQSI
                     VNSGLPFHPTRGQKFRAFRVLFWDEVKVVFGATRTFKKSGKQ"
     gene            complement(<84647..>87043)
                     /locus_tag="AGOS_ABL168C"
                     /old_locus_tag="ABL168C"
                     /db_xref="GeneID:4618859"
     mRNA            complement(<84647..>87043)
                     /locus_tag="AGOS_ABL168C"
                     /old_locus_tag="ABL168C"
                     /product="ABL168Cp"
                     /transcript_id="NM_208132.2"
                     /db_xref="GeneID:4618859"
     CDS             complement(84647..87043)
                     /locus_tag="AGOS_ABL168C"
                     /old_locus_tag="ABL168C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL212W (VID27)"
                     /codon_start=1
                     /product="ABL168Cp"
                     /protein_id="NP_982779.1"
                     /db_xref="GeneID:4618859"
                     /translation="MNIIRKFMESGSKPEVVSIPSGQLYLTRSRQSPKSSSECLYNDA
                     TVTVRACARYAYELVVRKQAEEELTPGAEDDDEDDGLSELSGQSTEDEWVFRLDETLR
                     LHRRWNKSGELTVVWRNTKGDCGEKFQFVVNSDIPLGDVEDFLETVYRCEYEAKYRRL
                     ASEATEQDLKQFDFSYLANHDSAVFFSDDETEVREPEFLSAQMGALAISDDDSDEDPD
                     LYEDALDEPQPRLHTNPPGVVRFLQYGDLSVYDPMTGRYALQERNVNVALLQDNKHRY
                     VYIEGSEIILAVETLPEVNPFLEVGIRSFLFNYTHEGIVLSYKVKFKNAAAFTHFHLH
                     WTIALWEMSTGQKWSDLSETEQNYILYSTSGKNEELDVFLEEPENQNDTLGDAQIGTD
                     EQEEEEEEEAEGSNLLISSSSFGDDEYDERRAEREYEESTSNVGNKALAVGFKSDRTF
                     VLRGDKIGVFKTSDADSLDFVTAINEVSDIKGNVLNPNSAMLYTEDRALILQDENHKE
                     RLFKMDLERGKVVEEWVAGGRDVLQIGPNKKFDQLTSEQTFLGIAPNSVFQMDPRLSG
                     QNKVVSSSDYSYSSVRDLRSLCTTQLGYVAVGSNKGEIRLYDKLGKRAKTLIPALGEP
                     IRHLCASADGKWLLATCKSSILLFDTEVKEGRNAGALAYQKSFSQGALPQCYVLKVDP
                     STAIYMQTETGAPIEFTKATFNTGLDTKEQTITTSTGPFAMVWPIKSILQGKKTPYVI
                     KKYHSNVTEESFKFGSDRNVIVALKDDISMAKKKSFRAPSRAMLTKMGKQKSRKASKE
                     "
     gene            complement(<87380..>88372)
                     /locus_tag="AGOS_ABL167C"
                     /old_locus_tag="ABL167C"
                     /db_xref="GeneID:4618860"
     mRNA            complement(<87380..>88372)
                     /locus_tag="AGOS_ABL167C"
                     /old_locus_tag="ABL167C"
                     /product="ABL167Cp"
                     /transcript_id="NM_208133.1"
                     /db_xref="GeneID:4618860"
     CDS             complement(87380..88372)
                     /locus_tag="AGOS_ABL167C"
                     /old_locus_tag="ABL167C"
                     /note="NOHBY210; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABL167Cp"
                     /protein_id="NP_982780.1"
                     /db_xref="GeneID:4618860"
                     /translation="MRARRPRLTFLLLVSVLLVSLCQQQPANGGPCANSDVLDQIRAE
                     WRFAALSRRWAPLALLALLRLLVALLALLVALLVALLSLLRLLVALLSLLRLLVTLLS
                     LLSLLRLLVTLLALLRLLVALLALLVALLALLIALLALLVALLALLIALLALLVALLA
                     LLIALLALLVTLLALLVALAESLLACAVLSIVRVSLPSLPIPLYIMLSDSATSHMTLA
                     VAAWPALAVLAGPPLVPPTMAVSTLLLLPAWASSGAVAAAVGRLPFVIVCAFSARHLN
                     CSSGTSLWQSRTSRPPHLMFIYQPLAPLHIVRHSRKCVSGCATYRRRSALPRLP"
     gene            <88547..>89791
                     /locus_tag="AGOS_ABL166W"
                     /old_locus_tag="ABL166W"
                     /db_xref="GeneID:4618861"
     mRNA            <88547..>89791
                     /locus_tag="AGOS_ABL166W"
                     /old_locus_tag="ABL166W"
                     /product="ABL166Wp"
                     /transcript_id="NM_208134.1"
                     /db_xref="GeneID:4618861"
     CDS             88547..89791
                     /locus_tag="AGOS_ABL166W"
                     /old_locus_tag="ABL166W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL207W (RIO2)"
                     /codon_start=1
                     /product="ABL166Wp"
                     /protein_id="NP_982781.1"
                     /db_xref="GeneID:4618861"
                     /translation="MKLDTSNMRYLTADDFKVLRAVEFGSRDHELVPVHLIHRNSGMR
                     AMSGTNRSIGDLAKLKLVSKLRNAKYDGYVLTYNGFDYLALKSLLEKNAIYSVGNTIG
                     VGKESDIYQVSDAASQSLVMKIHRLGRTSFHTVKTKREYLKRGQSANWMRLSHLSAER
                     EYAYMCLLYSKGFSVPKPYANSRHAIVMEYIRGYPMRRLRSHSNVPKLYSDLMAFVVK
                     LANHGMIHCDFNEFNIMIKDDIDDPEDQGFVVIDFPQCISIQHQEAEYYFKRDVDCIR
                     RFFKKKLKYEPKSDRTFLDTDGFGDGFRYAYPVFARDVNRCDNLDELVMASGFKKQHP
                     GDRDLEQSMDAMRNTDYTDEQSDSDAEEDTESEEYDELSEEDSEEEEDDLEEENKRII
                     EALSTGVGKLKMDNLGNYILEE"
     gene            complement(<89837..>91102)
                     /locus_tag="AGOS_ABL165C"
                     /old_locus_tag="ABL165C"
                     /db_xref="GeneID:4618862"
     mRNA            complement(<89837..>91102)
                     /locus_tag="AGOS_ABL165C"
                     /old_locus_tag="ABL165C"
                     /product="ABL165Cp"
                     /transcript_id="NM_208135.1"
                     /db_xref="GeneID:4618862"
     CDS             complement(89837..91102)
                     /locus_tag="AGOS_ABL165C"
                     /old_locus_tag="ABL165C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL206C (RTT106)"
                     /codon_start=1
                     /product="ABL165Cp"
                     /protein_id="NP_982782.1"
                     /db_xref="GeneID:4618862"
                     /translation="MPEFLERLPHAVKQKVLQISNNDAKILGVFEQVFQCGQENQDAR
                     RKAVKTGVSERLEDSELIFELRDVSFLSPIRKKLNLAITIGSDGKPALLFNKDRVPEM
                     AIPNLQESVKFAAFLPFPEKKNLLYLFIVYRTASDEAPDPVLLTMNKEGVLKQFKDKG
                     LIPVDSSNFGECVDYMRKQAILTGFRIGDPFSNSQGPPAFHVECHRGTKEGTLYFLPD
                     HIIFGFKKPILVFESNEIESITYSSITRLTFNVTLITKNQEKYEFSMIDQSEFANIDE
                     YVKRNQVKDKSMSDELKAKPMVKAHQVGEQSALKEAQQQLRENRPTGGVPIDSDDEEA
                     DGNFESESELSDGSGSDSEADSDEDADDTDDSDGTNDTHDVLQHEEIQIAAADAEDEV
                     LPDFDQAEAGIDIVIEEDDEEEGSGVEYD"
     gene            complement(<91564..>92646)
                     /locus_tag="AGOS_ABL164C"
                     /old_locus_tag="ABL164C"
                     /db_xref="GeneID:4618863"
     mRNA            complement(<91564..>92646)
                     /locus_tag="AGOS_ABL164C"
                     /old_locus_tag="ABL164C"
                     /product="ABL164Cp"
                     /transcript_id="NM_208136.1"
                     /db_xref="GeneID:4618863"
     CDS             complement(91564..92646)
                     /locus_tag="AGOS_ABL164C"
                     /old_locus_tag="ABL164C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL226C (GCS1) and YNL204C (SPS18)"
                     /codon_start=1
                     /product="ABL164Cp"
                     /protein_id="NP_982783.1"
                     /db_xref="GeneID:4618863"
                     /translation="MSEWKVDPDNRRRLLQLQKLGGNKKCADCGAPNPQWASPKFGIF
                     ICLECAGIHRGLGVHISFVRSITMDQFKPEELERMEHGGNAQFHEYLAKHGVDQKLPQ
                     KAKYDNPVAASYKEKLTCVCEGKDWVEPDLSGAGGATLDRGSSEQASPGTATPNGGAE
                     KLESRRATGPADEQKLRNENYFATLGKKNQTKPEHLPPSQGGRYQGFGNTPTPTNPNQ
                     ARQGGTTADLSLDNLQKDPWGTLTKGWGLFSTAVTKSVEEVNESVIKPGVQHLQSSEL
                     SAEAQRAAQQFGQKFQETSSSGISAFSRWTKNLQQQYVQQSPGAPDQDSQYSRLFDSL
                     ESRSKDHSQLRAQKKGGEADTEWDDF"
     gene            <93015..>93893
                     /locus_tag="AGOS_ABL163W"
                     /old_locus_tag="ABL163W"
                     /db_xref="GeneID:4618864"
     mRNA            <93015..>93893
                     /locus_tag="AGOS_ABL163W"
                     /old_locus_tag="ABL163W"
                     /product="ABL163Wp"
                     /transcript_id="NM_208137.1"
                     /db_xref="GeneID:4618864"
     CDS             93015..93893
                     /locus_tag="AGOS_ABL163W"
                     /old_locus_tag="ABL163W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL202W (SPS19)"
                     /codon_start=1
                     /product="ABL163Wp"
                     /protein_id="NP_982784.1"
                     /db_xref="GeneID:4618864"
                     /translation="MPNTLDKSYVQNGPWRDGVFQGKVVFVTGGAGTICRVQAEAMVL
                     LGAKAAIIGRNVEKTKKAAAEIAELGDSADCVLGIGGVDVREVADMKRAVEQTVAAFG
                     RIDYVIAGAAGNFLADMTNLSSRAFKTVLDIDLVGSYNTVKATLSELAKNKGAVLFVS
                     ATLHYTGTPLQAHVSAAKAGVDALSNVLAVELGPLGIRCNCIAPGLIGGTEGVDRLSG
                     GLPVTDAVKKIPLQRPGLTKDIADGTVYLFSPAASYTTGTILVVDGGAWHLGNLMGTH
                     FPETLKRKQSVLKSKF"
     gene            complement(<94114..>96630)
                     /locus_tag="AGOS_ABL162C"
                     /old_locus_tag="ABL162C"
                     /db_xref="GeneID:4618865"
     mRNA            complement(<94114..>96630)
                     /locus_tag="AGOS_ABL162C"
                     /old_locus_tag="ABL162C"
                     /product="ABL162Cp"
                     /transcript_id="NM_208138.2"
                     /db_xref="GeneID:4618865"
     CDS             complement(94114..96630)
                     /locus_tag="AGOS_ABL162C"
                     /old_locus_tag="ABL162C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL201C (PSY2)"
                     /codon_start=1
                     /product="ABL162Cp"
                     /protein_id="NP_982785.2"
                     /db_xref="GeneID:4618865"
                     /translation="MAKESLRIGVASTEPKRVKVYILEDNEWRDTGTGFCTGQCEQDK
                     PHAYLLVRDEEQPERVLLKSKLEGNIEYQRQEETLIVWKDLQGQDIALSFEESTGCNA
                     LCEFICLVQKTFENNISLVSVRSNDDGMGSVHEIITGPVHLPSNDPQQNEETLMESLR
                     ILNENTSFEFLKNETVDFILNTNYLHTLINHFHIAEEKLLHKDLLLLSHIIKTLFLYN
                     EREVLEQLIDDKHYMGVVGILEYDTDFPDCKASHRKCLQGVRPKFQEVIPLNDENMRQ
                     TINKTFRLQFLKDVVLIRFLDDHAFNLITDVMLTYQTTIIRCLQEGSFIDDLVNLYTN
                     NADTSDSDLIERKRQGIRLLDECVQISCNLDPPDRSIFYKVLVKKGLFNVLDFAFNVE
                     TNSDIRILATDMIISIIEYDILLINSVRNEVDDSPFAATNEDSNINTGLIDEGGADSA
                     DNNCNGNSAVKAGESNGAESPIAPPGSRSPSRHTSDISLLLILSKILLTDQSPGLKEQ
                     AFQALITLLDPEDFMGEEYEDQSNLESLMKFYANSKLREKPSTPPQFQLLEYFTKFYE
                     QVAPVLFQSFISGEVEGMDDQLLLRLVKLVDLLIHEHDIMLSRGFILENGILLTIGKL
                     MEPSHIIQLRLAAVRCIKGIVAVNDEFYHNYLISKNLFDPICQLLQENLYFDNMANSC
                     VLDLFKVISARFGQDQEYAEVSTKNFLVLNQYLVERFGPLLEKVDYVPYTSSMIQMSR
                     VGRDAINKQQDNNGERNTTTGGEADNEEFDVMGAMDSSLASESDGENNENNEESPYGG
                     AQNSKRSFSDIEDNTIGVEKGNPEPGLPIKKLAEEISESS"
     gene            complement(<97049..>97780)
                     /locus_tag="AGOS_ABL161C"
                     /old_locus_tag="ABL161C"
                     /db_xref="GeneID:4618866"
     mRNA            complement(<97049..>97780)
                     /locus_tag="AGOS_ABL161C"
                     /old_locus_tag="ABL161C"
                     /product="ABL161Cp"
                     /transcript_id="NM_208139.1"
                     /db_xref="GeneID:4618866"
     CDS             complement(97049..97780)
                     /locus_tag="AGOS_ABL161C"
                     /old_locus_tag="ABL161C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL200C"
                     /codon_start=1
                     /product="ABL161Cp"
                     /protein_id="NP_982786.1"
                     /db_xref="GeneID:4618866"
                     /translation="MHQPMELKQLTGEQAAALDAELMGPDVGYSLHQLMELAGLAVAQ
                     VVVRHWGAAQAKKKVLVLCGPGNNGGDGLVAARHLRLFGYDPVVYLPRLSAKQPFYAQ
                     LAKQLHFVGVPVLSEGDDWRAHLEPRDTLCVVDALFGFSFRPPLREPFASIVAELKRH
                     EDDIPIVAVDIPSGWDVDAGPLTPSDLMPRVLISLTAPKRCSAHIDTGVTTHYVGGRF
                     IPDALARRHGFDPFPYSGTDQILRI"
     gene            complement(<97908..>99170)
                     /locus_tag="AGOS_ABL160C"
                     /old_locus_tag="ABL160C"
                     /db_xref="GeneID:4618867"
     mRNA            complement(<97908..>99170)
                     /locus_tag="AGOS_ABL160C"
                     /old_locus_tag="ABL160C"
                     /product="ABL160Cp"
                     /transcript_id="NM_208140.2"
                     /db_xref="GeneID:4618867"
     CDS             complement(97908..99170)
                     /locus_tag="AGOS_ABL160C"
                     /old_locus_tag="ABL160C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL199C (GCR2)"
                     /codon_start=1
                     /product="ABL160Cp"
                     /protein_id="NP_982787.2"
                     /db_xref="GeneID:4618867"
                     /translation="MSAFSDRQFSTKSTAYGSPVTGSSQMKLDVFLIKGYQLVSHSGT
                     QDVPTSVSVVLRTAMDETISEKEQQRFQKLSQLYNAIIQNALLLDSSSSPKSAIELYQ
                     RFQQILKELELSGDASPYAKYFCKLEDDAGATWHIRDDQEMQGDSVWHSVSENIKKIY
                     DSDRGLILPILNKRRSAVNSTRNSPPPYKEDPLSYQQLRRKLSKLQGHYDYGGPGDST
                     RTVTAHAPDERDSKNVNGNGAIDFFNGGHSRSRNNDNDALLRGYYTMPTSPTSLWSSG
                     INLSLQSRREFSSQADNDPVEELLQMATGTASNNAAAVAAADRGAAVANANGSETPLQ
                     KNSTATADSTAVASGLTLMDDVQAIPTSLTLKETELYDRLLKEKDERIIELERQLVCE
                     RNECQWLRKLLLEDVGCIRNMLTGMKDR"
     gene            <99825..>101567
                     /locus_tag="AGOS_ABL159W"
                     /old_locus_tag="ABL159W"
                     /db_xref="GeneID:4618868"
     mRNA            <99825..>101567
                     /locus_tag="AGOS_ABL159W"
                     /old_locus_tag="ABL159W"
                     /product="ABL159Wp"
                     /transcript_id="NM_208141.1"
                     /db_xref="GeneID:4618868"
     CDS             99825..101567
                     /locus_tag="AGOS_ABL159W"
                     /old_locus_tag="ABL159W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL225W (SHS1)"
                     /codon_start=1
                     /product="ABL159Wp"
                     /protein_id="NP_982788.1"
                     /db_xref="GeneID:4618868"
                     /translation="MTAVQYSNALPPALFRRKKEQKRGVTYSVLLVGPSGTGKTTFAN
                     NLLESTIFSHRYQTEQPQYQNPMVKVVNPTRVVTFNSKNGIPSYQVPFDPMGAHLEPG
                     ITITATSVEVSTDSSSDDPRDKMCFNLIDTHGIGENLDNELCFDEVVAYLEQQFDLVL
                     AEETRIKRNPRFEDGRIHAALYFVEPTGHGLRELDIEMMKRLSRYTNVLPIIARADSF
                     MEDELSSFKAAVMRDIENYNVPVYKFEVDEDEDDPETLQEVGDLAAIQPFAVVCSDTK
                     GKDGRYVRAYPWGDLFIDDETVSDLRVLKSVLFGSYLQEFKDTTHNLLYENYRAEKLS
                     SISEWDTTKTSSKGTSIVKTEKNSSTPSLSNFASIVNTGNLKSQQSLTKVPNSDVPAP
                     STPSNESDSLFRETESPIRKMSVNIRRDNEEIIRNIKSSPSTAESGSQDRTKLRNISE
                     TLPYVLRHERIIAKQQKLEELEAQSARELQKRIQELEKKAMELKLKEKLLKQQKRNGS
                     TTSIGSTVTATSAASTNLTSGKPTIMQEGTPSTVNRARNGSLVSPSTQVSPSADSSQF
                     ASDGYASRATGQVQ"
     gene            complement(<102437..>104626)
                     /locus_tag="AGOS_ABL158C"
                     /old_locus_tag="ABL158C"
                     /db_xref="GeneID:4618869"
     mRNA            complement(<102437..>104626)
                     /locus_tag="AGOS_ABL158C"
                     /old_locus_tag="ABL158C"
                     /product="ABL158Cp"
                     /transcript_id="NM_208142.1"
                     /db_xref="GeneID:4618869"
     CDS             complement(102437..104626)
                     /locus_tag="AGOS_ABL158C"
                     /old_locus_tag="ABL158C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL224C (WHI4) and YNL197C (WHI3)"
                     /codon_start=1
                     /product="ABL158Cp"
                     /protein_id="NP_982789.1"
                     /db_xref="GeneID:4618869"
                     /translation="MSLVNSHSSASVENAAYNLHRAFSSSTENVGHMTPSNSSPLHHS
                     TVVAMGAESQGGGASNNNNNPANPGSTANNNSNNVNMNSIGGGASLGAGSGATGSISG
                     TKGMNNSHSPLHIATMLNTLSMNSNPPSQQQSNVQGPYLVRLQNVPKDTTLRECHALF
                     ALAHGVLSIELSSFQQYAERSQTSGQESTNYIVAKFDSLHLACQYATILDEKAQIFGP
                     SFPFKTYVEVVDELTQQQIPFQTQMQMHQGSPPAPTHVTAYQQPLLSASGVVSPPQSA
                     SSVKRPSLLVQRSRFSFTDPFSSEQTNMGSQQPDLITTPLKGHQDTGKSFLLMESDEI
                     NDSIWGNGTGIPSSISGLTTSQPPTPHLEWGTTGRRQSSTFYPSQSNTEIPPMHLTGQ
                     VQSSQLATGLQQPLPQPQRQSLSYNLVTPLSSDMNLPPQSSQGGILPHQAPAQTQPQS
                     QALQHHQHLHHQQQQLQQQQHHLQQQQHQQQQQSLSQQPQQQQSQQSQAHSQQHQQQH
                     QQQQQQQQPQQQQPQQHPPQQPQQQNSQQAIVGQSQQQVTSGQQKGSSRNSISKTLQV
                     NGPKNAAAALQNTNGISQVDLSLLAKVPPPANPADQNPPCNTLYVGNLPPDATEQELR
                     QLFSSQKGFRRLSFRNKNNNGNGHGPMCFVEFEDVAHATRALAELYGSQLARTSGTHN
                     NKGGIRLSFSKNPLGVRGPNSRRGGATNNTSNAGTTNYSYAAAFGKS"
     gene            <105305..>105853
                     /locus_tag="AGOS_ABL157W"
                     /old_locus_tag="ABL157W"
                     /db_xref="GeneID:4618870"
     mRNA            <105305..>105853
                     /locus_tag="AGOS_ABL157W"
                     /old_locus_tag="ABL157W"
                     /product="ABL157Wp"
                     /transcript_id="NM_208143.1"
                     /db_xref="GeneID:4618870"
     CDS             105305..105853
                     /locus_tag="AGOS_ABL157W"
                     /old_locus_tag="ABL157W"
                     /note="NOHBY209; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABL157Wp"
                     /protein_id="NP_982790.1"
                     /db_xref="GeneID:4618870"
                     /translation="MGRWQQTGTDCQPVPRGSSGSGKRWQACMRPAIFRWRAARAAGA
                     GPRNWGGGPSSSERSWTLEGAAVWMPRETISGRGPARGSLNTKSGVAGASGTRRAGAR
                     GDFGVAAEAAARSSGRGFARPATCLVLLARLLELLSLLMLLIWRVVTGEMCACHRFCP
                     RFQPAALPKAGGCRGNGRNMGG"
     gene            complement(<106137..>107426)
                     /locus_tag="AGOS_ABL156C"
                     /old_locus_tag="ABL156C"
                     /db_xref="GeneID:4618871"
     mRNA            complement(<106137..>107426)
                     /locus_tag="AGOS_ABL156C"
                     /old_locus_tag="ABL156C"
                     /product="ABL156Cp"
                     /transcript_id="NM_208144.2"
                     /db_xref="GeneID:4618871"
     CDS             complement(106137..107426)
                     /locus_tag="AGOS_ABL156C"
                     /old_locus_tag="ABL156C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL222C (FMP45) and YNL194C"
                     /codon_start=1
                     /product="ABL156Cp"
                     /protein_id="NP_982791.2"
                     /db_xref="GeneID:4618871"
                     /translation="MMFKGVITSLSFLLLLGSCLLGFFTILSGAKHTGVLKNFYWLEA
                     NTSNFNQAPPNTRWYNYNWCEYGDDHTGVCSNNKVMGFAPRDHWGDSSEMPENFISKR
                     ATYFYLSRVGWAMLVIGLFFMVLAILPYIVSIFTEKAAYVSTPALWLALFFVTLAACL
                     YTACYVKARNAFHSRNRYAKLGPRNFAFIWTAVFLLFLNCVWSTFLAASRAVMSFRNR
                     NKNDNYYDPASDKSFDNSTAIHSGATVVPSRKNYFREDGRPARGAAYDGEVMTGHGHQ
                     YNNATNYGVGSKTAAAGAAVAGAAGAYGASNYGHSEPHAPVSKQAAYDTYQAPSAPQT
                     TSYTTSEPYKVYKDPSAKAPKVYVYSESATRDAFPEAVERQNKPSKQGVSRNSGRIVD
                     PTEYQTAKDAASGTTAHDDLAHPRGLGMAAQAAAQAV"
     gene            complement(<107859..>110459)
                     /locus_tag="AGOS_ABL155C"
                     /old_locus_tag="ABL155C"
                     /db_xref="GeneID:4618872"
     mRNA            complement(<107859..>110459)
                     /locus_tag="AGOS_ABL155C"
                     /old_locus_tag="ABL155C"
                     /product="ABL155Cp"
                     /transcript_id="NM_208145.1"
                     /db_xref="GeneID:4618872"
     CDS             complement(107859..110459)
                     /locus_tag="AGOS_ABL155C"
                     /old_locus_tag="ABL155C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL220C (CDC13)"
                     /codon_start=1
                     /product="ABL155Cp"
                     /protein_id="NP_982792.1"
                     /db_xref="GeneID:4618872"
                     /translation="MQGEYQYISRPAELLRFFSSDDIVAQKVEFVAVLTRIVFTPSTS
                     CVLMLQNFEHGRDDRIPYVVKLPCRTWEQSQLVAIVLKLLMHGFGLDTEKVGDESGFD
                     LADIHIKHLCFARCRGKFITNDKNGSILLDEILGIDIDKELRNEAAGSQRLSNEDWGV
                     VNKITDNLIRLDRDSSHRFNFNNLAHSTRQFIDYLKYRTERLTQVDLRMNPMFGANQL
                     LCMKESQDDFNSQQDDPYFNSAEQLHTGFSLPNPLEETAAVSSGYPQGVVTEPKADSP
                     SVELPSTEHGRSYTRDERPVLSMQPISRIMQLTNSSKRKQMPHSPLSTHSAPCDGTNK
                     RPTLPLVPDDATGKRKRTSTTAGVVETALTIDTLENSEEGKLVSTTGFIAGLYPNVYE
                     ECVPRGSSFILYFPLTTADTCEVQDPAKNCIEIYSSDIDYVLQQYDIDHNMDRKEALI
                     LLNSRLDKLEVRLSITKAKLFFSDSTYSFCWELKALQVNAETLTQFTSIKMPNPLPER
                     GNALSIDQLSATTSSATIFAMLICARVDPGSKVHHFSFTDFTENLLISCKLDPYLNDY
                     CNRLKATECIYVKSYPEYIHNLDAYTLRHYNRRLVDCHNGRDTNLTNFGMVFRLKLDV
                     KSYQQRINGIIREAVLITGDTRFTGDEERLLEAFYNRAFQRIENKCFFHNYKRYKVCF
                     PINSLGERNSRLPVPSLLAHTLTLPAECVCARIPAANSDVASHSIKVFSSIAELQSNP
                     LSSEGVLYLLKGKILSTVVDSSKATIYITNDAKLQEEVSVRGFLRLQILGEANVSYFC
                     GADEASTDVLQALNLRAFKFYLLPGEVQISPSKTARVWCPVECSIEELNSQLQLSDNL
                     VKLEQHTCNN"
     gene            <110518..>112141
                     /locus_tag="AGOS_ABL154W"
                     /old_locus_tag="ABL154W"
                     /db_xref="GeneID:4618873"
     mRNA            join(<110518..110587,110640..>112141)
                     /locus_tag="AGOS_ABL154W"
                     /old_locus_tag="ABL154W"
                     /product="ABL154Wp"
                     /transcript_id="NM_208146.1"
                     /db_xref="GeneID:4618873"
     CDS             join(110518..110587,110640..112141)
                     /locus_tag="AGOS_ABL154W"
                     /old_locus_tag="ABL154W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL193W; 1-intron"
                     /codon_start=1
                     /product="ABL154Wp"
                     /protein_id="NP_982793.1"
                     /db_xref="GeneID:4618873"
                     /translation="MKINTMTFRHLSAPCKMTTPTGRRVKFNKAKKVEQQCCEIQEEF
                     YERAIQLEEQAERWVLSDVVKSLRFYSQAYIAYEQGLCARDATDNGTYNILYNQSRML
                     LKVFCEYRAADDYIDLLRYVNMDTVPEASNVLLPLPAIVAKFESAVARFPEKCGWDLY
                     FNLLTCFLLYLEAVDNVAEFEASYARFEATAYVLLQHMQREIESLERRPSEEALSPPA
                     DQPMEVSTGSLATEVVEMMDSASPQDLLDSLVLIYRVVQFALEAALDGTRFGSPDPAF
                     RDRLVLCASRLRSNVENAYNFACGLAGADTQELRLGRHALECLDALLSGDLARFETLL
                     QSAAPTDIDAQLHNVDLLETATTSVQDMDTLWKLCGVLDRTLRTCQDLLTTERSRMIS
                     TQSDLHLLSRTVFRLCDVLTRRADNEVHRLFIQKQGAAETQTLRILYKNARTLLANSV
                     AYAQKSCGFREYVTDKLKRNYVYHQAQRRLLFFDGHGGESTEAHTAVQEVMQQHTYYC
                     VLPSAELQAMADTSG"
     gene            <112378..>115443
                     /locus_tag="AGOS_ABL153W"
                     /old_locus_tag="ABL153W"
                     /db_xref="GeneID:4618874"
     mRNA            <112378..>115443
                     /locus_tag="AGOS_ABL153W"
                     /old_locus_tag="ABL153W"
                     /product="ABL153Wp"
                     /transcript_id="NM_208147.2"
                     /db_xref="GeneID:4618874"
     CDS             112378..115443
                     /locus_tag="AGOS_ABL153W"
                     /old_locus_tag="ABL153W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL192W (CHS1)"
                     /codon_start=1
                     /product="ABL153Wp"
                     /protein_id="NP_982794.2"
                     /db_xref="GeneID:4618874"
                     /translation="MEHGFAGNFSNFQRGSPRRPYTAASGGGEEEQVQQGLEASRGGE
                     TAQLHRDGTAYPPVFSVPPQAARLGGYGVGNGLRSQPAIGIPQATSRNDVLGAHGAQV
                     YSNVVPYNDDEFYEDVGRVSYVHDNSANQNHYYEHKETVPMLEEKSAPYTLSVVEDSQ
                     QSTGLQLTDTERQEGYIDQRGDEYQIISYLDSQGDTVNPYGSGHIMSARTDVDPMYRS
                     ADTPEAYFSTSGSDLSRSGLIGSTPVPKGSGDCSDLSSERLLSGLPQSKQPKNRIVLR
                     KFKLYRGNFIFDCPVSEQLVSQYARGMREDYLTNEYKFMRYQAVTCEPAEFQLKNFTV
                     RQLKYAVPRRTEIMIVITMYNENDILLARTLKGVMDNIKYFTRRKRSDIWGPDAWKRI
                     CVCVVSDGREAINPRSLALMSALGCYQDGFAKDEINGKKVVAHVYEHTTKINITKVSR
                     SKVHLACGDNTVPVQLLFCLKEKNQKKINSHRWAFEALAPVVQPEIVTLLDAGTLPGK
                     DSIYQLWKEFLDPNIGGACGEIRTDLGPGYSKLLNPLVASQNFEYKMSNILDKTTESN
                     FGFISVLPGAFSAYRYAALEGEPLRKYFMGENLNSTVFLSNMYLAEDRILCFEIVIKK
                     NARWLLRYSRASYAATDVPDRIPEFILQRRRWLNGSFFAALYSFVHFYKIWSSGHTIF
                     RKLLLTVEFFYLFITMLIAWFSLSSFFLVFRILTLSLTISYPEYSAFRYLSVIFLWLY
                     GITILITFILSLGNKPKGTPKFYLTTFIFFAILMIYMMFCALYMSVSTIKTMVIENKV
                     SFQALLKSGSFKDIVISMSSTYCLYILSSIVYLHPMHMLTSFIQYVLLSPSYINILNI
                     YAFCNVHDISWGTKGSQPKPLGKLESKADGTVRMEIPVSAREIDYNYNKYLDILQNPE
                     RGMDDSIPSFEEQKTSYLAAVRSLVIIFWIISNFVIIALVLETGGIGQYQYLKAADED
                     EPDTIAILSSNATVYFSAILWLVAIMAAIRFVGCCIYMIKRVSRRFRRN"
     gene            <115605..>116128
                     /locus_tag="AGOS_ABL152W"
                     /old_locus_tag="ABL152W"
                     /db_xref="GeneID:4618875"
     mRNA            join(<115605..115669,115741..>116128)
                     /locus_tag="AGOS_ABL152W"
                     /old_locus_tag="ABL152W"
                     /product="ABL152Wp"
                     /transcript_id="NM_208148.2"
                     /db_xref="GeneID:4618875"
     CDS             join(115605..115669,115741..116128)
                     /locus_tag="AGOS_ABL152W"
                     /old_locus_tag="ABL152W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL219W (DTD1); 1-intron"
                     /codon_start=1
                     /product="ABL152Wp"
                     /protein_id="NP_982795.2"
                     /db_xref="GeneID:4618875"
                     /translation="MRVVIQRVSQASVVVENKLISSIKTGYMLLVGISTEDTIADIEK
                     SVRKVSGLRLFPDDSNAQWKRSIKDIGGEVLSISQFTLIARTKKGTRPDFHEAQKGHL
                     ALEMYDRFLDLLRQELGEKQVQDGEFGAMMSCSLTNEGPVTIIYDTKE"
     gene            <116349..>117422
                     /locus_tag="AGOS_ABL151W"
                     /old_locus_tag="ABL151W"
                     /db_xref="GeneID:4618876"
     mRNA            <116349..>117422
                     /locus_tag="AGOS_ABL151W"
                     /old_locus_tag="ABL151W"
                     /product="ABL151Wp"
                     /transcript_id="NM_208149.1"
                     /db_xref="GeneID:4618876"
     CDS             116349..117422
                     /locus_tag="AGOS_ABL151W"
                     /old_locus_tag="ABL151W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL191W (DUG3)"
                     /codon_start=1
                     /product="ABL151Wp"
                     /protein_id="NP_982796.1"
                     /db_xref="GeneID:4618876"
                     /translation="MCRFLIFKGTEPIRLAHLLTRPAHSIINQSFDSRLRLDMRRPIN
                     GDGFGVAYYPNDAELDGSGPCLFKATTPAWNNQNLESLAEKTKSNLVFAHVRASTYGV
                     LSETNCHPFTYHQITFMHNGGIANFRKIKRRLLLHLEEEFFNCIQGSTDSECCFVLYL
                     DTLYKLGYDPSREQGDFGHQVLRQALARTIEYIKDWTKDAAEDIDATHEPSLLNFAVT
                     DGVSVVVSRYVTSRTDEAASLHFSCGSSFVEYAPGEYRMQRLDRNQDVVMVASEPLTF
                     ERGDWTTVPTNSILTIKNQTVLLHPIIDEYYQNDPLYERNASLAESKGLIGSVPLGQP
                     AAKDVPPLEREGRTRPCTAMHSA"
     gene            <118310..>119941
                     /locus_tag="AGOS_ABL150W"
                     /old_locus_tag="ABL150W"
                     /db_xref="GeneID:4618877"
     mRNA            <118310..>119941
                     /locus_tag="AGOS_ABL150W"
                     /old_locus_tag="ABL150W"
                     /product="ABL150Wp"
                     /transcript_id="NM_208150.1"
                     /db_xref="GeneID:4618877"
     CDS             118310..119941
                     /locus_tag="AGOS_ABL150W"
                     /old_locus_tag="ABL150W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL189W (SRP1)"
                     /codon_start=1
                     /product="ABL150Wp"
                     /protein_id="NP_982797.1"
                     /db_xref="GeneID:4618877"
                     /translation="MESESSATNKFVPEYRRTNFKNKGRFSADELRRRRDNQQVELRK
                     AKRDEALAKRRNFSATTAAGGNESEEEDGETESQDQQFYQQLTQELPQMLQQIQSNDF
                     QEQLAATVKFRQILSREHRPPINLVIDSGVVPTLVSFMNENQPEMLQLEAAWALTNIA
                     SGTSEQTRFVVDAGAVPLFIQLLYSNSVEVKEQAIWALGNVAGDSTSYRDYVLDCGAM
                     EPILSLFEVSKTSLIRTATWTLSNLCRGKKPQPDWNKVSQALPTLAKLIYSIDTETLV
                     DACWAISYLSDGPVNAIQAVVDARIPKRLVELLTHQSTLVQTPALRAVGNIVTGNDLQ
                     TQIVINCGVLPALRNLLTSPKDSIRKEACWTISNITAGNTDQIQAVIDANLIPPLVKL
                     LETAEYKTKKEACWAISNASSGGLQRPEIIRYLVSQGCIKPLCDLLEIADNKIVEVTL
                     DALENILKMGEAEKEARGAAVNENAEFIEKAGGMEKIFNCQSNANEKIYEKAYNIIEK
                     YFGAEDDNIDEAMAPQAAGNTFGFGSNMNQQFSFN"
     gene            <120226..>121218
                     /locus_tag="AGOS_ABL149W"
                     /old_locus_tag="ABL149W"
                     /db_xref="GeneID:4618878"
     mRNA            <120226..>121218
                     /locus_tag="AGOS_ABL149W"
                     /old_locus_tag="ABL149W"
                     /product="ABL149Wp"
                     /transcript_id="NM_208151.1"
                     /db_xref="GeneID:4618878"
     CDS             120226..121218
                     /locus_tag="AGOS_ABL149W"
                     /old_locus_tag="ABL149W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL188W (KAR1)"
                     /codon_start=1
                     /product="ABL149Wp"
                     /protein_id="NP_982798.1"
                     /db_xref="GeneID:4618878"
                     /translation="MSTSSGRPRGHQEPMGSAYLPSKKSRLMSENRVSKINRLYEDVQ
                     KRKSRPGAEHAHRDSVVSNSSTSVLTVEGGLEDATMLQGLLDRGPRAYGDLTLRPPAV
                     RPLRPRTLSPGRLRESLQSPLTSDADSMADEEEDLKLTPKLRSRRSIIRMSAESTPYR
                     YALEERTRPTNKKSTTRMQLRSQLGQPLPLGYIAHAATRPRAEDTHRVDLESRLRNIM
                     QKDRTSFEKRLQQIRQGYHELPIGIQDDALSLQNKTRESEASETTISFRDNTGVVAET
                     EVLRSELNRHAQKLDEVLTLLRSTPTNSHAELISWSACVIILLLCNVYVYYYFP"
     gene            complement(<121309..>121914)
                     /locus_tag="AGOS_ABL148C"
                     /old_locus_tag="ABL148C"
                     /db_xref="GeneID:4618879"
     mRNA            complement(<121309..>121914)
                     /locus_tag="AGOS_ABL148C"
                     /old_locus_tag="ABL148C"
                     /product="ABL148Cp"
                     /transcript_id="NM_208152.1"
                     /db_xref="GeneID:4618879"
     CDS             complement(121309..121914)
                     /locus_tag="AGOS_ABL148C"
                     /old_locus_tag="ABL148C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL217C (TIM22)"
                     /codon_start=1
                     /product="ABL148Cp"
                     /protein_id="NP_982799.1"
                     /db_xref="GeneID:4618879"
                     /translation="MVYRGFGLEHISPPVNKPFAEMTPEEQGERGAQMMMEFMTSCPG
                     KSAISGVTGFALGGVFGLFMASMAYDTPLHTPAPVGAGPGAGIPGAPTLQQMADLPLK
                     QQIKIQFADMGRRAYSSAKNFGYIGMIYSGVECTIESLRAKNDLYNGVAAGCLTGGGL
                     AYKSGPSAALIGCAGFAAFSTAIDLYMRSENGRPPKNDFDE"
     gene            <122094..>123317
                     /locus_tag="AGOS_ABL147W"
                     /old_locus_tag="ABL147W"
                     /db_xref="GeneID:4618880"
     mRNA            <122094..>123317
                     /locus_tag="AGOS_ABL147W"
                     /old_locus_tag="ABL147W"
                     /product="ABL147Wp"
                     /transcript_id="NM_208153.1"
                     /db_xref="GeneID:4618880"
     CDS             122094..123317
                     /locus_tag="AGOS_ABL147W"
                     /old_locus_tag="ABL147W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL187W (SWT21)"
                     /codon_start=1
                     /product="ABL147Wp"
                     /protein_id="NP_982800.1"
                     /db_xref="GeneID:4618880"
                     /translation="MNILAHTGDIFHGRGKLHASLKEQQVWDDLRRPGHDVPQLPRPQ
                     GYTASQPIYKRLPVVCRGLTWSFDGSSLVAVHEDCGIRQYAVCEEQGPVMAPVQRFFK
                     PQAIISHAVHPQNSLFQADSSLNVVVVSCKDMPYQLYPLHSNPDQPARALQTYNSASE
                     STEEFRAAYAMDFLDDAHFLAGSTRNTVSLFDASRRESIWVSSATRRGCGRGQHKAIV
                     SCFDEANERRDCVRYAGTYRSELLRIDPRTSSISSWKAIQDKSRGIYQVLQSNNGHYF
                     YIMKRYSNSITVLDSRKSMAIVNQFKLPFQTHAQKLRGTYSTRHGLLIGDEAGRILQW
                     APEVVEFGGIDRSGSVPSYGIGETGITHVCAEGSRINIIEKNPADSDIFAISYSPDKY
                     GEDVSCNAGILLMRL"
     gene            complement(<123312..>124574)
                     /locus_tag="AGOS_ABL146C"
                     /old_locus_tag="ABL146C"
                     /db_xref="GeneID:4618881"
     mRNA            complement(<123312..>124574)
                     /locus_tag="AGOS_ABL146C"
                     /old_locus_tag="ABL146C"
                     /product="ABL146Cp"
                     /transcript_id="NM_208154.1"
                     /db_xref="GeneID:4618881"
     CDS             complement(123312..124574)
                     /locus_tag="AGOS_ABL146C"
                     /old_locus_tag="ABL146C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL216C (RRI1)"
                     /codon_start=1
                     /product="ABL146Cp"
                     /protein_id="NP_982801.1"
                     /db_xref="GeneID:4618881"
                     /translation="MDTPSAALHRHTVGQLRKLLLHREGSAGCGRLQPALDGSQPLDS
                     PLSTVPSSRSQVRVQQELWKQDPTYFQKAALSALACMKILRHAFDGGDMEVLGMLLGY
                     VQDEMIVVVDSYRLPVEGTETRVNAQMESYEYTVQYLETAVPEGLAIVGWYHSHPGYG
                     CWLSGIDAETQTLNQNFQDPYLAIVVDPKRSKASGVIDIGAFRTMPETADTRSVSSHS
                     NASRYGHHSARYYELEVSYFEVPQERRWCDSRLSVEPPKPADATERAMLAQLLEAAKA
                     CKNVKRLQTVDRALVPESIGPYALREQADQDLQFRRPLRSFSSNSIARRSSTEVALGN
                     ANEELDPLPTLADANLRNHDSPSADMAMDNTSISSNEEQPHLTFQESSGVQLNAAETE
                     YFDIKNELLTLKLLEYQKARFYRDAFTL"
     gene            <124839..>127088
                     /locus_tag="AGOS_ABL145W"
                     /old_locus_tag="ABL145W"
                     /db_xref="GeneID:4618882"
     mRNA            <124839..>127088
                     /locus_tag="AGOS_ABL145W"
                     /old_locus_tag="ABL145W"
                     /product="ABL145Wp"
                     /transcript_id="NM_208155.1"
                     /db_xref="GeneID:4618882"
     CDS             124839..127088
                     /locus_tag="AGOS_ABL145W"
                     /old_locus_tag="ABL145W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL186W (UBP10)"
                     /codon_start=1
                     /product="ABL145Wp"
                     /protein_id="NP_982802.1"
                     /db_xref="GeneID:4618882"
                     /translation="MSVTKDSIKPLVDRIVSQPLHFSKAKNQDQVMIDPRSYIVIGER
                     RNGTVESKKSRNESGVSDSSGAGEPGLSGVAAERKPRSFQEALQLYTVGSSSTKPKKR
                     QMKNQDISDDEYTASSSDEEEDITTASAKAGQSLSSSSDEFYEAHEHAAGTSTAAGVD
                     WQPALAGSPDEEDIGEDIGEEVGGDSVHSSRESSVGVVEADQGSSSDEEYNPEGDNGS
                     IEESDVCMAAGERRKMPEMESESDDEYELASSGSIQSERQQLQQEVDEHAAEEAKSVL
                     PADADKLHGEHDAQVSLQKLTVPELELATSPTPPTTLSDTGEFYQFSENDHDRGTNAP
                     HRIKKNWGPALATSRPKGLLNHGVTCYQNAAVQAMLHIPALQHYLFDIAQGKYKDVIS
                     PSSVSQVLAETSKRMWSLENGKSKASYINPKKLIGRLEDINCMMSVWNQEDSHEYFMS
                     LISRLQEDSVPRGHKMTESLIYDIFGGLLQQRVKCKSCGSVSITEQPIYDLSLHLKGK
                     KLAKGDDSTVDDSITGDVKNSAAPSGSTDGAELPKRRYSIEKSIRDFFNPELIKKVDN
                     KEGYVCEKCKATTNAIKRNMILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPLFMDLT
                     EYCVEAAKCLPVKYQLISVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYINKITERN
                     VLKEVNAYYLVYTRLTPKSVKLTEKMDSHAHDLKNSSAAARATHTAQDLVPSRKKKFK
                     KSKKRRLNK"
     gene            complement(<127322..>127771)
                     /locus_tag="AGOS_ABL144C"
                     /old_locus_tag="ABL144C"
                     /db_xref="GeneID:4618883"
     mRNA            complement(<127322..>127771)
                     /locus_tag="AGOS_ABL144C"
                     /old_locus_tag="ABL144C"
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /transcript_id="NM_208156.1"
                     /db_xref="GeneID:4618883"
     CDS             complement(127322..127771)
                     /locus_tag="AGOS_ABL144C"
                     /old_locus_tag="ABL144C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL185C (MRPL19)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /protein_id="NP_982803.1"
                     /db_xref="GeneID:4618883"
                     /translation="MSQRAKEILVKLIVGAGQAAPSPPVGPALGSKGIKAMDFCKEFN
                     ARTASYTPGVPIPVLITIKPDRSFTFEMKSPPTGYLLLRALNQEKGHGKPNIKKPEGT
                     LGELSLKHIYEIAKIKKADGRHTYLDMENIVKSVVGVAKSMGIAVVP"
     gene            complement(<128215..>130428)
                     /locus_tag="AGOS_ABL143C"
                     /old_locus_tag="ABL143C"
                     /db_xref="GeneID:4618884"
     mRNA            complement(<128215..>130428)
                     /locus_tag="AGOS_ABL143C"
                     /old_locus_tag="ABL143C"
                     /product="ABL143Cp"
                     /transcript_id="NM_208157.3"
                     /db_xref="GeneID:4618884"
     CDS             complement(128215..130428)
                     /locus_tag="AGOS_ABL143C"
                     /old_locus_tag="ABL143C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL183C (NPR1) and YDL214C (PRR2)"
                     /codon_start=1
                     /product="ABL143Cp"
                     /protein_id="NP_982804.3"
                     /db_xref="GeneID:4618884"
                     /translation="MSSLTKLLQERRRESTAVRNFEEVDAAGAAQSVRDRQITVLGVQ
                     KPPLTHVSSSTTTITQVDSDTDSDTTPLGSKDGGRFSKAFLESSVGSTISYGNGGAFC
                     GRERQSLVPMGDCVSGVFKGSRATGSSASGRNLPSLSSSIPYSVPNSNSGGERTGTNG
                     AMNMPSSWVEKYGNPLPRNVSVIDSNIISSPKVDSVEPRFMISRQKLQKCSTDANPGH
                     AIPQSSSISSQLSNLFTKAAKDPPVTNCNPTILAASIANKETTAYGKSIPKPIHMRRG
                     SIYSASRQNFGSLNDPFIESPSPLYDSNMGQHNYRSRHSSFADLKRFFKRSSSSGQLS
                     TSPGTPPASAGSLSSQSSTHSSSITSCSYGSQSGGDTLLYNASIGTQTIPFSKRYSRT
                     GEKLGAGAGGSVKLVRRLKDNVVFAVKEFRPKHENETKRDYIKKITSEYCIGSTLRHS
                     NIIATIEIVYENNRILQVMEYCDYDLFAIVMSNRMSYEEICCCFKQILIGIGYLHSLG
                     LAHRDLKLDNCVLNSQGIVKIIDFGAAVVFTYPHSGTLVEASGIVGSDPYLAPEVCIF
                     SKYDPRPVDIWSAAIIYACMILKKFPWKIPKLKDNSFKFFCSGRDCDSLSALVTRTAD
                     PPPYDPAGDSSDRSQTCSNNPADPNNPNIGPQRLLHSLPEESHQIIGRMVSLAPACRA
                     SIEEIMEDSWIKSIDMCYVAGDNGKSISAKSHTHTQVDQSEAHIAGLERKKRAAK"
     gene            complement(<130875..>131498)
                     /locus_tag="AGOS_ABL142C"
                     /old_locus_tag="ABL142C"
                     /db_xref="GeneID:4618885"
     mRNA            complement(<130875..>131498)
                     /locus_tag="AGOS_ABL142C"
                     /old_locus_tag="ABL142C"
                     /product="ABL142Cp"
                     /transcript_id="NM_208158.1"
                     /db_xref="GeneID:4618885"
     CDS             complement(130875..131498)
                     /locus_tag="AGOS_ABL142C"
                     /old_locus_tag="ABL142C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL213C (NOP6)"
                     /codon_start=1
                     /product="ABL142Cp"
                     /protein_id="NP_982805.1"
                     /db_xref="GeneID:4618885"
                     /translation="MAEDQKLTKKQLKAQNFRKSKDEKTEEKKRPLQSEPKEPETGHA
                     EPAVKKRKTRRGKGGKGKVDSNGNRFLVFVGSLPKGITESELQAHFKTSSPDVIRLRP
                     DKNIAFLEFDGKKDPSTIQRRMDIALLQHGTQLKGKKINVELTVGGGGNSQQRLEKLR
                     QKNDKLSEERATRMKALIQDSRAKKTSAEDESRVVQGVHPDRAKLLQ"
     gene            complement(<131706..>133262)
                     /locus_tag="AGOS_ABL141C"
                     /old_locus_tag="ABL141C"
                     /db_xref="GeneID:4618886"
     mRNA            complement(<131706..>133262)
                     /locus_tag="AGOS_ABL141C"
                     /old_locus_tag="ABL141C"
                     /product="ABL141Cp"
                     /transcript_id="NM_208159.1"
                     /db_xref="GeneID:4618886"
     CDS             complement(131706..133262)
                     /locus_tag="AGOS_ABL141C"
                     /old_locus_tag="ABL141C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL182C (IPI3)"
                     /codon_start=1
                     /product="ABL141Cp"
                     /protein_id="NP_982806.1"
                     /db_xref="GeneID:4618886"
                     /translation="MDEQVIFTTAVSGTVCQVHSVGQANLRQCAASTPNSAVLMGDKL
                     LVAQANKALINVYSVDSRSKKEALEQRLPLPEQLSCLAVVENHTGDAGVHQQLPYLLL
                     GSTPSGKLYVWEAGSGKLLTVKAMAHYQAITKMQAIINGKYVVTAGADSRLIIWQTAS
                     LVLEEEPKPLYVLHDHTLAITDFAVSNAHNGKYLNSKLYTVSEDMTVRCYQLSSQLEQ
                     PQLLATFTFPLALTSIALDPADRCLYVGTREGAFALPLFYKLDSSGATLVNLLQPGKH
                     QIYSIVPEQAGVEVNKQELYRMGQLLCSKMLSCHVSLIRVSMDGSMVLLATGSGNCVV
                     VDTYSKQPVKELAPLLAPGTQTGPVSNIITRSMTVKSDSLLQDLNLADARATEAIKIP
                     ALAKTVFDKTGTHDIIYCAPTDTLSSVLPRALDLPQYLDMIAEEDSVFANTPVTRSTV
                     KVVGELAPAKAEALPASSAEAQQSADDTDAEVARLRESLQQLTGAYKDLRALHEKLYE
                     EHEKLLQTSK"
     gene            <133515..>134693
                     /locus_tag="AGOS_ABL140W"
                     /old_locus_tag="ABL140W"
                     /db_xref="GeneID:4618887"
     mRNA            <133515..>134693
                     /locus_tag="AGOS_ABL140W"
                     /old_locus_tag="ABL140W"
                     /product="ABL140Wp"
                     /transcript_id="NM_208160.2"
                     /db_xref="GeneID:4618887"
     CDS             133515..134693
                     /locus_tag="AGOS_ABL140W"
                     /old_locus_tag="ABL140W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL181W"
                     /codon_start=1
                     /product="ABL140Wp"
                     /protein_id="NP_982807.2"
                     /db_xref="GeneID:4618887"
                     /translation="MPLNILGTLIFEGTDKIPFYPQIKRYAPYVAVIGGLKYWLRGRS
                     NTWERNLHGKVYIVTGATSQGMGTSVVLDMARRGAQLVILTRSTDEWASEWCEQLREQ
                     SNNQLIYLEKCDLADLHQVRKFATTWLDNSPPRRLDGCIIMSGDIEPLGWPWARGIAP
                     RRFSPYGVEIQVATNFAGTFHLLHLLQPSFKAQPPDRNVRIIVTTCFLQALGTANVED
                     PLWLKDSGLRSLRLFSSSKLQLSLCMLELQRRMFQDIKKTSKDGRSGKNISVTLVDPG
                     LMRSSSLRRVVSNGSVWLLLMLYCGILYPIIWLIAKSGYRGAQVVLHALMSPELEEVN
                     RADPESVLYLVDCQKAPFARSEFKDTELQKKLYDATVERIMALEKKVAAKRNIAKNTK
                     "
     gene            complement(<134909..>135793)
                     /locus_tag="AGOS_ABL139C"
                     /old_locus_tag="ABL139C"
                     /db_xref="GeneID:4618888"
     mRNA            complement(<134909..>135793)
                     /locus_tag="AGOS_ABL139C"
                     /old_locus_tag="ABL139C"
                     /product="ABL139Cp"
                     /transcript_id="NM_208161.1"
                     /db_xref="GeneID:4618888"
     CDS             complement(134909..135793)
                     /locus_tag="AGOS_ABL139C"
                     /old_locus_tag="ABL139C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL180C (RHO5)"
                     /codon_start=1
                     /product="ABL139Cp"
                     /protein_id="NP_982808.1"
                     /db_xref="GeneID:4618888"
                     /translation="MCFSQSGRLSAQAADTMRSIKCVVIGDGAVGKTSLLISYTTNSF
                     PQDYIPTVFDNYSTTIAVQDPASSTGEQQLFKLNLWDTAGQEEYDRLRPLSYPQTDIF
                     LICFSINEPVSFQNIRDKWFPEIKHNTNYENMELFLECGKYPILLVGTKADLRDDDHE
                     EDRLREMNTDFVSQAEIERVVQDCGFMGYVECSAATQEGVREVFERAVKYVVYEPDRL
                     MNRSKNMSILVNSPLPLDSYANEDASNPKNKGGDPSAGSGPLKKAVGDDGAHGKELRV
                     SADKLKKKRRKRSRCTIL"
     gene            <136377..>137111
                     /locus_tag="AGOS_ABL138W"
                     /old_locus_tag="ABL138W"
                     /db_xref="GeneID:4618889"
     mRNA            <136377..>137111
                     /locus_tag="AGOS_ABL138W"
                     /old_locus_tag="ABL138W"
                     /product="40S ribosomal protein S3"
                     /transcript_id="NM_208162.2"
                     /db_xref="GeneID:4618889"
     CDS             136377..137111
                     /locus_tag="AGOS_ABL138W"
                     /old_locus_tag="ABL138W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL178W (RPS3)"
                     /codon_start=1
                     /product="40S ribosomal protein S3"
                     /protein_id="NP_982809.2"
                     /db_xref="GeneID:4618889"
                     /translation="MVAVISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPT
                     TTEVIIRATRTQDVLGENGRRINELTLLVQKRFKYQPGTIVLFAERVQERGLSAVAQA
                     ESLRFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFSDGFLIHS
                     GQPVNDFIDTATRHVLLRQGVLGIKVKIMKDPSKSRTGPKALPDAVKILEPKDEDAVV
                     EPSVKDYRPKAPPAQEQAQAQAQVQA"
     gene            <137260..>137865
                     /locus_tag="AGOS_ABL137W"
                     /old_locus_tag="ABL137W"
                     /db_xref="GeneID:4618890"
     mRNA            <137260..>137865
                     /locus_tag="AGOS_ABL137W"
                     /old_locus_tag="ABL137W"
                     /product="ABL137Wp"
                     /transcript_id="NM_208163.2"
                     /db_xref="GeneID:4618890"
     CDS             137260..137865
                     /locus_tag="AGOS_ABL137W"
                     /old_locus_tag="ABL137W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL212W (SHR3)"
                     /codon_start=1
                     /product="ABL137Wp"
                     /protein_id="NP_982810.1"
                     /db_xref="GeneID:4618890"
                     /translation="MVKFTYKDACTVGSALIVSATTFIMGVFFANQAYDYHLLFNANM
                     TQEHYDNALRHYQTLYFTAQPVLYIFGAIAIFGLLGSLIRIYKPNPELQLFEYGSLAM
                     YVLGVCVFLTNIKTGINSAHYGNWGEVTQNQGLAVIASSNIILLVVFVGVLVLQGGLW
                     YSEWEYEQRLETFMAEQEAENSAAPKEPAKGGKKSAKSKKE"
     gene            complement(<138019..>138930)
                     /locus_tag="AGOS_ABL136C"
                     /old_locus_tag="ABL136C"
                     /db_xref="GeneID:4618891"
     mRNA            complement(<138019..>138930)
                     /locus_tag="AGOS_ABL136C"
                     /old_locus_tag="ABL136C"
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /transcript_id="NM_208164.1"
                     /db_xref="GeneID:4618891"
     CDS             complement(138019..138930)
                     /locus_tag="AGOS_ABL136C"
                     /old_locus_tag="ABL136C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL177C (MRPL22)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /protein_id="NP_982811.1"
                     /db_xref="GeneID:4618891"
                     /translation="MFSKSLAALCRIRCTDSVGIRSLTSSAALRATNSESSGSIFGSI
                     TKEVQHDERDSTKLTNRLAAQAGSAEGEAADGNDSVTLATDKTLQDYILARQRPVQSP
                     AAQLLSPLKRRLYAANCAQNGGFYKKDTVVKLPGSSVRYQVKLTRDELDALEPSVYVR
                     SYRIESSIKKATVLLRLLSGLDVKKALTQCHFSDKKVARDVAELLQRGIEDGKELGMD
                     PNDLYIAQIWAGSDGQFQKRPDFKGRGRQGVIVHPRVHIRCILKTKSITKKRLENERL
                     LKELNRKPWVQLASKPVRGSTGGVYKW"
     gene            complement(<139219..>140253)
                     /locus_tag="AGOS_ABL135C"
                     /old_locus_tag="ABL135C"
                     /db_xref="GeneID:4618892"
     mRNA            complement(<139219..>140253)
                     /locus_tag="AGOS_ABL135C"
                     /old_locus_tag="ABL135C"
                     /product="ABL135Cp"
                     /transcript_id="NM_208165.2"
                     /db_xref="GeneID:4618892"
     CDS             complement(139219..140253)
                     /locus_tag="AGOS_ABL135C"
                     /old_locus_tag="ABL135C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL176C (TDA7) and YDL211C"
                     /codon_start=1
                     /product="ABL135Cp"
                     /protein_id="NP_982812.2"
                     /db_xref="GeneID:4618892"
                     /translation="MGYNNTSSPIGSGHGSSGVEKASRPSSVQSTTQMGARHSESMNL
                     SVSWLSTDAWSAAEFATLEGQRNRTESSGFTSTSSTSARSDRWAQTEEAVGTPQMTFV
                     VYSQRYKLTASYTTLCTLIPTTTTLPYSEAATYSAPTTVITTDIAFYKGLVPGDDDKS
                     AARVNGAQKRTIIGSVVGSVCGLLMCAMAAYYLLHLRRQRRKQYSVAREFTHELGRRL
                     EYTTDPDEPAERAPPGRGAQRPTTRGGNARGDRQLEKTADPFGDEYAGLGHGPEAAAL
                     PVSGDAYFTSRYSYVSSMDETTTDQQSDNSYSSELDSIPIHLAPNERTDRQHMGAANT
                     GSQSFLKEVI"
     gene            complement(<140659..>141786)
                     /locus_tag="AGOS_ABL134C"
                     /old_locus_tag="ABL134C"
                     /db_xref="GeneID:4618893"
     mRNA            complement(<140659..>141786)
                     /locus_tag="AGOS_ABL134C"
                     /old_locus_tag="ABL134C"
                     /product="ABL134Cp"
                     /transcript_id="NM_208166.2"
                     /db_xref="GeneID:4618893"
     CDS             complement(140659..141786)
                     /locus_tag="AGOS_ABL134C"
                     /old_locus_tag="ABL134C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL175C (NOP13)"
                     /codon_start=1
                     /product="ABL134Cp"
                     /protein_id="NP_982813.2"
                     /db_xref="GeneID:4618893"
                     /translation="MSDEESATASKVDMQAKALSDPTKKRKAEDEIEIDLTQPVPLSK
                     KQKRLLRRGKITLEQLSEKFNIDQKSIEEYKNEQKETAENDDAEPAAEEEPKPAPRKE
                     KKFGVWIGNMAFDTTQEELRRFVVSKTAGMEAGEVTDADIVRVNMPLAKNDGKQIKNK
                     GFAYVDFATSAQMDAVIGLSEAQLNGRNLLIKNAKSYDGRPAKNDLISMSKNPPSRIL
                     FVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTD
                     RSCRAIAGRPLRMEYGEDRSKRHVRSRPAPSLVDAEPHAPAPADPAPAPAPAPAPRAP
                     RPRKPTRNDHHSRPKSSVALASAQRASAAIVPSQGKKVKFD"
     gene            complement(<142441..>147741)
                     /locus_tag="AGOS_ABL133C"
                     /old_locus_tag="ABL133C"
                     /db_xref="GeneID:4618894"
     mRNA            complement(<142441..>147741)
                     /locus_tag="AGOS_ABL133C"
                     /old_locus_tag="ABL133C"
                     /product="ABL133Cp"
                     /transcript_id="NM_208167.2"
                     /db_xref="GeneID:4618894"
     CDS             complement(142441..147741)
                     /locus_tag="AGOS_ABL133C"
                     /old_locus_tag="ABL133C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR146W (CRP1) and YNL173C (MDG1)"
                     /codon_start=1
                     /product="ABL133Cp"
                     /protein_id="NP_982814.2"
                     /db_xref="GeneID:4618894"
                     /translation="MVDFTFTWPSGPKKVVITGDFDRWQGTVPLEKQPSGDFVVQLPI
                     GVVESDKFYFKFIVDGQWVTSDLYPKDSLTGAENNYVLLSSVGGGIGSRSAPGSAGAA
                     ALRAQPAPGSKKGKKKKKGKKRTRRNRSAGEASPAPGESPVPESYDEDGTSSDSSESE
                     PRDAPHSAASAAAEKAAEAAAEVAAAVAAGAGAAMAVAAAAMHKVPHKLEMGIGPLMR
                     DPSEVAELHQVDGEALNKRLNAERSGQHAGTLDPRASEKLPDDPRDSVRDNINKALAE
                     LDSTRGPAEDTTPLISANSTNPGKMVGLGLTEGIDTSGAIGTPASDSSTSLLPGTLPL
                     DTPTASGKPKDRNVAPVPESTPLREDVTPAREDSSLPETNKPAIPLPYSGPSGKDATP
                     AEDTLKPSGNDQKKSRVPEIAVAGQTTSQNSSIPSSAKDTPAPEGSTPILPGSPLLPS
                     TPEPSEKPSVKGATPSALSQKPISRDSAPADGSKPSIEKATPVPEGSTPILPGSPLLP
                     STPALSDKPSVKGATPSSPAQLVKKDVGSNDGSKSATEGSTPAPEGSTPILPGSPLLP
                     GTPVPVGKSSVKDATPSALSQKPISRDSAPGEESKPSTEKATPVPEGSTPVLPGSPLL
                     PSTPVPSDKPFVKGATPSSPAQSVKKDVGSNDGSKSATEYSTPTPEGSTPILPGSPLL
                     PGTPVPVGKPSGQSATPSALSQKPISRDSKPSEESKPSREKATPVPEGSTPVLPGSPL
                     LPSTPVPSDKPSVKGATPSSPAQLVKKDVGSNDGSKSATEYSTPAPEGSTPILPGSPL
                     LPGTPVPVGKSSVKDATPSALSQKPISRDSAPGEESKPSTEKATPVPEGSTPVLPGSP
                     LLPSTPAPSDKPSVKGVIPSGTAPVKKDAKTSDESKPATEYSTPVPEGSTPVLPGSPL
                     LPGTPVPTNKTSTKDVTPSALSQKPTSRDSAPADGSKPSIEKATPVPEGSTPVLPGSP
                     LLPSTPVPSDKPSVKGATPSSPAQSVRKDIGSNDGSKSATEYSTPAPEGSTPILPGSP
                     LLPGTPVPVGKSSVKDATPSALSQKPISRDSAPGEESKPSTEKATPVPEGSTPVLPGS
                     PLLPSTPAPSDKPSVKGVIPSGTTPVKKDAKTSDESKPATEYSTPAPEGSTPILPGSP
                     LLPGTPVPAGKPSRKTATPRSPAQPVKNDTKPSDKSTPATETSTPTPEGSTPILPGSP
                     LLPHTPVASGKPSESPASVPKKEDVTEKKDDVRSPAKHAATPVLSSPLAAPVPKGKPL
                     VKTASVNQPSKEGSPGSEYTTPLATSPVDVTHSLSGDSAPVKTPVGVTAIPVASKSVN
                     PVDKVEKPVNKNLQPSKGTDTNNTSATTTTGSTPILPGSPLIPSTPVLSGVKANENSP
                     SVESSVPAASNTPSKAAPTDGQTSVKTTTKPAITKEEPKPTPAVAKETPVSTSVAAVS
                     VAKKENTQDVSERPSQAELPSKTRIEPSTSVPVPVPVPAGVSQVTPASPGPRNPSRID
                     PENPPAQVPEEPEKRAAPAPAAQPSLAPRTAVPAPSEAHVTPVTNVPVSEQISSPKVT
                     QPVVESSPATESEKVIKAPAVAAHEIFPPHVVKLTPVSPKKKTSTGSLKKQIIAPREE
                     EQPQPVHAVTGTAIELEEVPSTVELVEVPPSEVPTTHSPIVVGIPLSNDKIVVAPVQI
                     QGDITTQTSAPSTQYTDTYAAPVRQDVPLATTAGRSSVTQSRHSKDAASMATAPSTKQ
                     SFDAHNGRPSSKNSNSSPSRSSTEPKRRSGFFARLKRFLR"
     gene            <148138..>149106
                     /locus_tag="AGOS_ABL132W"
                     /old_locus_tag="ABL132W"
                     /db_xref="GeneID:4618895"
     mRNA            <148138..>149106
                     /locus_tag="AGOS_ABL132W"
                     /old_locus_tag="ABL132W"
                     /product="ABL132Wp"
                     /transcript_id="NM_208168.1"
                     /db_xref="GeneID:4618895"
     CDS             148138..149106
                     /locus_tag="AGOS_ABL132W"
                     /old_locus_tag="ABL132W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML110C (COQ5)"
                     /codon_start=1
                     /product="ABL132Wp"
                     /protein_id="NP_982815.1"
                     /db_xref="GeneID:4618895"
                     /translation="MGVWAAVTWKGGEKSAGSRDLSSLQAPAAMRMGLSVLAGLRSSP
                     CVASRRALSAAAVRRSGDGGMTHFGSRTVPKDEKAKLVGNVFSSVASKYDVMNDVMSL
                     GVHRLWKSHFISKLDAGKRPNASEPLHFIDVAGGSGDIAFGLLDHAEAKFHDTESTMH
                     VVDINPDMLREGEKRAAEQGKYYNDPRVTFLVQNGETLEDIPTASKDVYTISFGIRNF
                     TDIQKGLNTAHRVLKPGGIFYCLEFSKIENPVVDIAYQQWSKLLPVMGSMVANDYDSY
                     QYLVESIQRFPSQDEFKGMIEKAGFASVGYENLTFGTCAIHWGIKV"
     gene            complement(<149191..>151788)
                     /locus_tag="AGOS_ABL131C"
                     /old_locus_tag="ABL131C"
                     /db_xref="GeneID:4618896"
     mRNA            complement(<149191..>151788)
                     /locus_tag="AGOS_ABL131C"
                     /old_locus_tag="ABL131C"
                     /product="ABL131Cp"
                     /transcript_id="NM_208169.1"
                     /db_xref="GeneID:4618896"
     CDS             complement(149191..151788)
                     /locus_tag="AGOS_ABL131C"
                     /old_locus_tag="ABL131C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR275C (BUL1) and YML111W (BUL2)"
                     /codon_start=1
                     /product="ABL131Cp"
                     /protein_id="NP_982816.1"
                     /db_xref="GeneID:4618896"
                     /translation="MRPGLQRQSTDNPSRGRARSTSPSLFFRSASASSLLRFRHGRTK
                     EQPPPEAEEDDIDNCAGACACADEEICDVLPSFQMYNALHRHIPRGNVNADQHDLPPS
                     YQEAYNGSVGGISVSSSRVNLTTIQSLDGVQSDSCINLQALSAQQYSLQTPSHDEPIE
                     DDLANQDDDNINIEKLYSLPKMVTPVEIDIRITKHPVKPHKKPEEESILREYTSGDII
                     NGYVVIKNRSAQPLKFEMFYVTLEGYATVIDRMKGKRTVKRFLRMVDISASWSYSSVE
                     SANGYAYTQSYKDYDNCILGLSNTRVLEPGVKYKKFFTFKFPMQLLDVSCKHEQFSHC
                     LVPPSFGIDKYKSNGKYATIQTNPLLGYGHLGTKGSPILTNDLVSDTVSINYAVDAKI
                     VGKDSKTGKLNIMREKEYNLRFIPFGFCQPFGGEQDPLQQLEDLTNLIQDRLAALRRV
                     FDRLEKKERIRSQDLRSTEAHGTIDEDIQLDPHDELDRKLRQLYVNNRLDAACTSLPL
                     KDSKLIHPHRKLLKSEFKYSYRTKHKSYKKKLFFSGFYSDNNRQSEAAKTGIILLEAD
                     QPKDGFPYLQPSLLKKTNMLANKNKHDQKNWNSLTARLTDRDKQTLENIEVRLQCIQA
                     NNSEQHSPPEITAVTTELVCLTAKSVNSIPIKLDAQLLLNKTKLKDITETFTAYLAEV
                     KEYQSKFEENIVQINELYNISRNTLSRRELAFGDFISAQLLHDIECLANLRVDVRNLH
                     HVLKEQIRTLKNPDDDLTLGEPKATLSSNILTATFSGSSVSSGSAQADLYRSQITRDW
                     VPVEENQYVRNVNVNLVLNQDIKETLVPTFESCLCCRMYCIRVNIKFEGQIGVASLDV
                     PVRIRMLEA"
     gene            complement(<152177..>153118)
                     /locus_tag="AGOS_ABL130C"
                     /old_locus_tag="ABL130C"
                     /db_xref="GeneID:4618897"
     mRNA            complement(<152177..>153118)
                     /locus_tag="AGOS_ABL130C"
                     /old_locus_tag="ABL130C"
                     /product="ABL130Cp"
                     /transcript_id="NM_208170.1"
                     /db_xref="GeneID:4618897"
     CDS             complement(152177..153118)
                     /locus_tag="AGOS_ABL130C"
                     /old_locus_tag="ABL130C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML112W (CTK3)"
                     /codon_start=1
                     /product="ABL130Cp"
                     /protein_id="NP_982817.1"
                     /db_xref="GeneID:4618897"
                     /translation="MSSDPITLLHNGTARAMDSLEARLKFIEVIKSLHKTLNVSRDTS
                     PSSTQPAATDPVHFYLVHYEDHYEDFHSCLFEVTASMDSLDRLNVLIYWNRLVSSLWQ
                     RASKDINGQPNIAGRVVHDYLLKDLGRMLALVLPEQDWKALTNLPVATDVFLRVWRTV
                     GSPSPQDTEPLTCRRESFTLDPDLRAFIDRRSLDPAWHTPAQDAPDAMREALLLLVDR
                     RAKAIFLQEYYRAHGAVSVPASTSASTILHRMESDRERHKKSKEHLWFTDRDSSMLEL
                     AEFDALWQQHRKGMTRDDYQDVKQLQRIAQESYLYQI"
     gene            <153759..>154796
                     /locus_tag="AGOS_ABL129W"
                     /old_locus_tag="ABL129W"
                     /db_xref="GeneID:4618898"
     mRNA            <153759..>154796
                     /locus_tag="AGOS_ABL129W"
                     /old_locus_tag="ABL129W"
                     /product="ABL129Wp"
                     /transcript_id="NM_208171.1"
                     /db_xref="GeneID:4618898"
     CDS             153759..154796
                     /locus_tag="AGOS_ABL129W"
                     /old_locus_tag="ABL129W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR276W (DSK2)"
                     /codon_start=1
                     /product="ABL129Wp"
                     /protein_id="NP_982818.1"
                     /db_xref="GeneID:4618898"
                     /translation="MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRL
                     IYSGKILKDDQTVESYKIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSS
                     ISAGQSGGFNPLADLTGARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQS
                     QMNEMLNNPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLQMGM
                     GGAGAEQGTDFPAPGSAATPDAAAPAPNPLAAILGLQPGAANPLGAAPADRGLAMPPL
                     DPAMLSSLFGAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQ
                     GALDALLNGDV"
     gene            <155132..>156556
                     /locus_tag="AGOS_ABL128W"
                     /old_locus_tag="ABL128W"
                     /db_xref="GeneID:4618899"
     mRNA            <155132..>156556
                     /locus_tag="AGOS_ABL128W"
                     /old_locus_tag="ABL128W"
                     /product="ABL128Wp"
                     /transcript_id="NM_208172.1"
                     /db_xref="GeneID:4618899"
     CDS             155132..156556
                     /locus_tag="AGOS_ABL128W"
                     /old_locus_tag="ABL128W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML114C (TAF8)"
                     /codon_start=1
                     /product="ABL128Wp"
                     /protein_id="NP_982819.1"
                     /db_xref="GeneID:4618899"
                     /translation="MTNGECNGIHNRAGAKEGIQLKKLPDLTEVTKSNPMQKLLAQAV
                     GLHLKTMRSDVGITQLGFENLVQFVELQLDDMLQILHRFANVQRRNEVSLKDVRLFLH
                     GCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQSASLMGHWHQPMSEEELLSSSHAEF
                     FFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEES
                     KLSEKALLHMLGTATKKPRADDAQLPQIISDGQQENLLIYGPERRRLAPEPAPTRGFN
                     IEDYARCRVELARRRVEEFEQQKLQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVL
                     LHRSYIGVLHAIPRLRRTKARELAAAYERERARQESMRNNTDLTQQQHGVLDLSALHD
                     DPLLADLDSSDSDDDRQPPSPRKPPDPTESDAPSPPTADTATPAPPSPLANPPVLDAA
                     PEPLSVPPPIEKLGSPDTNAASAS"
     gene            <156834..>159020
                     /locus_tag="AGOS_ABL127W"
                     /old_locus_tag="ABL127W"
                     /db_xref="GeneID:4618900"
     mRNA            <156834..>159020
                     /locus_tag="AGOS_ABL127W"
                     /old_locus_tag="ABL127W"
                     /product="ABL127Wp"
                     /transcript_id="NM_208173.2"
                     /db_xref="GeneID:4618900"
     CDS             156834..159020
                     /locus_tag="AGOS_ABL127W"
                     /old_locus_tag="ABL127W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR277W (FCP1)"
                     /codon_start=1
                     /product="ABL127Wp"
                     /protein_id="NP_982820.2"
                     /db_xref="GeneID:4618900"
                     /translation="MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVD
                     VITAPGEEEAGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACP
                     HDVTYGGLCVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKL
                     REARKLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFY
                     MGPKPPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLF
                     GDRILSRDENGSLTQKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIG
                     DINSNFLPIQQNSMLHLGRRNRKKPKQEEELLTDILDTEKKLKEKINEEVKRQEDQMH
                     RLTDEKLPDTRDIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNI
                     LLKVHSAYYDQLQRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERAD
                     IVLWTNMFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGW
                     ERVEESPYELIVEEPVGEEYLENFKRDLAEAQKKVDPPAQDSRSSLLLLDGNGSWLDY
                     DDDEMDEFLNEESDNEEDTEQMATASKAPRPNGFPSGGERPAAVQSQDKPELPEKESN
                     GKRPYQPDDAVSASKVKLQRTDAFSEEAEEEDEDDLEAELLLELGQ"
     gene            <159243..>161117
                     /locus_tag="AGOS_ABL126W"
                     /old_locus_tag="ABL126W"
                     /db_xref="GeneID:4618901"
     mRNA            <159243..>161117
                     /locus_tag="AGOS_ABL126W"
                     /old_locus_tag="ABL126W"
                     /product="ABL126Wp"
                     /transcript_id="NM_208174.2"
                     /db_xref="GeneID:4618901"
     CDS             159243..161117
                     /locus_tag="AGOS_ABL126W"
                     /old_locus_tag="ABL126W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR278W (PGM3)"
                     /codon_start=1
                     /product="ABL126Wp"
                     /protein_id="NP_982821.1"
                     /db_xref="GeneID:4618901"
                     /translation="MKENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDEL
                     RKRLLPRITFGTAGLRARMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDH
                     RFHSREFAEATIAAFLQLDYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCG
                     VMITASHNPKMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAI
                     KSGKLHDVRKEMLQKYKDSIQTMLVKQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASV
                     LGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADANGITVVLANDPDA
                     DRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRK
                     MAEEEGFLAVETLTGFKWLGNRARELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAA
                     AVFLQMCYEWKKVAKSSQEVLQECYEKYGYFVDYNGYYISSAPAVTKEVFDYFRNEYT
                     PAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPDLPVDHNSQMITCVLKPVKMETD
                     CESVRFTARGSGTEPKLKVYIESCAANHQRASHLSHLAWDVLKREWFRPTETGLQTNF
                     "
     gene            <161394..>162404
                     /locus_tag="AGOS_ABL125W"
                     /old_locus_tag="ABL125W"
                     /db_xref="GeneID:4618902"
     mRNA            <161394..>162404
                     /locus_tag="AGOS_ABL125W"
                     /old_locus_tag="ABL125W"
                     /product="ABL125Wp"
                     /transcript_id="NM_208175.1"
                     /db_xref="GeneID:4618902"
     CDS             161394..162404
                     /locus_tag="AGOS_ABL125W"
                     /old_locus_tag="ABL125W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YPL273W (SAM4) and YLL062C (MHT1)"
                     /codon_start=1
                     /product="ABL125Wp"
                     /protein_id="NP_982822.1"
                     /db_xref="GeneID:4618902"
                     /translation="MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAP
                     FLDAAAWQQPDSRERAIVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYN
                     ALLDRIVGFCRETVGDDKYLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDN
                     FNAQPALDLIGFETIPNAHELRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVA
                     AIVAAAAPLNPNFLGLGINCSSLSRTPAILAELHALLPALPMTIYPNSGEIYDPVKKV
                     WNASPHVVDWGAVVASYIRSGARIIGGCCRTIPNDIRQIADAVRTHARASSTDVPGHA
                     SP"
     gene            <162768..>164381
                     /locus_tag="AGOS_ABL124W"
                     /old_locus_tag="ABL124W"
                     /db_xref="GeneID:4618903"
     mRNA            join(<162768..162811,162872..>164381)
                     /locus_tag="AGOS_ABL124W"
                     /old_locus_tag="ABL124W"
                     /product="ABL124Wp"
                     /transcript_id="NM_208176.2"
                     /db_xref="GeneID:4618903"
     CDS             join(162768..162811,162872..164381)
                     /locus_tag="AGOS_ABL124W"
                     /old_locus_tag="ABL124W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML115C (VAN1); 1-intron"
                     /codon_start=1
                     /product="ABL124Wp"
                     /protein_id="NP_982823.2"
                     /db_xref="GeneID:4618903"
                     /translation="MPIFKRSDKNLELPISQHSRYQPRLKGRFSLKMNYKLKHVAMFV
                     WVMICGTLVVRQLVGSGEREVILVDREVPMEEREVFVDVSDDERAAEWEPQVLDDPEY
                     YDYEFAAASAERLAKYDEGFEHYFVTRDGQISRDDPEFEEQMEELVSATVEQYDLRNY
                     EGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCSENDKT
                     LQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVRDAF
                     SPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANAL
                     KPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIE
                     STDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAK
                     AKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIA
                     RRERENRRS"
     gene            complement(<164774..>166258)
                     /locus_tag="AGOS_ABL123C"
                     /old_locus_tag="ABL123C"
                     /db_xref="GeneID:4618904"
     mRNA            complement(<164774..>166258)
                     /locus_tag="AGOS_ABL123C"
                     /old_locus_tag="ABL123C"
                     /product="ABL123Cp"
                     /transcript_id="NM_208177.1"
                     /db_xref="GeneID:4618904"
     CDS             complement(164774..166258)
                     /locus_tag="AGOS_ABL123C"
                     /old_locus_tag="ABL123C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YPL154C (PEP4)"
                     /codon_start=1
                     /product="ABL123Cp"
                     /protein_id="NP_982824.1"
                     /db_xref="GeneID:4618904"
                     /translation="MSWAKLVLVCSFTYALCLHLATQNRFLEATETSRIYKLLAPTRI
                     VSEIKTSADDSTGSTLLKYNRSGAETKKSAQCNSLTFRPNISLLKRDPLSRVHIIQAT
                     FGGVSYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGT
                     AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLL
                     QGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNH
                     WLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFD
                     DSISDGKNFAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD
                     ISSSWILGEVFLQDLYTVFDIEGRQVGFANRNTKATLVHNEPQNYYEKNNSSLQMVST
                     SSDTTSSAAATSLHVSSTSKNIAYTPRPHPLLEQLLSLIYILVL"
     gene            complement(<167040..>170171)
                     /locus_tag="AGOS_ABL122C"
                     /old_locus_tag="ABL122C"
                     /db_xref="GeneID:4618905"
     mRNA            complement(<167040..>170171)
                     /locus_tag="AGOS_ABL122C"
                     /old_locus_tag="ABL122C"
                     /product="ABL122Cp"
                     /transcript_id="NM_208178.2"
                     /db_xref="GeneID:4618905"
     CDS             complement(167040..170171)
                     /locus_tag="AGOS_ABL122C"
                     /old_locus_tag="ABL122C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML117W (NAB6)"
                     /codon_start=1
                     /product="ABL122Cp"
                     /protein_id="NP_982825.2"
                     /db_xref="GeneID:4618905"
                     /translation="MTNYQRLGPLGQAVPGPGAGGQPASSGPAQGPGTGPGQPARFFP
                     GAEGMSLAAGSMPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGHS
                     SHSLHHAQSARSSFLYYPQPPMLKPIPPRRKKSVTLNHSEPYHINFKILPKGKDEYMT
                     RSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDDNHSILLSFLTKATCLDFYNNL
                     LQRFSEFKTKLHSPKLSVSFVCQDESSWFKYLQMNVVTRGATRSLTVEFEDSVKELNE
                     DFVRLKFPWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQP
                     SQKRQLNISRIQFVNVNGHHSKLSDEEAVAAANGLQQDSRTSSVSSISLSISNTADLA
                     ALFHSLDLSLDTLSLQVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSN
                     ATNAGNHHGVSSSLSGVLFMNDPSSSGSTPMIVPSELNLNTPVMGGPMQGQLMPGPPQ
                     PMSLHNPSDGNGGSPSYFMDPMVGAPIGQTLQRQYLAGASQANGINNRTVYIGNIHPR
                     SKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRV
                     GWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQ
                     LRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGR
                     YKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQSYSMKQGKQPRKEDGIVNSDDLT
                     KNNEVLPGVQMNSSKNGGVGESQSLVGDQELAEGLGISLTSAQISPDTGHTHHYSDGV
                     EEGDECDDDDAGYSTSGSSDIDIIVAPPDEFKRRESGTSSGKHKKKSKSTRRNQHSNA
                     ASSASYNQQYSLGSLDHTSSAGSLDAPPPLAPSSMQQHLADRRPRHTPGRSTDSSASQ
                     YNSQTPTNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEP
                     LGGYYDSNGNEQH"
     gene            complement(<170815..>174672)
                     /locus_tag="AGOS_ABL121C"
                     /old_locus_tag="ABL121C"
                     /db_xref="GeneID:4618906"
     mRNA            complement(<170815..>174672)
                     /locus_tag="AGOS_ABL121C"
                     /old_locus_tag="ABL121C"
                     /product="ABL121Cp"
                     /transcript_id="NM_208179.2"
                     /db_xref="GeneID:4618906"
     CDS             complement(170815..174672)
                     /locus_tag="AGOS_ABL121C"
                     /old_locus_tag="ABL121C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR280C (CAT8)"
                     /codon_start=1
                     /product="ABL121Cp"
                     /protein_id="NP_982826.2"
                     /db_xref="GeneID:4618906"
                     /translation="MAGPRKEKDGYGPRIIRTLGSQALGGAGGSSRASSVSQSPGGPE
                     GATGGASPAAAPQSTTGTPLSSLTPTNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG
                     FECKISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVSKYGCASA
                     PATSSSSANKKGDSDHTTLEDEQILQQLSNSDGGALRVSSTNLYLLNKKTAAFPLVQP
                     VQQNLSPTQLRSNPYTRATLSPSHVAEADHVTDLRKGLPANPVAISSSVGQVPPYPFT
                     NLNDPTSISFEQDQAPGLPAVKALSSLASHEESSQLAALVAVSIPRTTEEILFVPQLL
                     ARIGQMHGFTSKQCLYTASVLASLKEITPRKTSSILEQLKAKNLWEIDNVDTFLLEGL
                     QIDIRRGSSGDFNLENPNGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDW
                     YSLIPIFDRSEFESYWVKFKDNVSTPGFFTSGDTLFDRRHKSISYKIFACLLLTVCQM
                     GLMSKVKRERHERGDRLNNLMTYYDRAISHVIMNPYFSSSSTSIQSLQLLSLLLFYFL
                     NVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLD
                     VFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKV
                     LGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQL
                     KRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPIIDKPQPVVDTNIPGSQIDR
                     SSSSYVLLQQATNTFLNVLSSVSSLYLPLPLNITRTKTRFGLVSARGSLEYTKGGALF
                     QDNKNLLLDLLKDLEADKKLNMPGTISWHSLKLLDMAVNLILQPPNTKPEKQEKLLQK
                     KINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPIPEKEKPPSSKRHRGDDNAAA
                     SMPPLLEKKVKLEAPASNMPTPPAPISALHEDVPRVLDGHLGANSSLAVLAAKHEPEG
                     SLHSSAVNAITEAFQLDPILQPTPFSNTDLPSFFGVDQYAAPPELQPFPAGYAAPDKV
                     PQAAAQGPSATAGPPLSSKDSLFKVPSNGDFLKDYYSGMSSAQLNSLFTAPDRRDVRP
                     RAPQPDRAPSDGLQQQPGYGFVVDASLGLAPLLAWSPRPADDLLLDDKGAKLASARSF
                     THVNKLSSIPTLMSTQPPPASAPHAKLGQPAPPDQDDGILTIPPRDQRGPRRLWNSAL
                     NQARPAAALDDSISDLFRWQNSG"
     gene            <175098..>175847
                     /locus_tag="AGOS_ABL120W"
                     /old_locus_tag="ABL120W"
                     /db_xref="GeneID:4618907"
     mRNA            <175098..>175847
                     /locus_tag="AGOS_ABL120W"
                     /old_locus_tag="ABL120W"
                     /product="ABL120Wp"
                     /transcript_id="NM_208180.1"
                     /db_xref="GeneID:4618907"
     CDS             175098..175847
                     /locus_tag="AGOS_ABL120W"
                     /old_locus_tag="ABL120W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR281W (GPI12)"
                     /codon_start=1
                     /product="ABL120Wp"
                     /protein_id="NP_982827.1"
                     /db_xref="GeneID:4618907"
                     /translation="MFGSFFAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGDSQH
                     TSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKA
                     LRLLVLEHDVTLEVADFTDGMKEDWDLAEVRTRLGELVTDAKPLVLTFDERGVSGHRN
                     HIGCALAAARLGHKTLFLRSERNLLRKYSFFVLDVFRVVFGTPPPTVFVSTLAQYLHA
                     LVAMVVAHRSQMVWFRWGWWMASRYVYANEY"
     gene            complement(<175873..>177486)
                     /locus_tag="AGOS_ABL119C"
                     /old_locus_tag="ABL119C"
                     /db_xref="GeneID:4618908"
     mRNA            complement(<175873..>177486)
                     /locus_tag="AGOS_ABL119C"
                     /old_locus_tag="ABL119C"
                     /product="ABL119Cp"
                     /transcript_id="NM_208181.2"
                     /db_xref="GeneID:4618908"
     CDS             complement(175873..177486)
                     /locus_tag="AGOS_ABL119C"
                     /old_locus_tag="ABL119C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR282C (AEP2)"
                     /codon_start=1
                     /product="ABL119Cp"
                     /protein_id="NP_982828.2"
                     /db_xref="GeneID:4618908"
                     /translation="MMVDFSPSRRRMGTQELSLKPQVETPGIKLLAVMFCRYHLIRQL
                     KQVQAASRTRYAHSVPQSRPTLKERLAALHEKQQLSLLPPDAVKRVSENNPAVLIDCD
                     ARTLLQLFLAALQTDPQKTTLSELLSQEEGFSVFIHRLLPTYTPSSDLKHLVSKDGTT
                     ALLQKLYGFYREQFADAPIGRPSPGRLHDANSFARWFMAESKLRLARTVFAELVGNPT
                     ELAKLPRDTETIITLLQLHLGAKHIFWRDPGNSVGRGGQLFTPAHMAVVTAYNSLGEE
                     TLLRLLRLLQSDPQWKSVCSPDLDRNIILALAFHNRLDLVHAQAARYYAPAAPGHGLP
                     STPLLPDGALVGAVVTAFAFKHQLAQGLAIAYQFLDRFTHLPNEHELWKIIFTWLARR
                     HPTGSQGAALYDEAWSKMRTRYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLND
                     YMSPLYQQPAVAPRDRLLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHLLE
                     HIAARASSRTDADDDDAGDGLYLTGAPLW"
     gene            <177564..>179078
                     /locus_tag="AGOS_ABL118W"
                     /old_locus_tag="ABL118W"
                     /db_xref="GeneID:4618909"
     mRNA            <177564..>179078
                     /locus_tag="AGOS_ABL118W"
                     /old_locus_tag="ABL118W"
                     /product="ABL118Wp"
                     /transcript_id="NM_208182.1"
                     /db_xref="GeneID:4618909"
     CDS             177564..179078
                     /locus_tag="AGOS_ABL118W"
                     /old_locus_tag="ABL118W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR285C (NGL2) and YML118W (NGL3)"
                     /codon_start=1
                     /product="ABL118Wp"
                     /protein_id="NP_982829.1"
                     /db_xref="GeneID:4618909"
                     /translation="MTLQEDTSLQSMMASERELNDQLERVSLVETNSSNSKVHAEPGS
                     AEKTSKKPKANGRPSAEEIEKIRAQRKAKKEAAGKQGGEDVGFIKRPLLVCNGDEAKG
                     FVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQ
                     YKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDETLIDFDEEQSGEIERR
                     TTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYERARQCYIILSRM
                     KVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPIIYEGRARTVIEC
                     STSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRALVDAMQSLHNA
                     LDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYVMPWDFSDNT
                     EVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELELLM"
     gene            complement(<179093..>180901)
                     /locus_tag="AGOS_ABL117C"
                     /old_locus_tag="ABL117C"
                     /db_xref="GeneID:4618910"
     mRNA            complement(<179093..>180901)
                     /locus_tag="AGOS_ABL117C"
                     /old_locus_tag="ABL117C"
                     /product="ABL117Cp"
                     /transcript_id="NM_208183.1"
                     /db_xref="GeneID:4618910"
     CDS             complement(179093..180901)
                     /locus_tag="AGOS_ABL117C"
                     /old_locus_tag="ABL117C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR284W (YKU70)"
                     /codon_start=1
                     /product="ABL117Cp"
                     /protein_id="NP_982830.1"
                     /db_xref="GeneID:4618910"
                     /translation="MGERQDKSGGQSGHFVKPVTHDYIDRNQNIVLCIELSQTLCSPA
                     GSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRNGRRAEDGIVEAFPLRPLDA
                     NYVRNISDCVADLEETGMVGQHFPFTATVPASLDVMLAASDRYFTEDTQNADNRIFLV
                     TDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFFLHTEHAAFNDSSYAEILKTREW
                     GIPGAPQSTSPLSICKLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHER
                     PGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRK
                     MTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMF
                     EKGKAAIVWGQLKAGFHPTLFALIPSDGETCALRLVRIPFIEEVRCFPTLDGEDRLFH
                     TREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTLYHEQSQDAKRKMPELQY
                     LPESDSTLHKVQLVRDRIENSIIHDEPPIISEYINCWNIYYNHIIDKAVYEYGAPKRP
                     LKYFTGDTLHLEDALTPNQQRTQRNTAKNAKTRFNL"
     gene            complement(<181170..>182858)
                     /locus_tag="AGOS_ABL116C"
                     /old_locus_tag="ABL116C"
                     /db_xref="GeneID:4618911"
     mRNA            complement(join(<181170..181921,181976..>182858))
                     /locus_tag="AGOS_ABL116C"
                     /old_locus_tag="ABL116C"
                     /product="ABL116Cp"
                     /transcript_id="NM_208184.2"
                     /db_xref="GeneID:4618911"
     CDS             complement(join(181170..181921,181976..182858))
                     /locus_tag="AGOS_ABL116C"
                     /old_locus_tag="ABL116C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL210W (UGA4); 1-intron"
                     /codon_start=1
                     /product="ABL116Cp"
                     /protein_id="NP_982831.2"
                     /db_xref="GeneID:4618911"
                     /translation="MGAQDLDKQSSNSAVAEIYYESNKYGHKGDLIECSNKGPMNYID
                     AKNVHDDVELLAEIGYKQELKRHFSTLQIFGIAFSIMGLLPSIASVLPVALPGGSVSM
                     VWGWFIFGAFILAVGAAMAELASAIPTSGGLYYYTYYYAPPRLKACLSFLIGNGNSLA
                     LIAGLCSIEYGLAEQILSIIAISSNSYLVSSRWLLYGIYCMGLLATVLLASIATFSVS
                     LLQTASIVMNLALVALFIIVLPVGVAHNGRGFNSAKFMFTNFENHTGWPDWFQFFLCG
                     SLPIVWVIGAFDSTVHMSEEAKNATRSVPIGILSSISTCWALGFAIVVVIAACMGPDI
                     DAILNGEFNHPLAQILYNALGKGWALSVMVFIVVCQYLMGASILTASSRQIWAFARDD
                     GLPFSSWIKVVNTKLSSPLRATWASAFVALVIGLLTLAGPTASSALFSMAVAANYLAW
                     MTPNLLRMLFGKEIYRPGSFYMGKFWSPVINWTAILFQVFIILVMMFPSDTAGLRAST
                     MNYTAIITGFVWIGSIFYFLAYKHRTFIGPKSNLGR"
     gene            complement(183436..183520)
                     /locus_tag="AGOS_t0029"
                     /db_xref="GeneID:4618912"
     tRNA            complement(join(183436..183471,183480..183520))
                     /locus_tag="AGOS_t0029"
                     /product="tRNA-Tyr"
                     /codon_recognized="UAC"
                     /db_xref="GeneID:4618912"
     gene            <184385..>184834
                     /locus_tag="AGOS_ABL115W"
                     /old_locus_tag="ABL115W"
                     /db_xref="GeneID:4619309"
     mRNA            <184385..>184834
                     /locus_tag="AGOS_ABL115W"
                     /old_locus_tag="ABL115W"
                     /product="ABL115Wp"
                     /transcript_id="NM_208185.1"
                     /db_xref="GeneID:4619309"
     CDS             184385..184834
                     /locus_tag="AGOS_ABL115W"
                     /old_locus_tag="ABL115W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL208W (NHP2)"
                     /codon_start=1
                     /product="ABL115Wp"
                     /protein_id="NP_982832.1"
                     /db_xref="GeneID:4619309"
                     /translation="MAKEKTSTSEDNYEARLPAVLSFAKPLASKKLNKKVLKTVKKAS
                     KAKNVKRGVKEVVKALRKGEKGLVVIAGDISPPDVISHLPVLCEDQSVPYIFVPSKQD
                     LGSAGATKRPTSVVFIVPGSSKKKEGKAKEEEYRESYDEVVKEVKSL"
     gene            <185148..>186476
                     /locus_tag="AGOS_ABL114W"
                     /old_locus_tag="ABL114W"
                     /db_xref="GeneID:4618913"
     mRNA            <185148..>186476
                     /locus_tag="AGOS_ABL114W"
                     /old_locus_tag="ABL114W"
                     /product="ABL114Wp"
                     /transcript_id="NM_208186.1"
                     /db_xref="GeneID:4618913"
     CDS             185148..186476
                     /locus_tag="AGOS_ABL114W"
                     /old_locus_tag="ABL114W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR240C (SNU56)"
                     /codon_start=1
                     /product="ABL114Wp"
                     /protein_id="NP_982833.1"
                     /db_xref="GeneID:4618913"
                     /translation="MQSRKRARGPLPQQGLQKKQKYAGEATANTQNIWKCLPRLSEHE
                     MDIDNAIKHSRLFIRLSLEEQKHLRTIITAINDVIDAEKYAFHTHSIELKNFHITDCC
                     VLLAFIMINLNKLRRGLGGTDYCSITKPFYLRCSVYIHRTCQVVQMPTANKKTTFRRQ
                     LVRLPAVSAFKQVEFQSADLKDLMQGILQQVSAWRFRPSPTYLHRDFAAGLILQREQV
                     AKELAPMSVVTSLIDMGLVMPQNKAAIEQTQRALEEHGQRLLLHNEQVTVAAVDEAKP
                     QTTDSKPSRYSGLPTKGPNSRYQGAPARASPHGAFQDRKQNPGFLSMKDITEYCIATI
                     KATMEIVASKSAYQITRVYVKCPKSCVDVLYQKLADLRTESSCNIVVLNIQTVHESTS
                     WFDTLNMERHTTTVPPPSTLRVISIGGIGENCKKALLLLQKFLEEYVLAS"
     gene            <186739..>188676
                     /locus_tag="AGOS_ABL113W"
                     /old_locus_tag="ABL113W"
                     /db_xref="GeneID:4618914"
     mRNA            <186739..>188676
                     /locus_tag="AGOS_ABL113W"
                     /old_locus_tag="ABL113W"
                     /product="ABL113Wp"
                     /transcript_id="NM_208187.1"
                     /db_xref="GeneID:4618914"
     CDS             186739..188676
                     /locus_tag="AGOS_ABL113W"
                     /old_locus_tag="ABL113W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR239C"
                     /codon_start=1
                     /product="ABL113Wp"
                     /protein_id="NP_982834.1"
                     /db_xref="GeneID:4618914"
                     /translation="MSYEKKRKSFFFFGSSNSSSSRSSKAQTVQRSPVPAARAPTEKK
                     VRPFTTVDDPRLAKWQSPDQVISKSADPSTGKVISAAEVHGRASGGHERPVSCVVQTN
                     DYILDKKFLRSLAELEKVSIDLDPELGSPSRKSDVTFDTARDSAPTHRRHISEVDELV
                     DHLDNFINRATDSPLASPLGGEDLDPMRRGFFAIDTKTSSQGNFSNLDSPIAAVSPLD
                     LQLRTNALEGAKSHTTGTNTTSSASNTHCHIDTEGDIESACDQFSYATSTVSAGEIQQ
                     VAYGSMSGTIPLMTHLGSTDNGKSPYRNVSEKLVASPKQFRVVNEDKAHFYLNDTMED
                     ESSVHTTEPVYHDSISEFNEKFRYPSPQHGENAQSSVTSHSGFYTPPQRPQSTHEEPQ
                     LKSAFAGFGQRKEPVVRSRKPLDKNVRLVSSYVEELRLKYFPTSNSLQPPPSLPIALK
                     TRNNLELPQNIKVRIRTSSKQIGIKHGKAKQKLLSLETANEDEEEQDIKVDHTKEFRA
                     LLGRERSADAPGAVLEPPDDEVYGVNDLMAPLHDPMDDSFLRSGYKLKRSDTVTSYFT
                     KNIARLRSGTLEQEYSYSAQLPVTMTPISRSSYPMGDQDTVKHTSLRRSESPDFTTYS
                     SNYTSGLKVANPDSDTDECNM"
     gene            <188906..>191821
                     /locus_tag="AGOS_ABL112W"
                     /old_locus_tag="ABL112W"
                     /db_xref="GeneID:4618915"
     mRNA            <188906..>191821
                     /locus_tag="AGOS_ABL112W"
                     /old_locus_tag="ABL112W"
                     /product="ABL112Wp"
                     /transcript_id="NM_208188.1"
                     /db_xref="GeneID:4618915"
     CDS             188906..191821
                     /locus_tag="AGOS_ABL112W"
                     /old_locus_tag="ABL112W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR238C (SEC26)"
                     /codon_start=1
                     /product="ABL112Wp"
                     /protein_id="NP_982835.1"
                     /db_xref="GeneID:4618915"
                     /translation="MSTSLEQPSYTLVYDTTPQSITYSASDFQKALEKGSDNDKIETM
                     KRILVAMLDGNSFPELLMHIIRFVMPSKNKKLKKLLYFYWEIVPKLDNEGKLKQEMIL
                     VCNAIQHDLQHPNEYIRGNTLRFLMKLKEAELLEQMVPSVRACLDYRHAYVRKYAILA
                     VYSIYKVSDHLIPDAREIINSFLAAETDPVCKRNAFVALSELDREAALQYLQEHITTI
                     DVLDSLLQVAFIEFIRRDAIHTPSLKGQYVELLQELMVSTSSNEVVYEAGVALTVLTS
                     ASTVSLQVASKLIDLAVKESDNNIKLIILNKIDEIQAKDPRSLEDLTLDVLRVLRNQD
                     LDVRAKALDIALSLVTSRNVDDVVKLLKKELQSTVGDINDKSVEYRELLTKSIHKVAI
                     RFVEVSANVVSLLLEFIGDLNSDGASGVISFTKEVIEKYPQLREEILEHLISALPSVN
                     SARAYRGALWILAEHSQTEKDIQQAWKHIRDSIGELPIVQSEMKLLNKESDEDEEIPE
                     DNVPKGPTVLPDGTYVTESALTVQSTKQLSKEDKDSRPPLRRFILSGYFYAGSVLANT
                     IVKLILRFEKISDNKSIINALKAEGLLILVSILRAGQSKLVEKQIDEDAQERIMIAIS
                     ILMNHTDPEDTSEDRKLLEMAYLDATKSSYKAQLSINRRKLDKKIANLVNESAEPVDK
                     AVTFRQFAAANAQHTPVDNIDNDLELACRGSSFVSKQEANSITSKLKKIVPLTGFSDP
                     IYAECYITNHQFDVILDVLLVNQTKETLKNLHAQFATLGDLKIICNPPSTNLVPHGFH
                     RFSVTVKVSSADTGIIFGNIVYDGGHGEDARYVILNDVHVATMDYIKPAVCDEASFRK
                     MWNAFEWENKMVVKSKLPTLHDYLNKLIEVTHMNVLTPEESFADPECRFLSCNLYSKS
                     TFGEDALANLCIERDPTSGSIIGEVRIRSKTQGLALTHGDSIAHMERSFNTIKLDTV"
     gene            complement(<191982..>192857)
                     /locus_tag="AGOS_ABL111C"
                     /old_locus_tag="ABL111C"
                     /db_xref="GeneID:4618916"
     mRNA            complement(<191982..>192857)
                     /locus_tag="AGOS_ABL111C"
                     /old_locus_tag="ABL111C"
                     /product="mitochondrial 54S ribosomal protein YmL7/YmL5"
                     /transcript_id="NM_208189.2"
                     /db_xref="GeneID:4618916"
     CDS             complement(191982..192857)
                     /locus_tag="AGOS_ABL111C"
                     /old_locus_tag="ABL111C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR237W (MRPL7)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL7/YmL5"
                     /protein_id="NP_982836.2"
                     /db_xref="GeneID:4618916"
                     /translation="MMGCFARRAFSTSQYMEKAACSLVKPVHHLVKIDKSKLSPRFPE
                     LKYPKSDIRSPGFRPQETHQDRVREHYLNTLQDDLLLMNYEHNAEVKKGLKQREWDGS
                     SPFHVNRAPRKPKGSVRQHPDIKPVNWENVPEIESVVINCYVNQAKENPFLAIGAAMQ
                     LQQITGRKPTSLYAKKDMPSFKVRRGTHMGAMIELKGRPMSQFLSTLTEIVLPRIREY
                     KGISNKSGNGFGGISFGLTKDDVKYFPELAASPDLWPNTFGMHININTSAQTDSRART
                     LLSGFGLPFHGHERL"
     gene            <193088..>194617
                     /locus_tag="AGOS_ABL110W"
                     /old_locus_tag="ABL110W"
                     /db_xref="GeneID:4618917"
     mRNA            <193088..>194617
                     /locus_tag="AGOS_ABL110W"
                     /old_locus_tag="ABL110W"
                     /product="ABL110Wp"
                     /transcript_id="NM_208190.1"
                     /db_xref="GeneID:4618917"
     CDS             193088..194617
                     /locus_tag="AGOS_ABL110W"
                     /old_locus_tag="ABL110W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL207W (GLE1)"
                     /codon_start=1
                     /product="ABL110Wp"
                     /protein_id="NP_982837.1"
                     /db_xref="GeneID:4618917"
                     /translation="MRFAVEELLDRDEPQEDVLGYGNCEPDGVQLWMPRKEGDKPDTV
                     SLLVTLRAQLERMHISEKMPKLRMGGGVFVRPKVTSRVAAATTVHKDTRTSAAAPVHT
                     MATAAEMLQPLRNKMEDLERTNRAEVERVVALKKKAEEERGRLEQQQRERAAREEQER
                     RRREEEEQLRKIAREKQAAEAAAQREQAEKERLRQEAEARKEAEAEEAKRRRGAVNFQ
                     EVEDEYRRHMERIRTIKSDIVEPVKKDAELRKLLAQHKRKINPKFGQLTNSSTHLMEL
                     LRDMVGLIDATRSNMIAYRWILNFIAKAIVSQAETETRVKPETAVPLATLTLHLLCRY
                     PELHELLLARVVKKCPFVIGYTCNTDTEEGRIRMGWKRNSDGKWEDETTYDERMGGMM
                     TLYSVISRSPLPAEFITVREHPIGIAHSWKMLARLGNQDPALLTNTHFVLLGSWWDAA
                     ASHLLLHYGKQARKLLQVVADDLTTAVSDRKYVGAARLRILLEEWHQTGSIKSFPEMA
                     A"
     gene            <194702..>195370
                     /locus_tag="AGOS_ABL109W"
                     /old_locus_tag="ABL109W"
                     /db_xref="GeneID:4618918"
     mRNA            <194702..>195370
                     /locus_tag="AGOS_ABL109W"
                     /old_locus_tag="ABL109W"
                     /product="ABL109Wp"
                     /transcript_id="NM_208191.1"
                     /db_xref="GeneID:4618918"
     CDS             194702..195370
                     /locus_tag="AGOS_ABL109W"
                     /old_locus_tag="ABL109W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR236C (FMN1)"
                     /codon_start=1
                     /product="ABL109Wp"
                     /protein_id="NP_982838.1"
                     /db_xref="GeneID:4618918"
                     /translation="MPCISAYVIYSQVEKLPFSMNFISQHSVFTLKDCCEMARRPVDI
                     PIPASPVQPFPILTEYVDIVAGFGRGSAELGIPTANVPIEQLPSEVNEMATGVYFGWA
                     RLRPNMDQEAQVHHRNDGSEVIYNFGSKLSETERGVFPIVLSVGWNPFYNNSKKTVEL
                     HILNDFEEDFYGAKIKFSFLGYIRPELNYTTKEALIEDIHTDIKIASEVLHTEPYSSL
                     KNQL"
     gene            complement(<195538..>197175)
                     /locus_tag="AGOS_ABL108C"
                     /old_locus_tag="ABL108C"
                     /db_xref="GeneID:4618919"
     mRNA            complement(<195538..>197175)
                     /locus_tag="AGOS_ABL108C"
                     /old_locus_tag="ABL108C"
                     /product="ABL108Cp"
                     /transcript_id="NM_208192.2"
                     /db_xref="GeneID:4618919"
     CDS             complement(195538..197175)
                     /locus_tag="AGOS_ABL108C"
                     /old_locus_tag="ABL108C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR235W (PRP42)"
                     /codon_start=1
                     /product="ABL108Cp"
                     /protein_id="NP_982839.2"
                     /db_xref="GeneID:4618919"
                     /translation="MLQSFELDTDSKLHERLLKVSKFPKTLAYWEELLNYLLQLASPL
                     NKSIDRQLCKLIRYAYESMLLQFPYLENYHVDYALFEFKLGSTAKMHKIFQKALDIFN
                     QRSILLWVEYLKLCNEVVMSDKALFKKYETAERYIGLHFYAGEFWEMYLEQIRQRCKL
                     PHRYVTILRKVIEIPLYDYSVFYSLWLQCIQDVKDLRQLKWFAPCSELWKKLKINVCL
                     TSRRGPELQEAKAQLRKVTKELYMVVQYQVMEIYNLFEGKLVTHTYTSPSTLIPHEEI
                     TTWTKYLDYTATLRIYPLTSLNFQRAATVLAHYDVVWLKWANWHAEREGDYVSAQNVL
                     VKGLQLSNRKARILSRLAVVMIRNGEYSELNTIYDDLITLYQGKLDALDLQSFLDYVQ
                     IKVFLTQPISQSRYKSANDDFLISEELMEIILKRLSSEDEAGHRILLPLLNQMYQRVP
                     RDLLEKKLFQRIISSNWSQFLSSGYFWYEYCHMVWFDTGRSYLERRKYITKEIWPQAA
                     RYRNDGICNALQQFAASYSPDDLAILSELFDSNSKSE"
     gene            complement(<197433..>198413)
                     /locus_tag="AGOS_ABL107C"
                     /old_locus_tag="ABL107C"
                     /db_xref="GeneID:4618920"
     mRNA            complement(<197433..>198413)
                     /locus_tag="AGOS_ABL107C"
                     /old_locus_tag="ABL107C"
                     /product="ABL107Cp"
                     /transcript_id="NM_208193.1"
                     /db_xref="GeneID:4618920"
     CDS             complement(197433..198413)
                     /locus_tag="AGOS_ABL107C"
                     /old_locus_tag="ABL107C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL205C (HEM3)"
                     /codon_start=1
                     /product="ABL107Cp"
                     /protein_id="NP_982840.1"
                     /db_xref="GeneID:4618920"
                     /translation="MGEETLRIAGRRSKLAVIQSESVKEIVQREFPNYTCTVLAKQTL
                     GDQVQSKPLYAFGGKALWTKELEDLLYEEDLDQRIDMIVHSLKDMPTQLPEGFELGAI
                     TKRVDPSDCLVMAAGSPYKTLGDLPNGSVVGTSSIRRSAQLRRRYPHLVFASVRGNIQ
                     TRLKKLDDPENECKCIILATAGLVRLGLESRITQRFDSTIMLHAVGQGALGIETRTGD
                     ERLQAILAKVADRNSTICCLAERSLMRTLEGGCSVPIGVYSTFDEETSMLTLDGLVVS
                     VDGADAAEATVSYKIKSDKEDAIACGQLLAAKLLEAGAKKILDAIHLPEA"
     gene            complement(<199323..>201383)
                     /locus_tag="AGOS_ABL106C"
                     /old_locus_tag="ABL106C"
                     /db_xref="GeneID:4618921"
     mRNA            complement(<199323..>201383)
                     /locus_tag="AGOS_ABL106C"
                     /old_locus_tag="ABL106C"
                     /product="ABL106Cp"
                     /transcript_id="NM_208194.2"
                     /db_xref="GeneID:4618921"
     CDS             complement(199323..201383)
                     /locus_tag="AGOS_ABL106C"
                     /old_locus_tag="ABL106C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR234W (LYS4)"
                     /codon_start=1
                     /product="ABL106Cp"
                     /protein_id="NP_982841.2"
                     /db_xref="GeneID:4618921"
                     /translation="MRVVRCVRRFSASRAVSGQNTTEKIVQAHAVGLRPGHRVASGDY
                     VSIRPAHCMSHDNSWPVALKFMGLGATRVHDARQVVCTLDHDVQNRSEKNLAKYRNIE
                     LFAAQQGVDFYPARRGIGHQIMVEEGYAFPLGLTVASDSHSNTYGGVGALGTPVVRTD
                     AAAIWATGQTWWQVPPVARVELTGELPAGVSGKDAIVALCGVFGRDEVLNHAVEFAGP
                     GVARLTVEQRLTVANMTTEWGALSGLFPVDGVLLDWYREQVARAPAGHARLTAARVDA
                     LAERAAAMQPDTDARYAKQLTLDLSSLTHYVSGPNSVKVARPIAELAPQQLRIDKAYL
                     LSCTNGRLEDLEAAAAVLRADGSVRQVAPGVEFYIAAASAEVEAQARARGTWDVLLSA
                     GCIPLPSGCGPCIGLGKGLLEAGEVGISATNRNFRGRMGSKDAEAYLASPAVVAASAV
                     LGRIAAPCEVLGLSPPAAPAVRASVAQCGAPAAADGAAAAVEVLPGFPRAITGELVLC
                     DADNINTDGIYPGKYTYEDDIPRETMARVCMENYDLDFQHNVHAGDIVVGGYNFGTGS
                     SREQAATALLAKGVPLVVAGSFSNTFSRNAINNALLTLELPALLQLLRERYADAPSQA
                     TRRTGVFLTWDVAAATVTVTVGSPTGERVLHQRVGEFSANLQEIIVKGGLEGWVKHAL
                     AQSA"
     gene            <201739..>202575
                     /locus_tag="AGOS_ABL105W"
                     /old_locus_tag="ABL105W"
                     /db_xref="GeneID:4618922"
     mRNA            <201739..>202575
                     /locus_tag="AGOS_ABL105W"
                     /old_locus_tag="ABL105W"
                     /product="ABL105Wp"
                     /transcript_id="NM_208195.1"
                     /db_xref="GeneID:4618922"
     CDS             201739..202575
                     /locus_tag="AGOS_ABL105W"
                     /old_locus_tag="ABL105W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR233C (RTN1) and YDL204W (RTN2)"
                     /codon_start=1
                     /product="ABL105Wp"
                     /protein_id="NP_982842.1"
                     /db_xref="GeneID:4618922"
                     /translation="MGHCDLLLWRNPVETGKVFGGLLVALLVLKKVNLVTFFLRVLYT
                     TLFLSSAVEFASKFVLGQGLVTKYGVQECPNVAGMLRPKLEAALARLPAYQTQVRRLV
                     FAASPQQTFKAAGLLYVLHILVSFFSVWTLALLSVVGAFTLPVVYHKYQREIDDAVHQ
                     GLALAKAKSAEAQKMASETAAPYIKQIDEKFGPVSHYFIPKTPSSSGPAAQKPAAPST
                     ASSSKGSVVEPSQGASSAASFPSVPSAKIPESATKEVEEEDIDIEQLKQEMKGNKEAS
                     AL"
     gene            complement(<202806..>204476)
                     /locus_tag="AGOS_ABL104C"
                     /old_locus_tag="ABL104C"
                     /db_xref="GeneID:4618923"
     mRNA            complement(<202806..>204476)
                     /locus_tag="AGOS_ABL104C"
                     /old_locus_tag="ABL104C"
                     /product="ABL104Cp"
                     /transcript_id="NM_208196.1"
                     /db_xref="GeneID:4618923"
     CDS             complement(202806..204476)
                     /locus_tag="AGOS_ABL104C"
                     /old_locus_tag="ABL104C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR232W (HEM1)"
                     /codon_start=1
                     /product="ABL104Cp"
                     /protein_id="NP_982843.1"
                     /db_xref="GeneID:4618923"
                     /translation="MDSLARQSAKICPFVSRVTSSMQQVQVLHKTNMSAMAQQCPVMR
                     RAMAARGYVTASPPAGAAAADVGEARPITPVLERGTQERTFDYDGLFETELQKKRLDS
                     SYRFFNNINRLAKEYPMAHRLEEEDKVTVWCSNDYLTYSRNEKVMETMKRTIDKYGAG
                     AGGTRNIAGHNRHAMRLEAELAALHKKEGALVFSSCFVANDAVLSLLGQKMPNMVIFS
                     DEMNHASMIMGIKHANVQKHIFRHNDLQHLEELLAMYPKSQPKLIAFESVYSMSGSVA
                     DIRKICDLAEKYGALTFLDEVHSVGLYGPHGAGVAEHLDFEAHRKAGLASPAQTTVLD
                     RVDMITATLGKSFGSVGGYLAASEKLVDFVRSYAPGFIFTSSLPPAVMAGSAAAVFDQ
                     RSSLHLRQLQQKHTSYVKTGLGDLGIPVQPNPSHIVPVLVGNPDLAKRASDILMEKHR
                     IYVQAINFPTVPRGTERLRITPTPGHTNDLSDVLLDAMDDVWKTLQLPRVSDWAAHGG
                     LLGVGEPDYVPEANLWTEEQMSLTNDDLHPSVFSPVEKFLEVSSGIKA"
     gene            <204921..>206050
                     /locus_tag="AGOS_ABL103W"
                     /old_locus_tag="ABL103W"
                     /db_xref="GeneID:4618924"
     mRNA            join(<204921..204947,205004..>206050)
                     /locus_tag="AGOS_ABL103W"
                     /old_locus_tag="ABL103W"
                     /product="ABL103Wp"
                     /transcript_id="NM_208197.2"
                     /db_xref="GeneID:4618924"
     CDS             join(204921..204947,205004..206050)
                     /locus_tag="AGOS_ABL103W"
                     /old_locus_tag="ABL103W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR057C (MUM2); 1-intron"
                     /codon_start=1
                     /product="ABL103Wp"
                     /protein_id="NP_982844.2"
                     /db_xref="GeneID:4618924"
                     /translation="MNSSGFMLFQHQNSLDASFANLNFGDGSAVGQGEAAGNSFMGGN
                     GHPGNSVVSAPSPMASYAQQREPQREQKQTPKQQREQKQVAKHFHGHHHQHSKGSTSS
                     LEQAMGGGTSYWNTDSSATSSIVSIDPGVAAGGSTAGTLTTASIMDGHTAKSSSGFST
                     TFATTSSQQSNPSHGSLESMESLRLELQLKETQIESLEDEITKLKSIFNQGLTFKQQE
                     QQLQKRKLHQHALDLDHMPVEIPANLEIIFNKLATSLKRKDEELEDTRKRLESIMTAI
                     ALNPSNSVTRFGRYDEEALAHKMIVRLEMLTKENQEMAKLLSYGRSKETHIELELLKK
                     VNRDLQRKVEQLEKQLANSGNGK"
     gene            complement(<206440..>207561)
                     /locus_tag="AGOS_ABL102C"
                     /old_locus_tag="ABL102C"
                     /db_xref="GeneID:4618925"
     mRNA            complement(<206440..>207561)
                     /locus_tag="AGOS_ABL102C"
                     /old_locus_tag="ABL102C"
                     /product="ABL102Cp"
                     /transcript_id="NM_208198.1"
                     /db_xref="GeneID:4618925"
     CDS             complement(206440..207561)
                     /locus_tag="AGOS_ABL102C"
                     /old_locus_tag="ABL102C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR035W (ARO3)"
                     /codon_start=1
                     /product="ABL102Cp"
                     /protein_id="NP_982845.1"
                     /db_xref="GeneID:4618925"
                     /translation="MFIKNEYIGDKSRLEDWRIKGYDPLTPPNVLQHELPVSANGRAI
                     IVRAREGVVQVLSGRDDRLLVVVGPCSIHDPEAALEYAQRLSEVASRLRGELLVIMRA
                     YLEKPRTTVGWKGLINDPDIDNSFQINKGLRISREMYTQLVEHIPIAGEMLDTISPQF
                     LSDCFSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGCLQVAIDAMRAAAHSHYFL
                     SVTKPGVTAIVGTEGNEDTFIILRGGKDGTNYDAASVQQAKQDLVNAKLVDSAGVQRR
                     IMIDCSHGNSNKDYRNQPKVAQDIYEQLSKGENAICGVMIESNLVEGRQDIPEGNGRV
                     GLKYGCSITDACIGWDQTVEVLELLAKGVINKRAVMSTN"
     gene            complement(<207883..>209349)
                     /locus_tag="AGOS_ABL101C"
                     /old_locus_tag="ABL101C"
                     /db_xref="GeneID:4618926"
     mRNA            complement(<207883..>209349)
                     /locus_tag="AGOS_ABL101C"
                     /old_locus_tag="ABL101C"
                     /product="ABL101Cp"
                     /transcript_id="NM_208199.1"
                     /db_xref="GeneID:4618926"
     CDS             complement(207883..209349)
                     /locus_tag="AGOS_ABL101C"
                     /old_locus_tag="ABL101C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR056W"
                     /codon_start=1
                     /product="ABL101Cp"
                     /protein_id="NP_982846.1"
                     /db_xref="GeneID:4618926"
                     /translation="MFERLKLRFRRCRRLRANRLADVPYPNPTLNSAIIFQNRHNHGV
                     NLGSLFVLEKWIFESMFQCGGETEHAGIRKMMDAIGYEATAERLRKHYENYMAHIDWD
                     WLQSIGVTAVRLPVGYWHINNGMYTAGFVFDDVRLVYMSARPWDYVRALIHDASRRNI
                     GVLIDMHGLPGGANSEHHSGEGVDASFFKSGRNMDTVCNTMIPFIVQDLRGFHNVVGL
                     QVVNEAVYDYAAEGQKYYYERAVNAVRANSVCLPVVISDGWSPDQWSKWINDRGLSND
                     IVIDTHVYRCYSDDDKSKSVQQLTDDLKDTVRLDRDAADFVVGEFSCVLDADSWAKTS
                     GDRDQLIKNFGHEQVRVFNSNANVGWFFWTYQFQHGDGGEWGFVPMVHHGNLPSRPRL
                     SIPDVENRIRQMVSNHVSFWRDKGGDRMEHWRFEEAVRRTAADILAFDRFDHSRIGRV
                     HYWRSVRRAQYIRERGDSDLMWEWDQGFDQAISEFNKF"
     gene            complement(209727..209798)
                     /locus_tag="AGOS_t0030"
                     /db_xref="GeneID:4618927"
     tRNA            complement(209727..209798)
                     /locus_tag="AGOS_t0030"
                     /product="tRNA-Asp"
                     /codon_recognized="GAC"
                     /db_xref="GeneID:4618927"
     gene            <209878..>212595
                     /locus_tag="AGOS_ABL100W"
                     /old_locus_tag="ABL100W"
                     /db_xref="GeneID:4619310"
     mRNA            <209878..>212595
                     /locus_tag="AGOS_ABL100W"
                     /old_locus_tag="ABL100W"
                     /product="ABL100Wp"
                     /transcript_id="NM_208200.2"
                     /db_xref="GeneID:4619310"
     CDS             209878..212595
                     /locus_tag="AGOS_ABL100W"
                     /old_locus_tag="ABL100W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR055C (PRP6)"
                     /codon_start=1
                     /product="ABL100Wp"
                     /protein_id="NP_982847.1"
                     /db_xref="GeneID:4619310"
                     /translation="MCENQGLETPLSSLTTAERTAMSRSRPSFLDQEPPPGYVAGIGR
                     GAIGFASKAESAQSSYRRPSRLNEGHASGNRESGLQQEAALEQFKDHDEDKEADEIYA
                     ALDIRLTKKTAKQPQRSADSDKVKNTQDYFVDLKRQLAGLTESDWMSIPDAGDLTRRN
                     KRQRSEYQQQLKTYAAPDSLLPGARVDLMKLTEEREKLLGHQLDANFQPDTQKQVAST
                     EQYLAELESSTSTAELEAPSQDVTKARKMLAAYRRSDPKQPQGWIASAKLEERVNRFH
                     SAKAIIDQGCQECPRDEDIWLENIRLNSSDVNYCKIIVAQAIQFNSKSERLWLTAIEL
                     EGENFNKLRVVRKALRNIPKSEKLWILAVRLEPDTKEVVKILSKATQILPTSPQLWKL
                     LIKNQGPDEIRTTIQEARKSMPHNVDLCILEADIKLQATTDESKKLQLLSESIKSVSS
                     DNKPLTFNQWLVYITNAELDACSPKTIMALVGACFTEFATEVQVTEVLAMLQTVKSES
                     KVTKLSVCRCLALRDPSKLTFWSYYIDLCRNEGECSHLYETWETLLKGVTMVKKYPAI
                     LLMYSKEIWKMENDEVRALSILDKGIAIKPDHLAFWNAKLKLLLTMRDYETAESTLMH
                     MKDSICFTQAAGRDRLIRDYVIFLCFRGNHDGAVGFLNSMLSKDPENPQLYLLLSRVY
                     SETSHLTKALDLLSSAVKKLPSSDKLWIQLAYLQEHDLNTIKARSTLELGQLKNSSSI
                     ALYEARAELEDRLGNREHARLLVQEGIRKFPKSPELWVLNIRFLARKSLRKTMFQDAL
                     KNTDSHGTVLVEIGKLFYIEKQYEMALKWFERASETFPRLGDGWAWYYQTLSKLGKDT
                     SGVLRSAEEREPDSGKLWDHVCEKNKTLYALPSDIIRLCRSEIERGAWQ"
     gene            <212861..>215263
                     /locus_tag="AGOS_ABL099W"
                     /old_locus_tag="ABL099W"
                     /db_xref="GeneID:4618928"
     mRNA            <212861..>215263
                     /locus_tag="AGOS_ABL099W"
                     /old_locus_tag="ABL099W"
                     /product="ABL099Wp"
                     /transcript_id="NM_208201.1"
                     /db_xref="GeneID:4618928"
     CDS             212861..215263
                     /locus_tag="AGOS_ABL099W"
                     /old_locus_tag="ABL099W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR034C (LYS14)"
                     /codon_start=1
                     /product="ABL099Wp"
                     /protein_id="NP_982848.1"
                     /db_xref="GeneID:4618928"
                     /translation="MIKEAERDIDLTAAVKNNPSNAYDMSKQTRSSTKLLNMSDTAAS
                     GSGKSADSNTPQKFGSDPEPGYSGSATDLQLLSSPELVLDELSNSFRVAGIVSAGART
                     ISAASSVDHVNMATNAPPEEGRDNKYDEVSAINSSNDLQLSLLGNNEYYEVPRPSGNR
                     KVYSQLPSPPDTKASIKKASAVGDPKRTKRKYSRNGCTECKRRRMKCDEGKPICWQCS
                     RLNRECKYILNARNKKRAAAKKQQPEYNVNDYRTTLEKPVPSAQFQLNSFTNSLPISN
                     HPAVNTPDEAIIYSDVNLLLQNFNDIVNMKLNDSLFNCGTLNDDSLHDLDLSTTFHTS
                     AEIPKVLLSDYGDTSVEFNTSLESFHLGPFHEKYLTVFYHDCLNTIAPFFEGQTNPLR
                     DILLSFAKTEPYLLSAILAVGASARYRKFGCEDDEKAYCNYLSQCLSLLDDHYSEESK
                     LMSKIAPIMLTVILLAWDSVYTMNSQWRSHLKGVTDLLRKTDSIPSTKVLNVVKCWFK
                     VIETFAGISTVIGGALLDDGELDAIFDPYNNAYLAALKQLSIMTPLHEFNLLRGHKED
                     FDLVIKEVFKALNSIRASDKGDTFKKEGIMGKSFDYLQWSSMIPPAMRERLSYLRIQK
                     ILTDIDSQLSYKFIDNSGIIPISNCSHPENSHIVDNAIDTVVLNDGKTIAISWYDISH
                     QTQVLSFLLIVLLKLLGIPKQSIVIQDVVRRITGFFSFLDSPDPPKNLRSCYCNFAIL
                     IAGLNSIEQETQDIIRKYYRAFGGQSHTLMKYNLERLEQVWRLQGTEDASSIEDKDII
                     TW"
     gene            <215674..>216741
                     /locus_tag="AGOS_ABL098W"
                     /old_locus_tag="ABL098W"
                     /db_xref="GeneID:4618929"
     mRNA            <215674..>216741
                     /locus_tag="AGOS_ABL098W"
                     /old_locus_tag="ABL098W"
                     /product="ABL098Wp"
                     /transcript_id="NM_208202.1"
                     /db_xref="GeneID:4618929"
     CDS             215674..216741
                     /locus_tag="AGOS_ABL098W"
                     /old_locus_tag="ABL098W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR053C"
                     /codon_start=1
                     /product="ABL098Wp"
                     /protein_id="NP_982849.1"
                     /db_xref="GeneID:4618929"
                     /translation="MLQMITPSPTGTMSTMAPAVTEYFRDPNAMLSEGVTYSMETREL
                     YWVDIYHARIHRVLDVDNPEQSHSTYDINPATYGAASAYPGSADTAERVGCVFPGLGK
                     GGRLLFAAKRGIAELDLDSGSWRYLYLYSESGLNKAWDRLRSNDGSIAPNGAEIYVGL
                     MADFSVGGPDTSNAPEGCVLRIHLEGWRCQMVLDGIHIPNAINWSADGSQFYLTDSLA
                     FTIWACPVVDGSPQLLKRTPFYCTKNTGNDSHTSPEPDGGFVDCFTGHTFVAVWSTGK
                     VQELDNAGRLVAAYTLPTPRVSSCCAGPAGELLVSTAHAGDFKTGAHSDGVGGSIFRV
                     VIPGRRVAQAASPRLAEASFK"
     gene            complement(<216751..>217110)
                     /locus_tag="AGOS_ABL097C"
                     /old_locus_tag="ABL097C"
                     /db_xref="GeneID:4618930"
     mRNA            complement(<216751..>217110)
                     /locus_tag="AGOS_ABL097C"
                     /old_locus_tag="ABL097C"
                     /product="ABL097Cp"
                     /transcript_id="NM_208203.1"
                     /db_xref="GeneID:4618930"
     CDS             complement(216751..217110)
                     /locus_tag="AGOS_ABL097C"
                     /old_locus_tag="ABL097C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR031W (MIC14)"
                     /codon_start=1
                     /product="ABL097Cp"
                     /protein_id="NP_982850.1"
                     /db_xref="GeneID:4618930"
                     /translation="MSALDQFVMEDVAKHCPNEFMQYHKCISMNHEDPSQCDFRQRDL
                     AVCIKQKVPVVQDIMKHCSAQMQRYEQCIRDHMESRTINENCLGLMAEMRSCAERQTA
                     GKARPINELGGRGDERV"
     gene            <217163..>218503
                     /locus_tag="AGOS_ABL096W"
                     /old_locus_tag="ABL096W"
                     /db_xref="GeneID:4618931"
     mRNA            <217163..>218503
                     /locus_tag="AGOS_ABL096W"
                     /old_locus_tag="ABL096W"
                     /product="ABL096Wp"
                     /transcript_id="NM_208204.2"
                     /db_xref="GeneID:4618931"
     CDS             217163..218503
                     /locus_tag="AGOS_ABL096W"
                     /old_locus_tag="ABL096W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR030C (RAD28)"
                     /codon_start=1
                     /product="ABL096Wp"
                     /protein_id="NP_982851.2"
                     /db_xref="GeneID:4618931"
                     /translation="MATDNGPATGTLRKIRTTSGKTRQHPLVPQEVCERMNHRWLDYA
                     LGQGELVPPERTVQFKAPVVYHHERTPADVYSVGVSALAVDQHTGQFFVSCGTDGSVS
                     LWQFHGRVVGNGVLRNRRLHYVRGTVSEEPAPRRSADARHNVRQVNNIRMYMQRAPAA
                     APDTPRVGVQASVDCVFYGQDNGMFVTAGRNGTVRLWDTESCRPLHEVQLPHAAHQLH
                     ARGSLLLCALADPHPRVLDLRHPRGEGMQLRAGARARPGANALCARFLADAADDPRFV
                     AAGDHAGGLAVWDLRMANRRVAAVPGAHPGFVNALATLHVPAHVATLATAGADGRCRL
                     WTWANGALRLRRPLGPSDAARNRLASRTASRLLCHRGHCFLSSDQGDLLVYSCADGRL
                     VAKLAHADTFPAAPASARFQALAIQPRLAAGTGTRLLLGSDALSGALADYELAL"
     gene            <218935..>222000
                     /locus_tag="AGOS_ABL095W"
                     /old_locus_tag="ABL095W"
                     /db_xref="GeneID:4618932"
     mRNA            <218935..>222000
                     /locus_tag="AGOS_ABL095W"
                     /old_locus_tag="ABL095W"
                     /product="ABL095Wp"
                     /transcript_id="NM_208205.1"
                     /db_xref="GeneID:4618932"
     CDS             218935..222000
                     /locus_tag="AGOS_ABL095W"
                     /old_locus_tag="ABL095W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR028C (REG1)"
                     /codon_start=1
                     /product="ABL095Wp"
                     /protein_id="NP_982852.1"
                     /db_xref="GeneID:4618932"
                     /translation="MSRNLADYFGQGGPITPRRGPREDYVGPSVSMAVEAEDDDKFEK
                     ATFNLKRTRSMGLLDEYISPTRRLLEQDEAALEPEGEATWVAQASPQLPPLAVSHLEG
                     SKSPPEPDTDSYMLPLDDIDVHHEPNRHVDYLSHDWDECDISQSWKYIILKKRQKGEQ
                     DLVNAARLENASWRTWAKARNNLRTVSPEVVNWSKDSDVTWLYGPILRDSGHAQTLTR
                     NAVADMEELVYGSDDENSKRVSKKKSGGSTGPPQRPGPKPILKKRTVSEIIEENSLWR
                     LTVARQHRKQIADANSIMDGYGHNYQHDDYDALAARVNSQYYTGTISNDYSRNGKRNH
                     GTESEGPSSPLADKVDNHPLTKESSSRKVPPYKKDEEKQTEHHLTQEKMDQGSHAQKD
                     QKEFYIGRHQEHGHGDLPDHTLQEYGRRLKEPVLLPLHDKGQTSGQDATGDELPARQA
                     PQQTQAPAERHDLASLKDMAPIAPVLASILTSTNSEREKVKDRHIHFNDRVEQCVAVN
                     HYTDDDYDDDNEYEEDGYDYEYDDYDDSAPTARVYSSQYDDESTDHYGSSGEEEEEED
                     GLFISATGRKTTENVPPIQTDASSYGSSTVGHGSRCQMHLIIKMLPATTLNYGSDDEY
                     YDGGDYYRGNAVSHNVNTYRGYDYVYDYNSVYTADTSNFLAFNNCDIVDVPEDLQTPV
                     DEEGAPKFRYESPEETKDREQEPTEISNENIEVIPVPSSISSKISYHVTEFSSNSDMS
                     DDSLSEQSGVSLSNGCTISTGKVDDENDSLALKRTPSLGKSQNSSLHDLQYNKPTFPA
                     SFSFITGNAVPSRVVPQPHEQQLQQQQHQQHQQHQQHQVHHQQSTNKPTLVKRSSSKS
                     FIFDDSDTEDSEPDSIVPPPQISHSLSNDSNTKSPYSIPTRNTSASTSPKNIPPPNFG
                     SLGSGNSHASLNHVAIPGYISPRNGSMQSVISEEKLIPATKTVSHTSTSAEETSRNLD
                     LDSVNKTFGDCRIGSPDSSEFAYKTERGQQQSSTKMMEMASKYLNSWKR"
     gene            <222466..>223239
                     /locus_tag="AGOS_ABL094W"
                     /old_locus_tag="ABL094W"
                     /db_xref="GeneID:4618933"
     mRNA            <222466..>223239
                     /locus_tag="AGOS_ABL094W"
                     /old_locus_tag="ABL094W"
                     /product="ABL094Wp"
                     /transcript_id="NM_208206.1"
                     /db_xref="GeneID:4618933"
     CDS             222466..223239
                     /locus_tag="AGOS_ABL094W"
                     /old_locus_tag="ABL094W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YJL210W (PEX2)"
                     /codon_start=1
                     /product="ABL094Wp"
                     /protein_id="NP_982853.1"
                     /db_xref="GeneID:4618933"
                     /translation="MSRVAQLDSLALDSELHQGIWSEFQSQFKPVKYIDEWQLLLHTL
                     IYHFSTHTSVAGVSTYGSQLSGVTYRTSKSTLFLVTVLVRYIHKKLSTLLVRREGYAK
                     LYRVAAKWYHCYDLANFLSFLARPLFLSPIHRLFGIRCVRALDDPNFYLSTVYSGLEF
                     QNRQLMWNALLELLNANFFNSHFFSKRSLVKNARPTGPEECAKCRDVPNNPYSTSCCG
                     ATYCYVCVLISLDIKFCNNCGNRGDFSAIPLYAPPRLTE"
     gene            <223625..>226459
                     /locus_tag="AGOS_ABL093W"
                     /old_locus_tag="ABL093W"
                     /db_xref="GeneID:4618934"
     mRNA            <223625..>226459
                     /locus_tag="AGOS_ABL093W"
                     /old_locus_tag="ABL093W"
                     /product="ABL093Wp"
                     /transcript_id="NM_208207.2"
                     /db_xref="GeneID:4618934"
     CDS             223625..226459
                     /locus_tag="AGOS_ABL093W"
                     /old_locus_tag="ABL093W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR027C (VPS54)"
                     /codon_start=1
                     /product="ABL093Wp"
                     /protein_id="NP_982854.2"
                     /db_xref="GeneID:4618934"
                     /translation="MVKVNVSNASSQSSQDNSCVGDAKADQCKEPDGGERTEEKSTLN
                     GSPRHNSVKSLSVEASSLNDDLLSVVSSSKLRYGAAATVGRSTSVTRPSFESFSLRPS
                     LDPSSVFIAGARNNISTMLDIETASPTGSGVNYSPLGQNSIFEIVMNTRRKGWLRAPT
                     VQDIPPVPLSKDMPEGDWKTRLGSYVSRISDGYTTFQNTNTLASMNRSHQLKKLERYD
                     RTESAVSADEEDTEEDAFSSSKMLEDIPSVYFNEDFQLDNPRVFHKVVEDINLQLDSL
                     TIASQSQRAAAYKDLQERLNFYLDTIENILIVDISKSSHKFLDALEDVGTIKDEAQSV
                     LTKLDQLKTELETEDRERLQKRLRLSQKLTRIRNIERLEQGLLQLHVVLKQIEECRRL
                     YDAGEYTPCLKHITSVELLISGNIGNDELAQEWTHGWPYSLQDLSRIPSLAPKREYLS
                     NVRIEIGGKLSLALVDLLLSDLRAYATNQTVKGTLNRLQSQTKGGRTYWDIELAFREK
                     VTDIIQRLIKCEELTSAFQLYQDKFIVELKSIIKKHLPKDQPSSENSLNDGDSVAEPT
                     RPPTPSNTGTASTGSKLSRLIREQTPAEFQEMLTNIITEESNALRRLSRHQKLLLDVS
                     LTELASDSSQYDMIMLLDIRRSINEGIRIIQLRLGKVIAVRRDFTSQLPPRQFIRFYM
                     VCALFIQECESLSGDLLTKYLADVLMMQVRNYISTFAMSNMEQLQHSIDSDRWIPYIV
                     DTTDQSDVNDIVSCTDIDPLNWVHARDLAIESSPAASPSPPVSQSSSLTSPSAPSPSF
                     TSTTGHKRSVVVGDKTFVASESLIICLRMLSALLLLSLNLPSNHLSLLEKAVLDLLRC
                     FNIRAMSSAASTNDKKPSSATKNLSIMGESLDCLSEMIGLVQGFYQRLEALHKDFQAL
                     PPHTYAVLAQQFRRSSDKLYQAHAPPPPPI"
     gene            <227494..>229290
                     /locus_tag="AGOS_ABL092W"
                     /old_locus_tag="ABL092W"
                     /db_xref="GeneID:4618935"
     mRNA            <227494..>229290
                     /locus_tag="AGOS_ABL092W"
                     /old_locus_tag="ABL092W"
                     /product="ABL092Wp"
                     /transcript_id="NM_208208.1"
                     /db_xref="GeneID:4618935"
     CDS             227494..229290
                     /locus_tag="AGOS_ABL092W"
                     /old_locus_tag="ABL092W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR049C (REB1) and YDR026C"
                     /codon_start=1
                     /product="ABL092Wp"
                     /protein_id="NP_982855.1"
                     /db_xref="GeneID:4618935"
                     /translation="MSDTQGHHHGHTGGHEFVEEAVFKYVSGPISGESDSSTVAVRSG
                     SGPSSTGSTAATGGSGRRHSGIGVEGLRVKDKDKEMDWYLKHNDEEELHGRGEDSSAA
                     AAAVAAAAVAAALGERGKRRGSDELEALKKSKRQKAKAKKLKSQLGAVDPELASLDST
                     DNDHLVRKAIMDVDHISQHPDIQQYLNTEDEETEKDKDKDDELGLAPAYEDSEQKIAL
                     KKAEVLPKILDPDSSDRDIGNLIREAVKKAAHIINLQTQSTGKSFDETEEEALEQFVQ
                     DYQVIKGMTRRQICERIWSNERRKDDFWTNICRVLPYRTRSSIYKHVRRKYHIFEQRG
                     KWTPEEDAELARWCMEKEGQWSNIGKVLGRMPEDCRDRWRNYIKCGASRASNKWSPEE
                     EEKLKSVITEILESAPKNHLDGVDDKDEYEGTDDNRSMGRAVSPSSKSLAHELELVRG
                     DRVSLGDSAGEKDQGSPGLGVKAGSPRDVINWTIVSERMGGQRSRIQCRYKWNKLLKK
                     EAMNKIKTISDEDKTWLLLKLKDLGFTEDSQVDWEELAALMPGRRWTGTELKLCYEKL
                     RTSVRQYKKKPISEICRELVDYHDGKAILSKT"
     gene            complement(<229537..>230245)
                     /locus_tag="AGOS_ABL091C"
                     /old_locus_tag="ABL091C"
                     /db_xref="GeneID:4618936"
     mRNA            complement(join(<229537..229962,230201..>230245))
                     /locus_tag="AGOS_ABL091C"
                     /old_locus_tag="ABL091C"
                     /product="40S ribosomal protein S11"
                     /transcript_id="NM_208209.1"
                     /db_xref="GeneID:4618936"
     CDS             complement(join(229537..229962,230201..230245))
                     /locus_tag="AGOS_ABL091C"
                     /old_locus_tag="ABL091C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR025W (RPS11A) and YBR048W (RPS11B); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S11"
                     /protein_id="NP_982856.1"
                     /db_xref="GeneID:4618936"
                     /translation="MSTELTVQAERAFQKQPHIFTNPKAKANRRTKRWYKNAGLGFKT
                     PKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIIIRRDYLHYVPKYNRYEK
                     RHKNVPVHVSPAFRVQLGDIVTVGQCRPISKTVRFNVLKVASAANKNNKQFTKF"
     gene            <230729..>231733
                     /locus_tag="AGOS_ABL090W"
                     /old_locus_tag="ABL090W"
                     /db_xref="GeneID:4618937"
     mRNA            <230729..>231733
                     /locus_tag="AGOS_ABL090W"
                     /old_locus_tag="ABL090W"
                     /product="ABL090Wp"
                     /transcript_id="NM_208210.1"
                     /db_xref="GeneID:4618937"
     CDS             230729..231733
                     /locus_tag="AGOS_ABL090W"
                     /old_locus_tag="ABL090W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR046C (ZTA1)"
                     /codon_start=1
                     /product="ABL090Wp"
                     /protein_id="NP_982857.1"
                     /db_xref="GeneID:4618937"
                     /translation="MSDIPTEQKVVLIRETGGPEVLRYEEDYPVPEVRGSDILIKNRY
                     AGVNFIETYFRTGLYPCEKPYVLGREAVGVVAAIGADVRRFKVGDRVACLSSGTFAQY
                     TAVSEKSNVLKLPDDIQDGELQAVAGSLVNGLTALTLVDEAYKPQVGEIVLVYAAAGG
                     VGQLLIQLLHARSVRVIAVASTDEKLQIAKSRGAEFLINSSREDIVAKVLEFTDGEGV
                     GASYDSVGKDTFETTLQSVKRKGTIVSFGNASGAVPPFSIQRLTPKNLKILRPQLYGY
                     LATREEWEYYSSKLLHLIRSKKLIINITNLSPLEEFKRLTQLLESRQTTGKLLLAIPD
                     "
     gene            <232107..>233912
                     /locus_tag="AGOS_ABL089W"
                     /old_locus_tag="ABL089W"
                     /db_xref="GeneID:4618938"
     mRNA            <232107..>233912
                     /locus_tag="AGOS_ABL089W"
                     /old_locus_tag="ABL089W"
                     /product="ABL089Wp"
                     /transcript_id="NM_208211.2"
                     /db_xref="GeneID:4618938"
     CDS             232107..233912
                     /locus_tag="AGOS_ABL089W"
                     /old_locus_tag="ABL089W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR045C (GIP1)"
                     /codon_start=1
                     /product="ABL089Wp"
                     /protein_id="NP_982858.2"
                     /db_xref="GeneID:4618938"
                     /translation="MSIVMDKNLSFNSEQLLNVTTEEEEGNGEGFPGICGHHSSTLTE
                     RTMNLVAVSTAAASSLSANLITTPSSPPVVHRESQKKRKKARRLLRKWKQTVKQKLHI
                     ANYDTNGAYTNNQSTATSMSELKDALSCYYKFKSDESKIEEMFETMMFKNNGQSPPIT
                     RDQELRELVPFEIIGEQKLADLKKKLDVFSNCLSALDDDKPWNQSSGFNSPNDLKAPR
                     SAIGGSGSPPDLVSGISTLDSAEPPESLDKPSCCQLLSGDDCCINESADSTPHVGLTT
                     GSSKASSIVEKIASFVRTPKTSETSPMDSVRLSSPLDSEFEVQRLVIPTFRMNAGKNM
                     DVSHIVENLKSGTITENDLLYLASMYAAQEVGFMDKSFYDDQGNEADNESATSDDLEK
                     ERQTITTDERDYYKNNHESPDSVKFDRFSYLVIYNASKKCDSSGLKKRSTRNNSGSII
                     QGTTAVDSGYEGDDDEPHSPNITESDGSLCKSILKSKNNDKEYLESQRAVKCDKVSVD
                     EFLEFFEQYENERRDGEHMLTSARDKQLCNYYSNEYFPEISCQSNPVKATTEFTRSKL
                     ATEHNIGRELMDVKSEVDSYNCYNDCSSVIGVEAN"
     gene            complement(<234083..>235462)
                     /locus_tag="AGOS_ABL088C"
                     /old_locus_tag="ABL088C"
                     /db_xref="GeneID:4618940"
     mRNA            complement(<234083..>235462)
                     /locus_tag="AGOS_ABL088C"
                     /old_locus_tag="ABL088C"
                     /product="ABL088Cp"
                     /transcript_id="NM_208212.1"
                     /db_xref="GeneID:4618940"
     CDS             complement(234083..235462)
                     /locus_tag="AGOS_ABL088C"
                     /old_locus_tag="ABL088C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR023W (SES1)"
                     /codon_start=1
                     /product="ABL088Cp"
                     /protein_id="NP_982859.1"
                     /db_xref="GeneID:4618940"
                     /translation="MLDITLFIEEKGGNPDLIKKSQQARNAPVEIVDEIISDYKEWVK
                     TRFQLDELNKAFNKVQKEIGQKFKNKEDASELLAQKERMTEEKKQLIEQEQEQDKALR
                     DKVNRVGNIVHPSVVVSNDEANNELVRTWRPEGLSEVGTTASCTGQPAKLSHHEVLLR
                     LDGYDPERGVKISGHRGYFFRNYGVFLNQALINYGLSFLAAKGYCPLQAPVMMNKEVM
                     AKTAQLSQFDEELYKVMDGEDEKYLIATSEQPISAYHSGEWFEKPQEQLPIRYVGYSS
                     CFRREAGAHGKDAWGVFRVHAFEKIEQFCITEPEKSWEEFDSMIANSEEFYQSLGIPY
                     RIVGIVSGELNNAAAKKYDLEAWFPYQQEYKELVSCSNCTDYQSRNLEIRCGIKKMGD
                     REKKYVHCLNSTLAATQRALCCLLENYQTEDGLVVPEVLRKYIPGEPEFIPYSKELPK
                     NSTSNKRKN"
     gene            <236044..>236907
                     /locus_tag="AGOS_ABL087W"
                     /old_locus_tag="ABL087W"
                     /db_xref="GeneID:4618941"
     mRNA            <236044..>236907
                     /locus_tag="AGOS_ABL087W"
                     /old_locus_tag="ABL087W"
                     /product="ABL087Wp"
                     /transcript_id="NM_208213.1"
                     /db_xref="GeneID:4618941"
     CDS             236044..236907
                     /locus_tag="AGOS_ABL087W"
                     /old_locus_tag="ABL087W"
                     /note="NOHBY208; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B03718g"
                     /codon_start=1
                     /product="ABL087Wp"
                     /protein_id="NP_982860.1"
                     /db_xref="GeneID:4618941"
                     /translation="MTSAVNILLDAIYIVVTYVLPLILTFHTTYESNELSRHIAKGYS
                     DMEALQFKGSQVIKSEDYLRQLEEVMHINLKICALSLSKCMMRTQISIYWCVYWLSVT
                     VLEQFLYPCLRRKMLYASININAASWRTIQTMVTLALLIHTYEHPVERGKPLRERNKD
                     RFWSIQSMLMKVHDCCLNWVSAALDRANVSCTPAQISALVEKGNRILAVEQHKYFDRG
                     LALEALTKPHTGEKTVLVMDTQMSYDIVSTSECNSILSASSASSYSSAAVDHTRHGRG
                     RTNTTQPTFSK"
     gene            complement(<236962..>237726)
                     /locus_tag="AGOS_ABL086C"
                     /old_locus_tag="ABL086C"
                     /db_xref="GeneID:4618942"
     mRNA            complement(<236962..>237726)
                     /locus_tag="AGOS_ABL086C"
                     /old_locus_tag="ABL086C"
                     /product="ABL086Cp"
                     /transcript_id="NM_208214.1"
                     /db_xref="GeneID:4618942"
     CDS             complement(236962..237726)
                     /locus_tag="AGOS_ABL086C"
                     /old_locus_tag="ABL086C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR144W (MGM101)"
                     /codon_start=1
                     /product="ABL086Cp"
                     /protein_id="NP_982861.1"
                     /db_xref="GeneID:4618942"
                     /translation="MIRFCSARLIQRGLHTAVAKPVMATSTAASRAAASKMAGAQAET
                     GVVGSRLVPGYGRTLTRALGGQVLEADTEGGGHVMTEGSVDWRRSFHGLGAKPFAAPV
                     QEELARALEPLDIEIKPDGLLYLPEIKYRRILNRAFGAGGWGLAPRSDTIVTAKLVTR
                     EYALVCHGQLVSVARGEQDYFIDTGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIK
                     KFKKEYCMERFVEHLTTKKKKKIWLRKDREVEYPYK"
     gene            <237995..>240268
                     /locus_tag="AGOS_ABL085W"
                     /old_locus_tag="ABL085W"
                     /db_xref="GeneID:4618943"
     mRNA            <237995..>240268
                     /locus_tag="AGOS_ABL085W"
                     /old_locus_tag="ABL085W"
                     /product="ABL085Wp"
                     /transcript_id="NM_208215.2"
                     /db_xref="GeneID:4618943"
     CDS             237995..240268
                     /locus_tag="AGOS_ABL085W"
                     /old_locus_tag="ABL085W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR143C (PMT4)"
                     /codon_start=1
                     /product="ABL085Wp"
                     /protein_id="NP_982862.2"
                     /db_xref="GeneID:4618943"
                     /translation="MASKKSQKAASVERDDSAAKRGKAEGRYEYMGERWLQRPAPDSN
                     LKYKYYGYMVTAIAFAVRFHKLYHPSEVVFDEVHFGKFASYYLERTYFFDVHPPFSKM
                     LIAFVGWLVGYDGAFKFDDIGYSYETHQVPYIAYRSLSAILGTLTVPLVFSILRELNF
                     KAITCAFGALLVAVDNAHVIDSRLILLDATLVISVALSIYTYIRFYKAQLRAPLSSEW
                     YFWLYATGLSLSFVISTKYVGVFTFAMIGTAVIVNLWQLLDVRAGLSLRMFFRHFVQR
                     FNGLVCFPFAVYLFWFYVHFAILTKSGPGDDFMSSAFQETLADSPLAKDSKDVHYYDI
                     VTFQHRDTGALLHSHNAYYPLRYEDGRVSSQGQQVTGYSHEDINNQWEILPTKELSSR
                     TGQPVLLDDVLRLRHIATGTYLLTHDVASPYYPTNEEVTTISEELANGERYKQTLFKL
                     QPPNKKDGGHTVKSKTSMFRMFHVDTAVALWTHNDVFLPEWGFKQQEVNGNKKVTDPA
                     NIWTVNSILNLSEERKVYIPKKVTKMPFFSKWLELQRSMFEHNNKLSSEHPFASQPES
                     WPGSLSGVSFWTNDTERRQIYFTGNIIGWWIELISLALFVGILLADAITRQRSFFVLG
                     KLAREKIYGPLCFLYIGWAIHYFPFFLMGRQKFLHHYLPAHLIAAMFTAGLWEVIFTD
                     NRALTTRKDESEPAAPHNTNPIVYEYFLLAFLGLLSIAVVGFFIYFSPIVYGDRTLTP
                     EEVIKRQWFDIKLHFAK"
     gene            complement(<240348..>241364)
                     /locus_tag="AGOS_ABL084C"
                     /old_locus_tag="ABL084C"
                     /db_xref="GeneID:4618944"
     mRNA            complement(<240348..>241364)
                     /locus_tag="AGOS_ABL084C"
                     /old_locus_tag="ABL084C"
                     /product="ABL084Cp"
                     /transcript_id="NM_208216.2"
                     /db_xref="GeneID:4618944"
     CDS             complement(240348..241364)
                     /locus_tag="AGOS_ABL084C"
                     /old_locus_tag="ABL084C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR142W"
                     /codon_start=1
                     /product="ABL084Cp"
                     /protein_id="NP_982863.2"
                     /db_xref="GeneID:4618944"
                     /translation="MSTVDWDGTRQILLRTPADVQKGFSFIEIVNAVDGLSYDYQSNP
                     AFKEHVYEFHTHSGVPIGYILQFVVQEMRLVASTEFDRLFACSDAERYVKFKETDFET
                     RNEQLETLAQQLRSRSSLSCLKGWRNEKYAVYVEHLPYVLIERALSSVFGIITYGVHM
                     NGYLRDASTGELLIWVPRRSYKKATWPGMLDNVVAGGLGHPHGVYDTLLKESMEEAAL
                     PEEVIRNGARAVGVVSYFYHKPGGTYSTEADFITGEIEYLYDIQLPVDVIPKPNDDEV
                     NNFTLMTLQQVVDALIRGDFKPNCGLIMLDFLVRHGYVNSDNEPHYLEIVTKMHRHLP
                     FPTL"
     gene            <241545..>242690
                     /locus_tag="AGOS_ABL083W"
                     /old_locus_tag="ABL083W"
                     /db_xref="GeneID:4618945"
     mRNA            <241545..>242690
                     /locus_tag="AGOS_ABL083W"
                     /old_locus_tag="ABL083W"
                     /product="ABL083Wp"
                     /transcript_id="NM_208217.1"
                     /db_xref="GeneID:4618945"
     CDS             241545..242690
                     /locus_tag="AGOS_ABL083W"
                     /old_locus_tag="ABL083W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR201C (PPX1)"
                     /codon_start=1
                     /product="ABL083Wp"
                     /protein_id="NP_982864.1"
                     /db_xref="GeneID:4618945"
                     /translation="MSNSIAQFLTFLRNQYVKNLSQGVPLRIVCGNESADLDSVASAI
                     AYAYFSYAWKPTEPVVPIISIPHHDLKLRKDVEMVLEHIGVSDKSLFFLEDLQKWKMD
                     HGLTIDGVLVDHNELQGPCKDLIDEVVGVIDHHEDQRIYYEQVKKTNGPYIVAPTGSC
                     SSHVVNYWNGILGSSDQSQLTDALTLCMSAIMMDTSKLKHKVEDSDMQAYAICKSVLT
                     NMNEDAYYKRMKAAKNDVDGFSLDEILRKDYKELVFPSRSADLRVGVPTVVRSFEWMR
                     EKFGDNGTTKLWHSFLLEHKLDFLVVLTIKKANEGLKRELAIMANSCDRAQQVEFLIQ
                     SLTPELQLSKTSVFSPGSLVIETCDQRMLSASRKQIVPLLKRTVAEL"
     gene            complement(<242685..>243719)
                     /locus_tag="AGOS_ABL082C"
                     /old_locus_tag="ABL082C"
                     /db_xref="GeneID:4618946"
     mRNA            complement(<242685..>243719)
                     /locus_tag="AGOS_ABL082C"
                     /old_locus_tag="ABL082C"
                     /product="ABL082Cp"
                     /transcript_id="NM_208218.1"
                     /db_xref="GeneID:4618946"
     CDS             complement(242685..243719)
                     /locus_tag="AGOS_ABL082C"
                     /old_locus_tag="ABL082C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR141W"
                     /codon_start=1
                     /product="ABL082Cp"
                     /protein_id="NP_982865.1"
                     /db_xref="GeneID:4618946"
                     /translation="MQYLAEYLPRIGVMLIVVAGEAGEVELGKLGGHRLTVTVNGAAE
                     VIELPCEVDPLARPRIRHSEGAFEVRLKAVNGTEGRGADFTMLAAEDGWGRKDLARAE
                     LRCAACDGLLVTGEACRRVSAMPSEFWTELMDYWHCHKPADESAGAQQYLTKYNALLP
                     ADGELLVGDTFVTVGEGLLSEKLAMSGTAVLCKACRAPLGAVTREKLLRLHKWNLVQV
                     RSDGSRKKYRQASAVVAGLLSALNSHAARVVHLRAERGSQIALWVFNVGLDVSTADGL
                     IRCGLKILYTDDVESVTHAPSGRQHIESMTMPDACFDDFVKRLETTNATLPLRCGKMG
                     NWNVSYISML"
     gene            <243852..>248783
                     /locus_tag="AGOS_ABL081W"
                     /old_locus_tag="ABL081W"
                     /db_xref="GeneID:4618947"
     mRNA            <243852..>248783
                     /locus_tag="AGOS_ABL081W"
                     /old_locus_tag="ABL081W"
                     /product="ABL081Wp"
                     /transcript_id="NM_208219.2"
                     /db_xref="GeneID:4618947"
     CDS             243852..248783
                     /locus_tag="AGOS_ABL081W"
                     /old_locus_tag="ABL081W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR140C (HIR3)"
                     /codon_start=1
                     /product="ABL081Wp"
                     /protein_id="NP_982866.2"
                     /db_xref="GeneID:4618947"
                     /translation="MSLFTALNSTPHDALLEAEEHSRELQVEESFRVFQSALFHLKAK
                     RFDDAEAKFEQLFNIEVLKPDHWGLYRYSSPTLDLLRYLAYRNRGVFYYQYVREHAEE
                     LDKDDIVDYILKVVENLLQALQHSDGDAAVTGLLLQVFRGFKSKRLQRWILEYELTKQ
                     PEEMLLLGRGRALLPDTRGLVEEYRRVLRDVRSEPVTEFAARVLTLVKTDSLEVQPLP
                     PVLDKIEQLKDEDDAMMKQLAEYEVNLEELSWECIAESFRSLVPKYKYTNFFSKAPDP
                     YSEAGDPIECIKFVHNDKPIEQEVMEQLSVQNEREPFAATQAATEAPTLEKEGSENGG
                     RTESKRDSELPSDSQRPAQRSSKRFKERSTETNEAELLRPHQDFAALFYSCTGILEVR
                     LEIELSHLNPEAIPSTYPAYMPMLDFYECLNSWTSKHTEFLNQSETKGTSKNKGKGED
                     SFQLTSLLRSSMFTEENRPTISLTELPYKEVAEFISTVNSNRLHFHAVRLLLLQVLLT
                     VRPDGSCLITDTFWSPILYDTIESFVLSLESNIYDLVYSQSEKYKGLGLSFCEVLMNS
                     LGGIYTEIHAKKISGGKYGELEAQKNKLEKKIDRWVLLLDQLVFEGKLKFRYLWSKFC
                     YLQCISDVTDDRIIHSLDYITHELRNSSMDIDISYANYEHTPRLNMETVQSQLSKIKM
                     MRKFTMVNQMDVDRNDSSNEDQIEALSRVLVGTSLLDTPEDRSMSEFVNQAPFLLKIK
                     LWRIVLHHYLAVKDQSNFQICYFKVLHVLYERLCSKEYSDQSQLQRQQTLLSTLSLMR
                     SFTSLFIELLSGANEWVINDTSQASEYFKLLIDVFILLYPLTYFETLSQKSATTVSFF
                     KKAAKSSVILKDMFVDISCLLVLYFTGACTQKEVVNGVEVATEFIHALHLLIGGFTFC
                     DAANGNFLNLAEHFFCSVEGSSSFIPLKQILLCKYRLSLGGDANSFEDHGAKPQVLEM
                     HNAVRLAKYLIRFEYQNKNPYLISTNRSNLKQVIENVIDVIGKIPYAENHILARNVYY
                     FEQYLEAPVTAKIIQEALQGCISIELTKPRDNLQEIVDLGLYYISGVQLLNLYKVRKK
                     TLQARPSELDSIIETLKADILYKTNRFETWFLLGKCYSYVVEDDLIWTSDRLVVASKK
                     ATTASIQRKAILCYLMALNLCQLSVDDPSLSEAQKMENAFIKREIYEVLALELLNAYF
                     KPMEGLPFQRDIAPALVLTETGELVEPKNSPQPSISSANIYRATLLVFTNADEMYKDS
                     QDALQNWLNPHYIANLRFKHEREDFITDGFDIIIRACNLAMKASTSNDNIIEPHYSLV
                     IKCYKSVKHGWLRPEDALKHLLNDNSFLAQEANFYSHNPENSVQDFYRKIITLLRRLL
                     ALDKRKWHHRPTYRIARILFDDFNDVDGAIQEMGVLMALKSVNKNLVNIWKPEYERPG
                     KHFVYTYQYVMFYLKLLSHKNDYISLGHAARKMRRFGSGMVNGSLATDKAVEMFINGA
                     RAALGINEKEHAELLLPTLNYQAFNRYSDELIASFNKENYSYEVLESLAISYQLKKGS
                     SGIAFDGVCLSIYFKYLYLPWVEEHEAAEATQSMVKFVEINKNVNPTENETASPQPAA
                     EPQKSTTKQVSSRKRVSKKDAFDKISQIVDKIT"
     gene            <248991..>250061
                     /locus_tag="AGOS_ABL080W"
                     /old_locus_tag="ABL080W"
                     /db_xref="GeneID:4618948"
     mRNA            <248991..>250061
                     /locus_tag="AGOS_ABL080W"
                     /old_locus_tag="ABL080W"
                     /product="ABL080Wp"
                     /transcript_id="NM_208220.1"
                     /db_xref="GeneID:4618948"
     CDS             248991..250061
                     /locus_tag="AGOS_ABL080W"
                     /old_locus_tag="ABL080W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR139C (HOM6)"
                     /codon_start=1
                     /product="ABL080Wp"
                     /protein_id="NP_982867.1"
                     /db_xref="GeneID:4618948"
                     /translation="MLTNVLPTGTGLVGNAFLEQLLSIKQSICYNIIYVARSRAALIS
                     KDYSPLNLGSSWKSALENADEKPLELNALVGYLQKSPQKVILVDNTSSSDIADFYPNF
                     VGAGISIATPNKKAFSSDLKLWNGLFSDEEGHGLVYHEATVGAGLPIIGTLRDMIKTN
                     DKVEKIEGIFSGTLSYIFNEFSTIAPNSVKFSEVVKVAKSLGYTEPDPRDDLNGMDVA
                     RKVTILARIAGFEVQSPSSFPVQSLIPDELTSVNSVDEFMSRLPDYDEQLTLLKDAAA
                     RENKVLRFVGKVDFPNNVVSVGIEKYDFSHPFASLKGSDNVISIKTSRYSQPLIVQGA
                     GAGASVTAAGVLGDVIKIAERL"
     gene            complement(<250122..>254726)
                     /locus_tag="AGOS_ABL079C"
                     /old_locus_tag="ABL079C"
                     /db_xref="GeneID:4618949"
     mRNA            complement(<250122..>254726)
                     /locus_tag="AGOS_ABL079C"
                     /old_locus_tag="ABL079C"
                     /product="ABL079Cp"
                     /transcript_id="NM_208221.2"
                     /db_xref="GeneID:4618949"
     CDS             complement(250122..254726)
                     /locus_tag="AGOS_ABL079C"
                     /old_locus_tag="ABL079C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR138W (IML1)"
                     /codon_start=1
                     /product="ABL079Cp"
                     /protein_id="NP_982868.2"
                     /db_xref="GeneID:4618949"
                     /translation="MQSNLLQFSNLRTGNLRLASTNRGSANGGGSSTMESGTSGAGSS
                     SNKQVNMVIENNTLTIGGTEGKRAFGRRLQMDTSGLKVKSKVDQEELESAMKTPISGI
                     PFFNQSSRRSYQFELSFHNTPVSDDCHVLIDVSQLPGAREGDLAELRTYHRSPGTRDK
                     KVYFKIKSLDVEARRRSATTGLSILTGQLRYLLDLPSRSPVWVKLKSKNEHQADLVEL
                     HVKDCHVNRGDMWCISSTLLDTCVFTGQRVTYINALRLIVKAIYRNGKKVISGYVGNN
                     TKVIFASESARIIFLIQITEEMWHFEQNGEKTFHKVVNSLFPRILKRWKDIGTYHTIT
                     IVFCASVDESGQSFRNIPPGVRLKNTKDYFRIVVDRVNILYWDEIMKTLRKEFMQIIG
                     DLRNTQTDDGGGPIRWSFTPVIKSNILETINFATTLLADQFRVPDLKHTVTHVIIISP
                     GTGLYDVNYDLLKVTCRKLLSLEIAVDLICLSRAPLHIVPLFRYIDYQGELCHSAPTW
                     LSISFWDDNKKSQEWHPRCKIYDVQMMGVTERRDSEEVTLNYMNSALHTTSVTDFMDQ
                     YDKEVFDADKCYPLSNENRESTPLEDTSNIESTVLPKSGHEVQSIVWKPPRSSKPLVE
                     PTTVQSVIVSLHQPGTINNSSEDDLTDTSSSNSSPEANESLALASLKNMTQISRGLTK
                     RIVSKLIPDIKSKRSRHSIMATGNEHPRNDTYEDIEDIRKVDCHSTGTNITFLKPTFR
                     SMDAEHYNPPDTVSSHGSAGTDSRRESLMFEKKSVLLDDFAKKKSNVNKYIKEKSLVD
                     SLIHLDNPSVCFSGEVATMLIPDRWKDVYPKYVAKKYTKWRSFTTPAELPITTVHFPS
                     LSDFESNFIFRNHSVSLNIDREVYGQTTFDLLRDMIYIRLLAGFQICTSELLKKVEAT
                     GSNEIHEQEIAKVLSKDNYMVAIYYMIIDNEVHRIKCGYNGTIDVQRFLRKNENKMMD
                     TIAKYTPLVRTRYEHSYRPCKMDPLRISRTSLRWNQVDQILAGYYDSMMDSSKIGFRS
                     KFVILPADIPPNTFSSTVNGRKETLSAEEIRLEGLRKLISSISKSRLRTNPEKATKAS
                     RKEEILPEVHFYTGSLFEYLADHHDNLEHVDSPAKDAQSADLSKFNRDAELSRLAYEL
                     QHGEKPIKLTNRKWHFKNHSSCFVGLEMVNWLIENFSDIDTRDEAVIYGQQLLTDGLF
                     HHVDRRHGFLDGHYFYRISDPFVDIKIEKGSAESPLNSDPITINRRVSASTIISSKQN
                     SSGMIQSKNGDSELLDRQSVNDEGKTIVISTAIDIDLDPAGNSHKLETCTVHYDQVHN
                     PDHCFHIRIEWLTATPKLLDDLVTNWGRLCERYGLRLVEIPWHELCTIPSFDPTHSFI
                     EATLAINPWTDPEFMDAEIFASQKYFYHVHLLESFGFLLDNRASRILQNERVSFNVVY
                     SWGKPSFKYAQFIHNTGAYMAEIRENGDLFLAPNNLYLSRNGIGNSSGSLHLGPKSAI
                     YSEKVMLDFKHVCEDYKKLRSVFWEARDKWQQTRNTLEEY"
     gene            complement(<254945..>255790)
                     /locus_tag="AGOS_ABL078C"
                     /old_locus_tag="ABL078C"
                     /db_xref="GeneID:4618950"
     mRNA            complement(<254945..>255790)
                     /locus_tag="AGOS_ABL078C"
                     /old_locus_tag="ABL078C"
                     /product="ABL078Cp"
                     /transcript_id="NM_208222.1"
                     /db_xref="GeneID:4618950"
     CDS             complement(254945..255790)
                     /locus_tag="AGOS_ABL078C"
                     /old_locus_tag="ABL078C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR200W (RPN10)"
                     /codon_start=1
                     /product="ABL078Cp"
                     /protein_id="NP_982869.1"
                     /db_xref="GeneID:4618950"
                     /translation="MQLYICHRDRDQTQVPSAGGSVKEAIRMVLEATVLVVDNSEYSR
                     NGDFPKTRFEAQIDAVEFIFQAKRSSNPENTVGLISAAGSSPRVLSTFTAEFGKILAG
                     LHDTTVGGSIHLSTAIQIAALTLKHRQNKVQHQRIVVFVCSPISDEREELVRLAKKLK
                     KNHIAVDIVNFGEEAANTAILEEFVAAVNNSQEDNSHLLTVSPGPRLLYEHIASSPIV
                     LEEGATAPGMGAFGGDDYMDFAVDPSMDPELAMALRLSMEEEQARQERLRQEQDAKGK
                     SEEQH"
     gene            <256308..>260621
                     /locus_tag="AGOS_ABL077W"
                     /old_locus_tag="ABL077W"
                     /db_xref="GeneID:4618951"
     mRNA            <256308..>260621
                     /locus_tag="AGOS_ABL077W"
                     /old_locus_tag="ABL077W"
                     /product="ABL077Wp"
                     /transcript_id="NM_208223.2"
                     /db_xref="GeneID:4618951"
     CDS             256308..260621
                     /locus_tag="AGOS_ABL077W"
                     /old_locus_tag="ABL077W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR137C (MET5)"
                     /codon_start=1
                     /product="ABL077Wp"
                     /protein_id="NP_982870.2"
                     /db_xref="GeneID:4618951"
                     /translation="MLALKENLLSVGSAPDNWGDWTLAAALVRGAADGTVFYTARAKA
                     SRPLVAVAAEQQGVHAIRLLAANDPFCAVTAEAGDSVPATVFTDLATVITGAPHLATV
                     KTPIVVHIETLAEEYAAIPGFKDLGSVILVSSSPSQLLRAASTATKLAQASQRPVLHF
                     YTSDLNGFGEVDVGTADGTFDSTIEDAPERILDSLQSRLVSRGTPSTLILNLSAYGEQ
                     FAQYLPDDVALYDITVYKPFEFSQVLRELPVSVKNIAVVQGSTGGSKSNGFEPILLDV
                     FSDFNLLVDRGIKNIVVSGIGRLQYFAHTLEKIVSNSRSLSPSTDLYISDVKHAVHSG
                     IAEEFIKKAISLENAYLSVLQQVFEPNLQLLNQFNDSAINSLRPEYGFGKFLQQNRAR
                     RQLMKMVERSLDCSLYEYEGPSVVEGLAAWISYNKRALDSSLLKEANILARDVHELLQ
                     KNSNSEVAKSILASAPTLDSFSFSSSWLIGSDAWSYDLGNSGVHHAITSRENINILLI
                     DSEPYGSLSKNSARKKDVGLYAMNFGTAYVASVAVYSSYTQLLTAVVEASRFPGPSIV
                     LAYLPYNSEQDSPLTILKETKRAVESGYWPLYRYNPTASNEEDTFKLDSSVLRRQLQE
                     FLDRENKLTLLAKRYPDLSSNIVQSQSDIITAKQQRKSKEAYDQLLQGLSGPPLSVYY
                     ASDGGNAASLAKILAKKATTRGLKSFALSMDDIVLEDLPREQNVVFITSTGGQGEFPQ
                     DGKAFWEELKSATDLDLASVKFSVFGLGDSQYWPRKEDERYYNKPGKDLYNKLLLFSG
                     QTLIPLGLGDDQDPDGYRTGYEKWESELWAALGVSDIITGEEPKLITNEDIKLASNFL
                     RGTIAEALVDDSTGSIPSTDQQLTKFHGIYMQDDRDIRDVRKAQGLEPYYIFMIRARL
                     PGGIARPEQYLALDKIAASFGNNTIKLTTRATFQLHGVVKRNLKSSIRAMNSTLLDTL
                     AACGDVNRNVMVSALPANARVHEQVANVAAEISEELLPNTTAYHEIWLEGPDRNDASP
                     EWQAIWEGMKSGPKKKVLVGGNALQDIEPIYGPTYLPRKFKVNIAVPPYNDVDVWACD
                     VGLIAIIDETTSNLVGFNVYVGGGMGTTHNNKKTYPRLGSSFGFAPKEDITSVVEKIL
                     LVQRDHGDRTNRKHARLKYTIDDMGIDIYRQKVEELWGDKFAPERSYKIESNIDYFGW
                     VKDETGMNHFTAFIENGRIEDSSKLSHKTGLRKVAEYMKQSGSGHFRLTGNQHIVISA
                     IPDQHLDAIKGILKAYKLDNYSFSGLRLASSACVAFPTCGLAMAESERYLPQLISRLE
                     ESLEEYGLRHDSVVMRMSGCPNGCSRPWVAEVACVGKAPGTYNLLLGGGYYGQRLNKL
                     YRSSLKEAEILSILRPLFKRWSLEREESEHFGDFLIRVGVIKPTLEGRKFHDDLPDGA
                     I"
     gene            <260864..>261778
                     /locus_tag="AGOS_ABL076W"
                     /old_locus_tag="ABL076W"
                     /db_xref="GeneID:4618952"
     mRNA            <260864..>261778
                     /locus_tag="AGOS_ABL076W"
                     /old_locus_tag="ABL076W"
                     /product="ABL076Wp"
                     /transcript_id="NM_208224.1"
                     /db_xref="GeneID:4618952"
     CDS             260864..261778
                     /locus_tag="AGOS_ABL076W"
                     /old_locus_tag="ABL076W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR198C (AIM18) and YHR199C (AIM46); Tandem gene
                     duplication in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABL076Wp"
                     /protein_id="NP_982871.1"
                     /db_xref="GeneID:4618952"
                     /translation="MLNKRISNLATILRFIALPRARNIIAPQEYIANSVPVAITRRAA
                     RNTFVFSVALTPFVLYSAFHNDSAESDFPELVEVYPGVRPFPAVLGPPELPLQTNYKL
                     LGHGVRAVTFLSFKVYALGIYAAVDDLPLIPRTLSAEYLSTLDTEKVDAPAKEQLYKA
                     MQDHEKSRAVVNDLLGKGLRLVAKITPIRNTDFTHLKDGLVKSILNHPAARHEGETLA
                     NGLEELRAAFTRRGSVPKDDDLVLELQATGALQLYHRDAKTGQTTTLGKVTEPLIGRY
                     LFSQYLSGKAPLSKDTKDSVTRKIISMV"
     gene            <262000..>263283
                     /locus_tag="AGOS_ABL075W"
                     /old_locus_tag="ABL075W"
                     /db_xref="GeneID:4618953"
     mRNA            <262000..>263283
                     /locus_tag="AGOS_ABL075W"
                     /old_locus_tag="ABL075W"
                     /product="ABL075Wp"
                     /transcript_id="NM_208225.1"
                     /db_xref="GeneID:4618953"
     CDS             262000..263283
                     /locus_tag="AGOS_ABL075W"
                     /old_locus_tag="ABL075W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR136C (TTI2)"
                     /codon_start=1
                     /product="ABL075Wp"
                     /protein_id="NP_982872.1"
                     /db_xref="GeneID:4618953"
                     /translation="MPDNTSSLLHFTTAVEQSPDYTPTDDELLQVCHVFAAGTPISKE
                     ELHKAAQYLAYYSMSERVKQSTIDQCIQIFKEIMTDELLDHLIQQLQPMLLRTNNSRT
                     TAAGRFKKETATKLKPQLGFGIENENAVSAWKRSGGLRSIPLFYVVLSVLKHESISSN
                     LWWISPGILNLLDESDDIEKVKLPAVKLLRRFLECTIDVSDAVHFSFAATGLFAVYQP
                     ILVGLCHQIPPIIEARQSQIIWNTAYPTILALYRVQYANEGPEYKAELGQIFSELVLQ
                     LALPKVSMDHLELTNTLLDYTIQTLELLGAFSVRYLQRSIYVLGEYIVRNPFLTLFPP
                     LVEKTLDTLAKLAEVCPPERVCAHRYDFLACLLITYEKCSTEDVLPDSTLDRIHRLAQ
                     LLRAAGCDFARDRVTLLERNPDFERVLDRIEQRYK"
     gene            complement(<263313..>263576)
                     /locus_tag="AGOS_ABL074C"
                     /old_locus_tag="ABL074C"
                     /db_xref="GeneID:4618954"
     mRNA            complement(<263313..>263576)
                     /locus_tag="AGOS_ABL074C"
                     /old_locus_tag="ABL074C"
                     /product="ABL074Cp"
                     /transcript_id="NM_208226.1"
                     /db_xref="GeneID:4618954"
     CDS             complement(263313..263576)
                     /locus_tag="AGOS_ABL074C"
                     /old_locus_tag="ABL074C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR135W-A (TIM8)"
                     /codon_start=1
                     /product="ABL074Cp"
                     /protein_id="NP_982873.1"
                     /db_xref="GeneID:4618954"
                     /translation="MSGISPTELQNLDEPSKKEIMGFLETENSKQKVQMSIHQFTNLC
                     FKNCIHSVQSADLSAQENQCLKDCVNRFLDTNIRIVKGLQSIQ"
     gene            <263837..>264571
                     /locus_tag="AGOS_ABL073W"
                     /old_locus_tag="ABL073W"
                     /db_xref="GeneID:4618955"
     mRNA            <263837..>264571
                     /locus_tag="AGOS_ABL073W"
                     /old_locus_tag="ABL073W"
                     /product="ABL073Wp"
                     /transcript_id="NM_208227.2"
                     /db_xref="GeneID:4618955"
     CDS             263837..264571
                     /locus_tag="AGOS_ABL073W"
                     /old_locus_tag="ABL073W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR135C (MCM22)"
                     /codon_start=1
                     /product="ABL073Wp"
                     /protein_id="NP_982874.2"
                     /db_xref="GeneID:4618955"
                     /translation="MDKDVSRGQEDITNGPLDQDQTGVADPLEQQLRQELENKRFFLE
                     QAERALQNLDIEALEAEGNVNAEAWNKLLETQLFIPERSDPLGIAVAIDGETKAVNSG
                     AGAVLSRQIEELEEMVQDQRKLCDDMQALNSILKKRVNASFVQEEATETPCSSEEVEQ
                     IKDSFLSEFLVPDLCRDASDWPATNTAMEDVLRRLVKLDPQLRLTDFAPHCMGLYRML
                     SKANVIQEIFTDGHDNPYIRLYNLLE"
     gene            complement(<264577..>266871)
                     /locus_tag="AGOS_ABL072C"
                     /old_locus_tag="ABL072C"
                     /db_xref="GeneID:4618956"
     mRNA            complement(<264577..>266871)
                     /locus_tag="AGOS_ABL072C"
                     /old_locus_tag="ABL072C"
                     /product="ABL072Cp"
                     /transcript_id="NM_208228.2"
                     /db_xref="GeneID:4618956"
     CDS             complement(264577..266871)
                     /locus_tag="AGOS_ABL072C"
                     /old_locus_tag="ABL072C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR197W (RIX1)"
                     /codon_start=1
                     /product="ABL072Cp"
                     /protein_id="NP_982875.2"
                     /db_xref="GeneID:4618956"
                     /translation="MTSQVVPLSTFVQHLESCEGYEFRTMIKMLASPAYAKQQLLKDE
                     LSVFMAKVLKLLRSKDDYQVWKGCHIATVFCTYNPVVLCSFGGELMGILYRALEDATK
                     YYGDSVQTEQRKVMVRALVKTLDTLMDLIRGKPSLTREALTPHLSAIIPMLISFGRCE
                     PNLSLPVIKKLLSKHSTTFRPHVGKLKQLLTELYGHYQSLDPVTRKVVCDTAAYLHLT
                     QKPGNNANEHQAHHKSFPDEHWRAGLFSVLSQFGPVVRLWGEILDIGSDENLARLLET
                     LPRDTANDTSPLLPALTVDINKPVTLWHISARLEQLTDMVESFIRLPTLFPTRIPLGE
                     LVKVSEILLSLTTNYLPLKRGLRRDAALTGSIRSALPETQLQGIRLLRCLSDHIGKNL
                     ITYMPAILSSMELFIPLKDKKTSIDYQKCVDLQNGLLQLTALMNSIAQHLGHKVEEMS
                     LAIKLVDICAYIIEHKQNLDSAFSSTSGTAKAAGGAKKKEYKAKTGSMSDLFSHPHKF
                     LHPVPLENYTVVNTYYNMALTHWKLPSTQQAKITKYCIYYSLSFKEKLGYIPQTFIEL
                     LNTIVLFPGKDRFSILPIAVHLLKETGDPVFDVLCNPKLPLEMIQIRRQPTSSEDDTA
                     TSEAEEYAAPADQDDEHLSDDEHTTVDDGVATNAVMGLNNLVSSETLRSEQDSALETQ
                     HPEQARTSNLVPDEASEGREDARIFKKRSSSDEQDPPSKRTRAVAAQTPVPAAVPVDN
                     GEPESDDGSDFEIPEIELSDADEE"
     gene            <267098..>269089
                     /locus_tag="AGOS_ABL071W"
                     /old_locus_tag="ABL071W"
                     /db_xref="GeneID:4618957"
     mRNA            <267098..>269089
                     /locus_tag="AGOS_ABL071W"
                     /old_locus_tag="ABL071W"
                     /product="ABL071Wp"
                     /transcript_id="NM_208229.1"
                     /db_xref="GeneID:4618957"
     CDS             267098..269089
                     /locus_tag="AGOS_ABL071W"
                     /old_locus_tag="ABL071W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR134C (SGM1)"
                     /codon_start=1
                     /product="ABL071Wp"
                     /protein_id="NP_982876.1"
                     /db_xref="GeneID:4618957"
                     /translation="MSSPRKLSLEQRLSLATKATQKRRLKKSSPALTAGSDATGEDSI
                     SSPVDEREGQKPSRPANDTSSAEASVAHAHNGIPAPFTEVFPNGLEGKDMETVLAELA
                     PHFQRLRAMSPTTRIDAQPHREISTDSSLLLLVKEKDARIEELLEEQQETSAKERRAT
                     QALSKMEKKYNKQVAESAALEQKLRKQASENVLLKEEKDKAKAELKACRADYQQMKDA
                     CSAADSRYASLTHEQEALQCQLEDCEKEVLAARTGFETSKANWEKKEKELNARYNSLR
                     KSSNDEITRLEGVMERLRLEAEDSRDIRVRKQDDNPVHAESEYQSLLRQLEDQQRQAV
                     ISRENWSSIEYSMNQKIEELQTQLEEIQSSCAVLETRLGAADEERRRLVMELDRLGRE
                     NAKLKEASGILELDYKKATNNLKKLEEDHRLLAEKYKIQKLNLESRLGGKREVLQDKE
                     SLGENLLLPTSAEIKDAFQSLNGQQGMSAQSIATGHYESGLSSNYDFDMPVDETLSQT
                     AEISGDDLPEDSTSDARKTTTDFRSTISADQAGISAQMHVNAHIVNKLGAEVRRLELE
                     ISTLKAFNNTLEEEKARAEDDILKLLEENHTVHHLKTTNEALTTKVADYSNRQDTILQ
                     LLGEKTERVEELENDVEDLKQMLRMQAQQLADMQERLRI"
     gene            complement(<269197..>269826)
                     /locus_tag="AGOS_ABL070C"
                     /old_locus_tag="ABL070C"
                     /db_xref="GeneID:4618958"
     mRNA            complement(<269197..>269826)
                     /locus_tag="AGOS_ABL070C"
                     /old_locus_tag="ABL070C"
                     /product="ABL070Cp"
                     /transcript_id="NM_208230.2"
                     /db_xref="GeneID:4618958"
     CDS             complement(269197..269826)
                     /locus_tag="AGOS_ABL070C"
                     /old_locus_tag="ABL070C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR133W (XPT1)"
                     /codon_start=1
                     /product="ABL070Cp"
                     /protein_id="NP_982877.2"
                     /db_xref="GeneID:4618958"
                     /translation="MSASDKMYMSYNNIHKLCQQVAGQIMERGDRPDVIIAITGGGMI
                     PARIIRSFLKVKGQKNIPIQAIGLSLYEDLGLEDGTESIGKEVIRTQWLDFGALDKHF
                     DSLIGKKVLIVDEVDDTRTTLHYAVTELEKEVKEQQLKLNRMDEETIFSIFVLHNKDK
                     PKKAELPASIMATGRYLAAETVPDRWLCYPWEAIDIEEHTRLSIEQGNN"
     gene            complement(<270103..>271728)
                     /locus_tag="AGOS_ABL069C"
                     /old_locus_tag="ABL069C"
                     /db_xref="GeneID:4618959"
     mRNA            complement(<270103..>271728)
                     /locus_tag="AGOS_ABL069C"
                     /old_locus_tag="ABL069C"
                     /product="ABL069Cp"
                     /transcript_id="NM_208231.2"
                     /db_xref="GeneID:4618959"
     CDS             complement(270103..271728)
                     /locus_tag="AGOS_ABL069C"
                     /old_locus_tag="ABL069C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR196W (UTP9)"
                     /codon_start=1
                     /product="ABL069Cp"
                     /protein_id="NP_982878.2"
                     /db_xref="GeneID:4618959"
                     /translation="MTASEDTKLLASFSPDATRFAFQANASQKNFIDIYPLDPERNYT
                     VNSSSVNRIDFEATDLNLTDVVFQSWCLANSGQDISTKTKRRRGTGEDDEEQELSSTE
                     SFLINVFQQGKIVVFSPNGQDILNIIQNKRELLGIDTIGTSLWILDDDKTVKHFTCTS
                     TKPIKTFHLVDGKDEDILDFGLLNFPDVLLISVIVEDIVYIIDPTKRRPSTVAKLEVP
                     GCRTCKVLDDEHVVVAGANSISVIKFKEQSIIHTWELGAKKIDIVDGNIVALGEDGNI
                     SVFNAQNPNDVLTVRVENNSIIEFGGIGDRNLVVAWLNVNEPNFEIITSAQLASGQNI
                     VLQQAPQPLLTNHAPDTQVPEQEAAEREKPPSKKTSKTEQDDTSQALIHALATTLDEK
                     VVTELLISNTWSEDRIKEFVHMHLLPSRSNELFVIVSQLLASDVWAESSAIRWWFKWL
                     LRLRAPHLDALQPRGNKEIKALRANLKASSDSLPILLSMQGALEMLRAQAKLRQELSQ
                     VALEDADDAEYGSEITYANGEADDFVDALDYKK"
     gene            complement(<271947..>275072)
                     /locus_tag="AGOS_ABL068C"
                     /old_locus_tag="ABL068C"
                     /db_xref="GeneID:4618960"
     mRNA            complement(<271947..>275072)
                     /locus_tag="AGOS_ABL068C"
                     /old_locus_tag="ABL068C"
                     /product="ABL068Cp"
                     /transcript_id="NM_208232.2"
                     /db_xref="GeneID:4618960"
     CDS             complement(271947..275072)
                     /locus_tag="AGOS_ABL068C"
                     /old_locus_tag="ABL068C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR132W (NMD5)"
                     /codon_start=1
                     /product="ABL068Cp"
                     /protein_id="NP_982879.2"
                     /db_xref="GeneID:4618960"
                     /translation="MDLSILLQCFSGTLSHDAAVRSNAEKRLKEYSGHIGFLGACLDI
                     MGSSEVSENIKLSASLYFKNKITYGWSGKGHGKNELLEYTVDPDERPVVRELLVKALT
                     NCSQQAPSCMRVLQLALAEIVSVEYPAGRWDGLLEASFGSLASGDMHAAHVGLLCAME
                     VFRTYRWKENDERQELEMLIMRYFPDLLHYANALLYSEEKHNEIVGNMLKLVLKIYKF
                     VTYNDLPFTLQRSENFIPWANFHVSVIQSQLPEHVMALAVDDRRAHPWVRAKKWAYAN
                     MYRLFQRYASESLSKKFEYTEFKMLYVEQFLPQLLQLHFQQIERWGAGELWLSKESLY
                     YILEFIEQTVVQKSTWPIVDPHYATILEHVIFPLLCPSEETLESFEVDPQEYVHRNLE
                     AWDADYSPDVAAVSLLVTAVKKRSKTTLEPTVQFVSQMLQHNTVSFADMTLEQAVKVE
                     SCLRIVSSILDRLFHAKSPYTSEMEGFLTRFVFPLFHSKYGFLRARVCEVCSKLDSNM
                     LKQKETLQTIYQGVVKCFNEEPGSLPVQLLAALALQAFINIPDFHSSLSAIVVPTMQK
                     LLQLSSEFESDTISGVMQQFVESFATELQPFGVELMNNLVQQFLKLAIEFHEASNFDI
                     NGFSTGELPDESDKHMAALGILSTTISILLSFENSGDIVKNLEQSFYPAAEFILKNYI
                     EDFYREACEFVENSTFLLREITPISWKILELIGECNEKEGSMVSFYLEDFMLAINNYI
                     IYGKNELKQNSFYSTILFKIYAKAITVEDNGFTELKQLYDLSQKMVLSLGETTSKEYV
                     NQFLTDAVNSIISEKDSLEKCIAFGVTTFGVILSCLLYFPYDTLQFLHSKNVSLLYFQ
                     IWFDNYIPSYKRVYDIKLSLMALLSMLSHLSVEQFASCGLEPVLKKMGSTISGLFERY
                     PVAIKELKDKRAEFTSDADFGEGLIDSDWDDEIGEDGLENEQNYLEMLRNETDVVKFI
                     NGEPSCLEEDMDDLEEDPLSGSVLDDINVYAIFQTVFSTLQQNDSTKYQLVLENMSQD
                     EQMHLAHITSL"
     gene            complement(<275273..>275926)
                     /locus_tag="AGOS_ABL067C"
                     /old_locus_tag="ABL067C"
                     /db_xref="GeneID:4618961"
     mRNA            complement(<275273..>275926)
                     /locus_tag="AGOS_ABL067C"
                     /old_locus_tag="ABL067C"
                     /product="ABL067Cp"
                     /transcript_id="NM_208233.2"
                     /db_xref="GeneID:4618961"
     CDS             complement(275273..275926)
                     /locus_tag="AGOS_ABL067C"
                     /old_locus_tag="ABL067C"
                     /note="NOHBY207; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABL067Cp"
                     /protein_id="NP_982880.2"
                     /db_xref="GeneID:4618961"
                     /translation="MSSGSALIGFTLRRLSACATIRTPLLGVDIVRLAALLVTAGVIT
                     MWLWFCGQCSASCTLFLLLAAYRLWEEGYLPVWQPAPALPLPPPTTTKARTCEGNSAH
                     ASEVRRALLQFRRESAVPLVDIQAKRPRSPRLPASTCTAPAHRTRAKRVRDRCADSST
                     FRLQADTAPRAAAARSVHVQPCFGVQLLCIPPSFSDSACKATLSNVRASAQPFIYRH"
     gene            complement(<276108..>277808)
                     /locus_tag="AGOS_ABL066C"
                     /old_locus_tag="ABL066C"
                     /db_xref="GeneID:4618962"
     mRNA            complement(<276108..>277808)
                     /locus_tag="AGOS_ABL066C"
                     /old_locus_tag="ABL066C"
                     /product="ABL066Cp"
                     /transcript_id="NM_208234.1"
                     /db_xref="GeneID:4618962"
     CDS             complement(276108..277808)
                     /locus_tag="AGOS_ABL066C"
                     /old_locus_tag="ABL066C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR194W (MDM31)"
                     /codon_start=1
                     /product="ABL066Cp"
                     /protein_id="NP_982881.1"
                     /db_xref="GeneID:4618962"
                     /translation="MGLPLIIRTSAARHCRYVGIARLGLPRWTPFKAVFPALGCQPVR
                     RTLAGPARGPEEHEQTLRAARAAKRDQLLAQTPSSWERLRIRIKWALARSTKPFNSDD
                     ISAFVSWILVSHALLIILGTTTFASLVIYLMNTVLAQEYVATQVGNFLTKNTALTVVF
                     ENAIVPDWSSGKITFNKVFVSRRPKQLQGFSKGSQHEAVERAKLALSERLLVSGEEFD
                     DGNYTQFDLTIDQVEISLNFGKWINGKGILDEVTINGLRGVVDRTHVMWKDGDDPRKY
                     LNVHQPGDFEISTFRMNDVLFTLYQPGRFRPFQVSVFNCELPQLRKHWLFFDILNAHS
                     MSGTYDNAMFMIHRRYKEDQSSESPLWRKFTRMRVDNLNVDHLNAGMKGPFGWITSGK
                     VDMIGDILLPEEGLDGSDLSDMLAIIGDRLLKEARRHSDILPFQMPDPGDIDPHNYFV
                     MDFFLRLHNVRAEVPLFTPELSYINNALIRPIVGYINSKRSYIPIQCRVVKNLADFEG
                     SWTIYDSKLMDDLSAEVYDAFADYVADQERKNLRMKRVGFWSLHIIIQLILMSLGAIA
                     "
     gene            <278526..>281291
                     /locus_tag="AGOS_ABL065W"
                     /old_locus_tag="ABL065W"
                     /db_xref="GeneID:4618963"
     mRNA            <278526..>281291
                     /locus_tag="AGOS_ABL065W"
                     /old_locus_tag="ABL065W"
                     /product="ABL065Wp"
                     /transcript_id="NM_208235.2"
                     /db_xref="GeneID:4618963"
     CDS             278526..281291
                     /locus_tag="AGOS_ABL065W"
                     /old_locus_tag="ABL065W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR079C (RPG1)"
                     /codon_start=1
                     /product="ABL065Wp"
                     /protein_id="NP_982882.1"
                     /db_xref="GeneID:4618963"
                     /translation="MAPPVLRPENALKRADELISVGEPQAALQSLLDYITSRRIRFAD
                     PAAIEPIVFKFLELGVELKRGKVIKDGLYQYRKHVQSSTEGLKSVGAVSRRFIDLIEK
                     KMSSEQAKANAEESTEEDLEGGVTPENLLISVYEQDQSVGGFNDEAVTSWLRFTWESY
                     RTVLDLLRNNSQLEITYSGVVNRAMQFCLKYNRKNEFKRLADMLRQHLDAANYQQQKS
                     KQYTVDLSDPDTLQRYLDQRILQVNVSVKLGLWHEAFRSIEDVHHLLSMSTRDPKPSV
                     LANYYQNMAKVFFVSSNYLLNSVALQKFYDLYQQNPKATDEDFKFYASQLVLSALSIQ
                     QDDLPVVGYDPLARLAGFLNLESKPTRSQVIEAVSDSKIFSRADEPVKKLYELLNSDF
                     DVNTLKESLASLLPELNSKSYFTQYVEPLKSFTIRKAFISASKQFGSIKLDELFEHTS
                     LPSPFDLSPLDLEKSLLQAAMNDYVSFSIDHDAGVVSFMEDPFELLGGSTATNADDEQ
                     RNDDGYEETHVEEEPEPILTRNSAVRTQLIELAKALKETEGFPHASYVDKVRMARNEL
                     IRQNNAIIASEKEAAEERARQLEYEKQSASGVPLTAEQVVEERQRRMKEEKEAAEARM
                     EAEARRRAEEKRERELAAINEKTMLKMIEDINAKGLIFIDPKEAKNMTLEKFKKLTVE
                     LVSKDKKDLDERMSHAFKRVDHIERAYRKLEAPLWEKDAQKQKERDLESYNKLKQMMV
                     EKAKKDHEENLRIHDRLVKIYPSYLHFREKVIAAQKSQIEALRAENAAKLEAAKNARL
                     QEVRQQRYNELIARRKEELAAKEHDDRQRMLQDRLTKERKERERVNKEKDEAARKQRE
                     IEEAVERTIKRNVSATPAPPVRSAPPARAAPPPRASNEQVASPAPQPEKKLTYAEKMK
                     LRRAGRA"
     gene            <281605..>282195
                     /locus_tag="AGOS_ABL064W"
                     /old_locus_tag="ABL064W"
                     /db_xref="GeneID:4618964"
     mRNA            <281605..>282195
                     /locus_tag="AGOS_ABL064W"
                     /old_locus_tag="ABL064W"
                     /product="ABL064Wp"
                     /transcript_id="NM_208236.1"
                     /db_xref="GeneID:4618964"
     CDS             281605..282195
                     /locus_tag="AGOS_ABL064W"
                     /old_locus_tag="ABL064W"
                     /note="NOHBY206; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0C14476g"
                     /codon_start=1
                     /product="ABL064Wp"
                     /protein_id="NP_982883.1"
                     /db_xref="GeneID:4618964"
                     /translation="MSTFFDQFKTSFTNAPVDSSGNISTTEFLEASEGLVKLFDLLGN
                     TAFTVVQKDLTGNITKLRNRQLSHPGESATLQELVIAERAQGSKTASEGLLWLTRGLQ
                     FTAQALRETLDHPELELSKTFTDAYGKTLTKHHGMLVRPVFKLAMKACPYRKDFFAKL
                     GSDQEKVDTQLKQWLAALEKIVEILLQFLAQTCKDL"
     gene            complement(<282554..>283841)
                     /locus_tag="AGOS_ABL063C"
                     /old_locus_tag="ABL063C"
                     /db_xref="GeneID:4618965"
     mRNA            complement(join(<282554..283713,283781..>283841))
                     /locus_tag="AGOS_ABL063C"
                     /old_locus_tag="ABL063C"
                     /product="ABL063Cp"
                     /transcript_id="NM_208237.2"
                     /db_xref="GeneID:4618965"
     CDS             complement(join(282554..283713,283781..283841))
                     /locus_tag="AGOS_ABL063C"
                     /old_locus_tag="ABL063C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR078W (ECM33) and YDR055W (PST1); 1-intron"
                     /codon_start=1
                     /product="ABL063Cp"
                     /protein_id="NP_982884.2"
                     /db_xref="GeneID:4618965"
                     /translation="MQYKTGLTSVLVLAAGVSAQSNSCSVSSGATATAQADLDKYSSC
                     KKLSGDLVISGKQLSNGALANVEEIDGSLSIIDSSTIVNFSADKLRKIKDSLKLMDLP
                     SLEAASFGALEEVSMVQFQALPVVNNIVTSKLKTANDIVISNTNLRSIKEFTSLGAVQ
                     KFDVNNNRYLRSIDASIKTVGNSLALSSNDKIENITFNNLVWANNITLYSVRDISMKA
                     LVAVNHSLAVESCPMKSLELSNLTKVGGDVTFANNEHLTKIDLSKVEEITGALVIADN
                     EKLDRINGFKSVKSIGGSLTVNGSFSELDLSELGSVRGGVSVNSKAKNFSCNPLDDLH
                     KAKNIQGKYQCSTGKSDDSSSSSGSSGSSSGGKGDSGSSTKGSPATSKDIGAHLTPGA
                     SLMGAFAAVAIALL"
     gene            complement(<283946..>284428)
                     /locus_tag="AGOS_ABL062C"
                     /old_locus_tag="ABL062C"
                     /db_xref="GeneID:4618966"
     mRNA            complement(<283946..>284428)
                     /locus_tag="AGOS_ABL062C"
                     /old_locus_tag="ABL062C"
                     /product="ABL062Cp"
                     /transcript_id="NM_208238.2"
                     /db_xref="GeneID:4618966"
     CDS             complement(283946..284428)
                     /locus_tag="AGOS_ABL062C"
                     /old_locus_tag="ABL062C"
                     /note="NOHBY205; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABL062Cp"
                     /protein_id="NP_982885.1"
                     /db_xref="GeneID:4618966"
                     /translation="MLITKSLFWLPGGPAAAEPPPDSLYFLSKSILYWPAWCINRRGG
                     AARQPVPDPANRFVLPLRLAVPTPAPSYLCKSPACNSTIARSDVCLHLASLPFSARCA
                     CISPRREWLAPRGLRPAFPPKAERKNFVSSREYRAASHGHICWLARFFYLKKAVKATG
                     "
     gene            complement(<284547..>284738)
                     /locus_tag="AGOS_ABL061CA"
                     /db_xref="GeneID:4618967"
     mRNA            complement(<284547..>284738)
                     /locus_tag="AGOS_ABL061CA"
                     /product="ABL061C-Ap"
                     /transcript_id="NM_001355299.1"
                     /db_xref="GeneID:4618967"
     CDS             complement(284547..284738)
                     /locus_tag="AGOS_ABL061CA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL052C-A (DDR2)"
                     /codon_start=1
                     /product="ABL061C-Ap"
                     /protein_id="NP_001342226.1"
                     /db_xref="GeneID:4618967"
                     /translation="MKFTNYAIALTAAAYASAQATTHDSNHTANTTSHHSTNAAGALN
                     GVLPSVAGAAIAGALAFLV"
     gene            complement(<285219..>286403)
                     /locus_tag="AGOS_ABL061C"
                     /old_locus_tag="ABL061C"
                     /db_xref="GeneID:4618968"
     mRNA            complement(<285219..>286403)
                     /locus_tag="AGOS_ABL061C"
                     /old_locus_tag="ABL061C"
                     /product="ABL061Cp"
                     /transcript_id="NM_208239.1"
                     /db_xref="GeneID:4618968"
     CDS             complement(285219..286403)
                     /locus_tag="AGOS_ABL061C"
                     /old_locus_tag="ABL061C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL052C (SPE2)"
                     /codon_start=1
                     /product="ABL061Cp"
                     /protein_id="NP_982886.1"
                     /db_xref="GeneID:4618968"
                     /translation="MPATSLDLSDHSYLDSALSATLDSTDAFEGPEKLLEVWFYPSVS
                     ALPNAKGLRSISLDEWCSMLELVKCEVLSSKKTAHMDAFLLSESSMFVFEHKLTLKTC
                     GTTTTLLCLPRLLAMVESHLGWVMKSPGSDKFHPYKVFYSRRCFMFPSKQHPIHRNWG
                     DEVDYLNQFFLGGKSYVIGRSDQNDHWNLYITETNKTLASGLTSDERDETLEILMTGL
                     DSGSARQFVADRTQSPSEEGLAACNAPGHVYGLEITKATGLDCVYDNQKSVPFVHDAF
                     AFMPCGYSSNIIMDDKYYYTLHVTPEDGWSYASFESNVPVQDVSCGRQTQHDIVCRIL
                     DVFRPTDFCMTFFAKDLLSDRILQLMHLLDSLPNYVKRDKVIHELDEYQLIYLRYQRP
                     AQ"
     gene            complement(286717..286792)
                     /locus_tag="AGOS_AgSNR86"
                     /old_locus_tag="AgSNR81"
                     /db_xref="GeneID:9487542"
     ncRNA           complement(286717..286792)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR86"
                     /old_locus_tag="AgSNR81"
                     /product="AgSNR86"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR86; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149433.1"
                     /db_xref="GeneID:9487542"
     gene            complement(<286811..>287419)
                     /locus_tag="AGOS_ABL060C"
                     /old_locus_tag="ABL060C"
                     /db_xref="GeneID:4618970"
     mRNA            complement(<286811..>287419)
                     /locus_tag="AGOS_ABL060C"
                     /old_locus_tag="ABL060C"
                     /product="ABL060Cp"
                     /transcript_id="NM_208240.1"
                     /db_xref="GeneID:4618970"
     CDS             complement(286811..287419)
                     /locus_tag="AGOS_ABL060C"
                     /old_locus_tag="ABL060C"
                     /note="NOHBY204; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABL060Cp"
                     /protein_id="NP_982887.1"
                     /db_xref="GeneID:4618970"
                     /translation="MAMPYSLPCVCIGKFFMYKSRQPISSKLLFSKRPLTRSPSQGYI
                     ALRAPTAAGSFVRFRTSFVLQTSSAVFPGGIATAPRILMDIRPPGPPYAVPQPVCHVP
                     RAIEPWVKFFAQPVATSSGPRILRFHRCGRFLLVRGAGSGSRVACMTSVTAGYRRRSD
                     VSPTGPAAAADCSCCRARKRAATQRMVCWLVGQGFLPPGSGA"
     gene            <287637..>288251
                     /locus_tag="AGOS_ABL059W"
                     /old_locus_tag="ABL059W"
                     /db_xref="GeneID:4618971"
     mRNA            <287637..>288251
                     /locus_tag="AGOS_ABL059W"
                     /old_locus_tag="ABL059W"
                     /product="ABL059Wp"
                     /transcript_id="NM_208241.1"
                     /db_xref="GeneID:4618971"
     CDS             287637..288251
                     /locus_tag="AGOS_ABL059W"
                     /old_locus_tag="ABL059W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR319W (HSH49)"
                     /codon_start=1
                     /product="ABL059Wp"
                     /protein_id="NP_982888.1"
                     /db_xref="GeneID:4618971"
                     /translation="MDQNTECTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVK
                     QEHQGFAFVELFSEADCDFAIKSLNNTVSLFGKVLKVRRTLENAKNSAPVFARAKLFV
                     KNLDSTIDAVQLQKLFGKFGPLAKPPQLFTLKDGALRCAYVYFTTFRHSDEALEKLNN
                     QIVANQIISIDYAFKEGKAGEKHGDPVERLLDEEAQKHGVVKLT"
     gene            complement(<288372..>293018)
                     /locus_tag="AGOS_ABL058C"
                     /old_locus_tag="ABL058C"
                     /db_xref="GeneID:4618972"
     mRNA            complement(<288372..>293018)
                     /locus_tag="AGOS_ABL058C"
                     /old_locus_tag="ABL058C"
                     /product="ABL058Cp"
                     /transcript_id="NM_208242.2"
                     /db_xref="GeneID:4618972"
     CDS             complement(288372..293018)
                     /locus_tag="AGOS_ABL058C"
                     /old_locus_tag="ABL058C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR247C (RKR1)"
                     /codon_start=1
                     /product="ABL058Cp"
                     /protein_id="NP_982889.2"
                     /db_xref="GeneID:4618972"
                     /translation="MSFAVNTFQKYSNDFGLGSNGVKVTLNYFDALPPQDLLMSLPSG
                     LQLTLKSLLKRDDTTKERALNEIQELISTQASAEQFKDDIFCLCWSQIYAKLVTNSSK
                     SIRAGTHDFTARLIRLLHKKGAKFLKDWIPLLLVGCYDIDTSVGSSARSALLQCFNNS
                     DEKLAALWKVFYKQILACAQQILVVENVGSISDERYVSPEDADMRYSRLAASGVFLLV
                     QLLKNMNDEQGEEDTWYEILSSEALWKLMSLANLRSMKLYQVLLQLQRILLENGYLLG
                     HKDVLKLTGKRYFKTLAQVNTRNLLQISPLLPEVLETTLLWNSYKDGQIWAYDKSFKD
                     RILNLLKLGPGNSSAAYFDYLSKLFRVCEFLNAEETKLSILHKHALVFSERRILTKTS
                     EEQLSRFCSCYYQIVREIDSEVARDQMRDDSQKLISNISLQKHSNLVEAFAQITSPDS
                     ISTDLCSLLPLGTDKEHPSTTYADNLLALLLHNGLQKVDILKELARSSLESIENGEVA
                     VNYSFRIFQLFIKNNILSLHQEVQKFIGILPSTIDPSFIEQPTNIMSSYSRSQFLQQM
                     GEEEAVELFSDYVFAIAQLDIPMNSKLTHLNNLDIAILEKLRKEPSETLADFMTNFIG
                     TYDFSTDLIFSSNLLDQHVLKRLYEKALEHRKLDVFSSYLTRVPLTIYEEFLCGTDFL
                     SNYNIWYSAAAAQQVLKSLIPMVKRNGSFARKVTQEIVVHGASDYKHIPTELLIKFAS
                     ELFESNSDIWSYLSPHIMLKDLKTIVPYIDYRLSLVSPLGVGIHALDIPNESTFECSS
                     ARSIISYALFLDKFLTNHPQLCDDDCRIFLALMSELTLDFNCFSTDPIDQFPGFTNSL
                     FTGKTYDFNFADIVHAIIAGESHIAILNKLASRDVSDSSAVYNCRILKRMLLNSIDYT
                     TLNQFNEQVRIEKFISGIIRNTSSSAMDYLYATTIISACSKFSAESPMFVKLRTMLVA
                     ELIGKNSTDLVNGSWRLLILLDNILQVETSIMHSDSFQPITPQRLVMFVRTIFQWLDS
                     DVCFEESFSVVRLCLLHLLISMLQINSIRSLGSSLTDLCIRILADSLGFCHLEETLYL
                     DELRFYVLKLHLEIIRWTKEDKNTKDLWEHSAKDLNSELVELCLINYEKTPENHPHIL
                     FCSLLSSSVDQIPESYLQSYFDKFMEYLLSSLGTISSVRVVVTTLRKLIIAQQQELVI
                     EYELQKSNLGDGDNTPTSTCKIPPILVSALFADLPEEYLEYEEPMKVIKPLWYWYLVV
                     SYFKNISYNIRHQYIDQLKANNEIDRFFYFVSEQLDMQDTKFWDSVSPHEITEYQIHA
                     TGDSPYKDDILKESKLLLVSLLYDLFNNVGAMTSAWWLNIKDRALRSKIDAFVTRYVS
                     PILIDQELEQVSSKIPVLTAQDENLSIRINKITKEIKARYFIDDQNLEISFKLPCNYP
                     LTNIQVQEGTRVGVSEQKWKSWILSTQRVITGMNGSVVDSLELFTKNVRLQFADFEEC
                     AICYSILHVVDRKLPSKVCPTCSNRFHGACLYKWFKSSGNNTCPLCRGEIPFRR"
     gene            complement(293129..293201)
                     /locus_tag="AGOS_t0031"
                     /db_xref="GeneID:4618973"
     tRNA            complement(293129..293201)
                     /locus_tag="AGOS_t0031"
                     /product="tRNA-Ala"
                     /codon_recognized="GCU"
                     /db_xref="GeneID:4618973"
     gene            <293562..>294266
                     /locus_tag="AGOS_ABL057W"
                     /old_locus_tag="ABL057W"
                     /db_xref="GeneID:4619311"
     mRNA            <293562..>294266
                     /locus_tag="AGOS_ABL057W"
                     /old_locus_tag="ABL057W"
                     /product="ABL057Wp"
                     /transcript_id="NM_208243.1"
                     /db_xref="GeneID:4619311"
     CDS             293562..294266
                     /locus_tag="AGOS_ABL057W"
                     /old_locus_tag="ABL057W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL117W (SBA1)"
                     /codon_start=1
                     /product="ABL057Wp"
                     /protein_id="NP_982890.1"
                     /db_xref="GeneID:4619311"
                     /translation="MSKTITPEVHWAQRSHETDEDKNYVLLTLVIPDCEEPKLKLEST
                     SLEFSARSPGHTGEKDGHTYQLHIDFFKEIDPEKSQHRVANGQGYYLKLVKKELGKEY
                     WPRLTKEKLKYHYIKTDFDKWVDEDEQEEVPQAEEFGGMPFGGGMGGMGGMGGMGGME
                     GLEALQGLGGMGGMGGMGGMGGMGGMGGDAQAQLQQLMQQSGGFGGMDEEDEEEEDVE
                     AEEETKDAAGTADKSA"
     gene            complement(<294406..>295296)
                     /locus_tag="AGOS_ABL056C"
                     /old_locus_tag="ABL056C"
                     /db_xref="GeneID:4618974"
     mRNA            complement(<294406..>295296)
                     /locus_tag="AGOS_ABL056C"
                     /old_locus_tag="ABL056C"
                     /product="ABL056Cp"
                     /transcript_id="NM_208244.1"
                     /db_xref="GeneID:4618974"
     CDS             complement(294406..295296)
                     /locus_tag="AGOS_ABL056C"
                     /old_locus_tag="ABL056C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR099C"
                     /codon_start=1
                     /product="ABL056Cp"
                     /protein_id="NP_982891.1"
                     /db_xref="GeneID:4618974"
                     /translation="MSVDADEKEVILVHPSNEKTAVKILNYGATIYSWTIDGEEQLWL
                     SDAAKLDGSKPVRGGIPLVFPVFGKNTDDEHFSKLPQHGLARNSTWEFLGQTKENPPA
                     VQFGLGPELANEELTALWPFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHT
                     YLKIDDVEDTMVSNLKNFKTYDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIV
                     DKGRPIHSVSRGNLPDVVVWNPWIEKSANMQDFQPKEGYQKMICIEPGHVHDFVTLQP
                     GEKWSGYQLLSKDTLKYQAV"
     gene            complement(<295520..>297130)
                     /locus_tag="AGOS_ABL055C"
                     /old_locus_tag="ABL055C"
                     /db_xref="GeneID:4618975"
     mRNA            complement(<295520..>297130)
                     /locus_tag="AGOS_ABL055C"
                     /old_locus_tag="ABL055C"
                     /product="ABL055Cp"
                     /transcript_id="NM_208245.1"
                     /db_xref="GeneID:4618975"
     CDS             complement(295520..297130)
                     /locus_tag="AGOS_ABL055C"
                     /old_locus_tag="ABL055C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL116C (PRR1)"
                     /codon_start=1
                     /product="ABL055Cp"
                     /protein_id="NP_982892.1"
                     /db_xref="GeneID:4618975"
                     /translation="MSDKKLYDASNCVSEHMVLRKELYGEDYVGGERTVGTVITDAPV
                     SRSSLRSGDNSNELPTPTNSTFPVDVRNVSFKDLELHIPKKRAGNKWYPASELPPHKS
                     RMERDFSNLPSTMEMDARGSRGNRVTSDYFSEGTASFPADVNGNRARVVSLPGIESEG
                     DQQGSACVTHNNGEPTVLQDATGGSDAAATRNGMAEDKLTGFILPNLNSQLSWRLVKL
                     VGSGNFSDVYLYENTSASSTEEKFQQVAVKVTRYPAELQNPQARTATKYKEMLSRLES
                     SLTRELAVLRSLDYPCIVKLYGINDCSFLESRRPLIDHINEPSLPSCKMIMSYCFGGD
                     VLDVAKRGLLPDWLLQRVFTELAHAVLYLHENLVIHRDLKLENVLLKYPLEQLLSMRE
                     DFSCNFIELADFGLCKRIRQNELCTTRCGSEDYISPEVLMGLPYDGRLCDTWALGVIL
                     YALLEDRLPFDPLPLQGWRGNRPRSTAHRIARYEWRWLRLINNNHHAKVIVEKCLVTR
                     QHRWSIKDITEADFVRTLAPKLKYLHRH"
     gene            complement(<297705..>298784)
                     /locus_tag="AGOS_ABL054C"
                     /old_locus_tag="ABL054C"
                     /db_xref="GeneID:4618976"
     mRNA            complement(<297705..>298784)
                     /locus_tag="AGOS_ABL054C"
                     /old_locus_tag="ABL054C"
                     /product="ABL054Cp"
                     /transcript_id="NM_208246.1"
                     /db_xref="GeneID:4618976"
     CDS             complement(297705..298784)
                     /locus_tag="AGOS_ABL054C"
                     /old_locus_tag="ABL054C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL114C (APN1)"
                     /codon_start=1
                     /product="ABL054Cp"
                     /protein_id="NP_982893.1"
                     /db_xref="GeneID:4618976"
                     /translation="MGFVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKS
                     PKQWVSKAYSAEEIKRFHDNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFL
                     DDLQRCEQLGIGLYNFHPGSALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHG
                     NIIGSKLEDLRTVIDLVEQKDRVGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGM
                     QYLASMHINDSKAPLAANADRHELLGQGFLGLEAFRLIARSDFLQNIPIILETPQKED
                     DGYGEEIKMLEWLEGVDDEAALQQEYKDKCAELQQRGAKSRQEFAAKFEKKKAKAEKA
                     TGSRKRAAGQADIVSQMGRKAARKG"
     gene            <299216..>300532
                     /locus_tag="AGOS_ABL053W"
                     /old_locus_tag="ABL053W"
                     /db_xref="GeneID:4618977"
     mRNA            <299216..>300532
                     /locus_tag="AGOS_ABL053W"
                     /old_locus_tag="ABL053W"
                     /product="ABL053Wp"
                     /transcript_id="NM_208247.1"
                     /db_xref="GeneID:4618977"
     CDS             299216..300532
                     /locus_tag="AGOS_ABL053W"
                     /old_locus_tag="ABL053W"
                     /note="NOHBY203; No homolog in Saccharomyces cerevisiae;
                     Non-syntenic homolog of Kluyveromyces lactis KLLA0F08371g"
                     /codon_start=1
                     /product="ABL053Wp"
                     /protein_id="NP_982894.1"
                     /db_xref="GeneID:4618977"
                     /translation="MIISNKSDNESAAFTASIGQRGVAETLRGAAELAAKTDAEARVL
                     GGLDGVGGPLLNAASRVPRISFLLCDTDTGAVAAEPVPPQSALVAPQGAFSFTSPKLA
                     KFQECASPVVTVNRGFRYTIKEEEDLTSERKARKNFKLPEDIVFTGGFLRNTMLRYYD
                     TEVLRSSDKKYVPGQDGDQFAQTLKDVRQAEVLFENQSVEGLTPFLEAKAGSLGPEIR
                     DFRTIIALQRRQVEHQVSLQFGINPDQVEDKSDVFHFSIISRKCEHDDPAVNITSGWM
                     HLIATYELALLLEFIFGDIDENIWANDELLSAEVANDPKKRYQSRMRSRYKGAIFITV
                     YASRKLNKNTPGFLEGNSSGEEEVAMDACAVGRKKAKIKIKRKTLRLKAAIYDQMLSY
                     RIGVTGQPSHSLVKVDKLKWIIERSVEAYSWVNPSKAPAGGYKRLF"
     gene            complement(<300587..>301723)
                     /locus_tag="AGOS_ABL052C"
                     /old_locus_tag="ABL052C"
                     /db_xref="GeneID:4618978"
     mRNA            complement(<300587..>301723)
                     /locus_tag="AGOS_ABL052C"
                     /old_locus_tag="ABL052C"
                     /product="ABL052Cp"
                     /transcript_id="NM_208248.2"
                     /db_xref="GeneID:4618978"
     CDS             complement(300587..301723)
                     /locus_tag="AGOS_ABL052C"
                     /old_locus_tag="ABL052C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL113C (RAD27)"
                     /codon_start=1
                     /product="ABL052Cp"
                     /protein_id="NP_982895.2"
                     /db_xref="GeneID:4618978"
                     /translation="MGIKGLNSIIQQQVPSAIRPREMKQFFGRRVAIDASMSLYQFLI
                     AVRQADGVQLASADGETTSHLMGMFYRTLRMVDHGLKPCYVFDGKPPVLKAHELDKRT
                     ERRKETEQKLAELTEQAEIMKHERRLVKVEQWHVAEAKKLLGLMGIPYVDAPGEAEAQ
                     CAELAKKGKVFAAASEDMDTLCYRTPYLLRHLTFSEARKEPIHEIDTELVLQGLGLSQ
                     EQLVDLGIMLGCDYCESIKGVGPVTALKLIKEHGSLENIVEFISSGGNAKWKVPENWP
                     YKEARALFLQPDVLDAEGVSLKWEEPKEEELIAFMCKEKGFNEDRIKSGIQKLRKGLK
                     GGVQGRLDSFFKVKPKTTEQLAASARKAQAAKKTNQKGKVLKRR"
     gene            <302204..>303418
                     /locus_tag="AGOS_ABL051W"
                     /old_locus_tag="ABL051W"
                     /db_xref="GeneID:4618979"
     mRNA            <302204..>303418
                     /locus_tag="AGOS_ABL051W"
                     /old_locus_tag="ABL051W"
                     /product="ABL051Wp"
                     /transcript_id="NM_208249.2"
                     /db_xref="GeneID:4618979"
     CDS             302204..303418
                     /locus_tag="AGOS_ABL051W"
                     /old_locus_tag="ABL051W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL112W (ABF1)"
                     /codon_start=1
                     /product="ABL051Wp"
                     /protein_id="NP_982896.2"
                     /db_xref="GeneID:4618979"
                     /translation="MSLYEYKHPIINKKLASTDERKSFPTLESWYDVVNDYEFQARCP
                     IILKNSHRNKHFTFACHLKTCPFKVLLSYSGGAGGAHVGSVGAQSDKDVDDEKKVSVE
                     DDVTAAIAAAVAAVANTGGGTGEESVKGPFTVTKIEPYHNHPLESNLSLFKFVLTKIP
                     KILQNDLKFDSILETLCNEDDNTVAKFRVSQYVDESGILEIIKERYGLTDQELDKKLL
                     AQIARRITTYKARFVLKRKKQGPYAIAQSHGMSGEDDDDVSVPEHVHHHVHHVHASEV
                     AAAAAAVNEVNKHSLEDADEHPRKKVRSNKISNAVKMGTRSTLVTDHSQHETSTAGVG
                     EDDVGDDGVHHSHHKEMSPHDEMAEQLRLLSSHLKEVEAQEHGNVDVDVDPEIKKDDL
                     ADENIQPELRGQ"
     gene            <303680..>305440
                     /locus_tag="AGOS_ABL050W"
                     /old_locus_tag="ABL050W"
                     /db_xref="GeneID:4618980"
     mRNA            <303680..>305440
                     /locus_tag="AGOS_ABL050W"
                     /old_locus_tag="ABL050W"
                     /product="ABL050Wp"
                     /transcript_id="NM_208250.2"
                     /db_xref="GeneID:4618980"
     CDS             303680..305440
                     /locus_tag="AGOS_ABL050W"
                     /old_locus_tag="ABL050W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR098C (ATP25)"
                     /codon_start=1
                     /product="ABL050Wp"
                     /protein_id="NP_982897.2"
                     /db_xref="GeneID:4618980"
                     /translation="MLRAGRYSKASSVLRAVGGKRPSVCMASRVLTRLYSNGKEDDQV
                     ASSSSPSSKPWYLQGTGKPEIDVTSPFVGKIKLPATPVPDTVVNVTEYMRDKLGVTDI
                     TCFNTHEAHRPCVKNGYVILGCVKSTRHGARSMIELMRFLKTEYGVLPQKEGGISVQE
                     LRKRQKRLQRKGNLTSASAELAGESDWYLIDSKLYDGNGSGVFVHLLTKEKREDLNLE
                     GLYCTSEERGLYQKKVLSPSNDHLPNDDDDNVLAGLKRLALQNSRRYYSSTSSATADY
                     ARSSLQGGSNMENSDAPLFSLVDSLAQLPETEELDPQEWIRSLDAKWAFIDLTEKHWQ
                     ARWLMYRLLYVNRLHALQRAQDGDSANLDHLKRDLTFCYKTLLEYFTLKQAMNGRLNK
                     EELVGMLDIMLTQKELNGGYSKLVKHNRVLQQLLDHYKFHEPELFRDEQITIRTLKLM
                     VSSQAKLNVLSEFVRFLRDTGYTNRNVAIKCIEILAEAKEWRELKTFMFRDTTAALLS
                     DPMVWAHFLRSILAHGEPLLWRSLIDDGSILWLVRCGVDVRACEELHSALLELFQRAG
                     YDAVKADSLLRDYIQDGACS"
     gene            complement(<305441..>306367)
                     /locus_tag="AGOS_ABL049C"
                     /old_locus_tag="ABL049C"
                     /db_xref="GeneID:4618981"
     mRNA            complement(<305441..>306367)
                     /locus_tag="AGOS_ABL049C"
                     /old_locus_tag="ABL049C"
                     /product="ABL049Cp"
                     /transcript_id="NM_208251.2"
                     /db_xref="GeneID:4618981"
     CDS             complement(305441..306367)
                     /locus_tag="AGOS_ABL049C"
                     /old_locus_tag="ABL049C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL110C (KTI12)"
                     /codon_start=1
                     /product="ABL049Cp"
                     /protein_id="NP_982898.2"
                     /db_xref="GeneID:4618981"
                     /translation="MPLVLLTGFPSSGKTTYARQLEALLQAKCASSPELAKYTVVYHS
                     DETLGIQHDDYKTSQGEKSARSKIMSVVKRDLSRNAIVIVDSLNYIKGFRYQLHCEVK
                     HAMTTYCLVHCLAAYEKLVQWNTQQDTPWDAALLEALIQRYEEPNPATRWDSPLFAVL
                     SGEDKLEAIADDVYKALFPQLYRDCADRETEKLLQGLTPNSATILKPAAHVNLVQVLD
                     SETQAVVKTIMQHLQSNVVSGNIRVIVSETKDINDPSCCYVELQSDRVGMAQLQRIRR
                     QFVQMNKLRNIEKERIIPLFTEFLNKNLRSDL"
     gene            <306462..>307514
                     /locus_tag="AGOS_ABL048W"
                     /old_locus_tag="ABL048W"
                     /db_xref="GeneID:4618982"
     mRNA            <306462..>307514
                     /locus_tag="AGOS_ABL048W"
                     /old_locus_tag="ABL048W"
                     /product="ABL048Wp"
                     /transcript_id="NM_208252.1"
                     /db_xref="GeneID:4618982"
     CDS             306462..307514
                     /locus_tag="AGOS_ABL048W"
                     /old_locus_tag="ABL048W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR097C (MTG1)"
                     /codon_start=1
                     /product="ABL048Wp"
                     /protein_id="NP_982899.1"
                     /db_xref="GeneID:4618982"
                     /translation="MFKPSARCLLAARVFTPRAVFPDYHIPLSNFQGHQRKAMLRIEQ
                     LAPQLNLLLEVRDSTAPLSTHNVLFDQLVATHRLDRIILYTKRDVCAAPTPAALHRWH
                     AETGDDYMLLDARSAADAAALLAAVRARYDAAAAAPGALPLGYRLLVAGMPNVGKSTL
                     VNRLRASGTARRAKVAATGAHPGVTRATSECVRIADHRAGVFMHDTPGVALPARASSV
                     RRMLALALAGCVGPAVVDPVIQADYLLYLLNLQGLAPSYAAYSPPTNDIAALLAAVCT
                     RHRLRSETAAALHWLAIRPPGLCLDPELLLPPDAFSYKDHVTAAARVSLLPPRCHTRR
                     AGRSAARARNSNVLFR"
     gene            <308062..>309354
                     /locus_tag="AGOS_ABL047W"
                     /old_locus_tag="ABL047W"
                     /db_xref="GeneID:4618983"
     mRNA            <308062..>309354
                     /locus_tag="AGOS_ABL047W"
                     /old_locus_tag="ABL047W"
                     /product="ABL047Wp"
                     /transcript_id="NM_208253.2"
                     /db_xref="GeneID:4618983"
     CDS             308062..309354
                     /locus_tag="AGOS_ABL047W"
                     /old_locus_tag="ABL047W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL109W (HAP4)"
                     /codon_start=1
                     /product="ABL047Wp"
                     /protein_id="NP_982900.2"
                     /db_xref="GeneID:4618983"
                     /translation="MAKPVPIQPGPVHGGVAIAPNMGARKAGGGGLTIRTSRHWVLPP
                     RPKPGRKPSYAAAGAVEAERKKSGGRRSTKAVLRKEIQQLRLENVKLKKELERLVASL
                     QELKRRFTSVGLPETPAADIATPVSLGATPEASKKRVYIEDSTDAFLKFEDEEGGEVP
                     ALTTACMAQSLSLGSRASFTDEEDFGSTPSSLFSSDLQNLSAGVVCSALAQHVAHSPR
                     AMHSGSPSSSTSSTLSKSVPAGAGIEAGPAPALMALETLTFLDNYERSEFYSKHTSTL
                     LSRTSTAATPEEQSQLMLPLLSVGEEPPLQAIREEDDLVRDPAADTASFQLSAEDEQE
                     TDGTSILNFLKTHMAEQEVATEKQRYEPPVLPAQDLDRWTGYNDPLQLMEKRDLGQFI
                     APSLEELMEEQDDCDRDSKLLGPLNYDAEPVGGDSYGD"
     gene            complement(<309728..>311008)
                     /locus_tag="AGOS_ABL046C"
                     /old_locus_tag="ABL046C"
                     /db_xref="GeneID:4618984"
     mRNA            complement(<309728..>311008)
                     /locus_tag="AGOS_ABL046C"
                     /old_locus_tag="ABL046C"
                     /product="ABL046Cp"
                     /transcript_id="NM_208254.1"
                     /db_xref="GeneID:4618984"
     CDS             complement(309728..311008)
                     /locus_tag="AGOS_ABL046C"
                     /old_locus_tag="ABL046C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR094W (CTF13)"
                     /codon_start=1
                     /product="ABL046Cp"
                     /protein_id="NP_982901.1"
                     /db_xref="GeneID:4618984"
                     /translation="MAFDIQLFLGLPVDIRKAIYRRLDNRFTCLDPTDINGVNIQWGL
                     NRSAQKRDWGLQEIPFRPYVDHYNYIPNFVLLWRQYMPWLRYDSVVLDYLRINQLYDG
                     GLASLHWILIGPDPCIAIFDNDDDVLQVWFSLAEFRSWILGALQHPETAYCGEIDVVG
                     NASRMYGALKIDTGVVLDIQQLFGRLNTTGHLDTVGEVVLTQEEFLSQGEIGKHINYS
                     VSQLDSLRYLRTLKIRSDLLFHKFVNLRGARDNPGHTIGYNVRKRLRQLHLVGLRDEI
                     AVCDLSKWDSCVAVKIENFSGSLDLDGVIMPRHLQRLILKNVRSVRWWRFREIHEITL
                     DPNTFTKKQGFVGTIHGPDQDRVEVRQINRAVMSQDTYFHFDSLLRARFQNLNYISLH
                     NVSEEITGIIVPHRLYCNGRISIAGCVVKGVVVI"
     gene            <311151..>312290
                     /locus_tag="AGOS_ABL045W"
                     /old_locus_tag="ABL045W"
                     /db_xref="GeneID:4618985"
     mRNA            <311151..>312290
                     /locus_tag="AGOS_ABL045W"
                     /old_locus_tag="ABL045W"
                     /product="ABL045Wp"
                     /transcript_id="NM_208255.1"
                     /db_xref="GeneID:4618985"
     CDS             311151..312290
                     /locus_tag="AGOS_ABL045W"
                     /old_locus_tag="ABL045W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL108W (SLD2)"
                     /codon_start=1
                     /product="ABL045Wp"
                     /protein_id="NP_982902.1"
                     /db_xref="GeneID:4618985"
                     /translation="MSRTSAGELDVLKVQLKTWERQFLEENGRSPIKEDIKAHPEIRR
                     KYKEYTSLKKLLSKGNAAVTGQKHGSPSRATHPTPQKHIDAEIELGPTPQIYGKVVSL
                     FEMHISPLKKVPVRQLDADSSETCISPDLHSQDVAQSELLTDISCQAKRQLDFSVTPH
                     ASPVKAVQPLLLNAPDLRFEAIPHARTKYGPNSPVKFDGDVTLTLSQTPLQAKLAQAS
                     EGYSPSPLIKRPAKPLSQLAKEYEDIVEELKEVDHAAAVRNLGGLLQQEEENTQEAEA
                     AEPSATRSDRKRRKNKVRPALVTLEEEIPQGNLHEQLVKLRQKALDKFNGNDPNDSSD
                     EEKKTSATSAKPAKARKRKYNTVSDNFRRLKLPTKNTRNGRWRRR"
     gene            complement(<312396..>313952)
                     /locus_tag="AGOS_ABL044C"
                     /old_locus_tag="ABL044C"
                     /db_xref="GeneID:4618986"
     mRNA            complement(<312396..>313952)
                     /locus_tag="AGOS_ABL044C"
                     /old_locus_tag="ABL044C"
                     /product="ABL044Cp"
                     /transcript_id="NM_208256.1"
                     /db_xref="GeneID:4618986"
     CDS             complement(312396..313952)
                     /locus_tag="AGOS_ABL044C"
                     /old_locus_tag="ABL044C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR093W (UTP15)"
                     /codon_start=1
                     /product="ABL044Cp"
                     /protein_id="NP_982903.1"
                     /db_xref="GeneID:4618986"
                     /translation="MSSAVPRVTPLKNPVLPLQTTPEQRYWRQYSSTQLVKEHNAVTH
                     IEFNPQHPHDFAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSSSFRPDGKLLAAGDAT
                     GLVSVYDSYNPRNLLVSIKASTHPAHVTKFHPLDKQTLVTATDDRVVRVWDISHAYEP
                     TLELLGASDYVRSVCFVPGAPHMVVSGCYDGVVRLHDTRTRSAQPVTQLNHGMSVEDI
                     VAISPTQLVSCGGSKFKVWDLTGNKLLHERGNFAKTVTCLDYVNMPDGGAMNSCLLAS
                     SLDGHVKVFDPLDGYRVKFGWKFSSAVLSCAISPGDAQGNKHLVAGLSSGLLAIRTNK
                     KTREPKGDSDAQDTETAIMGKERKSNNFQRMMRGSEYKGDQEHIIHNDKPRQQPRLRL
                     FEKKLNQFKWAEALDSAFVPGMAKELTLTVLQELRKRGKIRVALYDRDETSLEPLLNW
                     CLKGLEDTRSAPVVADWIAVVLEMYATIIERSPVLEEMVVALRNKVRQEIHKCKEAQK
                     IQGMLQILTN"
     gene            <314691..>316511
                     /locus_tag="AGOS_ABL043W"
                     /old_locus_tag="ABL043W"
                     /db_xref="GeneID:4618987"
     mRNA            <314691..>316511
                     /locus_tag="AGOS_ABL043W"
                     /old_locus_tag="ABL043W"
                     /product="ABL043Wp"
                     /transcript_id="NM_208257.1"
                     /db_xref="GeneID:4618987"
     CDS             314691..316511
                     /locus_tag="AGOS_ABL043W"
                     /old_locus_tag="ABL043W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR092C (AIP1)"
                     /codon_start=1
                     /product="ABL043Wp"
                     /protein_id="NP_982904.1"
                     /db_xref="GeneID:4618987"
                     /translation="MAAIQLEKTLVPLPSTRRNFGTHLSYDRHTNRIAYGSGKSAIVK
                     SLDSDIVVQFTGHGSANVTVVRFSPVAGSQYVVSGDDAGRIMVWSYFEDEEKGQVETK
                     LRSEFQVLAGAVADISWDFEGRRLCVVGAGRDRYGAFISWDTGNSLGEVTGHALNVNA
                     CHIRQARPMRAATVSDDGSMVFYKGPPFQFSCSDHTHHANGKFVRDVRFSPAKGAYLV
                     SVGSDRKIVLYDGDSGEFIKYIGEDSEECGGFFSLAWVDDGDKSNRIVTASADGVVRL
                     WDVEANRLLKRWELGTEVAQQQVGVVVTRDSNIISVSLDGTLNVFSIESDKPIKTIEG
                     HKKGITALKTNPLVTASYDGRVLEWSAEGTAAVAAMHSNSVTSINNVGGRTCTVSWDG
                     TLKVDNEEKHKFPDDPKASVAFEGMVALITNNKRLVLVKSESGLVVQETALSRSPCVV
                     TMAKSHVAVGYEDSNIIDVFLVSDFATRFELALTIRGTPSALSFSPTEQYLAVGDVMG
                     KILLFNVEQRTVVTSRWSFHTGKITSMDWRPDEDDENYIATAALDTHLFIYSVKKPMR
                     VIKMLNAHKDGINMLGWEDPDHLITGGQDACIKRWRVSFS"
     gene            <316933..>318366
                     /locus_tag="AGOS_ABL042W"
                     /old_locus_tag="ABL042W"
                     /db_xref="GeneID:4618988"
     mRNA            <316933..>318366
                     /locus_tag="AGOS_ABL042W"
                     /old_locus_tag="ABL042W"
                     /product="ABL042Wp"
                     /transcript_id="NM_208258.1"
                     /db_xref="GeneID:4618988"
     CDS             316933..318366
                     /locus_tag="AGOS_ABL042W"
                     /old_locus_tag="ABL042W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR091C (NPL6)"
                     /codon_start=1
                     /product="ABL042Wp"
                     /protein_id="NP_982905.1"
                     /db_xref="GeneID:4618988"
                     /translation="MSREAKAPKVTFKDMHDEEGEDHSTSGQYGLKANYEADGGNNDK
                     ENDGDREYEDDEEEEDEEEEDGDDSRQDTSGNDENGDGNERGAESGRRHMGQRADDGV
                     VIPNRPQGEVRMTLIDPKNMPRTPTRGRPPKRKFGRSASPDLSKAGPGFTTSIPGNSK
                     RPRLPYPVDERGNPLPVINDEYTLPDDPEGERKITRDGDLLGGRQFLVRTFTLTGRGQ
                     TKYMLSTEPARAVGFRDSYLFFQYHPNLYKLVISQDERNDLIDRGVIPYSYRSRAIAL
                     VTARSVYKEFGAHIIVDGKNITDDYYATKLRAEGKLVEGTYAREPISKNGTRSDGWDY
                     PQSNINPARNAVEFFDKKNHNIAPGSNISATNWLYQHAAACSRFNSDLFYDRERVLLI
                     ENLGLRDPYTNTLHLPQSTQSSKVLAFRKLRPETDQIIYSTHIHDSDVARRKTGLADV
                     PPELFEDIVSDEVKEAILKQQEFERTN"
     gene            <318720..>321176
                     /locus_tag="AGOS_ABL041W"
                     /old_locus_tag="ABL041W"
                     /db_xref="GeneID:4618989"
     mRNA            <318720..>321176
                     /locus_tag="AGOS_ABL041W"
                     /old_locus_tag="ABL041W"
                     /product="ABL041Wp"
                     /transcript_id="NM_208259.2"
                     /db_xref="GeneID:4618989"
     CDS             318720..321176
                     /locus_tag="AGOS_ABL041W"
                     /old_locus_tag="ABL041W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR089C (YTA12)"
                     /codon_start=1
                     /product="ABL041Wp"
                     /protein_id="NP_982906.2"
                     /db_xref="GeneID:4618989"
                     /translation="MSSVLTYQLLRTLKGDRPLSVVRSSWRAIVANNHAVVYRQKVRA
                     LHTSPAAWNQNKSSKDGNDKDFGDDELKALKDELFKQIEEANKRTGSEKDAKQKEIAE
                     QMRRMEEVVKRQLERAKKEAAEKDAKATAGESGADNGKGPEGQRQEPDANNPFNDPKV
                     MTININLFKVGLVLTLIAFIMSKLGPGSGERELTWQEFRKELLCKGYVAKLIASRSNV
                     VKVVLNENGMHQLQNRDTSYYFTIGSVENFERKLREAQDELGIAEDFRIPVIYISEKR
                     WMQLAVQLLPTAMMIGGLYWLNKRFMSSASGGPGGIFNAGKSKARRYNKDTDVKVKFK
                     DVAGCDEAKEEIMEFVSFLKEPSRYERMGAQIPRGAILSGPPGTGKTLLAKATAGEAG
                     VPFFSVSGSEFVEMFVGIGASRVRDLFKTARENAPAIIFIDEIDAIGKSRQKGNFSGA
                     NDERENTLNQLLVEMDGFTPSDHIVVLAGTNRQDVLDRALMRPGRFDRHIHIDKPELS
                     GRQEIFKVHLSKIKLAGDIADLKDRLAALTPGFSGADIANVCNEAALIAARYDSSSVK
                     LEHFEQAIERVIGGVERKSKLLSPQEKKIVAYHEAGHAICGWFLEFADPLLKVSIIPR
                     GQGTLGYAQYLPNDVHLLSEQQLLDRMTMTLGGRVSEELHFSSVTGGAYDDFKRVTST
                     ATAMVTELGMSKELGLVNYTPKSEHDLTKPFSEETAAIVDSEVYNLIQYCHDRCEKLL
                     REKSEELEKVAQLLMKQEVLTREDMIRLLGKRPFPERNDAFDKYLNESETRRLKEQEE
                     KGDDDKKRDDAEPNGEKPSE"
     gene            <321555..>323258
                     /locus_tag="AGOS_ABL040W"
                     /old_locus_tag="ABL040W"
                     /db_xref="GeneID:4618990"
     mRNA            <321555..>323258
                     /locus_tag="AGOS_ABL040W"
                     /old_locus_tag="ABL040W"
                     /product="ABL040Wp"
                     /transcript_id="NM_208260.1"
                     /db_xref="GeneID:4618990"
     CDS             321555..323258
                     /locus_tag="AGOS_ABL040W"
                     /old_locus_tag="ABL040W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR088C (VBA1)"
                     /codon_start=1
                     /product="ABL040Wp"
                     /protein_id="NP_982907.1"
                     /db_xref="GeneID:4618990"
                     /translation="MDESESQLRGTLLPHDSLEYGTNSDKTLTETQRCQEHNRSLPKA
                     PILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAAFQPLYGRC
                     SDIVGRKCALLIAQSFFLLGTLLTCFARNVTEFAIARAICGMGGGGIGAMSSITVSDI
                     CTTKERGMYQGYANVIFGAGQVLGAPVGGLIMETFNWRIIFAAQVVAIMICMILAYRN
                     INLKLLHIPPFHQRFTRKNLSRIDLFGSSMLSCSLVSFLMLFSSGVSRSLWFLLTLVS
                     LTLFCINERYIATERLLPNGILRGHFGLSALLIVVSSFMMFAELYRMPVYLQLIQDIS
                     VSRSGIFLLFASVSSSGASLFTGWLLRTTKQDLGKLVYKIALASSFIQLVGMMLALFT
                     TSVTEPSQAVHAGWAVFSPRSAGQMHYFKSDSIAWRVLLTVALMCSSFAYASLLVSIL
                     VSIVDTTEKSQQATMIGVFYLWRSIGNTLGASVPLSVYEFEVARKLWDYMEAQGLRDT
                     YLDLLHDSSILRQRFRNHTLAALLQIYRSCFQVSYLPSICVCILGILAATRLTQRAAH
                     K"
     gene            complement(<323259..>324020)
                     /locus_tag="AGOS_ABL039C"
                     /old_locus_tag="ABL039C"
                     /db_xref="GeneID:4618991"
     mRNA            complement(<323259..>324020)
                     /locus_tag="AGOS_ABL039C"
                     /old_locus_tag="ABL039C"
                     /product="ABL039Cp"
                     /transcript_id="NM_208261.2"
                     /db_xref="GeneID:4618991"
     CDS             complement(323259..324020)
                     /locus_tag="AGOS_ABL039C"
                     /old_locus_tag="ABL039C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR087W"
                     /codon_start=1
                     /product="ABL039Cp"
                     /protein_id="NP_982908.2"
                     /db_xref="GeneID:4618991"
                     /translation="MRLCLIDNNQTVCEVWRRWLDGVGDVKVWRGGLEAVAAWDCGVT
                     RGVVSPGNSLGYLRGGFDLGLRELLGGAMFEDWVRGQLGRSYRPLGACAVLHVPERFS
                     AGGVRYLLHVPTMVAPTAPVFDAARPVATGVQPVFDAVWGVLQALPAEVEELLLPGIG
                     TGYAGIPASIAAVSMAFAIRLHLVREQLSAELVAVMIMCFLGCQYEPFMPEHCRREYV
                     SLGLPWERLLSFDVLQDSLDEILPRALRRPAVGNT"
     gene            <324574..>325905
                     /locus_tag="AGOS_ABL038W"
                     /old_locus_tag="ABL038W"
                     /db_xref="GeneID:4618992"
     mRNA            <324574..>325905
                     /locus_tag="AGOS_ABL038W"
                     /old_locus_tag="ABL038W"
                     /product="ABL038Wp"
                     /transcript_id="NM_208262.2"
                     /db_xref="GeneID:4618992"
     CDS             324574..325905
                     /locus_tag="AGOS_ABL038W"
                     /old_locus_tag="ABL038W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL106W (AAT1)"
                     /codon_start=1
                     /product="ABL038Wp"
                     /protein_id="NP_982909.2"
                     /db_xref="GeneID:4618992"
                     /translation="MTQTNQVRASTKGVLGMTRNVVGAFTANWRCRRQHQALGRVPEA
                     MPDQILGLTERFNQDRNPHKVNLTVGIYKDDNGEVTSFPSVARAQRMVEGQRGGRLAY
                     LPIAGCPSYGARVSDFLYSECAPQGREFLASGCVSFMQTLSGTGALSLASLFLSNFIS
                     KTIWVPQPSWANHMNIFKLNGFEEVRRYRYYEDGAVDVDSWLAQLERAAADRPYPQCI
                     LLHACCHNPTGVDPTREQWSRILSVINGLGMVPIVDMAYQGLESGDLRADAYLLRMCL
                     EHRWDNGLYVCHSFAKNMGLYGERVGSLSVVHPLGQFQAKAATDSQLKCIIRASYSSP
                     PSYGSRVATTVLSVPEIKQQWHEDVHGMCNRLWSVRCMLHEKLRWPKLIDSTSQHGMF
                     YYTGIGPDAVDTLREKYSVYLTKDGRLSLAGINTGNVDYVARALRNVSTYP"
     gene            complement(<326116..>328086)
                     /locus_tag="AGOS_ABL037C"
                     /old_locus_tag="ABL037C"
                     /db_xref="GeneID:4618993"
     mRNA            complement(<326116..>328086)
                     /locus_tag="AGOS_ABL037C"
                     /old_locus_tag="ABL037C"
                     /product="ABL037Cp"
                     /transcript_id="NM_208263.2"
                     /db_xref="GeneID:4618993"
     CDS             complement(326116..328086)
                     /locus_tag="AGOS_ABL037C"
                     /old_locus_tag="ABL037C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR086W and YKL105C"
                     /codon_start=1
                     /product="ABL037Cp"
                     /protein_id="NP_982910.2"
                     /db_xref="GeneID:4618993"
                     /translation="MLRKQTPGRARPADVEAVAAVSALGKVMNQDGTALDHSKVRKRE
                     SMLPTRGRSGRGGVRRASAESAGRRTRSEDGKAARSARERHMEDEFNAFGGRATAGVA
                     KEVPARGGADDGPVMTTKYVPSPRGLVKVTVPVSAGSSAHSSLRKSASIHTGMNMRHG
                     SGSRRASMTSAGSDAARRQAKSTAESSSARTRSNKPKPRPSGDSHSPSPTTRAPVTPR
                     RTTVKDLVAPPLPEEPEDSVSTSGKGESIVPLNEKEEEQDEQPFDSEANARSSPKTPK
                     QGGHVPALEVSQHGFQTPVPDGPTMAEYLQSADPILSAGATQRQRELEEAEAASTTPD
                     GDRLKIGKSPSPMKSAMKNSPSAGTSKYNRPPLDTSSAADGAYLSLTTAENTRLNAQL
                     SDDKMRKSPTLRQPKRRVSVHSPKTPSAASADRSSKVLRQFSLSKPQGRTLAMNKNNS
                     GEKQAQSPTSPKSNQKKVDPSVLYPREPPKKKSSFERERPQHKNLGFKNLSLRSEASN
                     EFMYQGTLEGEIHQSPGQHVGHETPKKALLSVTAEGWKSRFSDSDSENDSPPFSSNAS
                     GSTQPSSHRDSSLAHHGGFGLFKHKDHHGHKPKHSLGASLASAKPHEPQKARLAPTSN
                     RGSNTLSAERPLKNHNSFSGKLKKLFGKKHAT"
     gene            complement(<328585..>330705)
                     /locus_tag="AGOS_ABL036C"
                     /old_locus_tag="ABL036C"
                     /db_xref="GeneID:4618994"
     mRNA            complement(<328585..>330705)
                     /locus_tag="AGOS_ABL036C"
                     /old_locus_tag="ABL036C"
                     /product="ABL036Cp"
                     /transcript_id="NM_208264.2"
                     /db_xref="GeneID:4618994"
     CDS             complement(328585..330705)
                     /locus_tag="AGOS_ABL036C"
                     /old_locus_tag="ABL036C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL104C (GFA1), YMR084W and YMR085W; YMR084W and YMR085W
                     represent one ORF in this organism"
                     /codon_start=1
                     /product="ABL036Cp"
                     /protein_id="NP_982911.2"
                     /db_xref="GeneID:4618994"
                     /translation="MCGIFGYCNYLVEKSRGEIIDTLVEGLQRLEYRGYDSTGIAIDG
                     DGADETFIFKQIGKVSALEREIAERAPARDVRFVSHCGIAHTRWATHGQPRQVNCHPH
                     RSDARNEFVVVHNGIITNFRELKTLLRNKGYEFESDTDTEVIAKLFKHLYDTNLENGH
                     ELDFHELTKQVLLELEGSYGLLCRSSRYPCEVIATRKGSPLLVGVKSERKLKVDFVDV
                     EFPDNEKQPDVPIPAVLNGHKAGADCEKLLPIAASETGLRHSQSRAFLSEDGVPNPVE
                     FFLSSDAASVIKHTKKVLFLEDDDIAHIYDGELHIHRSRREVGASATRSIQTLEMELA
                     QIMKGPYDHFMQKEIFEQPESTLNTMRGRIDFENNTVMLGGLKSWLPAIRSARRLTMI
                     ACGTSYHSCLATRAIFEELSEIPVSIELASDFLDRRCPVFRDDVCIFVSQSGETADTM
                     LALNYCIERGALTVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVML
                     ALSLSDDRVSRIERRKEIIQGLKEIPRQIKQVLQLEKQIKHLCETELCNQKSLLLLGR
                     GYQFASALEGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVV
                     SSIEQVTARKGRPIIICNENDEVWTRKAQNSNLLTLEVPLTVDCLQGLLNIIPLQLTA
                     YWLAVNNGIDVDFPRNLAKSVTVE"
     gene            complement(<331090..>332583)
                     /locus_tag="AGOS_ABL035C"
                     /old_locus_tag="ABL035C"
                     /db_xref="GeneID:4618995"
     mRNA            complement(<331090..>332583)
                     /locus_tag="AGOS_ABL035C"
                     /old_locus_tag="ABL035C"
                     /product="ABL035Cp"
                     /transcript_id="NM_208265.2"
                     /db_xref="GeneID:4618995"
     CDS             complement(331090..332583)
                     /locus_tag="AGOS_ABL035C"
                     /old_locus_tag="ABL035C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL103C (LAP4)"
                     /codon_start=1
                     /product="ABL035Cp"
                     /protein_id="NP_982912.2"
                     /db_xref="GeneID:4618995"
                     /translation="MSELKEQVMATQEALRAIQESLKQLQIAPGADDASGADEEDGLE
                     KWARRFVDFTYKNPTTHHVVAHYAGRLEAAGFRRLDERDEWELPAEGRFFTVRNGTSL
                     AAFVVGRDWKATDGVGVIATHCDALAAKVRPVSARPAVDGYELLGVAPYAGALSPVWL
                     DRDLGIGGRVLVREADSDRVRSRLVDSTPHPVARISTLAPHFGAVATGPLDPETQMVP
                     VIGYGGADAEASAAERAAPLFGKHPLPLLRYVARLAGVEVAQLVQLDLDLFDVQRGSL
                     GGLRNDFLFAPRLDDRLCSFAAMEALLAAPAPAPAAFDAVVFFDNEEIGSRTRQGAAG
                     GLLGAIAARVLRARGADPAALPTLFANSVVLSADVTHLLNPSFCDQYLDGHKPVPNAG
                     LALALDENGHMATDSVGTAFAHDLAAAAGAPLQYFHIRNGARSGGTVGPILSAATGAR
                     TIDLGIPQLSMHSIRAAAGSRDLGLAIRFFAGFLADWRAVYDRFRGL"
     gene            <333444..>337721
                     /locus_tag="AGOS_ABL034W"
                     /old_locus_tag="ABL034W"
                     /db_xref="GeneID:4619005"
     mRNA            <333444..>337721
                     /locus_tag="AGOS_ABL034W"
                     /old_locus_tag="ABL034W"
                     /product="ABL034Wp"
                     /transcript_id="NM_208266.1"
                     /db_xref="GeneID:4619005"
     CDS             333444..337721
                     /locus_tag="AGOS_ABL034W"
                     /old_locus_tag="ABL034W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL101W (HSL1)"
                     /codon_start=1
                     /product="ABL034Wp"
                     /protein_id="NP_982913.1"
                     /db_xref="GeneID:4619005"
                     /translation="MTAGHRDERPDREGGSERDEHLNRVVQSVSDATKRLSQISNSST
                     AHTKTGKRKNRDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQK
                     QVTALPYGIEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGK
                     LPEQEAIHYFKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTN
                     RLLETSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLK
                     VQHGRYQMPSNVSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDNPGKGGLACPL
                     EKPEERPKVLDIHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLL
                     RYQQRQSVEPTSVPSNMASTNGSGAFARASNNDQSVINAPKVTQKSQFSINSLLVSPK
                     KTREGYVASSSRVFKHSVSRRSLHVSPSPMKSSTSCRSLKSSSSKRLQSPNPKAITQP
                     VKVTSPQPRRRTLHNSASKRSLYSLTSISKRSLNLNEFLQEANEVKTPKLPSMPLQDQ
                     PRSEAPKTPTKTTYGADSHGGEKPTFISVLHDCPTVDSEGMVFKSSSGTPMIAANAPI
                     IQPAFIFGVGAFPGTKQPSSNSLSKPSLNSQSSPKQAQEATANSMRETIRDRQTLVVE
                     KRVPSKTESVPPAFPRVRPIMERKHGSDLTLVRDTRSVAKEKRSSLSLDPRRTAPEPP
                     RGIETLLRRYSLKNSIKSRSSLKKKRDSGAWSITDKTIFQDLGQVPEDEEQEKDSEEK
                     GNDTFISTTETSDTPSSKFKVTTSTPIKKDDATAISAENAAVGTEQSGSEDEATNFDS
                     NAHSYPISTDLKTEDDLTPIKPQGQTDLLRMPSSFMNSSNTFANLNNFISNIDKEYSP
                     ENSDSGRIEKDEPAGKAQPEQITVKKRQRTLAPGGYLSPSIPRMESENSLNQELGSRI
                     SDLSDLSFANDMPTYTNTAHAVSISPGTRNVCSFSPLEPRSPQDVSNNGKMRSNLHIP
                     LRQLSEDMCDKTITTQEGESVNIFEDAPEEEGSLTTSTSGSVPNIHQKAISIDTMNTS
                     CALVPVSHVRTSIHMNGDSSVLDWSTSDGILSKARPLPTSNHVRKKSGNRLSNNLTLS
                     KSMMSMFKNLDQINVTDIQDPMPVSDLLSKGVDPIEPIEPLKNDQVTLKAESIGAESD
                     SINMDLADRKHVTIFHDNVSDKNFKSTRMENSDKGSLGSGAPQATHLFHTGNKDMKSH
                     ETLLSPITETPAAALSATSLTRKESISSDGKSVKDETKKSGKGNWFMRLIMSFTKPKK
                     TVIQEHMTVLPFDDVNIITLQQFSYQGVEYEIRQMERRKDKQKVEYDCRLLDGDFKFK
                     INIYGENSAATKVSVKQKGRSDELAFTKLNTDIEALIKAKENAANVK"
     gene            complement(<337878..>338999)
                     /locus_tag="AGOS_ABL033C"
                     /old_locus_tag="ABL033C"
                     /db_xref="GeneID:4619006"
     mRNA            complement(<337878..>338999)
                     /locus_tag="AGOS_ABL033C"
                     /old_locus_tag="ABL033C"
                     /product="ABL033Cp"
                     /transcript_id="NM_208267.1"
                     /db_xref="GeneID:4619006"
     CDS             complement(337878..338999)
                     /locus_tag="AGOS_ABL033C"
                     /old_locus_tag="ABL033C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR083W (ADH3)"
                     /codon_start=1
                     /product="ABL033Cp"
                     /protein_id="NP_982914.1"
                     /db_xref="GeneID:4619006"
                     /translation="MLRLLNPRSTQTVSRATRLVIRLSSTAIPTTQKAVVFYEHGGEL
                     KYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIKPKLPLVGGHEGAGVVVAKG
                     ANVTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNCETPTLSGYTHDGTFQQYATADAI
                     HAAHIPPGTDLAKVAPILCAGITVYKALKTAALIPGQWVAISGAGGGLGSLAVQYAVA
                     MGYRVVGIDGGNEKEALFRSLGGETFVDFHKNKDIVSAVREATGGGPHGVVNVSVSTN
                     AILQSVEYVRPTGTVVLVGLPPDATVKSDVLTHVLKSINIKGSYVGNRADTKEAIEFF
                     TRGLVQSPIKIIGLSQLEEAYKAMEEGTSIGRYVVDTSR"
     gene            complement(<339538..>340284)
                     /locus_tag="AGOS_ABL032C"
                     /old_locus_tag="ABL032C"
                     /db_xref="GeneID:4619007"
     mRNA            complement(<339538..>340284)
                     /locus_tag="AGOS_ABL032C"
                     /old_locus_tag="ABL032C"
                     /product="ABL032Cp"
                     /transcript_id="NM_208268.1"
                     /db_xref="GeneID:4619007"
     CDS             complement(339538..340284)
                     /locus_tag="AGOS_ABL032C"
                     /old_locus_tag="ABL032C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL099C (UTP11)"
                     /codon_start=1
                     /product="ABL032Cp"
                     /protein_id="NP_982915.1"
                     /db_xref="GeneID:4619007"
                     /translation="MAKLVHNVQKKQHRERSQVSERARFGFLEKHKDYTKRAQNFHKK
                     QATLKVLRSKAKERNPDEYYHAMHSRKVDSNGVLVKSRHANGEDPSLTMDQVKLLKTQ
                     DSNYVRTMRQSELNKASRLSQQLMFKASGQHTVFVEDEDSMRHFTPEQYFDTTSEMLQ
                     RRENRLTKDQLARTPLEPSSSIMPSESLQKKKVKKIKMVAQHLDREKKLQQVYQRMDL
                     QRELMKKGSKKKVADSSGAVSFKWKKQRKR"
     gene            <340469..>341302
                     /locus_tag="AGOS_ABL031W"
                     /old_locus_tag="ABL031W"
                     /db_xref="GeneID:4619008"
     mRNA            <340469..>341302
                     /locus_tag="AGOS_ABL031W"
                     /old_locus_tag="ABL031W"
                     /product="ABL031Wp"
                     /transcript_id="NM_208269.2"
                     /db_xref="GeneID:4619008"
     CDS             340469..341302
                     /locus_tag="AGOS_ABL031W"
                     /old_locus_tag="ABL031W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL098W (MTC2)"
                     /codon_start=1
                     /product="ABL031Wp"
                     /protein_id="NP_982916.2"
                     /db_xref="GeneID:4619008"
                     /translation="MVSELSLPEFEAGLSASLTCKRNFACFATFAGEIIGALRGSRLR
                     VQLLEDFSTIGKDSVLSGELQVLVLATMQELPPREQNEVARWLRALRKVHPGLVCIAT
                     IGAHENGGPGMTNFLRRQFWFATRGPKRACGALRLPKRAAFTVHPAVHRYVLDVLVHI
                     RMHRLLDHSQAGGASSSSAEDVLDLCRWLCSANHPEKTFVTPDDVQQACAWYFPMHLD
                     VIRLPQQEASVLYGTSMKFAEDLLIGLRTFLKKTGTVDNPLLLETLIVQEVLGKVVPA
                     I"
     gene            341436..341508
                     /locus_tag="AGOS_t0032"
                     /db_xref="GeneID:4619009"
     tRNA            341436..341508
                     /locus_tag="AGOS_t0032"
                     /product="tRNA-Lys"
                     /codon_recognized="AAG"
                     /db_xref="GeneID:4619009"
     gene            <341678..>343486
                     /locus_tag="AGOS_ABL030W"
                     /old_locus_tag="ABL030W"
                     /db_xref="GeneID:4618996"
     mRNA            <341678..>343486
                     /locus_tag="AGOS_ABL030W"
                     /old_locus_tag="ABL030W"
                     /product="ABL030Wp"
                     /transcript_id="NM_208270.3"
                     /db_xref="GeneID:4618996"
     CDS             341678..343486
                     /locus_tag="AGOS_ABL030W"
                     /old_locus_tag="ABL030W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR106C (YKU80)"
                     /codon_start=1
                     /product="ABL030Wp"
                     /protein_id="NP_982917.3"
                     /db_xref="GeneID:4618996"
                     /translation="MSQECTTFLIDYSASMLESTAKFEAYLEYALFDKAQRSRKTDYT
                     HVVLANCAMEKNPNNVKNMFEVFAPSAPITLSSVVKICERLKAMRELDPLDTKQSNVF
                     EALLAIGMQVNDKFNKRKMLKQVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCAE
                     QFPDNFSKTKWGQLLALKDGSRMFTLYEVLGTIERITHQPVKPVRVFHGQLRLGADMR
                     NLAGCQQDPHCLCINVEGYPATKAVVSMSRKQVQKTEDGKYLPLQSVIEYEIHEPTEE
                     DNEEYHVVPVPKEHVTKAYRYGADYVVLPELLEHERLYTTTPGLDIRGFIDTGKVLRH
                     HLCSESVYIMADSREGTAADYVTFAALVDAMIAAEKFAIARYVQKKDSEVQMCLLCPL
                     LVEPSTKKRPADDDAAEAKRALVLCRLPFAEDERSSDFPPLVKQEPADVMLDTTMAAF
                     IDSMDMDAAAPPASWCSSSNVRSFDSFMKDSTLPLPDDPSLAETISDPACIPAIALHH
                     QKHVLLEYFHQRFILRLNNGFSVADLRDSLRSKVSPWATAETSELAARIKDTCAVKLV
                     ERPPEATAGAYVDEEQDEASEVPPLEALLALGKRNP"
     gene            <343861..>345567
                     /locus_tag="AGOS_ABL029W"
                     /old_locus_tag="ABL029W"
                     /db_xref="GeneID:4619010"
     mRNA            <343861..>345567
                     /locus_tag="AGOS_ABL029W"
                     /old_locus_tag="ABL029W"
                     /product="ABL029Wp"
                     /transcript_id="NM_208271.1"
                     /db_xref="GeneID:4619010"
     CDS             343861..345567
                     /locus_tag="AGOS_ABL029W"
                     /old_locus_tag="ABL029W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL127W (PGM1) and YMR105C (PGM2)"
                     /codon_start=1
                     /product="ABL029Wp"
                     /protein_id="NP_982918.1"
                     /db_xref="GeneID:4619010"
                     /translation="MSITIESVPTKAFADQKPGTSGLRKKTKVFEQTEHYTENFIQAI
                     MESIPEGSENAVLVIGGDGRYYNDAVMQKIAEVGSANGVRKLIIGQNGLLSTPAASHI
                     IRTYHDKVTGGIILTASHNPGGPDNDFGIKYNLANGAPAPEKVTNSMFERSRNLTHYK
                     ITRGMPKLDLGKIGENQQYGNLLVDVIDPTEAYVRLMKEIFDFPLIKKFLEHAQKEYG
                     LKVLFDALNGITGPYGKAIFVDELGLSEDSLQNFVPKPDFGGLHPDPNLTYAHTLVSR
                     VDRENIAFGAASDGDGDRNMIYGAGPAFVSPGDSVAIIAEYASEIPYFIKNGIHGLAR
                     SFPTSGAIDLVAKEKNLDCYEVPTGWKFFCNLFDSKKLSICGEESFGTGSDHVREKDG
                     LWAIVAWLNVLAIYHRRHPDREPSIKTIQEEFWAKYGRTFFTRYDFEECDTEDANKVI
                     ELLRTFAENPAVVGQPFPAWHEVSVSAAGDFSYTDLDGSVSEHQGLYIKLSNGTRYVV
                     RLSGTGSSGATIRLYVERYTNDPAYYAQTADQFLAPDIKAVLKFLRFKDLIGTEEPTV
                     RT"
     gene            <345964..>348132
                     /locus_tag="AGOS_ABL028W"
                     /old_locus_tag="ABL028W"
                     /db_xref="GeneID:4619011"
     mRNA            <345964..>348132
                     /locus_tag="AGOS_ABL028W"
                     /old_locus_tag="ABL028W"
                     /product="ABL028Wp"
                     /transcript_id="NM_208272.2"
                     /db_xref="GeneID:4619011"
     CDS             345964..348132
                     /locus_tag="AGOS_ABL028W"
                     /old_locus_tag="ABL028W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL126W (YPK1) and YMR104C (YPK2)"
                     /codon_start=1
                     /product="ABL028Wp"
                     /protein_id="NP_982919.2"
                     /db_xref="GeneID:4619011"
                     /translation="MTMYGWKLTNKLKFGRSKEEKDKDREKERDSRHNSGSKHGVFGH
                     LSKRLSGTEEQVRGRTEEANTGAGTPRTSKDRKETIVATPNSIAPVRLSTDVAAPGWP
                     NGEVQSSVPSSFRDAGSETTDVGDEERAGTSSGSVVPEQANHSSASVSEERGEASMVN
                     STGIMTIKVYNGNSFKLPFALTSNPQILGKLLSSGVNAISRTGRSSVDELISSVEQVT
                     LSEDEDKLLPGDAATNYIPATIKLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPV
                     FNKISTFDVTRKLPYLKVNVFVRIPSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDV
                     QLDSFQLPLNLQFNSATSIRLYNHQWLNMEKGLGRVNITIDYKPSKNKPLSIDDFDLL
                     KVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIV
                     PLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNV
                     IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSK
                     VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCR
                     DPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTREK
                     PVDSVVNDFLSESVQQQFGGWTYVGSEQLGSSIIPGKNIR"
     gene            <348512..>350389
                     /locus_tag="AGOS_ABL027W"
                     /old_locus_tag="ABL027W"
                     /db_xref="GeneID:4619012"
     mRNA            <348512..>350389
                     /locus_tag="AGOS_ABL027W"
                     /old_locus_tag="ABL027W"
                     /product="ABL027Wp"
                     /transcript_id="NM_208273.1"
                     /db_xref="GeneID:4619012"
     CDS             348512..350389
                     /locus_tag="AGOS_ABL027W"
                     /old_locus_tag="ABL027W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL125W (RRN3)"
                     /codon_start=1
                     /product="ABL027Wp"
                     /protein_id="NP_982920.1"
                     /db_xref="GeneID:4619012"
                     /translation="MMSIEKVQKRSSSQDLPLSSDKGEGKKRKVEFADGLVHSRHRNE
                     LADEQPQDFSTKLYKGYIRDALDDLETSKDTGKLDTIANQLSLSASSPDRISAENFAI
                     LLEMLGNNITKIDNKRGVAIVRAVLNFEKWWDLPPLTLGNYVFFLQILCSSIPKWWQD
                     VSMLLISNFRLPVDKTTKHHEILKYFLRAIPSSSNFIDSYIAKYFPNKNDSKKNLVNY
                     ISNVLTLTEYCEELRFQAWSMIIEKIIAVDVELQNELDELDDDVDEEIDDKLADSDDG
                     EDELPGDDDAAEASTHSADDTSFDSEDEQLEGNEEYNIEVTRNIKELSKKLDVILSML
                     TTRLSDALTPETLESGEGVNTFNTLVSLFKSHILPTYYTRSVQYLMFHVSQQQPQLMD
                     AFLVTLIDIAFSPNETMEKKIKSLQYLGSFIARAKKLTHTQITFVASYLTSWLNRYVL
                     EREEEVDLPGGMDRFKHFYAAFQALCYIFCFRHALFRDGNAWECDIDAFFQRTVISKF
                     NPLKYCNENVMLMFARIAQHEGIVYCFSIIENNNNERLRGIMGKSSERSDGLASATGA
                     ASTWSLAARQQFIDLQSYFPYDPLFLKQYKNLMRDYYIEWSEISADYESDDSNEFTDA
                     A"
     gene            <350992..>352434
                     /locus_tag="AGOS_ABL026W"
                     /old_locus_tag="ABL026W"
                     /db_xref="GeneID:4619013"
     mRNA            <350992..>352434
                     /locus_tag="AGOS_ABL026W"
                     /old_locus_tag="ABL026W"
                     /product="ABL026Wp"
                     /transcript_id="NM_208274.2"
                     /db_xref="GeneID:4619013"
     CDS             350992..352434
                     /locus_tag="AGOS_ABL026W"
                     /old_locus_tag="ABL026W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL124W (SSH4)"
                     /codon_start=1
                     /product="ABL026Wp"
                     /protein_id="NP_982921.2"
                     /db_xref="GeneID:4619013"
                     /translation="MAGYLTFCHNEDEREYSEEVGGAHGLARRKRDSDLYRSPFLNLG
                     QANVEELAELELLELPRMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDR
                     GIQAYYLLPSINDNVDRRGNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAV
                     YFEVKVYKFRNYLASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYAS
                     TLLPKLQEGDVVGLGYRYRTGTVFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTY
                     TKEGLLDDIDNVELRKQIQDLEADQKRDITEVMNEQLLRPHDPRTRHINSDEIELQVN
                     LGGVGFVFVEANVKKYAFGSLYGEIGIPPAYNGDETKTDVILQKGDDLPPKYPEDELN
                     FFGNIKVNLGNGSSTESTSMYNRQGSSGSVAPPPATERPRSLQNVPYALQGLLDDIEE
                     RSVYEPLLPKGPRPAKSGHKRKKRKRRAPA"
     gene            complement(<352554..>352967)
                     /locus_tag="AGOS_ABL025C"
                     /old_locus_tag="ABL025C"
                     /db_xref="GeneID:4619014"
     mRNA            complement(<352554..>352967)
                     /locus_tag="AGOS_ABL025C"
                     /old_locus_tag="ABL025C"
                     /product="ABL025Cp"
                     /transcript_id="NM_208275.2"
                     /db_xref="GeneID:4619014"
     CDS             complement(352554..352967)
                     /locus_tag="AGOS_ABL025C"
                     /old_locus_tag="ABL025C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL122C (SRP21)"
                     /codon_start=1
                     /product="ABL025Cp"
                     /protein_id="NP_982922.2"
                     /db_xref="GeneID:4619014"
                     /translation="MSVKPVDSFIKDSLQLLCANPSQTLVSFRYRGGSAEGSAAEVRF
                     RTHNSHLGLHYKFKTRRQKDVSRVLSALGPRGVNVVAVGTERRKRKQASRDLVGMATL
                     LVNADVKQHVPEPAAAAAAAGSSRAKKSKKKGKKR"
     gene            <353689..>355893
                     /locus_tag="AGOS_ABL024W"
                     /old_locus_tag="ABL024W"
                     /db_xref="GeneID:4619015"
     mRNA            <353689..>355893
                     /locus_tag="AGOS_ABL024W"
                     /old_locus_tag="ABL024W"
                     /product="ABL024Wp"
                     /transcript_id="NM_208276.2"
                     /db_xref="GeneID:4619015"
     CDS             353689..355893
                     /locus_tag="AGOS_ABL024W"
                     /old_locus_tag="ABL024W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR102C and YKL121W (DGR2)"
                     /codon_start=1
                     /product="ABL024Wp"
                     /protein_id="NP_982923.1"
                     /db_xref="GeneID:4619015"
                     /translation="MVGRRKMGAEARRSGDSGGSGGSGEPQTATSGEKRELGGVGLLD
                     WGADTILRRFAAEPEYIKVLARKKGARCFRRLFVAQELQPPVDSPLHANHSSQSLGQA
                     APAGDKARSVWLLRFSKDGKYLASGGKGRQLCVWKVIASPMERWNLLPVYGGDKHHSN
                     TLSLLNQQLLKYSGKRTEAVPAPGPERKEIPFDLEQQYAPVFHPDPHRVFGEHLQDIL
                     DCDWSKNSFLLTASMDKTVKLWHINRTTSLKTFVHPDFVTCVRFHPHDDRFFFSGCLD
                     HTVRTWSILEGEVAEAFNCGDLIMALDVSPDGNWLLIGTFNGYVHVLHTNGLKLLHSF
                     HLLQKPNETENRPRHGPKITGVEFIRHKAYPWLGLLITSNDSRVRLFDMSTTRLLEIF
                     RGFSNESSRISAHHLEMEDGESVVLSASENHWLYTWMLHHEEYMYSHSDLDNARTVPS
                     PIDGKDPKKHSIRNIFRRSISFNSDILSESNPVARHHFPLFHHKAQHKGGCVKNSEYI
                     TFHAHHNPVTAATIAPKETTHVLSLSDDIICELNMKFGGEALEHLRTKSIREPGSPAG
                     RSDHKRNHSAEKNYSQSTAKQNVGTIIVSAAATGQIRVFRTDVSSSVRAKALEAIRAA
                     HGLPGSPERPLKPVLSALAHPLSAGVAKGKHICGDNRSAPSTTCPRCAPSAVNGQQDE
                     SASTAEQSTSSPKPTCDVCGGQKLSVVGKKTALQKTKSLYCLECGNHINRFK"
     gene            <355982..>356905
                     /locus_tag="AGOS_ABL023W"
                     /old_locus_tag="ABL023W"
                     /db_xref="GeneID:4619016"
     mRNA            <355982..>356905
                     /locus_tag="AGOS_ABL023W"
                     /old_locus_tag="ABL023W"
                     /product="ABL023Wp"
                     /transcript_id="NM_208277.2"
                     /db_xref="GeneID:4619016"
     CDS             355982..356905
                     /locus_tag="AGOS_ABL023W"
                     /old_locus_tag="ABL023W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL120W (OAC1)"
                     /codon_start=1
                     /product="ABL023Wp"
                     /protein_id="NP_982924.2"
                     /db_xref="GeneID:4619016"
                     /translation="MSPSTDTPVSKLGSFAAAGAAACVAVTFTNPIETVKTRLQLQGE
                     LVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALG
                     GCVLSDRRTYGTAALAVNATAGAAAGMIGAALGSPLQLVKTRMQALAHGGAPLPAAWP
                     TLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLAS
                     ALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLR
                     IAPHTILCLTLMEQALRVVRLVENRLPQIRP"
     gene            <357025..>358230
                     /locus_tag="AGOS_ABL022W"
                     /old_locus_tag="ABL022W"
                     /db_xref="GeneID:4619017"
     mRNA            <357025..>358230
                     /locus_tag="AGOS_ABL022W"
                     /old_locus_tag="ABL022W"
                     /product="ABL022Wp"
                     /transcript_id="NM_208278.2"
                     /db_xref="GeneID:4619017"
     CDS             357025..358230
                     /locus_tag="AGOS_ABL022W"
                     /old_locus_tag="ABL022W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR101C (SRT1)"
                     /codon_start=1
                     /product="ABL022Wp"
                     /protein_id="NP_982925.2"
                     /db_xref="GeneID:4619017"
                     /translation="MVQKGTHKNNDSFPSTAHTSMVEVKNTEAATAAGGAQKQADQVI
                     QLEWHDPIEEAAQELDAARVAANSEPTLRARVKRLVRGEWKQTYRNRPKISHILFQFG
                     LLRMVVNFVQNLLLKILQMGPLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVALMRT
                     LHTCKRAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGAR
                     LLVVGDRALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLVRLCQA
                     GALDSKDISTEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSYIEFSNCM
                     WPDFTFRTFFTILLKWSFVTALHEARKQERLRRKLGTYARSLLARRARPVRLEALPPP
                     PQAISVTDR"
     gene            complement(<358273..>358992)
                     /locus_tag="AGOS_ABL021C"
                     /old_locus_tag="ABL021C"
                     /db_xref="GeneID:4619018"
     mRNA            complement(<358273..>358992)
                     /locus_tag="AGOS_ABL021C"
                     /old_locus_tag="ABL021C"
                     /product="ABL021Cp"
                     /transcript_id="NM_208279.2"
                     /db_xref="GeneID:4619018"
     CDS             complement(358273..358992)
                     /locus_tag="AGOS_ABL021C"
                     /old_locus_tag="ABL021C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL119C (VPH2)"
                     /codon_start=1
                     /product="ABL021Cp"
                     /protein_id="NP_982926.2"
                     /db_xref="GeneID:4619018"
                     /translation="MDLPPSIACSCTGGRSFRHSNKQPSYTKLNGAKCENTPAQGHTM
                     FQLELSGPLRDKLLQAGGGAAAAEVKVAAARGWVTFGSLVVLCERGAATARETQALLG
                     SLQLRPRAARSSNYSDEFRAQQQRLRAAAAEDEYRALTGGMQQEQQRHGFGSAAREVR
                     EQLAAVANVVLTVVGVAYGVWWVARAAGVGAEARVLLALGCGLTALVADVAMYNVYHR
                     KVGEARRRERRLHEQRRVVTS"
     gene            <359097..>360929
                     /locus_tag="AGOS_ABL020W"
                     /old_locus_tag="ABL020W"
                     /db_xref="GeneID:4619019"
     mRNA            <359097..>360929
                     /locus_tag="AGOS_ABL020W"
                     /old_locus_tag="ABL020W"
                     /product="ABL020Wp"
                     /transcript_id="NM_208280.1"
                     /db_xref="GeneID:4619019"
     CDS             359097..360929
                     /locus_tag="AGOS_ABL020W"
                     /old_locus_tag="ABL020W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR100W (MUB1)"
                     /codon_start=1
                     /product="ABL020Wp"
                     /protein_id="NP_982927.1"
                     /db_xref="GeneID:4619019"
                     /translation="MRELNHRSVLSNRASFIISQTVYDRRALDNVADLPLINSLNHLT
                     FLTSSSAKVRETMSEDGALERLVSILHDCYLTLHDLCIGLHVGFRMGTVDSIVRQRKM
                     AMVAWKWTLAFQCLVLTGTRGTQEIRKQVAHSGVIPIIATVLDNYMIYHKNFDFFRDE
                     PIEFDFKSIASGNIFQLQPEEMESFFQKMDKSHPNLRLCINMERFKILVGEDIPSLLD
                     DPAKVNMHNCVPPITRLDTDFQSLWEGTLGLKSDEHPLSDVVLSIPREFFLGRVIPKL
                     DDITWSVQLLAFLTKCTATKPYLQKVSLVESISFRPILERAKERYTLLSNSLPPLNFT
                     DLSLVDDDDQRTSSSKPKVPIVIDPFLMEINAICEESNNKKQAKKSVNFSMLGLTDFT
                     KLKKADTTDVWRAFRMYDEVQMKKRFSYKWDYDKVSRELDEETWNKIINRETLNLFAL
                     VERYTVKIENDANITYWSSVVMRNSCRKHEATGVRQCANFFCGKWEDHPKQFPKCRRC
                     KRTKYCSCECQLQSWAYHRYWCHDVGSVFTGTSSTANTTGTHTPNAVGQSAGTTTTTT
                     TAATEVDQSILMTARGNVVDPQGIANQSAGEFVDTSENPPIGGA"
     gene            <361561..>362856
                     /locus_tag="AGOS_ABL019W"
                     /old_locus_tag="ABL019W"
                     /db_xref="GeneID:4619020"
     mRNA            <361561..>362856
                     /locus_tag="AGOS_ABL019W"
                     /old_locus_tag="ABL019W"
                     /product="ABL019Wp"
                     /transcript_id="NM_208281.2"
                     /db_xref="GeneID:4619020"
     CDS             361561..362856
                     /locus_tag="AGOS_ABL019W"
                     /old_locus_tag="ABL019W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YGR110W (CLD1)"
                     /codon_start=1
                     /product="ABL019Wp"
                     /protein_id="NP_982928.2"
                     /db_xref="GeneID:4619020"
                     /translation="MRSHRTGTHLLNTLKALHRRNFGDQVQAPRKDGRHIHTVRKPTP
                     PTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIG
                     KIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLL
                     DDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRN
                     MVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMKKQPPWWFIKLWDRNVSP
                     FSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLL
                     SFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHDWMDKEGGQRASSYITDR
                     IGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQSMMQT"
     gene            complement(<363480..>365573)
                     /locus_tag="AGOS_ABL018C"
                     /old_locus_tag="ABL018C"
                     /db_xref="GeneID:4619021"
     mRNA            complement(<363480..>365573)
                     /locus_tag="AGOS_ABL018C"
                     /old_locus_tag="ABL018C"
                     /product="ABL018Cp"
                     /transcript_id="NM_208282.1"
                     /db_xref="GeneID:4619021"
     CDS             complement(363480..365573)
                     /locus_tag="AGOS_ABL018C"
                     /old_locus_tag="ABL018C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR317W (FAA1) and YMR246W (FAA4)"
                     /codon_start=1
                     /product="ABL018Cp"
                     /protein_id="NP_982929.1"
                     /db_xref="GeneID:4619021"
                     /translation="MKSASVIVGEPAGPHETAPRRNSKCPDAVVERPLGFSCNTVYEF
                     ALEAMERGGRQRAMGWRETVEIHEDRKMVTKVVDGKETEVEKTWLYYEMGPYQYVTYD
                     QLHVEMHDYGRGMVKMGLQPGGEDRLHIFGATSHRWMRTFLAAQSQAITVVTAYDTLG
                     ESGLIYSLQQTGSKAIFVDNNLLEKLVKPVQEIPDLKYVIHADPLDPEDKRYGGRMYS
                     DAQKAIDRMKEVRPDIEVYSMDEVVELGSLCRDSIFVHRPRKKDLACIMYTSGSTGDP
                     KGVSLTHANIVAGIGGVSVVINRAIVKPDDRVIAFLPLAHIFELVFELTCLYWGALIG
                     YGSVKTLSEASVRNCKGDMKEFRPSVMVGVAAVWEGVRKAIVAQVTKLPPFKQKIFWA
                     AYHTKLRMKKCHIPGGDLIGSMIFKKVRETTGGNLRYILNGGSPLSRDTQVFISNLIC
                     PVLIGYGLTETVANGCIVPPHHFKYGVVGDILGSLTVKLVDVEELGYLAKNNQGELWV
                     KGPAVFKDYLQNEAETAAALEDGWFKTGDIAEWTKKGQLRLIDRKKNLVKTLNGEYIA
                     LEKLECIYRSNKYVANICVYADQTKVKPIAIVVPNVNAVTDLAISLGLIKDGCEVRDV
                     YDSKKLKKVILDDMHKTAKGQGLGGIELILGFVIFDDEWTPQNGYVTSAQKLQRRKIL
                     SAVQSEVDALYAANS"
     gene            complement(<365938..>366921)
                     /locus_tag="AGOS_ABL017C"
                     /old_locus_tag="ABL017C"
                     /db_xref="GeneID:4619022"
     mRNA            complement(<365938..>366921)
                     /locus_tag="AGOS_ABL017C"
                     /old_locus_tag="ABL017C"
                     /product="ABL017Cp"
                     /transcript_id="NM_208283.2"
                     /db_xref="GeneID:4619022"
     CDS             complement(365938..366921)
                     /locus_tag="AGOS_ABL017C"
                     /old_locus_tag="ABL017C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR234W (RNH1)"
                     /codon_start=1
                     /product="ABL017Cp"
                     /protein_id="NP_982930.2"
                     /db_xref="GeneID:4619022"
                     /translation="MRPKRPASKFYAVHRGRQPGVFRDWPACRDQVTGVRGARWAAFR
                     TLHDAEQFVRSGKRAAPAAPAAPAAPAAPAAPAAGRAFYGVHSSNPAVPSAVFDTWAA
                     CQAHVHRQRGVAFRKFPTRELAQNFAHGTAAHDWALLGSSPAEFARAHKLPPPPAPFS
                     ARSVVYCDGSALANGSARATAGIGVYFRDEPHLSLSEPLTLPPYTNNRAELLAASRAL
                     ELIWRNLAAVPAAAPRALYVLRTDSEYVVRLLSALYRAYDSPAALAAVSNGDLAVPLV
                     QNYLRVKHWYLLNTACFHPPAEFALEWVRGHDNEPGNEEADRLAREAAASV"
     gene            complement(<367023..>371009)
                     /locus_tag="AGOS_ABL016C"
                     /old_locus_tag="ABL016C"
                     /db_xref="GeneID:4619023"
     mRNA            complement(<367023..>371009)
                     /locus_tag="AGOS_ABL016C"
                     /old_locus_tag="ABL016C"
                     /product="ABL016Cp"
                     /transcript_id="NM_208284.2"
                     /db_xref="GeneID:4619023"
     CDS             complement(367023..371009)
                     /locus_tag="AGOS_ABL016C"
                     /old_locus_tag="ABL016C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR296W"
                     /codon_start=1
                     /product="ABL016Cp"
                     /protein_id="NP_982931.2"
                     /db_xref="GeneID:4619023"
                     /translation="MRLREASGGSSRRSDERVKSFLPSVEESYKPDVSKAELYQSLLK
                     VVLLEYINEPRFRRQYQRLNDVETGELFPRERQPVRSRDDRKRATWFWPNGELESTEG
                     NALKKVRPILEGRLSDIAIGKYKIRSDFLRRSLLKLYNDLYLDPNMSNLLENMGRFEE
                     LIMLFAKAASGEMMKLDVEDTQKELYQQVSQFIDILIDLLARCEVSTPEFVSKLRSYT
                     DSFKPEDGEGSIRSRSSQGVPAVGGNCIEVTVKPAFTVSEISHSVYIMELFGVDEKQF
                     MADVLHLKDGIKNDYYQYELDAIKHSIKSNGGFTADDFPTKELYEQWKEYELHAIDDL
                     INRLEENKARHNESLSKKAGVKVIPANSRGMLVKLLCILLEREQPSQTSPLSSDAQFL
                     ISKCARYWRLDYFSTRVSLFYTAYNLTLLDDGEMLKDDIEHLVQAAQSKGAQVSDTEF
                     NSTNWNAVDRHQWLINLNHTFISCMNVLHLMLSGIYSKPKPKFSPVLNIYYNYVKTDP
                     LMIQYNFPETDFYGKWMKQLKRCLTHTSEDYYASLVKQAKKEPFGMYSIQDIAEGIVQ
                     QLKIIQKRYPKPLLDEINITRTCAVVTIQKFLADLPEFINDAEQNALAENTEVLPAVA
                     LEAYRAIQELKDIWVQLKPKDLSFNTAVHDPFYKYLERLCADTCVRVHEVIHNSLKEE
                     TWEPIDESHHYSSSVLDIFKMMNESVQIFEKLQWENEYEIAKTKTRLLKSFSDGLCQY
                     AAKVLAIIEEDLSQADSALHSDDNSYENLITLQGTAERMKNTWLFNEMRNALMPALAE
                     PPETYEFKQRTCVCLNNLSEMMQKINDLEETVNAEKISDTISKHQVKVEDKKDRSDKA
                     VPQLYTIRIVKAENILSFNSDGSSNSAVTLVDTSVQREIAKTKVVRKTVNPMWDELFE
                     LVVPAGEARMISATVWHHSAKINPVSSYKVCGKCSLLLDPTVYRSDGYPQETNLDLDT
                     QGRLILQVSLESERFDAMFCVGRAHRALSRACDRAIGLMVSKFTAFVNFSLSRAALKT
                     VVSSTTASAPGGAGTKTNVVYDAILPLFDYLNSNLAILATELTRSLLHKVMLQAWNTI
                     LHSADALLLPNLSCARSRKKVMSSKSMTLWENAMSMAKGDSSDSAAAAATIPGFGSAL
                     TPREIDVVFDWLRALCVDFFHNGGEGPPLHDLKNQHYQNLLLVPVFYDKAADELQAEV
                     ERLMPFYEQYLDRRNYFDFGRHTASRPALPKGSLARKDSVWAHSSRRKRAQVAAAVRQ
                     LEHDPLEVAAVTQDILLRILLLRGRAAYVQDTLSRRAELAKAIATRKLVRAAVQGRGA
                     PLRKPDRT"
     gene            complement(<371207..>371876)
                     /locus_tag="AGOS_ABL015C"
                     /old_locus_tag="ABL015C"
                     /db_xref="GeneID:4619024"
     mRNA            complement(join(<371207..371812,371868..>371876))
                     /locus_tag="AGOS_ABL015C"
                     /old_locus_tag="ABL015C"
                     /product="ABL015Cp"
                     /transcript_id="NM_208285.2"
                     /db_xref="GeneID:4619024"
     CDS             complement(join(371207..371812,371868..371876))
                     /locus_tag="AGOS_ABL015C"
                     /old_locus_tag="ABL015C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR233W (TRI1) and YOR295W (UAF30); 1-intron"
                     /codon_start=1
                     /product="ABL015Cp"
                     /protein_id="NP_982932.2"
                     /db_xref="GeneID:4619024"
                     /translation="MIDAILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILE
                     RFDLLRDRQSKVLSQEELVQRDSEMAAALVRGDAGRAKRPRKRDADKPRKKRANQSDN
                     PNSFHMRPVQLSEPLQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAME
                     PVFGKKMTMFSMNKILSQHLTNPKDVSGSDQDANTEEHSDQLSA"
     gene            complement(<372109..>372726)
                     /locus_tag="AGOS_ABL014C"
                     /old_locus_tag="ABL014C"
                     /db_xref="GeneID:4619025"
     mRNA            complement(<372109..>372726)
                     /locus_tag="AGOS_ABL014C"
                     /old_locus_tag="ABL014C"
                     /product="ABL014Cp"
                     /transcript_id="NM_208286.2"
                     /db_xref="GeneID:4619025"
     CDS             complement(372109..372726)
                     /locus_tag="AGOS_ABL014C"
                     /old_locus_tag="ABL014C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR294W (RRS1)"
                     /codon_start=1
                     /product="ABL014Cp"
                     /protein_id="NP_982933.2"
                     /db_xref="GeneID:4619025"
                     /translation="MSSSSAEKSELPVTVEKPIPVTYDLGNLAVFDSNALDRNDLDSS
                     NANREEHLRALTRDNVQLLINQILSLPIKSTTDSTGSGQSSSIALVRLPEPTTDLPRE
                     KPLPKPKAPTKWELFAAKKNIKPKEKSGKMVYDEAAGEWVPKWGYKGANKKLDDQWLV
                     EVDDKVKGTEDELIDPRTLSRAERKKLIKKNELQHKRNLKNAVSK"
     gene            complement(<372922..>374889)
                     /locus_tag="AGOS_ABL013C"
                     /old_locus_tag="ABL013C"
                     /db_xref="GeneID:4619026"
     mRNA            complement(<372922..>374889)
                     /locus_tag="AGOS_ABL013C"
                     /old_locus_tag="ABL013C"
                     /product="ABL013Cp"
                     /transcript_id="NM_208287.2"
                     /db_xref="GeneID:4619026"
     CDS             complement(372922..374889)
                     /locus_tag="AGOS_ABL013C"
                     /old_locus_tag="ABL013C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR232W (FUS2)"
                     /codon_start=1
                     /product="ABL013Cp"
                     /protein_id="NP_982934.2"
                     /db_xref="GeneID:4619026"
                     /translation="MIKSKNSIYQLAYPATGEMTPIRDYAAECQLQNRNLQQGKVRRN
                     PYSESLWEALGENKRTIQRINTQVRNRHRPRSLKLEQEADIPVRKKVDSPLNLRTFGD
                     YMTLKSPKVDPKLLNTLDVVKRLVQTEREYIKKLELGNSVYRFELQAKKVGSMLLDKE
                     RNDELLLFGDLETLASVSKILVKQLEEKIAEAYGGDKGDSDQILKELRVHPDKLRAFI
                     ERLDIGTVLEHHFERIKYLYLTYSVNHQKQLELLQQIRRKHSTIYFKWYDRCLQKADL
                     IKLEDILKLPVERLRTWGAITEQVLLYTEGISSDLATAQLSDFYDQYCVYLRGVSTSE
                     RECNCEAKANLELTPTQIIHFYECSVDPEVSAIDIKRKKSQSTALSVNTGTSSAYSEP
                     NVLPSNKISDCKSPDSDYADLDRSICQFFSVRKGLQDLLVELEQLDLAEIICQQLANA
                     KTWHRLMDFEPHNENCNNSIYISSIYTAFIDKLNHQREEISVLRVKHLKKGVIDPLLV
                     LLARTDSVRGKIDDLKVLSKEYKAYMKQRDYHDIKKKVMAQSFEDAQALLAKELPQFM
                     AFMHKSISYLLLRYHSLVLEYLKILCGGEKLLKKELTFFEESERELGDNFDILQMFSS
                     SRFYTKQAVRGNWQFPGIPSASRVLRKLFEL"
     gene            complement(<375050..>378115)
                     /locus_tag="AGOS_ABL012C"
                     /old_locus_tag="ABL012C"
                     /db_xref="GeneID:4619027"
     mRNA            complement(<375050..>378115)
                     /locus_tag="AGOS_ABL012C"
                     /old_locus_tag="ABL012C"
                     /product="ABL012Cp"
                     /transcript_id="NM_208288.2"
                     /db_xref="GeneID:4619027"
     CDS             complement(375050..378115)
                     /locus_tag="AGOS_ABL012C"
                     /old_locus_tag="ABL012C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR231W (PEP5)"
                     /codon_start=1
                     /product="ABL012Cp"
                     /protein_id="NP_982935.2"
                     /db_xref="GeneID:4619027"
                     /translation="MSFNSQRQFQLFEITPIRDPNFGTDTPLYSDPTLSAVTPLGNGT
                     IAIAVRSVYIQTIDLKTPASLAEFKAYGDDYQITYLEYVKDGMLVSVGECVGKPTSIK
                     IWNLGKTPKDAFDFHSTCEVRNGNNTFPVSAISLSQDLSCIVLGFVNGRIILVRGDLY
                     RDRGSRQRIIYEDLNNEPITALFLNNDYSVTFASTTSRIMLFRTTGRNNGEPERVLNA
                     NTGIDLNCSCFNPERDELLCCLDKSVEFYKATGEKHSLLVEVPMKKRIFLIDNDHILL
                     LSSVSTPNSTALQLSSTGTITKKVLILDLKNQLIAMNHLLASNIVHIYSDTVDGVYSV
                     YLVTTDGVINRITEKPVDKQIKLITQRELYPIALQLAEQRSVSPLRIQEIRRQYGDAL
                     YKKNMKEEAVEQYIQCLDITETSEIISRFGIQKTSRPDDSRNLATYLWSMIKQKLSHS
                     DHVTLLLAILIKLKDVDGIDYFISHFSRNGEFVEEGEDESSWSVDDETFFYSDIVLMD
                     LDTILQLLKDSELDAQAFSLVHKFSKDPIQVVDVILNTLDDPHSALKYIKSLHVDDTL
                     RVLIEFSKVLLEKLPNDTNALLIDVFTGRYQRSTKCEVNIREKKQTISRNNPVFHSYK
                     AFVTYMYSTAGGVPNSEDIQEPTYHPPKPSLVFTSFIDRPFQFVVFLEACLESYNKFQ
                     GFLRDKQEILTTLYDIYLSLAATDEAHNEDWRTKATAVYKESEKLAGTCRSPQAPKAS
                     NTQFDNSLMMLISHINNVDLYSVEGDASGTEDLSVNKANLTNTFRSMCLTKEAKKCMN
                     FLEKYGSVEPELYRMALGFFLSSKQVYDSIGGAPVFKARVLDKVIEMDLLQPLDILFV
                     LSSTSVATFGLVRDFLINHIKAQQRETHNNEKLIQSYQGELQEKEMQLKTLLSESEPL
                     QVKVKNNFCKMCHTLLDLPVIFFKCGHIYHQRCLPEDSISDGNGSPHYRCPNCAVDIE
                     ASENLIKPKKDNDTKASLLQAALSSEDSSGDRFKVVSEFIGKGGLEFGT"
     gene            complement(<378259..>380361)
                     /locus_tag="AGOS_ABL011C"
                     /old_locus_tag="ABL011C"
                     /db_xref="GeneID:4619028"
     mRNA            complement(<378259..>380361)
                     /locus_tag="AGOS_ABL011C"
                     /old_locus_tag="ABL011C"
                     /product="ABL011Cp"
                     /transcript_id="NM_208289.2"
                     /db_xref="GeneID:4619028"
     CDS             complement(378259..380361)
                     /locus_tag="AGOS_ABL011C"
                     /old_locus_tag="ABL011C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR362W (STE11)"
                     /codon_start=1
                     /product="ABL011Cp"
                     /protein_id="NP_982936.2"
                     /db_xref="GeneID:4619028"
                     /translation="MATVGASVEQFLQDINCEGYLGAFRKYEISSVDQLQHLDHEILE
                     QVGIRSIGDRIRILNKSRTLQAGRDKGLLEELQQVIGKINALSAGPMAISEELVTDRH
                     SVIFILNDGSAKKVNVNGCFNADSIKKKLIKRLPPEFVAVAQNGEETSSQDYDVFVVD
                     YAKNVLHLLYDVELVTICHSSDRVEKNRLIFVSKDQTPSDKAILTSKKLYLKTMSAIH
                     QLGSLPTMLQTQGATTVGNYATPGAEAPAGDEDSLRIDNSKESLRRIFNQRPPSELIS
                     TNLPEYFPHTDFKRLQKTLRSSFRQSVRMSMLRPGAPLPEGNNVGNILVNQNQAVDRA
                     LLQSLDGTKTSSRSSGRSSVDGDASSMGSERRTNASKSTTLDGRDSDAGGRIELLNSE
                     SESECDDDNIVSLPTKVVTPKSWLKGARIGSGSFGSVYLGMNAQTGELMAVKQVELQP
                     TTVMAPSDDKKSQPSSNAVVKNSQIHRKMVDALQHEMNLLKELHHENIVTYYGSSQEG
                     GNLNIFLEYVPGGSVSSMLNSYGPFEEPLVKNFTRQTLVGLTYLHRKNIIHRDIKGAN
                     LLIDIKGSVKITDFGISKKLSPLNKKQNKRASLQGSVYWMAPEVVKQVVTTEKADIWS
                     VGCVVVEMFTGKHPFPDFSQMQAIFKIGTNTIPELPSWASDGAKAFLYQTFELDYKKR
                     PSSVELLQHKWLDTTTML"
     gene            <380482..>380961
                     /locus_tag="AGOS_ABL010W"
                     /old_locus_tag="ABL010W"
                     /db_xref="GeneID:4619029"
     mRNA            <380482..>380961
                     /locus_tag="AGOS_ABL010W"
                     /old_locus_tag="ABL010W"
                     /product="ABL010Wp"
                     /transcript_id="NM_208290.1"
                     /db_xref="GeneID:4619029"
     CDS             380482..380961
                     /locus_tag="AGOS_ABL010W"
                     /old_locus_tag="ABL010W"
                     /note="NOHBY202; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B13123g"
                     /codon_start=1
                     /product="ABL010Wp"
                     /protein_id="NP_982937.1"
                     /db_xref="GeneID:4619029"
                     /translation="MARGLLTSDGCTRSAAQGRHPCSFLPNEVSRPITRPLPLSANSH
                     DSDTMPDTAKDEVPDRVLFQRGGRTLEVHGARFMRPHTVVKPWEQKSHAPAEDASSSL
                     LQAGGHRPAPAGAAGHATDSEKEASGRAGRKDTSEGQGGDVSPRAARSQPRGGSAEH"
     gene            <381099..>382808
                     /locus_tag="AGOS_ABL009W"
                     /old_locus_tag="ABL009W"
                     /db_xref="GeneID:4619030"
     mRNA            <381099..>382808
                     /locus_tag="AGOS_ABL009W"
                     /old_locus_tag="ABL009W"
                     /product="ABL009Wp"
                     /transcript_id="NM_208291.2"
                     /db_xref="GeneID:4619030"
     CDS             381099..382808
                     /locus_tag="AGOS_ABL009W"
                     /old_locus_tag="ABL009W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR361C (DCR2)"
                     /codon_start=1
                     /product="ABL009Wp"
                     /protein_id="NP_982938.2"
                     /db_xref="GeneID:4619030"
                     /translation="MAAYLPRKVIRNAVLLVNVVFLLLLCYLLFWLGSDVLQREQHGG
                     GAKITRKPVMPPELAPELAPIAEESLVVNLGKLHCFHLWGLPEACWAFQRVFRRTAFD
                     MVAQRTWVPKNLIVSRAASRFGRSEYLYYDWITVGQLAEMSQEGLPPGSRGIVDISAR
                     KLENSVSVGRLYVATEPWDLAQVGRGRYVSAVTALFGEDCVEPRINWRRDDTPYRNNG
                     GMPVYVDVARAQVNSVQEKPRLRVDPDGKFKVVQLADLHLVPGKGECRDEFPPTENCE
                     ADVKTMKFVNDVLDIERPDMVVYTGDQITGDLCDNDAETPLLKAFAPAIQRRIPFAVI
                     WGNHDDAGSLNRLQLSQYVEALPFSLFKIGPRDTMDRSFGMGNYVHQVLGENGHPEIT
                     FYFVDTHSYAPNPRGRRVYDWVKEEQWQYFEDCHAKLEHTELSLAFLHIPLPEYLDVK
                     SKKDPQKYNQFLGTFREGVTAPRHNSGGAERLARLGVSAVTAGHDHCNDYCLQTDFRD
                     IDPKIWMCYGGAAGEGGYGGYGGTERRIRIFEIDTREKRIETWKRLNSSPNDKFDAHL
                     IYP"
     gene            complement(<382795..>384058)
                     /locus_tag="AGOS_ABL008C"
                     /old_locus_tag="ABL008C"
                     /db_xref="GeneID:4619031"
     mRNA            complement(join(<382795..383970,384020..>384058))
                     /locus_tag="AGOS_ABL008C"
                     /old_locus_tag="ABL008C"
                     /product="ABL008Cp"
                     /transcript_id="NM_208292.2"
                     /db_xref="GeneID:4619031"
     CDS             complement(join(382795..383970,384020..384058))
                     /locus_tag="AGOS_ABL008C"
                     /old_locus_tag="ABL008C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR360W (VPS38); 1-intron"
                     /codon_start=1
                     /product="ABL008Cp"
                     /protein_id="NP_982939.2"
                     /db_xref="GeneID:4619031"
                     /translation="MATMSSPQPYLLHRRLRHLRSISVCNASLVRGDTGLDMRWRLFP
                     CFVVVEDTHGRVQYVSEVQEGRHSVVRFNELPVLEAAESQVVLRLVGQLPEPEFAGEW
                     AEVARQQVDLNALHYVGHVELVDGLRELNVPVLEFADGHFAAARVPGRLADGAPGKFP
                     ARRSFSFNALLKLNKILEYMSQVEKESQQLVRQAEALLGQSESKQLGPGLDSAFGELE
                     VQRKRKLAQLSALQDHACRLQANPDDEESFDSDYGSMYSELIQKKQRVHLLQERKLQR
                     LIEIFTNTSLFSSPYVVVRTSTDSSPYDISLGKLELQTILDVDDRISINTILGYYLLF
                     LDILAGKICYIPLPHRLAYYGSTSIIDNKFPLYLPTSSTQHHLDRFSEAVHLFNINII
                     QVRQFLNNLKDK"
     gene            <384268..>384993
                     /locus_tag="AGOS_ABL007W"
                     /old_locus_tag="ABL007W"
                     /db_xref="GeneID:4619032"
     mRNA            <384268..>384993
                     /locus_tag="AGOS_ABL007W"
                     /old_locus_tag="ABL007W"
                     /product="ABL007Wp"
                     /transcript_id="NM_208293.1"
                     /db_xref="GeneID:4619032"
     CDS             384268..384993
                     /locus_tag="AGOS_ABL007W"
                     /old_locus_tag="ABL007W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR057C (LST7)"
                     /codon_start=1
                     /product="ABL007Wp"
                     /protein_id="NP_982940.1"
                     /db_xref="GeneID:4619032"
                     /translation="MSSLLVSLTHFCDKHGPKLLVVTQCAKSAEECEKLLLPNYPSDS
                     YCDSCHISFPTDQESKSIRSTIGERYYVSTHYSAVRYQYLTALVKKIFSEETVSYDGS
                     PLLFYDHARGLNLAMGFKLEDPHARGNERRYCLVLTVDLRERAPAMEIVSQHWKFISG
                     AFENMIEYIKQQRRAELLRVMQQGQVQGTSNFSSMVSGTYLRGNNLKIPKNITELTND
                     RLLFVRIHKWNAFILDRLGGQLD"
     gene            complement(<385128..>386576)
                     /locus_tag="AGOS_ABL006C"
                     /old_locus_tag="ABL006C"
                     /db_xref="GeneID:4619033"
     mRNA            complement(<385128..>386576)
                     /locus_tag="AGOS_ABL006C"
                     /old_locus_tag="ABL006C"
                     /product="ABL006Cp"
                     /transcript_id="NM_208294.2"
                     /db_xref="GeneID:4619033"
     CDS             complement(385128..386576)
                     /locus_tag="AGOS_ABL006C"
                     /old_locus_tag="ABL006C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR359W (ADE13)"
                     /codon_start=1
                     /product="ABL006Cp"
                     /protein_id="NP_982941.2"
                     /db_xref="GeneID:4619033"
                     /translation="MSEFDKYATPLSSRYASEEMSSLFSLRHRFSTWRKLWLNLAIAE
                     KELGLSVITDEAIAQMREHLTITDEEIAQAAKQEAIVRHDVMAQVHTFGETCPAAAGI
                     IHLGATSCFVTDNADLIFMRDAYDIIIPKLVNVINRLSKFACEYKDLPVLGWTHFQPA
                     QLTTLGKRATLWIQELLWDLRNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDRVEA
                     LDKRVTELLGFDIVYPVTGQTYSRKIDIDILAPLSSFAATAHKMATDIRLLANLKEVE
                     EPFEKTQIGSSAMAYKRNPMRCERVCSLARHLGSLFNDAVQTASVQWFERTLDDSAIR
                     RISLPSAFLTADILLSTLLNISSGMVVYPKVIERRIKSELPFMATENVIMAMVEKGAS
                     RQEVHEAIRVLSHQAAAVVKEEGGDNDLIERIKADAFFQPIWNELDSLLDPSTFVGRA
                     PQQVEKFINNDVKSALAPFSEHITDAAFNLNV"
     gene            complement(<386882..>389431)
                     /locus_tag="AGOS_ABL005C"
                     /old_locus_tag="ABL005C"
                     /db_xref="GeneID:4619034"
     mRNA            complement(<386882..>389431)
                     /locus_tag="AGOS_ABL005C"
                     /old_locus_tag="ABL005C"
                     /product="ABL005Cp"
                     /transcript_id="NM_208295.2"
                     /db_xref="GeneID:4619034"
     CDS             complement(386882..389431)
                     /locus_tag="AGOS_ABL005C"
                     /old_locus_tag="ABL005C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR357W (RSC2) and YGR056W (RSC1)"
                     /codon_start=1
                     /product="ABL005Cp"
                     /protein_id="NP_982942.2"
                     /db_xref="GeneID:4619034"
                     /translation="MLLRDQLKVLLDGVFDLKEENGIEILPIFYTLPLRKDYPDYYRI
                     IKKPLSLATVKKKLNHYKRAQEFVNDLVRITWNARMYNTKESEIYHYAQIMDRYVREV
                     VIPRIEREMGPVKYPYLGPLPDEQPLPGALLERDDDETGAKDDSLLPETVDEEKDATA
                     DEEEPEASMVPEYDDDEEYTEEKRRLPKLRIPVMITPTPSAVSKSTTPQPSFQRHQAQ
                     KTHMRRGRPPVIDLPYEQRIKNVLKNLKRETLSGSREFLTLHFDRLPDEEREPQYYTV
                     ISNPLSLDDIRKRVKQRKYKDFLAFQQDVGLMLNNYRMYHRSQPQEMRRAAEFEAKFT
                     DFAKYELSRPDEDFMTDGELKYPLDHIELHDKTYKIGDWILLHNPNDETKPTVAQIFR
                     LWHTNDGRRWLNCCWYLRPEQTVHRVDRLFYKNEVVKSGQYRDHLVEEIIGKCYVCHF
                     TRYQRGDPDLMLEGPLFVCEYRYNESEKVFNKIRTWKGCLPEEVRDIEEPTIPVIGRK
                     FFKYESPIKHLLPPNATINDPIPQPTEGAVNAPPLVGAVYLRPKIKKDDLGEYSTSDD
                     CPRYIIRPGDPPEVGRIDPETGTIITNSQTASVLPKMNMSTPRLSSLNRNGSYSNLIG
                     RSGSPINMTRSTQYFPPVPNGDLRNLPIVQQIPNSTIPSAQSSAKGGIQGTMGGSING
                     TTPAYQPPSIINNLAAQAKTNNTVLGNILVDTPGAYVLPISITKNVEVLQRTDYNNQV
                     RRLGKEQVPKKRKNKGEVLWFKGASVVCYERLLNTGGDTDVPLNRWFKKKRKLDYEEV
                     DEEVGDGTQVENGSNDEYDSQDEHTELPGTFPMGLRPSAKYMSYKIASGRC"
     gene            <389708..>390667
                     /locus_tag="AGOS_ABL004W"
                     /old_locus_tag="ABL004W"
                     /db_xref="GeneID:4619035"
     mRNA            <389708..>390667
                     /locus_tag="AGOS_ABL004W"
                     /old_locus_tag="ABL004W"
                     /product="ABL004Wp"
                     /transcript_id="NM_208296.1"
                     /db_xref="GeneID:4619035"
     CDS             389708..390667
                     /locus_tag="AGOS_ABL004W"
                     /old_locus_tag="ABL004W"
                     /note="NOHBY201; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0B04928g"
                     /codon_start=1
                     /product="ABL004Wp"
                     /protein_id="NP_982943.1"
                     /db_xref="GeneID:4619035"
                     /translation="MASQEEQLASFQRCLQGARKILCIVGAGLSASSGLTTFQAAHGE
                     WRGHSALELATPEAFQENPELVWVFYSARRYTAMKARPNNGHFALAELCRRVAADERR
                     EILLVTQNVDGLHWRAGQPEASTVELHGSVFDYRCTEFLCSYRGRNVRDHFLTAGLRA
                     HTPRELPRPAAAEEPENKRAKHACEGTPETLRSRLDMLRGDLPRCPRCRVGLLRPGVV
                     WCGESLSLVQMDRVDAFLSAKQKVDLVLVIGTSGRLWPAMGYVERAQLCGSRIAFFNT
                     DIEDAAGVAKNKRMWAFQGNAAELLPQALEPVIGRHYKPRGWS"
     gene            complement(<390859..>392544)
                     /locus_tag="AGOS_ABL003C"
                     /old_locus_tag="ABL003C"
                     /db_xref="GeneID:4619036"
     mRNA            complement(<390859..>392544)
                     /locus_tag="AGOS_ABL003C"
                     /old_locus_tag="ABL003C"
                     /product="ABL003Cp"
                     /transcript_id="NM_208297.1"
                     /db_xref="GeneID:4619036"
     CDS             complement(390859..392544)
                     /locus_tag="AGOS_ABL003C"
                     /old_locus_tag="ABL003C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR055W (MUP1)"
                     /codon_start=1
                     /product="ABL003Cp"
                     /protein_id="NP_982944.1"
                     /db_xref="GeneID:4619036"
                     /translation="MSQGTIFSQLKIRKKRQEVAFFESNADANDVEAGEHFITELDKG
                     DKRLGLFSSIGLICNRMLGTGIFVVPAKIFQLTGSVYFALGLWVLGALIALAGLYVYM
                     EFGTAIPRNGGEKNYLEFIFKKPKFFITSMYSAYVIFLGWAAGNSVMAAAMFLDAGKV
                     EATRWRERGLGVAVIFFCFLVNSLSVKAGLYFQNILGVFKIGTIIFIAITGLVALGGH
                     IDGAPGTENFRHSPSDLSPSAYTIVNALYQVIWSFVGYSNVNYALGEVKNPVRTLKIA
                     GPSSLAVLGTLYLLVNVAFFAVVPMEILKDAGMNLTPKFFDIAFGDKARRASAIFIGL
                     SALGNVCSVIFSQGRIVQQLGREGVLPFTSFFASSKPFNSPMAGLFQHMIICAITILA
                     PPPGDAYDFVLNLISYPMNIINFILACGLIWIYWQRRQSKLEWNPPIRAGYFVTSFFL
                     IANLYLIVAPYVPPPSGSSVYKSLPYYIHCVVTWAIFAVGSIYWLIWSRLLPKWNNYE
                     LVHSEVLGEDGFWRNKIVKKYAGEDSVSTPDGGSDSTLKEGFSGIGVKQSIVQ"
     gene            complement(<393175..>394971)
                     /locus_tag="AGOS_ABL002C"
                     /old_locus_tag="ABL002C"
                     /db_xref="GeneID:4619037"
     mRNA            complement(<393175..>394971)
                     /locus_tag="AGOS_ABL002C"
                     /old_locus_tag="ABL002C"
                     /product="ABL002Cp"
                     /transcript_id="NM_208298.1"
                     /db_xref="GeneID:4619037"
     CDS             complement(393175..394971)
                     /locus_tag="AGOS_ABL002C"
                     /old_locus_tag="ABL002C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR002W (PAP1)"
                     /codon_start=1
                     /product="ABL002Cp"
                     /protein_id="NP_982945.1"
                     /db_xref="GeneID:4619037"
                     /translation="MSQQKVYGVTGPISKEGPTAAENKLNDELIQELKKEGTFESEEE
                     TAKRIKVLEELQALAQEFVFKVSRKRNMSEGMARDAGGKIFTFGSYRLGVHGPGSDID
                     TLVVVPKHVTRDDFFTVFDELLRARPELDEIAPVPEAFVPIIKIKYSGISIDLICARL
                     DIPQVPLNLTLSDKNLLRNLDEKDLRALNGTRVTDEILELVPKPTAFKIALRAIKLWA
                     QRRAVYANVFGFPGGVAWAMLVARICQLYPNACSAVIVARFFHILTRWSWPQPVLLKP
                     IEDGPLQVRVWNPKIYANDRLHKMPVITPAYPSMCSTHNICESTKKVILNELQRGVEV
                     TTDIFTNKKTWGDLFQKHDFFYKYKFYLTVMASTKGSDEQHLKWSGLVESKLRLLVLK
                     LEVLSGINLAHPYTKPFESTYAYKTEEQYKEIFDNYGTHKTEDVLKKYTEVTNENKDD
                     ESLKGMEKVHITTMYIGLNIAVDEKKKIDIHVPCQEFFNLCRSFQEYEDTETFSLVIK
                     YVKLYDLPDHVYDEGEQRPVKASKKRKNEKAGKKAKRPKSSSVLAADAEDSTMADGST
                     VSEEPQPPLSNTTAPSTNTGAELSVAAGGAST"
     gene            <395827..>397884
                     /locus_tag="AGOS_ABL001W"
                     /old_locus_tag="ABL001W"
                     /db_xref="GeneID:4619038"
     mRNA            <395827..>397884
                     /locus_tag="AGOS_ABL001W"
                     /old_locus_tag="ABL001W"
                     /product="ABL001Wp"
                     /transcript_id="NM_208299.1"
                     /db_xref="GeneID:4619038"
     CDS             395827..397884
                     /locus_tag="AGOS_ABL001W"
                     /old_locus_tag="ABL001W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR001C (VPS1)"
                     /codon_start=1
                     /product="ABL001Wp"
                     /protein_id="NP_982946.1"
                     /db_xref="GeneID:4619038"
                     /translation="MDEHLIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSS
                     VLENIVGRDFLPRGSGIVTRRPLVLQLINRRGKKGDKRNAHGDLLELDVAADQKTGQS
                     EDNAEEWGEFLHAPGKKFYNFDQIRQEIVNETEKLTGKNAGISPIPINLRIYSPHVLT
                     LTLVDLPGLTKVPVGDQPVDIESQIKNMIMQYISKPNAIILAVNAANADLANSDGLKL
                     AREVDPEGTRTIGVLTKIDLMDEGTDVVDILSGRIIPLRYGYVPVINRGQKDIESRKT
                     IREALNDEKRFFENHPSYSSNANYCGTPYLAKKLNSILLHHIRQTLPEIKNKIELSLK
                     KYQAELLALGPETLDSPNSIVLSMITDFSKEYTGILDGEAKELSSQELSGGARISFVF
                     HEIFKGGVYALDPFDQIKDSDIRTIMYNSSGAAPSLFVGTEAFEVLVKQQIQRFEDPS
                     LRLVALIFDELVRILREIISQPKYARYPGLREAISNYFIQYLKERIIPANDFVVDIIK
                     SEQTYINTAHPDLLKGSQAMAMVEERLHPKQVDPKTGKSLPPTVQHTDKGSSGIFGGF
                     FASKNKKKLTALEAPPSVLKATGQMTERETLETEVIKLLIESYFSIVKRTVADLIPKA
                     VMLKLIVKSKNDIQKILLEKLYGNQDIEELTKENDITIQRRKECHNMVQILKHASEIV
                     SSV"
     centromere      398810..399000
                     /note="Chromosome II centromere"
     centromere      398810..398817
                     /note="Chromosome II centromere CDE I element"
     centromere      398818..398983
                     /note="Chromosome II centromere CDE II element"
     centromere      398984..399000
                     /note="Chromosome II centromere CDE III element"
     gene            <399480..>400185
                     /locus_tag="AGOS_ABR001W"
                     /old_locus_tag="ABR001W"
                     /db_xref="GeneID:4619039"
     mRNA            join(<399480..399592,399651..>400185)
                     /locus_tag="AGOS_ABR001W"
                     /old_locus_tag="ABR001W"
                     /product="ABR001Wp"
                     /transcript_id="NM_208300.1"
                     /db_xref="GeneID:4619039"
     CDS             join(399480..399592,399651..400185)
                     /locus_tag="AGOS_ABR001W"
                     /old_locus_tag="ABR001W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL001C (MET14); 1-intron"
                     /codon_start=1
                     /product="ABR001Wp"
                     /protein_id="NP_982947.1"
                     /db_xref="GeneID:4619039"
                     /translation="MSTNVTWHANINYDERVSLRNQKGCTVWLTGLSASGKSTIACTL
                     EKLLLLEGISAYRLDGDNIRFGLNKDLGFTEEDRNENIRRIAEVAKLFADSCTVAIAA
                     FISPYKADREKARELHKDAGLDFIEVFIDVPIEVAENRDPKELYKKARAGIIKDFTGI
                     SAPYEAPENPDIHLRTDKETVEQCADHILQFLKKLEILQSSSACSNHSNSVETAV"
     gene            complement(<400229..>400999)
                     /locus_tag="AGOS_ABR002C"
                     /old_locus_tag="ABR002C"
                     /db_xref="GeneID:4619040"
     mRNA            complement(join(<400229..400873,400940..>400999))
                     /locus_tag="AGOS_ABR002C"
                     /old_locus_tag="ABR002C"
                     /product="ABR002Cp"
                     /transcript_id="NM_208301.1"
                     /db_xref="GeneID:4619040"
     CDS             complement(join(400229..400873,400940..400999))
                     /locus_tag="AGOS_ABR002C"
                     /old_locus_tag="ABR002C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL002W (DID4); 1-intron"
                     /codon_start=1
                     /product="ABR002Cp"
                     /protein_id="NP_982948.1"
                     /db_xref="GeneID:4619040"
                     /translation="MSLFEWAFGKSVTPQERLKKNQNALDRTQRELEREKRKLEAQEK
                     RLVQDIKKSAKNGQINAAKIQAKDLVRTKRYIEKFNGMKTQLQAISLRIQAVRSSDQM
                     AISMREATGLLSSMNRSMNLPQLQRISMEFERQNDMMDQRQEFMDEAIDDAMGDELEE
                     DEEAEEIINKVLDEIGVGLNNKLEDAPQGLVKNSAAAEARVAIPVVSNDTGGALSASS
                     NTDDELQARLNSLKRG"
     gene            <401207..>401599
                     /locus_tag="AGOS_ABR003W"
                     /old_locus_tag="ABR003W"
                     /db_xref="GeneID:4619041"
     mRNA            <401207..>401599
                     /locus_tag="AGOS_ABR003W"
                     /old_locus_tag="ABR003W"
                     /product="mitochondrial 37S ribosomal protein YmS16"
                     /transcript_id="NM_208302.1"
                     /db_xref="GeneID:4619041"
     CDS             401207..401599
                     /locus_tag="AGOS_ABR003W"
                     /old_locus_tag="ABR003W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL003C (MRP17)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS16"
                     /protein_id="NP_982949.1"
                     /db_xref="GeneID:4619041"
                     /translation="MLYELVSIARVTNPLAVHAEAKQLATTIGKLVIENRGVVRKIIP
                     IGNKLLPRIQKKDQERHFQGYHFLMLFDSSAPVQSEILRTLRSDPRVLRASIMKVDTS
                     KKLDAVSSLERAAGYGSIPEKAKGGISF"
     gene            complement(<402165..>403484)
                     /locus_tag="AGOS_ABR004C"
                     /old_locus_tag="ABR004C"
                     /db_xref="GeneID:4619042"
     mRNA            complement(<402165..>403484)
                     /locus_tag="AGOS_ABR004C"
                     /old_locus_tag="ABR004C"
                     /product="ABR004Cp"
                     /transcript_id="NM_208303.2"
                     /db_xref="GeneID:4619042"
     CDS             complement(402165..403484)
                     /locus_tag="AGOS_ABR004C"
                     /old_locus_tag="ABR004C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL004W (AUR1)"
                     /codon_start=1
                     /product="ABR004Cp"
                     /protein_id="NP_982950.2"
                     /db_xref="GeneID:4619042"
                     /translation="MKTVVLTAQQADTVDSRMPNWFERVFLAQKPPGSRLANLETSFD
                     ANLSIKRLKNHQFTLKEVCHYGFLGAVLFFVFIANPAPWLLKGCVSMLFLALFLMPAT
                     GQFFFHALPIFTWLALYFTSASFGSTYRPPITVKVLPAIETIMYGDNLSDVLAASTNK
                     CLDILAWLPYGILHFGAPFVVAAILFIFAPPTTLRGYAFAFGYINLFGVIIQNFFPAA
                     PPWYKNLYGLSAAHYGMKGSPGGLSRIDEYLGIDLYTTAFSNSAVIFGAFPSLHSGCA
                     TMEALFLAHVFPRLRLLFVFYVCWLWWSTMYLTHHYFVDLMAGSILSYVIFQYTKYCH
                     LPIVHPEYFTRWSYAEIKTFDIIQSDPLYHDSSDVEALPLAPLDTDFNFTFEMSSVDE
                     VATPTPSIFDEGAPGSASRSSANSIEVPDAEPFRANFVNKMYRQRYD"
     gene            complement(<404103..>404543)
                     /locus_tag="AGOS_ABR005C"
                     /old_locus_tag="ABR005C"
                     /db_xref="GeneID:4619043"
     mRNA            complement(<404103..>404543)
                     /locus_tag="AGOS_ABR005C"
                     /old_locus_tag="ABR005C"
                     /product="60S ribosomal protein L14"
                     /transcript_id="NM_208304.1"
                     /db_xref="GeneID:4619043"
     CDS             complement(404103..404543)
                     /locus_tag="AGOS_ABR005C"
                     /old_locus_tag="ABR005C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL001W (RPL14B) and YKL006W (RPL14A)"
                     /codon_start=1
                     /product="60S ribosomal protein L14"
                     /protein_id="NP_982951.1"
                     /db_xref="GeneID:4619043"
                     /translation="MSAESTVKASNWRLVEVGRVVLVKKGPSAGKLAAIVEIIDNKRA
                     LVDGPETGVPRQAVSLGHVVLTPLVFALPRGARTSTVSKKWAAAGVNDKWAASSWAKK
                     IAQRERRAALSDFERFQVMVLKKRRGFVLKREVATAVKVAASAE"
     gene            404973..405057
                     /locus_tag="AGOS_AgSNR87"
                     /db_xref="GeneID:9487543"
     ncRNA           404973..405057
                     /ncRNA_class="snoRNA"
                     /locus_tag="AGOS_AgSNR87"
                     /product="AgSNR87"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR87; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149434.1"
                     /db_xref="GeneID:9487543"
     gene            <405380..>405737
                     /locus_tag="AGOS_ABR006W"
                     /old_locus_tag="ABR006W"
                     /db_xref="GeneID:4619044"
     mRNA            join(<405380..405415,405480..>405737)
                     /locus_tag="AGOS_ABR006W"
                     /old_locus_tag="ABR006W"
                     /product="ABR006Wp"
                     /transcript_id="NM_208305.1"
                     /db_xref="GeneID:4619044"
     CDS             join(405380..405415,405480..405737)
                     /locus_tag="AGOS_ABR006W"
                     /old_locus_tag="ABR006W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL006C-A (SFT1); 1-intron"
                     /codon_start=1
                     /product="ABR006Wp"
                     /protein_id="NP_982952.1"
                     /db_xref="GeneID:4619044"
                     /translation="MSDDRYSQIERGNDRRLDELSNKLSTFRSLNRDIGNQAAADNTL
                     IDEIQNSFGALFVNIRNSSSRLSRAILAGNSVWKMVGLSLLILFVLYNVFKLF"
     gene            complement(<405817..>406602)
                     /locus_tag="AGOS_ABR007C"
                     /old_locus_tag="ABR007C"
                     /db_xref="GeneID:4619045"
     mRNA            complement(<405817..>406602)
                     /locus_tag="AGOS_ABR007C"
                     /old_locus_tag="ABR007C"
                     /product="ABR007Cp"
                     /transcript_id="NM_208306.1"
                     /db_xref="GeneID:4619045"
     CDS             complement(405817..406602)
                     /locus_tag="AGOS_ABR007C"
                     /old_locus_tag="ABR007C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL007W (CAP1)"
                     /codon_start=1
                     /product="ABR007Cp"
                     /protein_id="NP_982953.1"
                     /db_xref="GeneID:4619045"
                     /translation="MSKFSDIITQLLFDAPPREINSVYDSLVIITEDTDNDTLLDALK
                     RCLVAKRLPIDVEGSPTIVTEYNKDGAKYFDPFKKVLFSVDCLDRVGLDIEPHESETT
                     PYQEKLYEELQKYVAKNFPGDSACTVLPTGDDDELAIIIVSSKFSPSNYWSGYWKSEY
                     IYSPEERSLTGRIDVVVHYFEDGNVKFSTQEFIDKEDINDPISCIRALESEIETGLDE
                     SFSKLNQTQFAKLRRKLPVTRSKVNWGKAISNYRLGKDAAQGK"
     gene            complement(<406771..>408102)
                     /locus_tag="AGOS_ABR008C"
                     /old_locus_tag="ABR008C"
                     /db_xref="GeneID:4619046"
     mRNA            complement(<406771..>408102)
                     /locus_tag="AGOS_ABR008C"
                     /old_locus_tag="ABR008C"
                     /product="ABR008Cp"
                     /transcript_id="NM_208307.1"
                     /db_xref="GeneID:4619046"
     CDS             complement(406771..408102)
                     /locus_tag="AGOS_ABR008C"
                     /old_locus_tag="ABR008C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL002W (HSE1)"
                     /codon_start=1
                     /product="ABR008Cp"
                     /protein_id="NP_982954.1"
                     /db_xref="GeneID:4619046"
                     /translation="MEYKQDIETAVSRATDGKLRTDNWQYLLDVCDLVKEEPEDGAQY
                     VMEAIDERLQQADANVILRSLSLVACLSENCGSRVQQAVASKRFTGLLYYLIEDKHVH
                     ATVKREIAKVVDQLSSSFQRDPSLKGMSDLLQKIIRRYPHLVAEPKLPQKREMSADAK
                     LQEDQDLEEALKLSLQEYEQQQRHNGGQPPQQAPAALASETSLPEQPQPQIVRRVKAI
                     FDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYVGVCPEPTAEEVA
                     KEAAQEHAVFAQAGNVENLLQKLRVSQNVDVTHEDEISELYSTVTPLRPHVTKLIGKY
                     AQKKEDLASLREVLANAEATYNMMLEKATCYSSSNFMPSTQHRTYQPSGQAAPYSNYE
                     FSQPSTNVLPPRPASYSVNPQVTGLPVHQQRSVPENTEIRYRSYSGDLPHT"
     gene            <408451..>409692
                     /locus_tag="AGOS_ABR009W"
                     /old_locus_tag="ABR009W"
                     /db_xref="GeneID:4619047"
     mRNA            <408451..>409692
                     /locus_tag="AGOS_ABR009W"
                     /old_locus_tag="ABR009W"
                     /product="ABR009Wp"
                     /transcript_id="NM_208308.1"
                     /db_xref="GeneID:4619047"
     CDS             408451..409692
                     /locus_tag="AGOS_ABR009W"
                     /old_locus_tag="ABR009W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL003C (LAG1) and YKL008C (LAC1)"
                     /codon_start=1
                     /product="ABR009Wp"
                     /protein_id="NP_982955.1"
                     /db_xref="GeneID:4619047"
                     /translation="MAENSLLKPPSLSRKRSSSVGNIGLGDTKVPGLSTMSESKESKI
                     AARARLRALSGASKTDIDIYYKLWLSYRELNYRHAWLTPLIILFLIYSCYFASGNRTE
                     SNPLHMFVAISYRVGNTNMYGKGVKDMCFVFYYMVFFTFLREFMMEMVLRPLTFRLGV
                     TKPHKVKRMMEQAYSTFYYGLSGPFGLFVMYRTDLWLFKTAEMYKTYPDLTNEYYYKI
                     FYLGQAAFWAQQACILVLQLEKPRKDFRELVFHHIVTLALISLSYVFHFTKMGLAVYI
                     TMDVSDFFLALSKIFNYMESSFTAPLFLLFVSSWVYLRHYVNIKILWSVLTEFRTVGD
                     YTLNFATEQYKSWIALPIVFGLIFALHLVNLYWLALIFRILYRMLFQGVQKDERSDSE
                     SEDNEEELDDSSDETDKKKNQ"
     gene            complement(<409885..>411060)
                     /locus_tag="AGOS_ABR010C"
                     /old_locus_tag="ABR010C"
                     /db_xref="GeneID:4619048"
     mRNA            complement(<409885..>411060)
                     /locus_tag="AGOS_ABR010C"
                     /old_locus_tag="ABR010C"
                     /product="mitochondrial 37S ribosomal protein MRP4"
                     /transcript_id="NM_208309.2"
                     /db_xref="GeneID:4619048"
     CDS             complement(409885..411060)
                     /locus_tag="AGOS_ABR010C"
                     /old_locus_tag="ABR010C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL004W (MRP4)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP4"
                     /protein_id="NP_982956.2"
                     /db_xref="GeneID:4619048"
                     /translation="MSLRYSTRAAILRSIVHRHVGARLQSTVGAVPEADEPAPQSQDQ
                     HLTSPQMRGLMHELANYPVEDFEQLTKVSRPLTTKEKQLDERLEDFLRRFGVENQVLK
                     PLEENKSVAATPFTLAGGYSRYPYLAQTSADEPYSKQELFVRQMEHASHTAKLGAEIK
                     EVYFPHTDISNPPAIEKLSISKLAAAGVHLGQSTSLWRSSTQPYIYGSYKGIHIIDLN
                     QTLFHLKRAAKVVEGVAENGGLILFLGTREGQKPALRRAAERVRGCYVASKWIPGTLT
                     NPIEISSVWGRHEVDFEGNPTGRELTEEENISIIKPDLIIVLNPTENRNALREAMQAR
                     VPTIGIIDTDSEPSMVTYPVPGNDDSLRSVSLLVSILAKAGERGLANRKEKLAALSE"
     gene            <411192..>411683
                     /locus_tag="AGOS_ABR011W"
                     /old_locus_tag="ABR011W"
                     /db_xref="GeneID:4619049"
     mRNA            <411192..>411683
                     /locus_tag="AGOS_ABR011W"
                     /old_locus_tag="ABR011W"
                     /product="ABR011Wp"
                     /transcript_id="NM_208310.1"
                     /db_xref="GeneID:4619049"
     CDS             411192..411683
                     /locus_tag="AGOS_ABR011W"
                     /old_locus_tag="ABR011W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL006C (SHU1)"
                     /codon_start=1
                     /product="ABR011Wp"
                     /protein_id="NP_982957.1"
                     /db_xref="GeneID:4619049"
                     /translation="MNSRMPEAPPPPRSACQMERALLQLVVEDDAKALVFVLGQDARR
                     YFEEELPASPFEFPSPQAVANSRQNVGVMFLDKLQYLYMYLTKLEVDEAPEYRTLVVY
                     GLEQLLGAGGELDADQVRLASLIYNTAFRVRVRHGAAVRFVAHGAPHAQLQQLEAHWR
                     LFT"
     gene            complement(<411742..>412452)
                     /locus_tag="AGOS_ABR012C"
                     /old_locus_tag="ABR012C"
                     /db_xref="GeneID:4619050"
     mRNA            complement(<411742..>412452)
                     /locus_tag="AGOS_ABR012C"
                     /old_locus_tag="ABR012C"
                     /product="mRNA turnover protein MRT4"
                     /transcript_id="NM_208311.1"
                     /db_xref="GeneID:4619050"
     CDS             complement(411742..412452)
                     /locus_tag="AGOS_ABR012C"
                     /old_locus_tag="ABR012C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL009W (MRT4)"
                     /codon_start=1
                     /product="mRNA turnover protein MRT4"
                     /protein_id="NP_982958.1"
                     /db_xref="GeneID:4619050"
                     /translation="MPRSKRSKLVTLAQTEKKGRENKERIFDEVRQALDTYRYVWVLR
                     LEDVRTPVLQEIRSAWAGSKLIMGRRKVLEKALGGTRETEYKENVSGLVKQCEGMCGL
                     LFTDETPETVTAYFREYRKADYSRAKSRAPLRVEIPAGVVYSRGGQVPAEDDVPMVHS
                     LEPTLRNKFKMPTRIQNGKITLEQPYLVCEAGETLDVRQALILKQFGVAAAEFRVKLA
                     AYYDGEAAAVEEVRINME"
     gene            <412710..>416984
                     /locus_tag="AGOS_ABR013W"
                     /old_locus_tag="ABR013W"
                     /db_xref="GeneID:4619051"
     mRNA            <412710..>416984
                     /locus_tag="AGOS_ABR013W"
                     /old_locus_tag="ABR013W"
                     /product="ABR013Wp"
                     /transcript_id="NM_208312.2"
                     /db_xref="GeneID:4619051"
     CDS             412710..416984
                     /locus_tag="AGOS_ABR013W"
                     /old_locus_tag="ABR013W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL010C (UFD4)"
                     /codon_start=1
                     /product="ABR013Wp"
                     /protein_id="NP_982959.2"
                     /db_xref="GeneID:4619051"
                     /translation="MNRGDEEYDQDGDYAVSGMEDFGETQLDSQESGDDDSNAEYSYP
                     EEEGDYSNYYNEYGDEDAEEDAEEEEREDTEAVGRGPGGRPDRWVSSLQELLGTLAQG
                     LEARRAGEDGGARRVNLAEVFPEYRQMFGMGGGARGEHGRMQTLVANVVAAAEDPYVA
                     AESLREINEQLLMLNPLAAERVVPQGELLLAIIDVLRDERLQGELQLQLIACRCLYNM
                     FEMNPEMVSSAVEKDVIPTLRKKLAEISYIDLAEQVLETLEYISRLLGKEILESGSLV
                     ECLQYVDFFTVHAQRKATTIVANSCARAKACDFKNIEAFFPLLKGVLVNNKDQVILTK
                     MLNALYSICGALGASSRAELESLIDLEIIRRVVGVVSSSDIDLDGKLRSIDILSQLAT
                     TSPKIRKQIIDSCDLSSMLWGCFSEYKKNSTSSLHETLMFVPKQLLASISRFLALLLP
                     IEEEQVLSIDHRDDPQAVAISEEYITLVGQLMPFLIEIYLNTVDFDIRRYILISLARI
                     ASIMSSNSSYVDKQLIGLLSSSITQNKSAYEQDKGDKLVTGGLLIGLLSVSTIMIAKC
                     SQNVLPALRREGTFEILRSLYSYLQQTHDPKGIDEGSEPFDISEDPDDGDDVTHSTSG
                     ISSDEDDYDMEFGEVDVPDQVKPKKIKFAVFRPLTTQYVEKKLWQLCQTLVEGLSSND
                     ESVINELREIEELVSFLHSVDRSEDSPEYWTRTWTAVRDMIFRDNFTISGFEFISTGL
                     SDGICRLIKLHPSKSSSCRTAFIQVFSDRLELLVKTLQSALTKLESFEIIDCGTTESR
                     AASLGKQMKLKLEYIGDLKKDNIPPMMSSLMVNIHCISSYKTLNEFLKHRVAQSRFLN
                     SILPLSNSIAASDDVKTMNFQFQAGDEIISSSETIFGSIFKYMSNAKRSPTQIWSEVQ
                     VIKYKRVYEENDDPDITRLYPEHVFDSEELKPIDGILDLLSCCYNIVEDSSLFVNPKL
                     TVKLSRQLEEPLIVASGALPRWALHITRHYFFLFPLDVRMFFLQNTSFGYGRLIQLWK
                     ERTENEKYSSSDDQLQQLGRPTRHKLRISRENMFLSALKILSKYGSSPSVLEIEYQDE
                     VGIGMGPTLEFYASVSKEFARKSLGMWHGSSVPGDDFLDGLLFPAPLSPKRNGAKIYE
                     LFTHLGTFVARSMLDNRILDFRFNRVFFDLMHTAARREELDFAHPAKLLESLRLIDPQ
                     LAKSLAFVREPRNWPDLESMALSFTVPGYDFDLVEGGANTPVTAANAELYVARVLDAF
                     LGSGVRQQLRAFMEGFSRAFPYSSLLVLTPDELSELYGRVEEDWSVETLYSYITADHG
                     YSMDSPTLHDLIAVMAAFDQHHRRLFLQFLTGSPKLPVGGFKNLKPHLTVVLKHPEGD
                     LSPDQYLPSVMTCANYLKLPKYSSREVLRARIVHAIHEGSGAFLLS"
     gene            <417699..>420611
                     /locus_tag="AGOS_ABR014W"
                     /old_locus_tag="ABR014W"
                     /db_xref="GeneID:4619052"
     mRNA            <417699..>420611
                     /locus_tag="AGOS_ABR014W"
                     /old_locus_tag="ABR014W"
                     /product="ABR014Wp"
                     /transcript_id="NM_208313.2"
                     /db_xref="GeneID:4619052"
     CDS             417699..420611
                     /locus_tag="AGOS_ABR014W"
                     /old_locus_tag="ABR014W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL007C (STE20)"
                     /codon_start=1
                     /product="ABR014Wp"
                     /protein_id="NP_982960.2"
                     /db_xref="GeneID:4619052"
                     /translation="MSKVSGANETLQGALAPLSHMGGGGDATLLKDEGQVELPRGPGV
                     LNVQVLPEEGHAHLQDLEGYKSMDPRQSESASTDVSEMLQHTASLDDPIQFTRVSTSS
                     VTSNSSSDPRESGDTQETGSRRGCSTEEQAPAGAERVSGQDQDSWDVEEVVAEPRSGI
                     DVTPVGDVTNSTIRASGRSAESTSHYLDEYSDTRYSSSSPSSGSRKLSTTIITPEKNV
                     VAQALHCYADNYESPLNDLMSSGDERSSSVRETSFENASSDTNANLNGGRASTGESMR
                     SPPPATGLPNGFVHTQASAPALPVLPAKSPFRAVQSPFSGTRKSRNSANLAELSLPRT
                     STSSASSMEQRKSRGGRMKVVLSSFVQNIRRNSQGEKRRSGTAMKISTPYNATHVHHV
                     GVDSRTGEYTGLPEEWERLLASSGISKKEQQQHPQAVMDIVKFYQDVTGTSGEDKVFK
                     TFNVSSTNACELSSSPSFKTPSLSSITRFEGSHEAYNSAYHSPMLQSPMGFHDPQHDE
                     KFIPSRPAPRPPGGAAPKTDFTSPLAYDSQSATATPKNQRFSNQSSGFFSLARKATLN
                     KNKQQLPPIPSAAAASAPITQPGSTANIPYIKPAENPVSAPSKSIPPSLPAVPTPPPP
                     IEKDPPLRDLEREREREHSSAKQGQLALERKREEKRRRNQKLQAKLAEICSPGDPSKI
                     YRNLVKIGQGASGGVYTAYEIGTNASVAIKQMNLEKQPKKELIINEILVMKGSRHNNI
                     VNFIDSYLLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIAAVSRETLRGLHFLHSKGV
                     IHRDIKSDNILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVVSRKEYGP
                     KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDADSLSPVLKRFLSWC
                     LQVSPNDRATAMELLYDKFIVEVAEANASLAPLVKLARMKKLAEKMDADSDDNRTD"
     gene            complement(<420842..>422560)
                     /locus_tag="AGOS_ABR015C"
                     /old_locus_tag="ABR015C"
                     /db_xref="GeneID:4619053"
     mRNA            complement(<420842..>422560)
                     /locus_tag="AGOS_ABR015C"
                     /old_locus_tag="ABR015C"
                     /product="ABR015Cp"
                     /transcript_id="NM_208314.2"
                     /db_xref="GeneID:4619053"
     CDS             complement(420842..422560)
                     /locus_tag="AGOS_ABR015C"
                     /old_locus_tag="ABR015C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL089W (MIF2)"
                     /codon_start=1
                     /product="ABR015Cp"
                     /protein_id="NP_982961.1"
                     /db_xref="GeneID:4619053"
                     /translation="MDYMNLGITSRKTGLRVKQSIRRDEHSMENVDDFFAEDDESTVS
                     SRRQSRRTSLLSDLKPHLSGAGAAHLFLDEDGFRIPSSAPQPRKQAAWSQRRQTETEL
                     DEYPPLDPGLPPIEDAFEEEPVAAGKYTGNGTPPYGTKYATRYDIPREEDSDVEESTI
                     RLTPTKPTDDDYRDVPGLVDDNETTRDNTSFNTSEHALLEDEMEDDYEVDSADEEDGE
                     YVDAVSRAEDSSASEHDDSDDSSASDADDAGLSRQNQRSKNGYMGDSDSEVLDSDEEY
                     IQQQAKQLLPSGLDGGRSTGIRRSKRVRVPPLDYWRNEKVVYKRKSDKPVLEIDKIIT
                     YDQEEEEDEEEVRPKKKNPKTKARPYNYIPTGRPRGRPRKNAPQPATNNNEPNRDLLL
                     KLENGEISNGEWLKHGILKGTVNISADKKGNEIVAFAPGLSQSEQVQESEDEKFTLAV
                     MFDKYREMFASGMLILPVDGMKSVSDSYNAFITFYVVQGIVEVTLSENKFICTEGSSF
                     QVPAFNTYAFQNAGHNEAKLFFVQVTVPENFDGSNGAAVDLQETSSRRTTGHSLSSSD
                     MSLTTP"
     gene            complement(<422768..>424075)
                     /locus_tag="AGOS_ABR016C"
                     /old_locus_tag="ABR016C"
                     /db_xref="GeneID:4619054"
     mRNA            complement(<422768..>424075)
                     /locus_tag="AGOS_ABR016C"
                     /old_locus_tag="ABR016C"
                     /product="ABR016Cp"
                     /transcript_id="NM_208315.2"
                     /db_xref="GeneID:4619054"
     CDS             complement(422768..424075)
                     /locus_tag="AGOS_ABR016C"
                     /old_locus_tag="ABR016C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL090W (CUE2)"
                     /codon_start=1
                     /product="ABR016Cp"
                     /protein_id="NP_982962.2"
                     /db_xref="GeneID:4619054"
                     /translation="MSPDEAVQFLQELFPDRTASVLAQVLRNANGDVDTACAMLVERE
                     QATAGKAEQGRQWNLASLMEMFPKISSADIEQTYDACDGDTDLAAMSLLNFQGLSGED
                     ARMQAEYERIVRQQPDVAGRPDSWQDLRRKVADIVKYTGVKEGQAKAAFFKNSCNAPA
                     AVADIISSGVARSESTEQQSPVPAAVAVPGGRVQARAGLAHTVTYSSRPRPPAEAHAA
                     SDGLAMQRARYVYSPGSPEAIELAELVRANIQLASLSRELLQSALEYYAGDVTRTIET
                     AAFIIGARPALREPKRRPATTRKVSQPRRPKRPAPPELRNSLFSSTEAYNRALELARA
                     VHSSWRIDLHGFLVDDAEALSEYVLASWWQRERELRELHCQRMSQSLALNMPPLTVVT
                     GRGLHSVGGVSRVRVRIQRLLDKQHYVYDEEPSYFIVKGRRPK"
     gene            complement(<424355..>425044)
                     /locus_tag="AGOS_ABR017C"
                     /old_locus_tag="ABR017C"
                     /db_xref="GeneID:4619055"
     mRNA            complement(<424355..>425044)
                     /locus_tag="AGOS_ABR017C"
                     /old_locus_tag="ABR017C"
                     /product="ABR017Cp"
                     /transcript_id="NM_208316.2"
                     /db_xref="GeneID:4619055"
     CDS             complement(424355..425044)
                     /locus_tag="AGOS_ABR017C"
                     /old_locus_tag="ABR017C"
                     /note="NOHBY211; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B13673g"
                     /codon_start=1
                     /product="ABR017Cp"
                     /protein_id="NP_982963.2"
                     /db_xref="GeneID:4619055"
                     /translation="MGKKLHLKKAQQHPGEPFFPSELHQFLDRAPRESFLPGVECMLD
                     DKVILVRKFFTAAVCEQLIAHFSRPNVLELFHQRGSRDYAERLNDRASVTDSETALKL
                     WRKLHAVLAQDPHVMQDLRFSGAKGLNPQLRLYRYQKGHHFGKHYDESVSVPGAGRTQ
                     WTVLIYLSGGDSLEGGDTVFYKYHERGHEAVHPMPGLALLHKHGDDCLLHEAQMVMRG
                     VKWVLRSDIIF"
     gene            complement(<425326..>426174)
                     /locus_tag="AGOS_ABR018C"
                     /old_locus_tag="ABR018C"
                     /db_xref="GeneID:4619056"
     mRNA            complement(<425326..>426174)
                     /locus_tag="AGOS_ABR018C"
                     /old_locus_tag="ABR018C"
                     /product="ABR018Cp"
                     /transcript_id="NM_208317.1"
                     /db_xref="GeneID:4619056"
     CDS             complement(425326..426174)
                     /locus_tag="AGOS_ABR018C"
                     /old_locus_tag="ABR018C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL009C (YAP3)"
                     /codon_start=1
                     /product="ABR018Cp"
                     /protein_id="NP_982964.1"
                     /db_xref="GeneID:4619056"
                     /translation="MRPEEQQHYFYNTGPDIRDPLGVPAALMHTEPGIRWPPQAEEHG
                     MQAQVLSFNDGMCNYPMGAPPETAGYPQDVTPSTGSSSTPPGSSLGSQNHRQFVSPYS
                     QDGMLDSLDLIEKKKAQNRAAQKAFRERKEARLRELEQKLKESEQNRDALFREVEQLK
                     RENQVINNENRMLLQRTTNNPSAGAAEGPEKFTFPAKDTAISDPTEGGQKQGIQYFAG
                     GKKLLTVPATWEYLHKISLQRDIDVYYIMQLLKGAEVCHGFGPAYPRELIDSLVGECL
                     NEDRKS"
     gene            complement(426590..426664)
                     /locus_tag="AGOS_t0033"
                     /db_xref="GeneID:4619057"
     tRNA            complement(426590..426664)
                     /locus_tag="AGOS_t0033"
                     /product="tRNA-Val"
                     /codon_recognized="GUU"
                     /db_xref="GeneID:4619057"
     gene            complement(<427033..>429225)
                     /locus_tag="AGOS_ABR019C"
                     /old_locus_tag="ABR019C"
                     /db_xref="GeneID:4618997"
     mRNA            complement(<427033..>429225)
                     /locus_tag="AGOS_ABR019C"
                     /old_locus_tag="ABR019C"
                     /product="ABR019Cp"
                     /transcript_id="NM_208318.1"
                     /db_xref="GeneID:4618997"
     CDS             complement(427033..429225)
                     /locus_tag="AGOS_ABR019C"
                     /old_locus_tag="ABR019C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR078C (CTF18)"
                     /codon_start=1
                     /product="ABR019Cp"
                     /protein_id="NP_982965.1"
                     /db_xref="GeneID:4618997"
                     /translation="MRAGARSDRGCGDGEDAVAVGPPGLAAGSLGAGGLFGGGSGDEQ
                     EHSGAAAAAQERYFVSSSGQVGVLREQAAMERQTVEWTADESYGVDINALLDRIEGAA
                     EGAQRAARAPGRVPQALWAEKWRPQRFVDLVGNESNNRKVMRWLRQWSALVFGEALPG
                     RASANAAAEQPEDPLQRPQKRILLLHGPPGIGKTSVAHVLARQAGYAVMELNASDERG
                     GTRLREKVRNCLFNDTFNSQPVCLVADEIDGSAENGLIRTLVDIVNADARATSELLGR
                     LEHGKRKRARHKYSGKVLVRPIVAICNNVYARALEDLRPHCQIVAFRPPGELALLERL
                     ELVCEKEGVPADKKTLKQMAELSQGDIRNALNNLQFMSVTDGTGSPASGRRKDTGVPW
                     FKLCNKLFRNNPHAESRAQFQELLSEVELSSSYEKVADGCFQLYPAVKFSDMRLQKPG
                     AISDWLYFFDRMSASLYEHNGELLRYCPMAIMEFFVLFSDIANRQDQVIKSMEYEVRE
                     KGRRHSAMVAATRKGMHPDSQIFTSTEALLLETLPYLDIMLSPDLTAIHDQLTRQKIM
                     DNIVPLLHQFGLQLHHIKDTDYRNLLAIQPPFNELVALDPKRSRETASKRPHVLNILL
                     AKLEEEKAKKRTVRKVRHAEEDLEVLRRNTPATPADFFKNQYTRLNAANVPVVPAAAP
                     GAPPASTAEGPVRRGASPPEPELKIWVKYKEGFSNAVRKNVKWGTLWQ"
     gene            <429593..>430616
                     /locus_tag="AGOS_ABR020W"
                     /old_locus_tag="ABR020W"
                     /db_xref="GeneID:4619058"
     mRNA            join(<429593..429601,429699..>430616)
                     /locus_tag="AGOS_ABR020W"
                     /old_locus_tag="ABR020W"
                     /product="ABR020Wp"
                     /transcript_id="NM_208319.2"
                     /db_xref="GeneID:4619058"
     CDS             join(429593..429601,429699..430616)
                     /locus_tag="AGOS_ABR020W"
                     /old_locus_tag="ABR020W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR079W (SEC14) and YKL091C; 1-intron"
                     /codon_start=1
                     /product="ABR020Wp"
                     /protein_id="NP_982966.2"
                     /db_xref="GeneID:4619058"
                     /translation="MPTEEELLASYPSKCAAGSLAGTPGNLTSEHEAALEELRKVLKQ
                     AGFTKRLDDSTLLRFLRARKFDVAAARAMFENCEKWRKENGVDTIFEDFHYEEKPLVA
                     KFYPQYYHKTDKDGRPVYIEELGAVNLTEMYKITTQERMLKNLIWEYESFSRYRLPAS
                     SRQADCLVETSCTILDLKGISISAAAQVLSYVREASNIGQNYYPERMGKFYMINAPFG
                     FSAAFRLFKPFLDPVTVSKIFILGSSYQKELLKQIPAENLPVKFGGQSDVSEAEGGLY
                     LSDIGPWRNPKYIGPEGEAPKAFSMSPKPESA"
     gene            <431173..>434418
                     /locus_tag="AGOS_ABR021W"
                     /old_locus_tag="ABR021W"
                     /db_xref="GeneID:4619059"
     mRNA            <431173..>434418
                     /locus_tag="AGOS_ABR021W"
                     /old_locus_tag="ABR021W"
                     /product="ABR021Wp"
                     /transcript_id="NM_208320.2"
                     /db_xref="GeneID:4619059"
     CDS             431173..434418
                     /locus_tag="AGOS_ABR021W"
                     /old_locus_tag="ABR021W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL092C (BUD2)"
                     /codon_start=1
                     /product="ABR021Wp"
                     /protein_id="NP_982967.2"
                     /db_xref="GeneID:4619059"
                     /translation="MRPDISKPVAIGKPLQINTDFSAPNTPSSGSSEASQSRHDGAVV
                     SRGAIIERIRQQRGTFCGEVQWCSNLSLDDWRTHFLEITERGVLTHALDRDSVANLQS
                     TVQRQESLMGRAPSASAMASQNSRAPIIKHLQACSLRLLNNHHGPFPILEVGTYHNKI
                     YLRIREQRTFLDMFSSLLFWKSLQSTGVFSKFSVVAPIFKAIPEPTNLLVCQFKIYGP
                     LPRNKHVPLLSMKRPPLPDNVAHSPEEGWFAAMGMLGSDGVLDLLLQSDGSLLYSIDI
                     KRLLRSEIQIMDSSILQKDTFMFIGILPELRKQLGISSKDSMFISRMRTGTVPRLFLQ
                     FPLRIDLEDWYVALHSFAMLEVLSLIGTDKSNELRVSNRFKVNILEADLRMLEMERKR
                     KRSMTEHSDGEQAKPNTYSFYATVSIWNQQVARTSIVSGKYTPFWREEFDFNFSVKAN
                     NMRVSIRESTGDNTDYSDNDTLLGYIEISQDMINDTELNKETRLPIFAIDNKSFQLGT
                     ICIKLASSLNFVLPSINFSKFESVLKEFDLQVMTNYVYDTAIADDLKLDGISNVFLDV
                     FQAIGRENDWFQALIEKELAKFDKSILTNNQNSAPSTHIYNSLFRGNSILSKSIEKYF
                     NRIGQEYLDKSIGGIIRRIVAEEDMCELDPARIKEPDEIKKRVILETNQAKLISWAKE
                     IWHIIYKTSNDLPDAIKVQLTHIRKKLEIVCGDSNLKTVLNCISGFLFLRFFCPVLLN
                     PKLFHIVEDHPDEQKRRLFTLLTKVLMNLSTLTMFGPKEPWMNNMNHFIQEHKDELVD
                     YIDKVTQRKLDFNNKILKLSNTVARPKLDMNKEIMRELATNPYLIERYLRETELVNAF
                     VTYRHKISSLNRLDLKPVTMDQISRELQSLPISPTDTPNLRIGELEFEKITENNVEVF
                     GQDMLKYLDNDDSSIKKQGRALTPEDNADLTMRLEQESDLLFHKIKHLTTVLSDYEYP
                     SDIILGKSEYATFLVESVYYDSQRSLSLDCDNMFAKRDGFTKLFQNAQTVNAFFSPVK
                     DAESLNAFIKSIESTTPVEDSQENKNMKGKLTRNSPARNTKLSRWFKKVSF"
     gene            complement(<434620..>437619)
                     /locus_tag="AGOS_ABR022C"
                     /old_locus_tag="ABR022C"
                     /db_xref="GeneID:4619060"
     mRNA            complement(<434620..>437619)
                     /locus_tag="AGOS_ABR022C"
                     /old_locus_tag="ABR022C"
                     /product="ABR022Cp"
                     /transcript_id="NM_208321.4"
                     /db_xref="GeneID:4619060"
     CDS             complement(434620..437619)
                     /locus_tag="AGOS_ABR022C"
                     /old_locus_tag="ABR022C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR080C (NAM7)"
                     /codon_start=1
                     /product="ABR022Cp"
                     /protein_id="NP_982968.4"
                     /db_xref="GeneID:4619060"
                     /translation="MAASLENGAKETTPAISNSGSQGLLAQDGGSDRELDFYYNSDGE
                     LIKLVADDEKPEEDLGNLVSVAEHACSYCSIDSPSCVVKCNACNKWFCNSKNGTSSSH
                     IINHLVFSHHNVVSLHPESDLGDTVLECYNCGCRNVFLLGFVSAKSEAVVVILCRLPC
                     AQTRNVNWDTDQWQSLIENRQLLSWVAEEPSEEDQLKACLITPSQISKLEMKWRSNKD
                     ATINDIDLPEEQEELPPVLMRYTDAYQYQRSFGPLVKLEADYDKQLKESQALEHISVT
                     WTLGLNNRHLASFALSTFESNELKVAVGDEMILRYSGLQQAEWEGRGYILRLPNSFQD
                     EFTLELKPSKAPPPTNLTTGFTAEFVWKGTSYQRMQEALKKFAVDKKSISGYLYYKIL
                     GHDVPDIEFEVDLPKDFSIPNFTKLNTSQVNAVAHVLQRPLSLIQGPPGTGKTVTSAT
                     IVYHLSKMHKERVLVCAPSNVAVDHLAAKLRDMGLKVVRLTAKSREDVESSVSDLALH
                     NLVARSSRGELKKLLKLKDEVGELSVKDTRSFVKLVRKTESTILKKADVVCCTCVGAG
                     DKRLDSKFRTVLIDESTQASEPECLIPIIKGAKQVVLVGDHQQLGPVILDRNAGDAGL
                     KQSLFERLISLGHVPIRLEVQYRMNPYLSEFPSNMFYEGTLQNGVTVEQRTVVDSSFP
                     WPICDIPMMFWANYGREEISANGTSYLNRIEAINCERIITRLFKDGVKPEQIGVVTPY
                     EGQRAYIIQYMQMNGSMDKDLYMTVEVASVDAFQGREKDYIILSCVRANDQQSIGFLT
                     DPRRLNVALTRAKYGLAILGNPASLCRNSIWNHLLIHFREKGCLVEGTMDNLQLCTMQ
                     LTRSKNVNSNSDSRQKNTKWHLESNLPLPEFPISNNREFDSQNLMSFGGQGSNIFAPS
                     SDLSSFMNSNQQYWNAPGPELGLPAKERDSEQRGYTSSNVGLDATLARELQQFTASSL
                     GYEANQDSTGTAQFKALNSFQNLNIHG"
     gene            complement(<438058..>438888)
                     /locus_tag="AGOS_ABR023C"
                     /old_locus_tag="ABR023C"
                     /db_xref="GeneID:4619061"
     mRNA            complement(<438058..>438888)
                     /locus_tag="AGOS_ABR023C"
                     /old_locus_tag="ABR023C"
                     /product="ABR023Cp"
                     /transcript_id="NM_208322.1"
                     /db_xref="GeneID:4619061"
     CDS             complement(438058..438888)
                     /locus_tag="AGOS_ABR023C"
                     /old_locus_tag="ABR023C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR081C (ISF1) and YKL093W (MBR1)"
                     /codon_start=1
                     /product="ABR023Cp"
                     /protein_id="NP_982969.1"
                     /db_xref="GeneID:4619061"
                     /translation="MPVSSASGSLCPSDSAGTMVPNIQKAQEAGCSFRLHSPQQSAAA
                     ETCQCRNGMRIFERSVEESCADVWDSDTSEEERSDAEDDALGDEACAGGRRARAVRAH
                     SGASSALRQTTCARCHKLRAARSAHDEQGQRPRTNSIILQLSRQTTRQSFLDSAAPGH
                     GDSADDAVCHTKSRSSFSAIPTHIYSLERYISAELDSATESFFDTDVKLADTSATNGV
                     SSVASPNFPSSSASISMSLASLSSASNFNDKLSPPPVFLDQRKRRKSHIELALSESFQ
                     "
     gene            complement(<439249..>440091)
                     /locus_tag="AGOS_ABR024C"
                     /old_locus_tag="ABR024C"
                     /db_xref="GeneID:4619062"
     mRNA            complement(<439249..>440091)
                     /locus_tag="AGOS_ABR024C"
                     /old_locus_tag="ABR024C"
                     /product="ABR024Cp"
                     /transcript_id="NM_208323.1"
                     /db_xref="GeneID:4619062"
     CDS             complement(439249..440091)
                     /locus_tag="AGOS_ABR024C"
                     /old_locus_tag="ABR024C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL095W (YJU2)"
                     /codon_start=1
                     /product="ABR024Cp"
                     /protein_id="NP_982970.1"
                     /db_xref="GeneID:4619062"
                     /translation="MSERKAINKYYPPDYDPEQAERQVRQLSKKLKTMHRDTVGIRLM
                     TPFSMRCLKCSEYIPKFRKFNGKKELLPERYLDTIKIYRLSIRCPRCNSTISFRTDPN
                     RGDYTMEAGGERNYVRDDARSPHIKPDETTDETLQRLLREEAEAARPADSAGEDRMQE
                     LEKRLARLQQEQHDAEEIDRLHRESLERGRRAASLAASIADRRTRAEADAARAEEAFR
                     AAPAHVRPTTAPDPTPAAPAPARKPAGKNPLGVVVRNKKKQRARLAAQHRVPTDSAPA
                     DPSA"
     gene            complement(<440295..>441209)
                     /locus_tag="AGOS_ABR025C"
                     /old_locus_tag="ABR025C"
                     /db_xref="GeneID:4619063"
     mRNA            complement(<440295..>441209)
                     /locus_tag="AGOS_ABR025C"
                     /old_locus_tag="ABR025C"
                     /product="ABR025Cp"
                     /transcript_id="NM_208324.2"
                     /db_xref="GeneID:4619063"
     CDS             complement(440295..441209)
                     /locus_tag="AGOS_ABR025C"
                     /old_locus_tag="ABR025C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL096W (CWP1); Tandem gene quadruplication in this
                     organism"
                     /codon_start=1
                     /product="ABR025Cp"
                     /protein_id="NP_982971.2"
                     /db_xref="GeneID:4619063"
                     /translation="MKVFSGAILGLTALAKMVLADSEAFYFLSIRSASMYHMSSVFED
                     NGALKLGGSTADALSAVVTDDGKLKLSNGHYAVVDAKGAFTAGSADKASTGFSISRGY
                     VTYKGNSGFYPVGSSSPYELTLEQPGATSISVALRAQSVTGASSVDDFEPAEGAARSA
                     APAAGAGPAANATAPVANGTAPATNGTAPAGGFANVTVTATGYHTVIQTITSCENNGG
                     KCTVLTTTGPAPVPVSTAPGSSAPHSSAPVSSAPVSSAPHSSAPHSSAPSTSASSTIP
                     IETQTGNGAAKAVVGLGAGVLAAAAMLI"
     gene            complement(<441730..>442209)
                     /locus_tag="AGOS_ABR026C"
                     /old_locus_tag="ABR026C"
                     /db_xref="GeneID:4619064"
     mRNA            complement(<441730..>442209)
                     /locus_tag="AGOS_ABR026C"
                     /old_locus_tag="ABR026C"
                     /product="ABR026Cp"
                     /transcript_id="NM_208325.1"
                     /db_xref="GeneID:4619064"
     CDS             complement(441730..442209)
                     /locus_tag="AGOS_ABR026C"
                     /old_locus_tag="ABR026C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL096W (CWP1); Tandem gene quadruplication in this
                     organism"
                     /codon_start=1
                     /product="ABR026Cp"
                     /protein_id="NP_982972.1"
                     /db_xref="GeneID:4619064"
                     /translation="MKFVSSFLLAATALAAGVLADSEEFFFLGLRTATKFHFSAIYAH
                     DHALKVSYQGGPKGDALSAVITDSGKLKLSDGTFAVVTPDGPVVEGSEDQASAGFAIA
                     NGYLTYSGNSAFVPVANGDTYDLSVKPTSASPEIAIGISAQSKDTPGGVAADFPPSS"
     gene            complement(<443045..>446440)
                     /locus_tag="AGOS_ABR027C"
                     /old_locus_tag="ABR027C"
                     /db_xref="GeneID:4619065"
     mRNA            complement(<443045..>446440)
                     /locus_tag="AGOS_ABR027C"
                     /old_locus_tag="ABR027C"
                     /product="ABR027Cp"
                     /transcript_id="NM_208326.2"
                     /db_xref="GeneID:4619065"
     CDS             complement(443045..446440)
                     /locus_tag="AGOS_ABR027C"
                     /old_locus_tag="ABR027C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL096W (CWP1); Tandem gene quadruplication in this
                     organism"
                     /codon_start=1
                     /product="ABR027Cp"
                     /protein_id="NP_982973.2"
                     /db_xref="GeneID:4619065"
                     /translation="MKLPSTALAVALLAAAKVVVADSEKFSLESLSGAADLKSVSLQL
                     KSGKLVFSPGGKISVLVTDAGRLSFDGNKFAVIEDSGAITFGDEKEGTLGFAVRDGRL
                     TFRSIDSFSATKVNGEYTLSVGWNADATSVGIRAVKDGSPVKDFTPVVSIIDKPKGID
                     IGSLCSKLEKLCHWSHTPSCSTVVPPPQPTTSGKPGESTAVPPPQPTTSGKPGESTAV
                     PPPKPTTSGKPGPSTTAVPPPKPTTSGKPGESTAVVPPPKPTTSGKPGESTVIPPPKP
                     TTSGKPGESTAVVPPPKPTTSGKPGESTVIPPPKPTTSGKPGPSTTAVPPPKPTTSGK
                     PGPSTTAVVPPPKPTTSGKPGESTVIPPPKPTTSGKPGPSTTAVVPPPKPTTSGKPGP
                     STTAVPPPKPTTSGKPGPSTTAVPPPKPTTSGKPGPSTTAVPPPKPTTSGKPGPSTTA
                     VPPPQPTTSGKPGPSTTAVPPPKPTTSGKPGESTVIPPPKPTTSGKPGPSTTAVVPPP
                     KPTTSGKPGESTAVVPPPKPTTSGKPGPSTTAVPPPKPTTSGKPGPSTTAVPPPKPTT
                     SGKPGPSTTAVPPPKPTTSGKPGESTAVPPPKPTTSGKPGPSTTAVPPPKPTNPGKPC
                     THSHRPGETCTHHPGKPTSHGPPPQPTAPGHTTGHVPPPKPTAPGHTTGHVPHPKPDH
                     PHHPGKPCTHSHRPGETCTHHHPGQPTGHVEHPKPDHPHHPGKPCTHSHRPGETCTHH
                     HPGQPTGHVPHPKPDHPHHPGKPCTHSHRPGETCTHHHPGQPTGHVPHPKPDHPHHPG
                     KPCTHSHRPGEPCTHHPGKPTGRAPPQPNKPHHTRKPCTHSHRPGEPCTHHPGQPKPT
                     AKPPAAQPGKPAPPVQPKPTAKPHGGHPGGHRPGGSKDCHETKTYKGGIRVDKGPHHT
                     KGGGIVHEGQATKIAGHGAGPAATAAPGAGGHGTSGGGASGHGGASGHGKKASGHGGV
                     SGHGGVSGHGGASGHGGASGGKKASGSGTRGAGAAHHRGSGSSKGSGSGAHRGGSRSG
                     GHTGSRPKSGGHRGGGRSGGHRGGRRDLGDDIVDYQQDVQMQKRAETTAHPVSVTTSH
                     FTSHAVTGSQSSAHAIATTNGAGAGFMSIPFGAVVLGVAAILL"
     gene            complement(<447488..>449779)
                     /locus_tag="AGOS_ABR028C"
                     /old_locus_tag="ABR028C"
                     /db_xref="GeneID:4619066"
     mRNA            complement(<447488..>449779)
                     /locus_tag="AGOS_ABR028C"
                     /old_locus_tag="ABR028C"
                     /product="ABR028Cp"
                     /transcript_id="NM_208327.2"
                     /db_xref="GeneID:4619066"
     CDS             complement(447488..449779)
                     /locus_tag="AGOS_ABR028C"
                     /old_locus_tag="ABR028C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL096W (CWP1); Tandem gene quadruplication in this
                     organism"
                     /codon_start=1
                     /product="ABR028Cp"
                     /protein_id="NP_982974.2"
                     /db_xref="GeneID:4619066"
                     /translation="MKLSPAFTVALMALAKMVVADSAMFSLSISGGVGINQAAGVFMK
                     SGKLVIGAEGSARAAVTEEGKLSFGGGLFAVVDDSGLIKGGAEAEGTSGFSITNGRLS
                     FRGINTFCTTHVDGDSALAVGGGSGEASIRIQATAGGSVLGDFKPAGSVDGSCSCPDA
                     SLPGSGTPGSGDSTPSGPDGSQPSGSGSGDHPASTPASGPEGTQPSGPGNGEHPSGPG
                     NGQQPGGQQPGGQQPGGQQPGGQQPGGQQPGGQQPGGQQPGGQQPGGQQPSGPGNGEQ
                     PRGPGNDSPANGPASGPQGTQPSGPGNGSPAGGQPANGPGHGPGLPTGPGPAIGQDGS
                     QPSAPGNGGQPANAPAHGPEGSQPNAPAPAHGAPNAPADSVAGKLHGAGQALGHAAGS
                     VQGGGRVDIGAVGNIAGDISGAAETAGQIAGRLSAAGEALGQAAGRISADGGASAGID
                     AHAAGDVAGKLSGAADLVGSIAGELSGAASAAGELAGSVSGSLGAAGNAGVSGSASLG
                     GEAAGHLSGAAQVAGDVAGKIAGAAQAAANAAGQIHGAAHASSQAGASGEIAGHIAGL
                     GQTLGEAAATLGGLAGSLGPTIGGSVGPGGISGNIGLGGVGLGINAGLGGGAGIHQAE
                     LSNADGHSPFGNKEGEENGQQACSTVTTTIVAGQADQGGVATVTVPPGGGVATATVWA
                     GENQQGGNEGNQGGVATATVWPGQGSNEGSQEGVATSTVWPQQSSQGGQATRSIQQAT
                     TNGAGFMNFPVGAGLLAAAAMLL"
     gene            complement(450317..450389)
                     /locus_tag="AGOS_t0034"
                     /db_xref="GeneID:4619067"
     tRNA            complement(450317..450389)
                     /locus_tag="AGOS_t0034"
                     /product="tRNA-Lys"
                     /codon_recognized="AAG"
                     /db_xref="GeneID:4619067"
     gene            <450617..>454207
                     /locus_tag="AGOS_ABR029W"
                     /old_locus_tag="ABR029W"
                     /db_xref="GeneID:4618998"
     mRNA            <450617..>454207
                     /locus_tag="AGOS_ABR029W"
                     /old_locus_tag="ABR029W"
                     /product="ABR029Wp"
                     /transcript_id="NM_208328.2"
                     /db_xref="GeneID:4618998"
     CDS             450617..454207
                     /locus_tag="AGOS_ABR029W"
                     /old_locus_tag="ABR029W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR010C (RPA135)"
                     /codon_start=1
                     /product="ABR029Wp"
                     /protein_id="NP_982975.2"
                     /db_xref="GeneID:4618998"
                     /translation="MSVMEPLSANRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPH
                     VGSFNALTEGPGGGLLNLGARDIGAKVVFDGKASDENPNYLGNKLALSVTQVSLTKPM
                     SNDGVTAAAERNVFPAEARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQ
                     SNRCHLHKMSPQELVEHKEESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFAN
                     RGTSYSHYGVQIRCVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTD
                     ASDREIFDGIVGADTSNSFLTDRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQA
                     SPDMSDYLVGQELLRRIVLVHLGDENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQH
                     QEVLLGGFLYGMIVKEKIEEYLQNIKLQIQADVNRGMPVDFKDRKYMTRVLTRINENI
                     GSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTT
                     TVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCKISTTQSDVSKIPTLLYSLGVSPA
                     AHVTAAGPSLCCVQLDGKIVGWCSHEQGRIVADTLRYWKVEGKTDGLPLDLEIGYVPA
                     SKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDIVGPFEQVYMDIAVTPEEIQNNVHTHV
                     EFSPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSG
                     QTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFSYGTVYK
                     TEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEKLDEDGLPIIGSYVEEGDPICAYFD
                     DTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQYITIKYRIRRVPQIGDKFSSRH
                     GQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQ
                     DATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLR
                     HMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNS
                     SDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAKKIITQQDSEDSIFI
                     DDSHIWEDGQGNKFVGGGNTTTVAIPFVLKYLDSELAAMGIRLRYNVDPK"
     gene            <454423..>455532
                     /locus_tag="AGOS_ABR030W"
                     /old_locus_tag="ABR030W"
                     /db_xref="GeneID:4619068"
     mRNA            <454423..>455532
                     /locus_tag="AGOS_ABR030W"
                     /old_locus_tag="ABR030W"
                     /product="ABR030Wp"
                     /transcript_id="NM_208329.2"
                     /db_xref="GeneID:4619068"
     CDS             454423..455532
                     /locus_tag="AGOS_ABR030W"
                     /old_locus_tag="ABR030W"
                     /note="NOHBY212; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B06259g"
                     /codon_start=1
                     /product="ABR030Wp"
                     /protein_id="NP_982976.2"
                     /db_xref="GeneID:4619068"
                     /translation="MSIQLLKASEGSVITGYCVTNGLRYVIFAEVTYAKSKGVLKLFS
                     VDNEKTITFNKPVEVGTEAAHDDAVLNKLAIIKVPVIRKNKVEKTDIVVINAGDGIQL
                     MSLEQLFGLDDGDGVTAKWQLSHGQDRILSFEAKATTNGVIEIWFCTRLGQAMQVKYS
                     VSSDKFHSFQQLMEVSDDSLNCMATGSEEYGSWEAKLGPLKAVAMACFDNSIYWLHEG
                     TLERQSILSFEQANNNTLTSVAYVTVKRLTTTYVNYYCGSVTNIGCIMYKRSTRGDWD
                     VVHTFRRPISKPESSPLLNCALHFDNVSEITIVSGTECGILCVWRYDYKAELELAVNH
                     IKVGGEGDLVHGVQLLGSQRAYFLCNRSELRYVDL"
     gene            complement(<455529..>456242)
                     /locus_tag="AGOS_ABR031C"
                     /old_locus_tag="ABR031C"
                     /db_xref="GeneID:4619069"
     mRNA            complement(<455529..>456242)
                     /locus_tag="AGOS_ABR031C"
                     /old_locus_tag="ABR031C"
                     /product="ABR031Cp"
                     /transcript_id="NM_208330.1"
                     /db_xref="GeneID:4619069"
     CDS             complement(455529..456242)
                     /locus_tag="AGOS_ABR031C"
                     /old_locus_tag="ABR031C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR024C (THG1)"
                     /codon_start=1
                     /product="ABR031Cp"
                     /protein_id="NP_982977.1"
                     /db_xref="GeneID:4619069"
                     /translation="MAKSRFEYVREYEVHDTLLPETYIVVRIDGKHFHEFSQHYSFEK
                     PNDERALKLMNASAKNVVMAYSGDIILAFGESDEYSFILRKDSTLFRRRRDKLSTLFV
                     SLFTAQYVALWPKFFPEQPLSHKRLPFFDSRCVCYPNTTVVKDYLCWRYVDTHINNLY
                     NTVFWNLVLKCNLTPREAEQRLSGTLSSDKQEILFSECGVNYNNESEMFKKGSLINRK
                     GEIMHIDVVKQIDELFAGF"
     gene            <456620..>457444
                     /locus_tag="AGOS_ABR032W"
                     /old_locus_tag="ABR032W"
                     /db_xref="GeneID:4619070"
     mRNA            <456620..>457444
                     /locus_tag="AGOS_ABR032W"
                     /old_locus_tag="ABR032W"
                     /product="ABR032Wp"
                     /transcript_id="NM_208331.2"
                     /db_xref="GeneID:4619070"
     CDS             456620..457444
                     /locus_tag="AGOS_ABR032W"
                     /old_locus_tag="ABR032W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR026W"
                     /codon_start=1
                     /product="ABR032Wp"
                     /protein_id="NP_982978.2"
                     /db_xref="GeneID:4619070"
                     /translation="MVKKEVIRKKRKPQQDPVVRQKLIWTVGHVMTLTCGLIFTCACV
                     YNVLFFYRHWGWSRLLPSWLVPSRLLSFSKYGLVPHHGIGYWAAKTGVPASYRLALVG
                     VLFSHGVTSWQNWARLNPTYYDLLSKDNFQNLLIATLWLFSRSSFYKLVPFIITSYLH
                     LTKKQSASDDETTKQNSMLLHLIAYSELVVLISLLWDTLLFRGASGFALVFYLAIYWL
                     KLNFSPYVQTTVLRILSKLKRVVPASQRERWDAVQDFLLRKLREQKVTQEEARKRL"
     gene            complement(457536..457614)
                     /locus_tag="AGOS_AgSNR61"
                     /old_locus_tag="AgSNR61"
                     /db_xref="GeneID:4619071"
     ncRNA           complement(457536..457614)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR61"
                     /old_locus_tag="AgSNR61"
                     /product="AgSNR61"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR61; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149406.1"
                     /db_xref="GeneID:4619071"
     gene            complement(457662..457717)
                     /locus_tag="AGOS_AgSNR55"
                     /old_locus_tag="AgSNR55"
                     /db_xref="GeneID:4619072"
     ncRNA           complement(457662..457717)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR55"
                     /old_locus_tag="AgSNR55"
                     /product="AgSNR55"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR55; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149400.1"
                     /db_xref="GeneID:4619072"
     gene            complement(457826..457906)
                     /locus_tag="AGOS_AgSNR57"
                     /old_locus_tag="AgSNR57"
                     /db_xref="GeneID:4619073"
     ncRNA           complement(457826..457906)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR57"
                     /old_locus_tag="AgSNR57"
                     /product="AgSNR57"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR57; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149402.1"
                     /db_xref="GeneID:4619073"
     gene            complement(<458221..>458705)
                     /locus_tag="AGOS_ABR033C"
                     /old_locus_tag="ABR033C"
                     /db_xref="GeneID:4619074"
     mRNA            complement(join(<458221..458551,458695..>458705))
                     /locus_tag="AGOS_ABR033C"
                     /old_locus_tag="ABR033C"
                     /product="40S ribosomal protein S25"
                     /note="5'UTR intron"
                     /transcript_id="NM_208332.2"
                     /db_xref="GeneID:4619074"
     CDS             complement(458221..458547)
                     /locus_tag="AGOS_ABR033C"
                     /old_locus_tag="ABR033C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR027C (RPS25A) and YLR333C (RPS25B); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S25"
                     /protein_id="NP_982979.1"
                     /db_xref="GeneID:4619074"
                     /translation="MPPKQQLSKAQKAAAAMAGGKKSKKKWSKKSHKDKAQHAVILDQ
                     DKLDRILKEVPTYRYVSVSVLVDRLKIGGSMARVALRHLETEGIIKPISKHSKQAIYT
                     RATASE"
     gene            <459227..>461068
                     /locus_tag="AGOS_ABR034W"
                     /old_locus_tag="ABR034W"
                     /db_xref="GeneID:4619075"
     mRNA            <459227..>461068
                     /locus_tag="AGOS_ABR034W"
                     /old_locus_tag="ABR034W"
                     /product="ABR034Wp"
                     /transcript_id="NM_208333.2"
                     /db_xref="GeneID:4619075"
     CDS             459227..461068
                     /locus_tag="AGOS_ABR034W"
                     /old_locus_tag="ABR034W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR335W (NUP2)"
                     /codon_start=1
                     /product="ABR034Wp"
                     /protein_id="NP_982980.2"
                     /db_xref="GeneID:4619075"
                     /translation="MAKRFAGSQITRETYEQSASDSEGETGSGPKLASALTMQKRKIA
                     MPKRKTSSASGGAGFGNAFAFVKRAGAAPGAEEAAPAPATAPAGDQQAKLQALNMQFH
                     EKVMHAVREDPFVNLTPALEKYKKYLSSIGVLSVGMEEEREGKYATVIKHDVGMACAG
                     GAKQAEEDDSDAMSEDEVKPVKVEGPKFVLAQGPTTKNPVFSFGTKKQQKKEDSDSED
                     EIEVKGPTFTVSGNVSSGIFKLNKDSAENKAEQSAPIFSTKSDEKSSSAAVTAFGGAA
                     AQEASLNGTTPTKPVFTFGVPSDKKPEAAKPSFSFGFSASTQADKTEKAEKPVFSFGV
                     SANQQNDKEDKPRFTFGTAAEKNVENSKPTFGAPTSDAKQGVTSKPAFQFGTGTTNTA
                     ATPFGVKLPVADQSKQQNKPLSFSFGSSTASLAPSFSFGAKPADASQQPAGDFKFSLP
                     FAQDSKTLTTENIEQTGTEEATAAHEGANDQAQTGEPESEGIKMTNGEENEEVLFCEK
                     AKLLIFDSDTKGYTSRGVGELKLLRKKDDKGKVRVLCRSEGMGHVLLNTSVVKSFKYQ
                     PIDADNENLIKWPIITDGKLETFIIKVKQKADGRRLVGAVADAQQAM"
     gene            complement(<461242..>464184)
                     /locus_tag="AGOS_ABR035C"
                     /old_locus_tag="ABR035C"
                     /db_xref="GeneID:4619076"
     mRNA            complement(<461242..>464184)
                     /locus_tag="AGOS_ABR035C"
                     /old_locus_tag="ABR035C"
                     /product="ABR035Cp"
                     /transcript_id="NM_208334.3"
                     /db_xref="GeneID:4619076"
     CDS             complement(461242..464184)
                     /locus_tag="AGOS_ABR035C"
                     /old_locus_tag="ABR035C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR336C (SGD1)"
                     /codon_start=1
                     /product="ABR035Cp"
                     /protein_id="NP_982981.3"
                     /db_xref="GeneID:4619076"
                     /translation="MSKHGIRLPGALLDELNGKDYKDDERFKGHRSKRARNQPNRKDK
                     RRERRQLKKQKRQRGDVESAPQTGRAAAARPRQQKKEKAAPAPRQTAAPFSSDDELSS
                     GDFDEFDEGDLSAGELEQLRELEEDESASEDEGGNSSSSDEQEEEEEEEELDAAQTME
                     RLRALKAAKVKKQQRSKEPEQEEELDAAQTMERLRALKAAKSKAKHRSQEEEEDDDSE
                     EDDDSEDDDEEEFRGFDDEPEHDARERAARSSSSRAPILPEDLAAVERDEMAMNYYGK
                     KLGLKRKKWQLHATDEFDAIGGLLEGLDFFQNYGEEGQYSEDEEASQEDTGSESGDEE
                     IGSEAGDNARSDGGLPFSSDDELSSGDFEELDEEDVEDDSEHVEQAKKSKKENPYVAP
                     AAGSYVPPSLRKKMLAETDSKETVQLKRSVRSSLNKLSESNIPIIVASLNEQYDLHAR
                     QYVTDAINSQIIEIISQNNKLLDTFIMAYASVAYALWRLRGVEVGASFVQEAVLSFLR
                     LYDEQMKQIEDMGDIDVNTFSKKCSNLITLLAYAYNFGMVSSRLIYDCVRVFINKPNE
                     FTMELVLRVVSVSGPLIRGDDPAALKDILAELLPNVNKIKQTTRMKFLLDTLLDLKNN
                     RLKPSILAASHHGIKKVLAGALKTAAPTDALQVSLEDIQQIETKGKWWLVGSSWKGNM
                     DNAFAEADKAKPEPVAKKRTIEITDTLLDGIPDWNEIAKAQRMNTDVRRAIFISIMSA
                     HDYMDAFTKLEKLNLKNKQSLEVPKVLVHCLSVDSAQNGYNPYYSLLGSKICQQHHSI
                     AKSFQFLFWNIMRKFENDIGSDDEEDPFQINDLDEEKTLRMLSNQACFFGYLMAEGQV
                     KLDVLKHVSIMGLNSDGRLFLENLLFQFLLASAKKAETKKKVGNIKEWSYRDDLLQGA
                     LSHGIQAENKKIICKSLRMFMRNFRYTNYIRGQPGSKEYQRDMRRLDWAVKRFLELID
                     EELDSADL"
     gene            <464386..>465468
                     /locus_tag="AGOS_ABR036W"
                     /old_locus_tag="ABR036W"
                     /db_xref="GeneID:4619077"
     mRNA            <464386..>465468
                     /locus_tag="AGOS_ABR036W"
                     /old_locus_tag="ABR036W"
                     /product="ABR036Wp"
                     /transcript_id="NM_208335.2"
                     /db_xref="GeneID:4619077"
     CDS             464386..465468
                     /locus_tag="AGOS_ABR036W"
                     /old_locus_tag="ABR036W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR028W (MSP1)"
                     /codon_start=1
                     /product="ABR036Wp"
                     /protein_id="NP_982982.2"
                     /db_xref="GeneID:4619077"
                     /translation="MARNIDLKTVTDWSVLIGTGISLYYLLHRLFNDADGPLASVSKE
                     SREKQSTTWRRLVEANPELSRVHLNSYEQNALASVVTPQDIDVSFSDIGGLETIIDEL
                     TESVIYPLTTPELYTQHSLLEAPTGVLLYGPPGCGKTMIAKALARESGANFLSIRMSS
                     IMDKWYGESNKIVDALFSLANKIQPCIIFIDEIDSFLRERASSDHEVTAMLKAEFMTL
                     WDGLTSNGRIIVMGATNRITDIDSAFLRRLSKRFSVPLPNEPQRRKILDVILENVEVD
                     PQDFDIDYLVKATRGLSGSELKELCRDAALNAAREYIRQKRQLSAKDASYEGKPLKVR
                     PLQTRDFLKNLKLDATQPFVTSVALD"
     gene            <465595..>466227
                     /locus_tag="AGOS_ABR037W"
                     /old_locus_tag="ABR037W"
                     /db_xref="GeneID:4619078"
     mRNA            join(<465595..465683,465753..>466227)
                     /locus_tag="AGOS_ABR037W"
                     /old_locus_tag="ABR037W"
                     /product="ABR037Wp"
                     /transcript_id="NM_208336.3"
                     /db_xref="GeneID:4619078"
     CDS             join(465595..465683,465753..466227)
                     /locus_tag="AGOS_ABR037W"
                     /old_locus_tag="ABR037W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR029W (ERV1); 1-intron"
                     /codon_start=1
                     /product="ABR037Wp"
                     /protein_id="NP_982983.3"
                     /db_xref="GeneID:4619078"
                     /translation="MPETSVSVSQKSYSAGPSGRTIVYDEDGKPCRSCNTLLDFKFAT
                     NALHGKVADSTGAVPEAAAAAATVSANIPGSKHYRQVEPADVEELGRSSWTLLHTAAA
                     KYPRQPSDAQKQEMRQFLSIFSHIYPCNWCAKDFEQYIRDRAPRVDSRDELGQWMCEA
                     HNDVNQKLGKELFDCNFWKKRWLDGWE"
     gene            complement(<466293..>468140)
                     /locus_tag="AGOS_ABR038C"
                     /old_locus_tag="ABR038C"
                     /db_xref="GeneID:4619079"
     mRNA            complement(<466293..>468140)
                     /locus_tag="AGOS_ABR038C"
                     /old_locus_tag="ABR038C"
                     /product="ABR038Cp"
                     /transcript_id="NM_208337.2"
                     /db_xref="GeneID:4619079"
     CDS             complement(466293..468140)
                     /locus_tag="AGOS_ABR038C"
                     /old_locus_tag="ABR038C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR337C (VRP1)"
                     /codon_start=1
                     /product="ABR038Cp"
                     /protein_id="NP_982984.2"
                     /db_xref="GeneID:4619079"
                     /translation="MPAGSMMAGRDALLSDIRKGSRLKKAVTNDRSAPSIGGGGRVES
                     SGSVGGSAPSLPSGAASGLPMGPQLGDILAGGIPKLKPVGEPVRALQVPPNASAGAPP
                     VPSVRPPVRKHAGGSPEGARAPVSPVAPKLPETGAPPVPSARPPQHGGDGALPVGAPR
                     LPAFGAPPVPGAGPARPDAGSTPPGGAPNLPNISPPPVPGAPPPVGAPKLPEAGPPPV
                     PGVAPPVPSIAPPPPSAAAPPPTAAPPIPAAPPPPLAPQMPAAAQSAPPPAPPPPPPP
                     PPPAVKAPVAPPISPPAAQQPPSIIPPASGGLPFLAEIQKKRDDRFVVDGGSNYTTQS
                     SAQSHEPVKPQITSLRDHSQQPPPHLPTSAAPPLPQMAAPAPPIPSFAAPQIPQVQLP
                     AAHQPADTVAEGTSTTHSEHPFLSEMQRRLDATSLAGSSPSRSTAERYETADTPASSA
                     GDAAIPLGRPHVKQQPDRTFSPPQHIPPAAVPPPPPSIPPPVLDERPPEMIAKAPPPP
                     PPPQAEGAFPPPASVPSHRQRLFSSAGGTSGSSSQVPVRESSIDTFTISNRVSTGDAV
                     SRQPICIDDTRFKFSNAGGIPKPRVFQNKTKLYPSGRGSSVPLDLSLYS"
     gene            468470..468553
                     /locus_tag="AGOS_AgSNR46"
                     /old_locus_tag="AgSNR46"
                     /db_xref="GeneID:4619080"
     ncRNA           468470..468553
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR46"
                     /old_locus_tag="AgSNR46"
                     /product="AgSNR46"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR46; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149391.1"
                     /db_xref="GeneID:4619080"
     gene            468841..468912
                     /locus_tag="AGOS_t0035"
                     /db_xref="GeneID:4619081"
     tRNA            468841..468912
                     /locus_tag="AGOS_t0035"
                     /product="tRNA-Met"
                     /note="Initiator tRNA"
                     /codon_recognized="AUG"
                     /db_xref="GeneID:4619081"
     gene            <469047..>469982
                     /locus_tag="AGOS_ABR039W"
                     /old_locus_tag="ABR039W"
                     /db_xref="GeneID:4618999"
     mRNA            <469047..>469982
                     /locus_tag="AGOS_ABR039W"
                     /old_locus_tag="ABR039W"
                     /product="ABR039Wp"
                     /transcript_id="NM_208338.2"
                     /db_xref="GeneID:4618999"
     CDS             469047..469982
                     /locus_tag="AGOS_ABR039W"
                     /old_locus_tag="ABR039W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL013C (OTU2)"
                     /codon_start=1
                     /product="ABR039Wp"
                     /protein_id="NP_982985.2"
                     /db_xref="GeneID:4618999"
                     /translation="MDSAAVLARHRKEKKDLQNQVTGLKKQASKKNRKQVNAKCEELS
                     RELEERHARELAELEHEGGEQKADDAAEDGQVTPEELLAQLELEQPAAAAAPAPQAVA
                     SGRRGNRRKEKLARREAEVARIKAEAAAEAAEQPDLSKGEEALLQQLCSTAGLRAVDI
                     QPDGHCLFASVLDQLRARHGERACEPYCLPQSYEGPRSAAEMDVWALRKLACCQVREH
                     PDDFVPYLFDEQTLELQDVATYTAAIESSAKWGGEIELLALSQVFRCCISVLMAGRST
                     HRVNEQHAVNPELKLVYYKHSYALGEHYNSLRDAA"
     gene            <470108..>471346
                     /locus_tag="AGOS_ABR040W"
                     /old_locus_tag="ABR040W"
                     /db_xref="GeneID:4619082"
     mRNA            <470108..>471346
                     /locus_tag="AGOS_ABR040W"
                     /old_locus_tag="ABR040W"
                     /product="ABR040Wp"
                     /transcript_id="NM_208339.2"
                     /db_xref="GeneID:4619082"
     CDS             470108..471346
                     /locus_tag="AGOS_ABR040W"
                     /old_locus_tag="ABR040W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL014C (YLF2)"
                     /codon_start=1
                     /product="ABR040Wp"
                     /protein_id="NP_982986.2"
                     /db_xref="GeneID:4619082"
                     /translation="MGFWIRPYSTQRAIVRASNNLTSGIVGLANVGKSTFFQAITKST
                     LGNPANYPFATIDPEEAKVLVPSEHLDHLQKLYGSRKKIPATLTVYDIAGLTRNASRG
                     EGLGNKFLGDIRLVDGIYSVVRGFRDDSITHIEGSVDPIRDLSVVQDELVLKDLEWLE
                     AGREKLTRKLGRTAKSSLDHKQMQDELALLAQLEEFLYEGRRIAHFKQNWTKEEVDTL
                     GQYNFLTAKPTLVLLNSSPRDYLLQQNEYLDEVSKWIDQYSPGDEVLIFSAEYETRYN
                     EFASTSDWEGLQRYCSELAGGAAIKAGALPSALPSIILKMRQLLRLISFYTCGPEESR
                     QWTIQQGTRAPQAAGVIHSDLEKTFINASVIKYDDLRDASHPLDESALRRLGKIKRCG
                     KDYVVEDGDVVHFRAAAGKN"
     gene            complement(471439..471493)
                     /locus_tag="AGOS_AgSNR69"
                     /old_locus_tag="AgSNR69"
                     /db_xref="GeneID:4619083"
     ncRNA           complement(471439..471493)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR69"
                     /old_locus_tag="AgSNR69"
                     /product="AgSNR69"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR69; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149414.1"
                     /db_xref="GeneID:4619083"
     gene            complement(<471996..>472349)
                     /locus_tag="AGOS_ABR041C"
                     /old_locus_tag="ABR041C"
                     /db_xref="GeneID:4619084"
     mRNA            complement(<471996..>472349)
                     /locus_tag="AGOS_ABR041C"
                     /old_locus_tag="ABR041C"
                     /product="40S ribosomal protein S20"
                     /transcript_id="NM_208340.1"
                     /db_xref="GeneID:4619084"
     CDS             complement(471996..472349)
                     /locus_tag="AGOS_ABR041C"
                     /old_locus_tag="ABR041C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL015W (RPS20)"
                     /codon_start=1
                     /product="40S ribosomal protein S20"
                     /protein_id="NP_982987.1"
                     /db_xref="GeneID:4619084"
                     /translation="MVDMKDKTEQQEQPQIHKIRMTLTSTKVRELEDVSANIVKNAQS
                     FHLVMKGPVRVPTKVLKICTRKAPNGEGSKTWDTYEMRIHKRYIDLQAAAQVAKRITQ
                     LAIQPGVDIEVTIAA"
     gene            <472653..>473927
                     /locus_tag="AGOS_ABR042W"
                     /old_locus_tag="ABR042W"
                     /db_xref="GeneID:4619085"
     mRNA            <472653..>473927
                     /locus_tag="AGOS_ABR042W"
                     /old_locus_tag="ABR042W"
                     /product="ABR042Wp"
                     /transcript_id="NM_208341.2"
                     /db_xref="GeneID:4619085"
     CDS             472653..473927
                     /locus_tag="AGOS_ABR042W"
                     /old_locus_tag="ABR042W"
                     /note="NOHBY213; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F25520g"
                     /codon_start=1
                     /product="ABR042Wp"
                     /protein_id="NP_982988.2"
                     /db_xref="GeneID:4619085"
                     /translation="MTATKEYLCSLRAVRETSAEVFRYVSARGRGKYCKLDSSKLTDV
                     VQYVLKIIDRDYGRATCEIPPHGRLQHFNVGGVDRVGELLRGWRGVDDIELSRRLVDL
                     VVLSVLLDAGAGSQWSFREPGSGLRVGRSEGIALASFYMFKNGMLSADGSTTVNGHHL
                     AAIPLEMFQEAFQVTEKNTIVGLEGRWRLARKLGQVMCSNSAVFGPDARPGGIVDYLR
                     GLCGGGPLHIEQLWDTLMDNLLPVWPDNRCTIDGEPLGDAWQLDTLVSGDTAGRAHGI
                     VSFHKLTQWLCYSVLPPLTEYGYKFDILDTDQLTGLPEYRNGGLFCDLGVISLLPEAK
                     QYGEQMARAAGAEDVPVFPAEHGAIVEWRCLTVALIDELLSMINKELDVPLTLAQLLE
                     AGTWKAGREVAQKKRPETGGPPIAIASDGTLF"
     gene            <474251..>476311
                     /locus_tag="AGOS_ABR043W"
                     /old_locus_tag="ABR043W"
                     /db_xref="GeneID:4619086"
     mRNA            <474251..>476311
                     /locus_tag="AGOS_ABR043W"
                     /old_locus_tag="ABR043W"
                     /product="ABR043Wp"
                     /transcript_id="NM_208342.2"
                     /db_xref="GeneID:4619086"
     CDS             474251..476311
                     /locus_tag="AGOS_ABR043W"
                     /old_locus_tag="ABR043W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL016C (DUR3)"
                     /codon_start=1
                     /product="ABR043Wp"
                     /protein_id="NP_982989.2"
                     /db_xref="GeneID:4619086"
                     /translation="MDHLNPPLSQGVGYAIVVGLGAVFAIGMVMTTYILRRYQREVIT
                     AEEFATAGRTVKTGLIASAVVSSWTWAATLLQSTTMAYKVGVSGPFYYAAGACVQIIL
                     FSTLAIKCKQRAPNAHTFLEIIKARYGRKAHILHMCYALVTNVLVTTMLLTGGSAVVS
                     ELTGMHTAAACFLLPVGVIIYTLFGGIKATFLTDYVHTVIIVGIILTFTFSVYRTSDM
                     LGSASKVYDLLREAARQHPVKGNRNGEYLTMKSESGGIFFVVSLVGNFGTVLLDNGYF
                     TKAFSSSPAAALPGYVVGGIVWFAIPCLVATSLGLACLALELLPSFPNYPSRLSQEQV
                     DAGLVLPVAAFNLLGKGGAMAALLMVFMAVTSAMSAELIAVSTIFTYDIYRGYVNPDA
                     PGKRLIVTSHAACVVFGVAMSAVSVGLYYAGISLGYLYEVMGIIISSAVIPSALTLFW
                     SKQNIYAVTIAPLVGTTLAVTSWLVCAKVLYGSITVENTYKDYPMLTGNLVALLSPAL
                     LIPLLTYSLGADSYDWIAMKTDILRVDETDELLDADKGLAMVVTRELFESSSVPSAIE
                     KEEINHTTEPNLQREMTNGLEEERILKRASRLATILCAIFILSFLVLWPVPMYGTGYI
                     FSKGFFTGWVSVLTLWLFCTGFAVCIYPLWEGRHGLFTTVRGIYWDCTGQKAKLRDWQ
                     CSQI"
     gene            complement(<476474..>477832)
                     /locus_tag="AGOS_ABR044C"
                     /old_locus_tag="ABR044C"
                     /db_xref="GeneID:4619087"
     mRNA            complement(<476474..>477832)
                     /locus_tag="AGOS_ABR044C"
                     /old_locus_tag="ABR044C"
                     /product="ABR044Cp"
                     /transcript_id="NM_208343.2"
                     /db_xref="GeneID:4619087"
     CDS             complement(476474..477832)
                     /locus_tag="AGOS_ABR044C"
                     /old_locus_tag="ABR044C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL039W (PTM1) and YHL017W"
                     /codon_start=1
                     /product="ABR044Cp"
                     /protein_id="NP_982990.2"
                     /db_xref="GeneID:4619087"
                     /translation="MYSKEDWGGKIEPYIEVNMQKLEGKALVAVFNFQDFRHLGYQDH
                     GELRMVCTQEAVNAQRCTAEELGQLLVRKKVYNPETGQNETLRSEVKSMRVEKEGVLE
                     PRYPVKETGFYCVFVYAPDVKYAGEVTFQNAFGHLPASDVNNLMLYGLLAVAYAIAMA
                     LYMFAVWKHKHELLLLQKYILAFFLFLTLETILVWSAYDLVNRKGVTAGTITYNVFIS
                     IINAGKVSMSCFLILIVALGYGVVYPKLNRKLMRRVQVFTAFNFVTMAAAIIHSSLTR
                     AENVGVSLLLSVFPVLTLIVFYVLIIRSLGSTLGYLREHKQVVKLNAYRKMFMLIIGS
                     IVLNILGVFFSIFSMARRNDDEIISNLWKTKFIMEVWPSFVYFLVFVVFAFMWRPTDT
                     SYMLACSQQLPTDPENVTDFDLDDLQSLNDDASNRRVNDDEINFSDEEGPGSYHPSHQ
                     GK"
     gene            <478086..>478805
                     /locus_tag="AGOS_ABR045W"
                     /old_locus_tag="ABR045W"
                     /db_xref="GeneID:4619088"
     mRNA            <478086..>478805
                     /locus_tag="AGOS_ABR045W"
                     /old_locus_tag="ABR045W"
                     /product="ABR045Wp"
                     /transcript_id="NM_208344.1"
                     /db_xref="GeneID:4619088"
     CDS             478086..478805
                     /locus_tag="AGOS_ABR045W"
                     /old_locus_tag="ABR045W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL040C (NFU1)"
                     /codon_start=1
                     /product="ABR045Wp"
                     /protein_id="NP_982991.1"
                     /db_xref="GeneID:4619088"
                     /translation="MRSQMLALGRAARCVARRGLHIKTLTTPNENALKYVSTDGELLQ
                     ERGAPSVEIRNFDMELIRQAPLAEKLFAQVPGVEAVMIGDDFVTVSKDAELGWAQVTP
                     RVLEVLTQQLASGQAAVQGQVAVGGTERFQYDEEEQEISDTIEEIIQTRVRPAIMDDG
                     GDIQYRGWDPETGRVYLKLQGACKSCSSSEVTLKHGIESMLKHYVEEVSGVEQVLDVE
                     EQVALHEFGRLEERLRARTSK"
     gene            complement(<478810..>479136)
                     /locus_tag="AGOS_ABR046C"
                     /old_locus_tag="ABR046C"
                     /db_xref="GeneID:4619089"
     mRNA            complement(<478810..>479136)
                     /locus_tag="AGOS_ABR046C"
                     /old_locus_tag="ABR046C"
                     /product="ABR046Cp"
                     /transcript_id="NM_208345.1"
                     /db_xref="GeneID:4619089"
     CDS             complement(478810..479136)
                     /locus_tag="AGOS_ABR046C"
                     /old_locus_tag="ABR046C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL018W"
                     /codon_start=1
                     /product="ABR046Cp"
                     /protein_id="NP_982992.1"
                     /db_xref="GeneID:4619089"
                     /translation="MYNKIAKQLPILLRPPELQAGLAALPHWRLVGASLQRELRLADF
                     EATWGLLTQVAMRAHLWGHHPTITTTHTRATIALTTHDAGGVTDIDLRMARRIERLLA
                     RSECIS"
     gene            <479239..>480735
                     /locus_tag="AGOS_ABR047W"
                     /old_locus_tag="ABR047W"
                     /db_xref="GeneID:4619090"
     mRNA            <479239..>480735
                     /locus_tag="AGOS_ABR047W"
                     /old_locus_tag="ABR047W"
                     /product="ABR047Wp"
                     /transcript_id="NM_208346.1"
                     /db_xref="GeneID:4619090"
     CDS             479239..480735
                     /locus_tag="AGOS_ABR047W"
                     /old_locus_tag="ABR047W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL019C (APM2)"
                     /codon_start=1
                     /product="ABR047Wp"
                     /protein_id="NP_982993.1"
                     /db_xref="GeneID:4619090"
                     /translation="MSCCLLILDEELQLLTVRQLRPLPELLGPLQWFISSPRRLPVLS
                     HRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIMDN
                     FHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE
                     EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQV
                     RLNQVHGAINCRSYLSGMPQLTVGLNKMVAQDRDFTSQVHFHQCVDLERLATDRHITF
                     VPPDGEFQLCHYKLARGANEQPLIKLEECRAAVKPRRRPADADRLVLTVSISTNFKLQ
                     DATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFNITDDYLLWDIGKAKGSHGD
                     RRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEALYNQTHASAPTHASALL
                     RVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRYKSTNHQLCAFQL"
     gene            <481083..>482156
                     /locus_tag="AGOS_ABR048W"
                     /old_locus_tag="ABR048W"
                     /db_xref="GeneID:4619091"
     mRNA            <481083..>482156
                     /locus_tag="AGOS_ABR048W"
                     /old_locus_tag="ABR048W"
                     /product="ABR048Wp"
                     /transcript_id="NM_208347.1"
                     /db_xref="GeneID:4619091"
     CDS             481083..482156
                     /locus_tag="AGOS_ABR048W"
                     /old_locus_tag="ABR048W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL020C (OPI1)"
                     /codon_start=1
                     /product="ABR048Wp"
                     /protein_id="NP_982994.1"
                     /db_xref="GeneID:4619091"
                     /translation="MNHTNTEPGEEHELIAIEALSRLCNGTNGETRLEKSHGAEQGQA
                     QQHQDDGETLLCRMRQNPIFTNAVSLYEQTKSHHPNFRRRAELVERSASTMVRRTSEL
                     WAPRDGASKHRLEESCETGTPLDDEVGPSPRVSKRQKIKENLKEYRLTMSIESKKQLI
                     TCLHLLKLANRQLSSTVGSLQDLVQKEREDSGPREPEEEDGEQYFDASETIVSERSKE
                     IKMEVVGTVKKVYSLISRFAGSSLPEPARSQVRETLLKMPTNWSLTVNSASRETPTNA
                     RLSANSKMLILAEESLDMVSNIIQVFDMTLGRAEEWVKHKQELKELIKSQYMEAQLKS
                     KVKQQLEKEQSEQQRHELKRSSV"
     gene            complement(<482199..>482870)
                     /locus_tag="AGOS_ABR049C"
                     /old_locus_tag="ABR049C"
                     /db_xref="GeneID:4619092"
     mRNA            complement(<482199..>482870)
                     /locus_tag="AGOS_ABR049C"
                     /old_locus_tag="ABR049C"
                     /product="ABR049Cp"
                     /transcript_id="NM_208348.2"
                     /db_xref="GeneID:4619092"
     CDS             complement(482199..482870)
                     /locus_tag="AGOS_ABR049C"
                     /old_locus_tag="ABR049C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL041W (VPS24)"
                     /codon_start=1
                     /product="ABR049Cp"
                     /protein_id="NP_982995.2"
                     /db_xref="GeneID:4619092"
                     /translation="MNFIKTAIWGVDPREQHRKLKAILRKNQRQLDKSLRELAALKGK
                     TQVLIKKSAKTNDVKTVRIYAKELYQINKQYDRIYTSKAQLQSVGMKIEEAFHMNKMQ
                     QTMAQSAGLMREVNSLVSVPQLRSTMMELEKELLRSGIVSEMVNDSLENIDMTVDDEE
                     VDEQVEQIVMQYTGAKFNAVDNVPETQLERQDALEEVVPEEDIKDEADNMLREMRERL
                     NALQG"
     gene            483148..483219
                     /locus_tag="AGOS_t0036"
                     /db_xref="GeneID:4619093"
     tRNA            483148..483219
                     /locus_tag="AGOS_t0036"
                     /product="tRNA-Glu"
                     /codon_recognized="GAA"
                     /db_xref="GeneID:4619093"
     gene            <483589..>487275
                     /locus_tag="AGOS_ABR050W"
                     /old_locus_tag="ABR050W"
                     /db_xref="GeneID:4619000"
     mRNA            <483589..>487275
                     /locus_tag="AGOS_ABR050W"
                     /old_locus_tag="ABR050W"
                     /product="ABR050Wp"
                     /transcript_id="NM_208349.2"
                     /db_xref="GeneID:4619000"
     CDS             483589..487275
                     /locus_tag="AGOS_ABR050W"
                     /old_locus_tag="ABR050W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR012W (CLU1)"
                     /codon_start=1
                     /product="ABR050Wp"
                     /protein_id="NP_982996.2"
                     /db_xref="GeneID:4619000"
                     /translation="MSKELDTVEVSIRVPFGKSKRLSTTASRRARVQSIMYFLAFNAA
                     SKYYTNYELLHNGVEVDEQQLISELAGNEQTVHLQLRLKPYNTGEVIRHFVTFREYIG
                     FVGDSDDDITSLALSNVAKFRELPLTDIAAASGKTEVADDRQKEEFQVSDAEKAVFTK
                     ELDSILELRPSAQDVLKGGSALSKPCLRSLIISGYNPVPAFFRTKGHLLYLQAVTLEG
                     ETLHITATVSGFYVNKSSAIKFDPTLKTDAAVCLTLYELLTKHSKKFASHLSQLEAAL
                     KAHESVNYVKPISVFLHKTWFPSSLPSNSIDFTEYQLEALNFQTERNFNDEFQAVKET
                     SSEDIVARLEKEKLLNRVIHDFNVAASKGSMEIFYGNMVAMNPDAPRQEHIFLKNNIF
                     YSFVSDLDGHYQDKGGDAAAHAASNQDLHIIKTLLQSNMRSVRHLLTAVVEFGGVRIL
                     AQSPVPGILDTAGMKFIKNEKGEEEAIQAKNDITVCYGFDEASNKVIADAEFGSSLDD
                     FAKVFHLKKHEVDGVELKVASTSKGVVGFDKRNYILDLADNNPLDVGFALENFDAVTD
                     EKARYPHRQTLLRRELVEKWWFSKVDGTGSEMEAAYEEGKFSYNPDAYKIEGIEDETV
                     VELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVDIMHKNGINIRYLGRVIELAEQEL
                     EAQRALREAHLQQVEADNKEFTEWEANYLKHIESLIKERQVTIQKLLAEGKEVPAELK
                     EELKLDDKEIRKPHEKEGVAVNNDQLSVLLTLAQIEIISRSIKHVFRKHCHELPAVII
                     PTFIAFALNLLFGYCYNKAPIAEFPTDGSDIDFAFTKLTREQLLSEISEQAVLRFRYT
                     LPDGWESRYEHTPFALLRPICNKFGIQLLNKEYFFTREQYQNWRQAQDKKIRSKLVEP
                     VSTFSINDLSVRPIIKVATLTTGVSDDCWAQGAYMINEEEKQATALALFSQSIAFREE
                     TSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYERVCGFDSFEMIRSLNNL
                     AMLEMANDSPYNAALCLKTIMSILSVVIPVNHPATINSYSMLHSMCSSLQNSSAMIKV
                     LNKLGDIIVEIDGHKSLPYAVNESRLANLYASVGEYKRSLACIESCYELFSKELGVNH
                     KTTVECNSWITGVENLIESTSQSKALAASKAAAAAKQGEKKPAQKQQQSAELRDKSID
                     ELMNFINGGSAPAKKSKKKKNAKK"
     gene            complement(<487452..>488903)
                     /locus_tag="AGOS_ABR051C"
                     /old_locus_tag="ABR051C"
                     /db_xref="GeneID:4619094"
     mRNA            complement(<487452..>488903)
                     /locus_tag="AGOS_ABR051C"
                     /old_locus_tag="ABR051C"
                     /product="ABR051Cp"
                     /transcript_id="NM_208350.2"
                     /db_xref="GeneID:4619094"
     CDS             complement(487452..488903)
                     /locus_tag="AGOS_ABR051C"
                     /old_locus_tag="ABR051C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR013C (SEC59)"
                     /codon_start=1
                     /product="ABR051Cp"
                     /protein_id="NP_982997.2"
                     /db_xref="GeneID:4619094"
                     /translation="MMAVKTANAEQAVKAEEQADTGAVPLGGKAVQAVVLAVTVHLAA
                     EVFGKDEAGRAAFYSALSVAAAYGAAAAAGRVPAFNAVYVVYLPVMVSLLFRRELVPV
                     NCAMALGGMQMPVVLRVLQQLTILYLQPAARGRGLRDVAALAVHQAVWWALARVSELR
                     SLDMVDCGLLSILLTNVLFVIGGESSVQFQILRACLYGFLVAVGANYVFVRAYGRRNQ
                     YVRTAVLLAVFALVFPSVILAFLDLDDTDNALVWLIKYIFSSALRMQIMAGWLVFLGV
                     LIPSVFVMKSHLSLNTSRKIWHFALLPLLVCQMAVEPEFTTVAIAGTVVVFLIVEYFR
                     YMNLYPFGDYINAQLRTFTDFRDEQGPIIVSYLYLILGVSFPLLINRSLVGVISLGVG
                     DSLASIIGRRYGKYHWPGTNKTVEGTLAFIVASAALCLVCQQAFLAFEGVATRNIILA
                     CVVSGILEGNSDLNDNILIPSFMLIFMELCKYY"
     gene            489239..489315
                     /locus_tag="AGOS_AgSNR78"
                     /old_locus_tag="AgSNR78"
                     /db_xref="GeneID:4619095"
     ncRNA           489239..489315
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR78"
                     /old_locus_tag="AgSNR78"
                     /product="AgSNR78"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR78; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149425.1"
                     /db_xref="GeneID:4619095"
     gene            489399..489475
                     /locus_tag="AGOS_AgSNR77"
                     /old_locus_tag="AgSNR77"
                     /db_xref="GeneID:4619096"
     ncRNA           489399..489475
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR77"
                     /old_locus_tag="AgSNR77"
                     /product="AgSNR77"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR77; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149424.1"
                     /db_xref="GeneID:4619096"
     gene            489531..489618
                     /locus_tag="AGOS_AgSNR76"
                     /old_locus_tag="AgSNR76"
                     /db_xref="GeneID:4619097"
     ncRNA           489531..489618
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR76"
                     /old_locus_tag="AgSNR76"
                     /product="AgSNR76"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR76; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149423.1"
                     /db_xref="GeneID:4619097"
     gene            489656..489735
                     /locus_tag="AGOS_AgSNR75"
                     /old_locus_tag="AgSNR75"
                     /db_xref="GeneID:4619098"
     ncRNA           489656..489735
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR75"
                     /old_locus_tag="AgSNR75"
                     /product="AgSNR75"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR75; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149422.1"
                     /db_xref="GeneID:4619098"
     gene            489810..489852
                     /locus_tag="AGOS_AgSNR74"
                     /old_locus_tag="AgSNR74"
                     /db_xref="GeneID:4619099"
     ncRNA           489810..489852
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR74"
                     /old_locus_tag="AgSNR74"
                     /product="AgSNR74"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR74; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149421.1"
                     /db_xref="GeneID:4619099"
     gene            489919..490019
                     /locus_tag="AGOS_AgSNR73"
                     /old_locus_tag="AgSNR73"
                     /db_xref="GeneID:4619100"
     ncRNA           489919..490019
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR73"
                     /old_locus_tag="AgSNR73"
                     /product="AgSNR73"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR73; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149420.1"
                     /db_xref="GeneID:4619100"
     gene            490152..490177
                     /locus_tag="AGOS_AgSNR72"
                     /old_locus_tag="AgSNR72"
                     /db_xref="GeneID:4619101"
     ncRNA           490152..490177
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR72"
                     /old_locus_tag="AgSNR72"
                     /product="AgSNR72"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR72; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149419.1"
                     /db_xref="GeneID:4619101"
     gene            <490378..>491907
                     /locus_tag="AGOS_ABR052W"
                     /old_locus_tag="ABR052W"
                     /db_xref="GeneID:4619102"
     mRNA            <490378..>491907
                     /locus_tag="AGOS_ABR052W"
                     /old_locus_tag="ABR052W"
                     /product="ABR052Wp"
                     /transcript_id="NM_208351.2"
                     /db_xref="GeneID:4619102"
     CDS             490378..491907
                     /locus_tag="AGOS_ABR052W"
                     /old_locus_tag="ABR052W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR014W (BUD22)"
                     /codon_start=1
                     /product="ABR052Wp"
                     /protein_id="NP_982998.2"
                     /db_xref="GeneID:4619102"
                     /translation="MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQG
                     KKAAQRVEKLLAGLTADGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLR
                     KNPKKDEQRNSKLQVLEGVQRGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAW
                     FQNHRILQQFGNKEDECNPGRVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVD
                     LVLGTKKERRQNSDAAEKTAVAARSAEGEDDSSSSDNAASDIDEGAASESEEENSDDE
                     AARSPSVDEDALVSQYAGMLAASDEEDDDPDGYHLDPNVDYNEVTDEEPDQSADETIQ
                     PDADDSSDSDSSAPPLKKQKTSKTKVQLPALMAGYYSGDDDSDAEEHDLAGKAEPLEP
                     PKRKNRRGQRARQKIWEKKYGRNAKHIQQQFEKEREERARKQREYEERAAKRAAKEAE
                     LARTRPAFKDSAIRAAEPGAAKSAAKPVAQELHPSWEAKKLSQEKQKAAKFQGKKIVF
                     D"
     gene            complement(<492209..>493756)
                     /locus_tag="AGOS_ABR053C"
                     /old_locus_tag="ABR053C"
                     /db_xref="GeneID:4619103"
     mRNA            complement(<492209..>493756)
                     /locus_tag="AGOS_ABR053C"
                     /old_locus_tag="ABR053C"
                     /product="ABR053Cp"
                     /transcript_id="NM_208352.1"
                     /db_xref="GeneID:4619103"
     CDS             complement(492209..493756)
                     /locus_tag="AGOS_ABR053C"
                     /old_locus_tag="ABR053C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR015C (ERG5)"
                     /codon_start=1
                     /product="ABR053Cp"
                     /protein_id="NP_982999.1"
                     /db_xref="GeneID:4619103"
                     /translation="MDAIGFGEQAGWLWRALAALWAWRVLAALVLVLVADQAAYRRNK
                     GRIAGPAWKMWPLIGPFLESLDPKFEVYQAKWASGPLSCVSIFHKFVVIASTRDLTRK
                     ILQSPKYVKPCLVDVAKKILRPTNWVFLDGQAHLDYRRSLNGLFTRDALARYLPSQEA
                     VIDRYMAKFVAFSRETDYEHRVFFHEMREMLCALSLKAFCGSYITDDQVRKIADDYYL
                     VTAALELVNFPLILPFTKTWYGKRTADMAMKIFERCAQEAKQHIAAGGEPTCVVDAWC
                     KLMLDAKAKDDADSRLLHRKFTNREMSEALFTFLFASQDASSSLACWLFQIVADRPDV
                     LAKIREEQLAVRRNDPSVPLSLELIDQMKYTHMAVKECLRYRPPVLMVPYQVHEAFAV
                     SADYTAPKGSMLVATMYPALHDPAVYENPDDYIPERWDGEQSPANQAKKNWLVFGSGP
                     HVCLGQKYVFMTFTALIGKFALFTEFDHKVTSLSEKIKVFATIFPQDDLLMSFKKRDP
                     LTGQTTE"
     gene            complement(<494056..>495000)
                     /locus_tag="AGOS_ABR054C"
                     /old_locus_tag="ABR054C"
                     /db_xref="GeneID:4619104"
     mRNA            complement(<494056..>495000)
                     /locus_tag="AGOS_ABR054C"
                     /old_locus_tag="ABR054C"
                     /product="ABR054Cp"
                     /transcript_id="NM_208353.1"
                     /db_xref="GeneID:4619104"
     CDS             complement(494056..495000)
                     /locus_tag="AGOS_ABR054C"
                     /old_locus_tag="ABR054C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL042W (SPC42)"
                     /codon_start=1
                     /product="ABR054Cp"
                     /protein_id="NP_983000.1"
                     /db_xref="GeneID:4619104"
                     /translation="MNISPTPKRYQSSNHMPRAVNHNYHSAVPAYHEHAAGQNADRIV
                     PDEYKINSNMISSLIKQNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKKLQA
                     QAQAARVPSPPEPAAEPAADYLQLPRRAPAAENDKKIGELYDKLEQLTKVVHQQHLHD
                     PPAPARPRSPARSRSPARTAVSDDDIMISESSELKRLEEQVDQLKRKVLIKSENELRK
                     LSLNQQLADLMHKLGVSSSSPASSALLFDRQPSPTSAASSAPLAHAHCEQCHHAEDAL
                     KKPAMDIKNALQTPTPSRTRRDAHPHTHTTHHATNALW"
     gene            complement(<495282..>497318)
                     /locus_tag="AGOS_ABR055C"
                     /old_locus_tag="ABR055C"
                     /db_xref="GeneID:4619105"
     mRNA            complement(<495282..>497318)
                     /locus_tag="AGOS_ABR055C"
                     /old_locus_tag="ABR055C"
                     /product="ABR055Cp"
                     /transcript_id="NM_208354.2"
                     /db_xref="GeneID:4619105"
     CDS             complement(495282..497318)
                     /locus_tag="AGOS_ABR055C"
                     /old_locus_tag="ABR055C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR016C (SOK2) and YKL043W (PHD1)"
                     /codon_start=1
                     /product="ABR055Cp"
                     /protein_id="NP_983001.2"
                     /db_xref="GeneID:4619105"
                     /translation="MSYYGDWYHYYPQSQQQDGHSTQSEQQAPLPGPLPPQQSNMVSA
                     QQPPQPAFGGLFGQHQSHNGRRPPGEPQKAQASAAGPGVYCYYYPQQPYSGYSPFFGG
                     TQGGGPAKVGGGRREEGPFRHGGCPAPTAYQYPGFQPATYGDPSGAARYAGYAQEQRA
                     AAHQTPAFTQHQQHEKPQQQPQPQQHQHQNQHQHQQRAAVPAAAAYMRQVGGPEALPA
                     TAATAASTATTTPVPTTNTSLQSNSPGATKNPFVEPVPSIIPQNSVGAGLGLGGTRVG
                     DGSPASTPATVKKNKAGEGSLLAIATGSHGNTAKAASVADSGSSSSGFESQGPRVTTT
                     MWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRHVVK
                     IGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQTSTTSGPAENGAKLG
                     KLIQATGAPSRNGPPPPYGQQDQQHGAAAAMSVPSQPRRASAVAASSLPQQTPYLVSS
                     YPSSSQPYYGRTGYLPQPISYANYDTGGSALSNYGYSPAGSTSTGTARPPPRSQSPFQ
                     ALTQVSALAQKQLNSKDQQLLPVGPIAALSSGTPALGQQHFQRREHMQNSLGRSTSDE
                     GHANMLPPPQALIQRDHTVPQGHPHLLSKFTPIATLSSTVAAEHPGSIVYSAKE"
     gene            complement(<498143..>499612)
                     /locus_tag="AGOS_ABR056C"
                     /old_locus_tag="ABR056C"
                     /db_xref="GeneID:4619106"
     mRNA            complement(<498143..>499612)
                     /locus_tag="AGOS_ABR056C"
                     /old_locus_tag="ABR056C"
                     /product="ABR056Cp"
                     /transcript_id="NM_208355.1"
                     /db_xref="GeneID:4619106"
     CDS             complement(498143..499612)
                     /locus_tag="AGOS_ABR056C"
                     /old_locus_tag="ABR056C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL045W (PRI2)"
                     /codon_start=1
                     /product="ABR056Cp"
                     /protein_id="NP_983002.1"
                     /db_xref="GeneID:4619106"
                     /translation="MFRQSKRRVAQRRHGDGADGATILAGLTAEEEQARYDQLYPAKL
                     SFYALPPVGEITLDQFETWAIDRLKVLLELESLIQRNRAGRELEQAMKPLLGKLLPLG
                     EEQEARRKDYYSHFILRLCFCRTAELRERFVRAETALFRLRFQMLTSADQARFVQSLD
                     LPLVQFIDEAEKQALGAQLYDAVAPQLLHQLQLTDEAQRRQFFQHERFLKLPFESVID
                     LVGPRHVLLRGGWAYLPQFMQLNHIAAEYAARLATDLRATYQHLPALAGDDRLPPILA
                     HLSAGHVVAPPPPPTGGGLTAADLAAEPVRAALPLCARGLLDGLAANHHLRYLGRQQL
                     ALFLKGAGMSADDALRFWADAFTAGPTSLDRFNREYRYALRHTYGLEGNRINYRPWDC
                     RTILAKPRPARNEFHGCPYRDWAPDRLAAALAAMQLAPPAVAAVRDACARREYTLACT
                     HVFDACHGHVAPSAPGHVPAPDMSHIVHPNQFFERARPA"
     gene            <500105..>501667
                     /locus_tag="AGOS_ABR057W"
                     /old_locus_tag="ABR057W"
                     /db_xref="GeneID:4619107"
     mRNA            <500105..>501667
                     /locus_tag="AGOS_ABR057W"
                     /old_locus_tag="ABR057W"
                     /product="ABR057Wp"
                     /transcript_id="NM_208356.2"
                     /db_xref="GeneID:4619107"
     CDS             500105..501667
                     /locus_tag="AGOS_ABR057W"
                     /old_locus_tag="ABR057W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR020W (FMS1)"
                     /codon_start=1
                     /product="ABR057Wp"
                     /protein_id="NP_983003.2"
                     /db_xref="GeneID:4619107"
                     /translation="MIENAGTPEYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARAR
                     TGGRLLQVESSVFPGRRYDLGASWHHDTLSNELFAEELRLPEAERAGYVFDDVPTMVV
                     SPAGRRLDGDFGLMLEALQREVEHYIEEQYFESLEARDMPFFELVMAYLYERRGVLTD
                     DQIQQLPGTVRFLEFWHAIDWKLLSAKLSEVENNGRNAFVLNYDKLLRRIESGVPREW
                     IRLGTEVTKIERVRDTVHITTADGACYVSKCAIVTVPQSVLELSLKPERVPGRIEFRP
                     PLNDNITSAFERAHYASLGKIFFEFDKCTWDTQRPRVAIAAKVPDDFSAQVRKAQDLQ
                     ELLRSASAQTEVKLGQDCFDFPQEFQNMVALAGIPTLIAFTQTPLTEHVERLSKQEIV
                     DYFKPAIVVALRALGSKEECLFDLGNTQPQDDSHPGPILKNVIFNPWSQDTYSRGSYT
                     GSHVDDDQLPLTVALNNGQDSRIRFAGEHTVMEGNGCTYGAWESGRREAEYVLEYLRR
                     FPLAHPQDGKKQ"
     gene            complement(<501722..>502777)
                     /locus_tag="AGOS_ABR058C"
                     /old_locus_tag="ABR058C"
                     /db_xref="GeneID:4619108"
     mRNA            complement(<501722..>502777)
                     /locus_tag="AGOS_ABR058C"
                     /old_locus_tag="ABR058C"
                     /product="ABR058Cp"
                     /transcript_id="NM_208357.2"
                     /db_xref="GeneID:4619108"
     CDS             complement(501722..502777)
                     /locus_tag="AGOS_ABR058C"
                     /old_locus_tag="ABR058C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR021C (MAC1)"
                     /codon_start=1
                     /product="ABR058Cp"
                     /protein_id="NP_983004.2"
                     /db_xref="GeneID:4619108"
                     /translation="MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDI
                     RKVILVDAGSQVPMEDEDTEECCDGGKTCGKMDRQPILFLKALKTQKALLVDGALKIM
                     IEDRANSDGVDKRFKFVTEKEFLLQNADMLEARDGCGCQRPGKRARVGCSTGAGSPHA
                     VEPYTYKGVYLSTQCSCDDSACQCANCLIHRKEEELDQFIRQSGVPLTSVDLEDRKPA
                     EAGACCGDRASGLLGYDYAANERTSCACSPVSCMCKDCEIHAEEVVSMNRLLLHGILN
                     TPLKRKMSIQYKGKLINSKFWWDILYLQCAVAREPQLEALDLLQWFDNIIETHGAALP
                     DAEPAATGLDYMLGKLS"
     gene            <503174..>503671
                     /locus_tag="AGOS_ABR059W"
                     /old_locus_tag="ABR059W"
                     /db_xref="GeneID:4619109"
     mRNA            <503174..>503671
                     /locus_tag="AGOS_ABR059W"
                     /old_locus_tag="ABR059W"
                     /product="ABR059Wp"
                     /transcript_id="NM_208358.1"
                     /db_xref="GeneID:4619109"
     CDS             503174..503671
                     /locus_tag="AGOS_ABR059W"
                     /old_locus_tag="ABR059W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR022W (UBC7)"
                     /codon_start=1
                     /product="ABR059Wp"
                     /protein_id="NP_983005.1"
                     /db_xref="GeneID:4619109"
                     /translation="MSKTAQKRLMKELQQLLRDSPDGIVAGPVSEDNLFLWDCLIEGP
                     ADSPYEGGVFNARLQFPRDYPLSPPKLTFTPSILHPNVYPNGEVCISILHAPGEDPNM
                     YEEASERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWRDNRADFERQVQESVR
                     RSLGL"
     gene            <503998..>505353
                     /locus_tag="AGOS_ABR060W"
                     /old_locus_tag="ABR060W"
                     /db_xref="GeneID:4619110"
     mRNA            <503998..>505353
                     /locus_tag="AGOS_ABR060W"
                     /old_locus_tag="ABR060W"
                     /product="ABR060Wp"
                     /transcript_id="NM_208359.2"
                     /db_xref="GeneID:4619110"
     CDS             503998..505353
                     /locus_tag="AGOS_ABR060W"
                     /old_locus_tag="ABR060W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL046C (DCW1)"
                     /codon_start=1
                     /product="ABR060Wp"
                     /protein_id="NP_983006.2"
                     /db_xref="GeneID:4619110"
                     /translation="MLAVTFTAAAVLSLLAASGRTLNLDVDDLQSIREATSLLATGLM
                     DYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYYMENSTYNDLLTDSLLHQAGED
                     LSYTPWNETTTEGNDDQFFWGMAVMAAAERNFPNPPADQPQWLALAQAVFNTMALRWD
                     METCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRYTGNATYLEWAERVYDWMY
                     GVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMAGCAFIYNHTQDELWHQ
                     RTLRFLDSARIFLSNDTLYEAGCQGGDNCNIDQRSFKAYFSRFLGLTAQLVPESRETI
                     VRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQMAALEIIQNLRCLERP
                     APYTAMNGGTSPGDPAAGTKTKAENLPPLDIKAGDRAGAGIITALIGSSFLACTLWLI
                     I"
     gene            complement(<505545..>507143)
                     /locus_tag="AGOS_ABR061C"
                     /old_locus_tag="ABR061C"
                     /db_xref="GeneID:4619111"
     mRNA            complement(<505545..>507143)
                     /locus_tag="AGOS_ABR061C"
                     /old_locus_tag="ABR061C"
                     /product="ABR061Cp"
                     /transcript_id="NM_208360.2"
                     /db_xref="GeneID:4619111"
     CDS             complement(505545..507143)
                     /locus_tag="AGOS_ABR061C"
                     /old_locus_tag="ABR061C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL047W"
                     /codon_start=1
                     /product="ABR061Cp"
                     /protein_id="NP_983007.2"
                     /db_xref="GeneID:4619111"
                     /translation="MSLRKQEAPLSPMVYHPRSGNFQLGSASHRVPLTAMCLTKFDVK
                     KGNTVLWTTSLAPEHKLHNIEFKTLPAGIHESEQDWVNFVLPKEDGEFYYGVALFSQN
                     GLRLVEEEQSHGVDRSRVEMYSLAVITDPQFRLDAMAESKYYRWKPNMFICANEYKED
                     LAQLMEQWLKSKSLEVLEHYFSYNKYQPDLGSPLLMRKWPGSSTLTGGSYEDYAQGSK
                     DDAETFKPSKSWLYLLPEIIEQLGPSIFTLWKACLLRQRILVVNEHGQSFERTNALTY
                     CLSVLSLIPLQLERKLAHANMPLQTLYTIGIADLDHLTDMVSDALHKSDPDGPHLPSF
                     IACTSDEILAERGELFDMVVKLSNYHGVKVYAHGTEVRATPHEWESFQYLSANFLYRE
                     YSEVEMNGYMKNVESLSWSQYIIDALYWWSTAGYLQPPYHNTSNLLANCDRVDEKNEV
                     EIVLGIVEYFHSKITLLYEKLHEIITDPDADASDRIAVPSLFLAECGLDCFSFQDHEF
                     LKTLCAQWFNVHIEIRVADFNVFC"
     gene            <507280..>507618
                     /locus_tag="AGOS_ABR062W"
                     /old_locus_tag="ABR062W"
                     /db_xref="GeneID:4619112"
     mRNA            <507280..>507618
                     /locus_tag="AGOS_ABR062W"
                     /old_locus_tag="ABR062W"
                     /product="ABR062Wp"
                     /transcript_id="NM_208361.1"
                     /db_xref="GeneID:4619112"
     CDS             507280..507618
                     /locus_tag="AGOS_ABR062W"
                     /old_locus_tag="ABR062W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL061W (BLI1)"
                     /codon_start=1
                     /product="ABR062Wp"
                     /protein_id="NP_983008.1"
                     /db_xref="GeneID:4619112"
                     /translation="MNEKQLRQQLDRCLDHVQEHVDMLSARAISKLSGDAVANHEWLS
                     ELSGRYPTRSAEELQQFRELKDGYVKKLDTLETEVKYLEDLGQELAEFQNELSVKLQR
                     IRRNSYVQEN"
     gene            complement(<507622..>509103)
                     /locus_tag="AGOS_ABR063C"
                     /old_locus_tag="ABR063C"
                     /db_xref="GeneID:4619113"
     mRNA            complement(<507622..>509103)
                     /locus_tag="AGOS_ABR063C"
                     /old_locus_tag="ABR063C"
                     /product="ABR063Cp"
                     /transcript_id="NM_208362.3"
                     /db_xref="GeneID:4619113"
     CDS             complement(507622..509103)
                     /locus_tag="AGOS_ABR063C"
                     /old_locus_tag="ABR063C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR023C (MSS1)"
                     /codon_start=1
                     /product="ABR063Cp"
                     /protein_id="NP_983009.3"
                     /db_xref="GeneID:4619113"
                     /translation="MLRTIGRRWLSVPATTYAPTIYALSTPMGQKSAIAVVRVSGTHA
                     RLVYEKLTDSKRPPTPRRASLRNLYSPQSAPEKVFLDSALTLFFEQPGTFTGEDILEL
                     HVHGGKAVVAGVLDAIGALHDESAGVQIRYAEAGEFSRRAFQNGRFDLTEIEGIGELI
                     DAETETQRRSAISSFRGQNRLLFAGWRQQIVDNIAQVAAIIDFGDDTEIQDIDAILEG
                     VRCSVKALRREVADFVERVTRSTILQSGIRLSVLGAPNAGKSSLVNCITKDDTSIVSS
                     IPGTTRDAIDVPLDINGYKVILTDTAGVRAHSTDPIELIGIARAQERTARSDIVLLVV
                     DATAATPLSPALRSHLRDLTDKCRLVVINKSDLVPPSRLKYIQTQLAAELPDCGPALV
                     ISCKQRDGLDALVHALTSHFTDLASCAAADPIAISARARDILRQDVLAGLDGFLRLAS
                     SAEVDVASESLRSAADGIGTITGDAVGVEEVLGVVFSNFCVGK"
     gene            <509679..>513011
                     /locus_tag="AGOS_ABR064W"
                     /old_locus_tag="ABR064W"
                     /db_xref="GeneID:4619114"
     mRNA            <509679..>513011
                     /locus_tag="AGOS_ABR064W"
                     /old_locus_tag="ABR064W"
                     /product="ABR064Wp"
                     /transcript_id="NM_208363.2"
                     /db_xref="GeneID:4619114"
     CDS             509679..513011
                     /locus_tag="AGOS_ABR064W"
                     /old_locus_tag="ABR064W"
                     /note="NOHBY214; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABR064Wp"
                     /protein_id="NP_983010.2"
                     /db_xref="GeneID:4619114"
                     /translation="MRTALLLSLGLVAAVDPSPVNEEVSLEERFEDVSTYDFDLDSIS
                     YLSHIAVEKAVDWLESHDISSISECFEYYNEHRLDPGTLEIAVSTGHEWYKSSDFFRQ
                     GIDLVAELMEKSRDSQKLQWWKHGLVQSLIRLGTVDLFEELLRDNFGVHFEKLADIYK
                     DMQVQLHSIDVVGGVVDAPHGNSLRAPKEFPWGGPNQGSGSSQGDSPSSPWDLPKEPP
                     TVRSKAPAGNGEKTEGNPLDYANPKKATAEFNFPKFKKPKDDEKKDGDKKDDKKDDKS
                     DNKDDKKDDKSDSKDDKKDDKSGKKDDKPDNKPDNKDDNKPDKKGDNKPDKKGDNKPD
                     KKDDKSDNNDAKKDGKKGEKSDRKDENKDDNSDKKDDKKDGKSDRKDENKDDNSDQKD
                     GKKDGKSDNKDEKSDDKSDNKDEKNDKSDKKDENKDDNSDKKDEKRDDNSDQKDEKRD
                     DKSGKKDGKRDEKRDDKSDKKDEKRDDNSDKKDEKRDDKSDKKDEKRDDNSDKKDEKR
                     DDKSDKKDEKNDKSDKKDGNDDKKDEKNDKSDKKDGNDDKKDDEKDCDKKDGDQKDDK
                     HDDKHDDKHDDKHDDKHDDKHDDKKKNKDKNDSDKKKKGGKHDEKHDDEKKDEDKHED
                     EKEEKKEDKSDKKEDKRDDKSDKKEDKRDDKSDKKEDKRDDKKDERDDKSDRKEDKRD
                     DKSGKKGDKSDKDDKSDEKDKNECGRFRKCRPIEKPDESKETNPKDDNSKGKKQEDQK
                     SKDGKNKDGKPSDDDKTEEKPDKSKGWTKPCDRWKKNKPKDGDNSGKPKEQNPNDEKD
                     KDSGKKGDEKSKPCDEPKVQPIEDEKDDKNSKGPKDSKDSKDSKDSINAVKATALPRG
                     KPLRDPALADRLKNAHLRSSALPKSQILDPKFPVEPTQKPVPSASLVPKESLVVLPKP
                     PATLVSPAEPPSSTAQPLETSEPAKPAEQAPRSTHKMSSIFIPRFKGFSKFLHAPNQA
                     VLNGQEAPPAAPEPAPEAAPEAAPEAGNPDADPAASASPVDGTQASSIVRYTRTAAAG
                     SSAASSDLSDAASTLLARRPGYVTFDGTFPTGKRLEKYYSNHTNGSSFIIDTNVSNVA
                     TNLHPWSFVGAVIVLVSSALLF"
     gene            <513287..>514321
                     /locus_tag="AGOS_ABR065W"
                     /old_locus_tag="ABR065W"
                     /db_xref="GeneID:4619115"
     mRNA            <513287..>514321
                     /locus_tag="AGOS_ABR065W"
                     /old_locus_tag="ABR065W"
                     /product="mitochondrial 54S ribosomal protein YmL3"
                     /transcript_id="NM_208364.2"
                     /db_xref="GeneID:4619115"
     CDS             513287..514321
                     /locus_tag="AGOS_ABR065W"
                     /old_locus_tag="ABR065W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR024W (MRPL3)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL3"
                     /protein_id="NP_983011.2"
                     /db_xref="GeneID:4619115"
                     /translation="MPQVIRALRCFHSGIFLRQGAVGATGAGGATELEKYRGYFKQLQ
                     QALETGDEEAAGKSPLLHTLHSRLALPQQLGLGTLSRCLNCPSANLADVGMKTAKTAQ
                     NKEQHNRSLNILGKNLLTLHAMRRLVERYPRLPVPVLNAAVDAYIGLPVLAQIGRGWG
                     IESERETVMERFLRQEPSHMTLGRLRFFNNTLKEIDGIRILSSSNMSESASMAMAVRS
                     IVGALWASTQDLQLVERFLDAHVMSRKLPITQLFMFEQPTRELARLCSREGLERPVSK
                     LIAETGRLSKAPVFVVGVFSGEEKLGEGFGSSLKEAKARAATDALMKWYCYQPLPSQG
                     PVIDPGQVLV"
     gene            <514446..>515195
                     /locus_tag="AGOS_ABR066W"
                     /old_locus_tag="ABR066W"
                     /db_xref="GeneID:4619116"
     mRNA            <514446..>515195
                     /locus_tag="AGOS_ABR066W"
                     /old_locus_tag="ABR066W"
                     /product="ABR066Wp"
                     /transcript_id="NM_208365.2"
                     /db_xref="GeneID:4619116"
     CDS             514446..515195
                     /locus_tag="AGOS_ABR066W"
                     /old_locus_tag="ABR066W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR025W (CSI1)"
                     /codon_start=1
                     /product="ABR066Wp"
                     /protein_id="NP_983012.2"
                     /db_xref="GeneID:4619116"
                     /translation="MEEWIIEEEVLLAASYYNAQSTSGVGRSRAGTSDEVPKAYLLLG
                     DESAKHVQTPVAIDVRVDAGSKQLMWDASLVAERVRLVQVIHTMQTVVGLLVAGTGKC
                     YSTFVLEIAARWPAVHNVFTYGRDGTLQCLDLTLGRQVAYVTAACGMRKYLPQKPAKA
                     GGKETDLEEQSRVLEALQQKVAQIVTYLEGIEGELELPQEEILRQCWLLVCRLRRPPS
                     RDIEEEILALETQCQLINVLTTQFETSMLLD"
     gene            complement(<515205..>516266)
                     /locus_tag="AGOS_ABR067C"
                     /old_locus_tag="ABR067C"
                     /db_xref="GeneID:4619117"
     mRNA            complement(<515205..>516266)
                     /locus_tag="AGOS_ABR067C"
                     /old_locus_tag="ABR067C"
                     /product="ABR067Cp"
                     /transcript_id="NM_208366.1"
                     /db_xref="GeneID:4619117"
     CDS             complement(515205..516266)
                     /locus_tag="AGOS_ABR067C"
                     /old_locus_tag="ABR067C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR026C (PEX12)"
                     /codon_start=1
                     /product="ABR067Cp"
                     /protein_id="NP_983013.1"
                     /db_xref="GeneID:4619117"
                     /translation="MDFYSNLPVDATATPTLFEITSSHEIDGLLKPTFQYLSANAIQR
                     APTRARIMLHSRFDELYALLKLLLEYYHLDKYNATFIEKYYGLQRESVAGGVAGARLS
                     RGQVAVVLCEKVAAVYVRDKLDQLHGRLYGRRLTAKLSAWERWFVRWYPHLKKLVAVA
                     SLLCKLRYLSGRSRATSVLDYLAGIQYARLSQPAGADAVAAAGAALARPVRTNWPRIR
                     ELIYRFLKTTGGALGVLTSELFPTFIFTVRLLQQWSQQPTKKQDPWDTLSSAPPAPRP
                     EVLVHGDAEATDAAEGEPYISVRCPVCRSAVSNPGVLQTGYIACYPCAVRYVEKHGKC
                     PVMQTPLLGGPRGIRKLIC"
     gene            complement(<516417..>517499)
                     /locus_tag="AGOS_ABR068C"
                     /old_locus_tag="ABR068C"
                     /db_xref="GeneID:4619118"
     mRNA            complement(<516417..>517499)
                     /locus_tag="AGOS_ABR068C"
                     /old_locus_tag="ABR068C"
                     /product="ABR068Cp"
                     /transcript_id="NM_208367.2"
                     /db_xref="GeneID:4619118"
     CDS             complement(516417..517499)
                     /locus_tag="AGOS_ABR068C"
                     /old_locus_tag="ABR068C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL060C (FBA1)"
                     /codon_start=1
                     /product="ABR068Cp"
                     /protein_id="NP_983014.2"
                     /db_xref="GeneID:4619118"
                     /translation="MGVQDVLKRKQGVIVGDDVRALFSYAREHKFAIPAINVTSSSTV
                     VAALEAARDSKSPIILQTSNGGAAYFAGKGVSNEGQYAAVQGATAAAHYIRSIAPAYG
                     VPVVLHTDHCAKKLLPWYDGMLEADEAYFKEHGEPLWSSHMLDLSEETDDENIATCVK
                     YFQRMAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYEALAPISPNFS
                     IAAAFGNVHGVYKPGNVVLSPEILGEHQQYAAAKVGGSEAKPLYLVFHGGSGSTQQEF
                     NTAISNGVVKVNLDTDCQYAYLQGIRDYVLNKKDYIMSMIGNPEGEDKPNKKFFDPRV
                     WVREGEKTMTKRIAEALQVFHAVNQL"
     gene            <517676..>519244
                     /locus_tag="AGOS_ABR069W"
                     /old_locus_tag="ABR069W"
                     /db_xref="GeneID:4619119"
     mRNA            <517676..>519244
                     /locus_tag="AGOS_ABR069W"
                     /old_locus_tag="ABR069W"
                     /product="ABR069Wp"
                     /transcript_id="NM_208368.1"
                     /db_xref="GeneID:4619119"
     CDS             517676..519244
                     /locus_tag="AGOS_ABR069W"
                     /old_locus_tag="ABR069W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR027W"
                     /codon_start=1
                     /product="ABR069Wp"
                     /protein_id="NP_983015.1"
                     /db_xref="GeneID:4619119"
                     /translation="MGAKVSFWGRGSVGQITWRGPVRHRVTRGRTRGHAAGCVSRAAL
                     EQPPARADARAGRAGQRLFIAGGRPARAARGPRMNAAPPPRKFRTDDAGTFGQYTARE
                     RWPRILQNCLEDLAAEHAEGAAAAQLRELTAQVAALKADVEADRALEFFSAAEERSAH
                     VPASFNSALASSGSRSWLAAEWLTCEIYLYRRLDVLVRAQPAWREHDVFERVKRETFR
                     QSGRGVVELAQWFCGAATQLARSRDALEPLFREFVDISLWGNATDLSLLTNVTAAEIE
                     SLQGAQARAAAEARVLVNDTAAAWAGLSAGPPGRVDFVLDNSGFELYADLLFALFLLD
                     AGLAAEVVFHTKDIPYMVSDTMDKDVEQLLADLEDGAFFAVGAAEREALDEVATRVRA
                     ALAAGRLRLRADSFWTEPQDFWELVPGHAVFEELRQARLVVFKGDLNYRKLTGDRRWP
                     RETPWATALGPLARHGLRVLSLRTCKADVVVGLPAGVDERLCAEWEREGHEHGSWWAT
                     CGRWAVVSYCDGKY"
     gene            complement(<519259..>520449)
                     /locus_tag="AGOS_ABR070C"
                     /old_locus_tag="ABR070C"
                     /db_xref="GeneID:4619120"
     mRNA            complement(<519259..>520449)
                     /locus_tag="AGOS_ABR070C"
                     /old_locus_tag="ABR070C"
                     /product="ABR070Cp"
                     /transcript_id="NM_208369.2"
                     /db_xref="GeneID:4619120"
     CDS             complement(519259..520449)
                     /locus_tag="AGOS_ABR070C"
                     /old_locus_tag="ABR070C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL059C (MPE1)"
                     /codon_start=1
                     /product="ABR070Cp"
                     /protein_id="NP_983016.2"
                     /db_xref="GeneID:4619120"
                     /translation="MSSTIFYRFRSQKDPSRILFDGTGITVFDLKRDIIQENKLGDGT
                     GFQLRLYNPDTGEEYDDDGTVVARSSMVIVRRAPAEHGVAGNASRYVQGRPRVAARAQ
                     GPAVGGSFGSYVAGGVGGGTEEERIARMFASQENQWQETQQAMSAAVPVYHSRSHGAA
                     QDEGPPPPGYMCYRCGGKDHWIKNCPTNSDPNFEGKRIRRTTGIPKKFLKSVEIDPLT
                     MTPEEMAERKIMVTDDGKFVVQVADQHSWEDYQRKQQQQKIAVREQDAVWLPNRFEDL
                     PAELKCPITNGLVRDPVRTARCCARLVSRAPMEDALLASDFVCPLCGAPDVLLDSLAP
                     DAESAKAVDEFLESHGSKRAADAPADDPTKTKMPMMPMPPFGMPFMFPMPFMPPVPPS
                     ESKK"
     gene            <520555..>520893
                     /locus_tag="AGOS_ABR071W"
                     /old_locus_tag="ABR071W"
                     /db_xref="GeneID:4619121"
     mRNA            <520555..>520893
                     /locus_tag="AGOS_ABR071W"
                     /old_locus_tag="ABR071W"
                     /product="ABR071Wp"
                     /transcript_id="NM_208370.2"
                     /db_xref="GeneID:4619121"
     CDS             520555..520893
                     /locus_tag="AGOS_ABR071W"
                     /old_locus_tag="ABR071W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL058W (TOA2)"
                     /codon_start=1
                     /product="ABR071Wp"
                     /protein_id="NP_983017.2"
                     /db_xref="GeneID:4619121"
                     /translation="MSTTGYYELYRRSTIGVALMDSLDTLISDGRIEASLAMRVLETF
                     DKVVSETLRDKTSAKLTFKGHLDTYRFCDDVWTFIIKDCQVNLDQPSADGAESSFTCE
                     RLHIVACNSK"
     gene            <520943..>521986
                     /locus_tag="AGOS_ABR072W"
                     /old_locus_tag="ABR072W"
                     /db_xref="GeneID:4619122"
     mRNA            <520943..>521986
                     /locus_tag="AGOS_ABR072W"
                     /old_locus_tag="ABR072W"
                     /product="ABR072Wp"
                     /transcript_id="NM_208371.2"
                     /db_xref="GeneID:4619122"
     CDS             520943..521986
                     /locus_tag="AGOS_ABR072W"
                     /old_locus_tag="ABR072W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR028W (TAP42)"
                     /codon_start=1
                     /product="ABR072Wp"
                     /protein_id="NP_983018.2"
                     /db_xref="GeneID:4619122"
                     /translation="MVTVRERYRALVAAAAGAAGRQDEEAYQAEVARTLEGLAEVREA
                     VHTLGLFSRNEGVEDVATGTLELLALDWQLARVAARRYRRGADARRWRLRCLEEAVQF
                     AMQFLVGLQDYGVLDEALSKRLDGFEKTFRPRVEEMYPQPQSARDLGGAHLRREAKIA
                     QFRRVRELEAQLDELEARRAAAGADEELERRLWLAQLQQMSYECFGELEGWLMEMELL
                     RNTEPADEPAAAAQATPDSQEYTEKLESLQKPLLSKYGKVLRNFTLVDQRDRVKERVL
                     GYGQYGPTMTVEEFLEQEFESGRVLQGGEEPEEVPDEDNEEWQDKQTYKEREWDEFKE
                     ANPRGSGNTMNKG"
     gene            complement(<522056..>525136)
                     /locus_tag="AGOS_ABR073C"
                     /old_locus_tag="ABR073C"
                     /db_xref="GeneID:4619123"
     mRNA            complement(<522056..>525136)
                     /locus_tag="AGOS_ABR073C"
                     /old_locus_tag="ABR073C"
                     /product="ABR073Cp"
                     /transcript_id="NM_208372.2"
                     /db_xref="GeneID:4619123"
     CDS             complement(522056..525136)
                     /locus_tag="AGOS_ABR073C"
                     /old_locus_tag="ABR073C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL057C (NUP120)"
                     /codon_start=1
                     /product="ABR073Cp"
                     /protein_id="NP_983019.2"
                     /db_xref="GeneID:4619123"
                     /translation="MAESQLSKLDVNLQSLNPYTFSKTRCIVNLHISDDTKNRDPSTT
                     NGSYSNSQLLSNGEHVCYHFSQDYCVLSIYPVTDAITGKTVVVHLPHETFNDHHTFTM
                     AEEDGCIVMDLILKTGLFLTLRFSLEYLFNRNADINSSWYSLLKPYDFTVRLPDYLYK
                     VNSALSIVYLNDGGLLGLQKTQTSGSDEYDLHPVLFNDNSYFQSFTRFFSHNDSGREN
                     VVSSVSYGDYHLLTLTENCKLRIWDLRTNSVTAQLNLITDPQDKHRKYESIGPYLALL
                     DSVLVVFLPFGNGAFRTFQLSVNNSGGLVLTPRGELIRTNLSTASIWSLVDTKLTKPF
                     ELNIETSYLQMVVLWKSNTSIKLQILNFETEALDKHSWVEASNKSLPDILDNDILGDN
                     FEQSLLDLKAHYTPAIYEEAQRILSANGIIFVPSQQNNDEYLSNLESILKDLKKHHDE
                     PSSLTLYNGEVVMVNTLYLYNHFVYKINSKLESFYYNLTSENEATQDDLLTYLQVVNG
                     FVSTLSSETLQRTSRKLCGLVTGELQGNMPLKDKFTAIFKECLESQFQVSNLKKLYDR
                     LTSLDIMTLLKSFIENHLQNSLLTPTLIDSMSFDNFSSVALLESVYQCVLIENKFIVD
                     TLLIFTLMDFNYSMFEKQLNFLLKTHYNQSLWLQLYRLDKSLLISEIFVATSKYGYGP
                     KISSYADLSAATKRIVTYIAEAPLLENPFLIAPYNKWIIHPKNNSTVRNPSFFLDTIH
                     TQFYVRENTVHQFMLGLSYYRCGRYEEAYSYLSRAETAAIKPKQLPLCLQLITKAANH
                     PWQSIISDLGVEPQAAGYYYNLSKLFSNVMSYSYALQSIKKSIALSQEVSPSTEFRIL
                     QLTQFMDTLIIFDEFEEVLDVLTLEQETLGRDIRTSYYERLLSDQQLRDRFITTLFRL
                     CSTSCEKLYLNLDDFLIIDSLLRSQLDASMWDTYKRLFCYRILNHHEREAAEVLYEYI
                     GRGNDPIVKEKCYWMIVNVLASLSPQDQWIINSSNRGQVVYLADIRKDLQALTA"
     gene            complement(<525487..>527178)
                     /locus_tag="AGOS_ABR074C"
                     /old_locus_tag="ABR074C"
                     /db_xref="GeneID:4619124"
     mRNA            complement(<525487..>527178)
                     /locus_tag="AGOS_ABR074C"
                     /old_locus_tag="ABR074C"
                     /product="ABR074Cp"
                     /transcript_id="NM_208373.2"
                     /db_xref="GeneID:4619124"
     CDS             complement(525487..527178)
                     /locus_tag="AGOS_ABR074C"
                     /old_locus_tag="ABR074C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR029C (FAR8)"
                     /codon_start=1
                     /product="ABR074Cp"
                     /protein_id="NP_983020.2"
                     /db_xref="GeneID:4619124"
                     /translation="MNQQSTGSLSAQYTLPGVMHYLQTEFTKNERDRINWELERCEMK
                     ARIAQLEGENRDLRRELVRCAQGHERPEEVQPVEPSLLKAKLSVQENVKEIVYLLKSP
                     QVTDQLDAWNEKGSSVHLLETMNLHVKKAAHGAPLTSGGTSPTSAELELGQPVAAGLP
                     GSRGYESDQDTVILEEPPVRVPPSSKQRGLAAPPLTPRDTPSMSLEGATGPLSNTSVI
                     QPVAGDSAPVAVEKLTLHQKNLLTLTETGHLKHWQINLNLELTDSLTQVSFEGLGPHV
                     LGLFWWDSKTFMTLDTNGLKVWSVELPEPVMLWECFQDLPFETVDMVDFKNKWLVLKV
                     AEKILIWKICTTGEQHTLQMSNDYEIWLHNQDPTFFILGLTEESLLVLYLDPCQLAVY
                     NFQGKILQQVDLSHLVKDLKPRGKNTTRLVLNKKTSKLLVQVNKQILIYSFDQKKIVA
                     SFELGNAPSHIIFKFNSESIILGYLDGTIEVRNLNNFETAVKRYNHFESVQSAHEQPQ
                     QSGFQKSPNTDAQIDALLDRNLTSMDIAVIDGVPVVVSGGTDGYIRLESVWAISY"
     gene            complement(<527391..>527894)
                     /locus_tag="AGOS_ABR075C"
                     /old_locus_tag="ABR075C"
                     /db_xref="GeneID:4619125"
     mRNA            complement(<527391..>527894)
                     /locus_tag="AGOS_ABR075C"
                     /old_locus_tag="ABR075C"
                     /product="ABR075Cp"
                     /transcript_id="NM_208374.2"
                     /db_xref="GeneID:4619125"
     CDS             complement(527391..527894)
                     /locus_tag="AGOS_ABR075C"
                     /old_locus_tag="ABR075C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL056C (TMA19)"
                     /codon_start=1
                     /product="ABR075Cp"
                     /protein_id="NP_983021.2"
                     /db_xref="GeneID:4619125"
                     /translation="MIIFKDLISGDELLSDAYDVKLVDGVIYEADCAMVKVGADNVDI
                     GANPSAEGGDEDVDDGTETVNNVVHSFRLQQTAFDKKSFLTYIKGYMKEIKNRLQETN
                     PDEIAIFEKGAQVYVKKVIGSFKDWEFFTGESMDPEGMLVLMNYREDGVTPFVAIWKH
                     GVKEEKI"
     gene            complement(<528015..>528830)
                     /locus_tag="AGOS_ABR076C"
                     /old_locus_tag="ABR076C"
                     /db_xref="GeneID:4619126"
     mRNA            complement(<528015..>528830)
                     /locus_tag="AGOS_ABR076C"
                     /old_locus_tag="ABR076C"
                     /product="ABR076Cp"
                     /transcript_id="NM_208375.2"
                     /db_xref="GeneID:4619126"
     CDS             complement(528015..528830)
                     /locus_tag="AGOS_ABR076C"
                     /old_locus_tag="ABR076C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL055C (OAR1)"
                     /codon_start=1
                     /product="ABR076Cp"
                     /protein_id="NP_983022.2"
                     /db_xref="GeneID:4619126"
                     /translation="MHSLAVAVVTGGTRGIGYQVVQRTLAEGLSCVFVGSSEASVATA
                     FDQLGCTPLREHQFVRGVALDLATWPAWPAQASFPCWERSAAGSAQRAAALLDLAPGG
                     PRRARYHYDLLVNCAGVSQASLAAHTSADAAARLLHVNLGSLVSLCQLSVRPMLRARR
                     VAHARPTIVNVASVLGCAHAQPPPGTAVYAASKSAVIQYSRALAAELERTGIACHAVA
                     PGLVPDTDMIAALPPDARARLAAAFPEAPTTPRAVCDHIWRLYRQPSPRAPGP"
     gene            complement(<529183..>531300)
                     /locus_tag="AGOS_ABR077C"
                     /old_locus_tag="ABR077C"
                     /db_xref="GeneID:4619127"
     mRNA            complement(<529183..>531300)
                     /locus_tag="AGOS_ABR077C"
                     /old_locus_tag="ABR077C"
                     /product="ABR077Cp"
                     /transcript_id="NM_208376.2"
                     /db_xref="GeneID:4619127"
     CDS             complement(529183..531300)
                     /locus_tag="AGOS_ABR077C"
                     /old_locus_tag="ABR077C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL054C (DEF1)"
                     /codon_start=1
                     /product="ABR077Cp"
                     /protein_id="NP_983023.2"
                     /db_xref="GeneID:4619127"
                     /translation="MSQQYSRRGGGKAKRTQVDAEKKFKLDTLTELFPDWTNEDLIDL
                     VHEFEDLETIIDKITTGAVTKWDEVKKPSKKDRQQKEPAGDVEHIHAGSAAAAFGASA
                     QAQGAPASLQRSHHSAGHQNNAKPYQRQSKYSNSPRQGKQQHQRKEKVAKENLKPAGQ
                     PAKSTASSTSWAAMLSKKEDSKLQAPEQQLEEQPQAQSQAQQTEEPVAKESQTEKKVG
                     PQPVAAPLHEEQDSKPKKMTWAAIASKPPKHAENASKKPQEILQNVQDLKKEINKIAT
                     EDTAVEHSETTVTHSEVGVNAQAEHESFPIEDGARSVGADDTYYAENVDATNEDAAAT
                     VNGNAPAASEEAAAQEDASNANANVPVSLPAEANHQASQQVSFGSEEKQQTPQQPSQQ
                     GGMHAGQHVVSQVPQSAQHSSQAAAQTSQQVASQAPQQQTPQQAYYQDTYTQQLPQQQ
                     AQAAQAQQYYMNQYQFPGYSYPGMFDSQSAYPVYNHQQFAVPQQGQPTAQSSQNSQQA
                     QSQSQQQQQQQQQQQQQQQQQQQQQQQQQQQYGIPPGYVQAGELAAQSPASTHTQPQQ
                     QPQYGGYGMPYYFYQQSFPYAQPQYGMAGQYPYQVPKAAYNYYQPQQMSQAGNQATHQ
                     SQSSQNDDSSSASAANPQQGQQGGANSQQQSQAAAAQAQAAAQAQFQQYYQFQQQAAA
                     NQQGMPYGYSGYDYTSQTSRGFY"
     gene            complement(<531646..>531900)
                     /locus_tag="AGOS_ABR078C"
                     /old_locus_tag="ABR078C"
                     /db_xref="GeneID:4619128"
     mRNA            complement(<531646..>531900)
                     /locus_tag="AGOS_ABR078C"
                     /old_locus_tag="ABR078C"
                     /product="ABR078Cp"
                     /transcript_id="NM_208377.1"
                     /db_xref="GeneID:4619128"
     CDS             complement(531646..531900)
                     /locus_tag="AGOS_ABR078C"
                     /old_locus_tag="ABR078C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL053C-A (MDM35)"
                     /codon_start=1
                     /product="ABR078Cp"
                     /protein_id="NP_983024.1"
                     /db_xref="GeneID:4619128"
                     /translation="MGNAMSASFAPECTPLKETYDQCFNTWYSEKFLRGRSTENECTE
                     SWYAYMHCVEAHLVKQGIKPALDEARKEAPFEDEGQTRSQ"
     gene            complement(<531960..>532505)
                     /locus_tag="AGOS_ABR079C"
                     /old_locus_tag="ABR079C"
                     /db_xref="GeneID:4619129"
     mRNA            complement(<531960..>532505)
                     /locus_tag="AGOS_ABR079C"
                     /old_locus_tag="ABR079C"
                     /product="ABR079Cp"
                     /transcript_id="NM_208378.1"
                     /db_xref="GeneID:4619129"
     CDS             complement(531960..532505)
                     /locus_tag="AGOS_ABR079C"
                     /old_locus_tag="ABR079C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL052C (ASK1)"
                     /codon_start=1
                     /product="ABR079Cp"
                     /protein_id="NP_983025.1"
                     /db_xref="GeneID:4619129"
                     /translation="MARQPPAPEPTLEQLDQEITLQLQKIDANLSACFSKITKDIIPA
                     VARYGAVCDDALSACSWLRELFQKSSDIQLATEPAAPAPAAESLFPQAPAPRAPEVTT
                     EGHVLAVPVSSDDEPDDGSTLQRQHKRRKLSLQLQQRYGSSSSSSFVSRSPTLRTRPA
                     SSPLRAPDDPDPPAVLRFAAR"
     gene            <533170..>534192
                     /locus_tag="AGOS_ABR080W"
                     /old_locus_tag="ABR080W"
                     /db_xref="GeneID:4619130"
     mRNA            <533170..>534192
                     /locus_tag="AGOS_ABR080W"
                     /old_locus_tag="ABR080W"
                     /product="ABR080Wp"
                     /transcript_id="NM_208379.2"
                     /db_xref="GeneID:4619130"
     CDS             533170..534192
                     /locus_tag="AGOS_ABR080W"
                     /old_locus_tag="ABR080W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL051W (SFK1)"
                     /codon_start=1
                     /product="ABR080Wp"
                     /protein_id="NP_983026.2"
                     /db_xref="GeneID:4619130"
                     /translation="MGFPPPGNYFFLVPWIAVIPWCGMLIAMLVCWSVQGHPIYWFMD
                     GDQFPVYISDIGATNLQPLFVTCVAWQGLWYCIMVACEFFQRSGHWPLPWLARQRLPA
                     DVEPVSSSSYMGSELSMRVRYAELLSSSRFLMPPYYTKHERNLIFASFVLGLIGELAI
                     LMCAIFSTAKFHKVHLSMVGVFVSMMYFSILCAAIEYLSMGRHYARLHPLAGSAAHVG
                     SASSRHGHVWNKLTVSGTVKMVWLFLAAAWAICFGAVKNPSISASFEWVLAFWLCAYY
                     VIVSVDFYMGSRYKESKYFHQITNFSGYYKYDQLVLGEAKLHVERVGHDAGQDYRGNT
                     PVDIVT"
     gene            complement(<534626..>537151)
                     /locus_tag="AGOS_ABR081C"
                     /old_locus_tag="ABR081C"
                     /db_xref="GeneID:4619131"
     mRNA            complement(<534626..>537151)
                     /locus_tag="AGOS_ABR081C"
                     /old_locus_tag="ABR081C"
                     /product="ABR081Cp"
                     /transcript_id="NM_208380.1"
                     /db_xref="GeneID:4619131"
     CDS             complement(534626..537151)
                     /locus_tag="AGOS_ABR081C"
                     /old_locus_tag="ABR081C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR031C (EIS1) and YKL050C"
                     /codon_start=1
                     /product="ABR081Cp"
                     /protein_id="NP_983027.1"
                     /db_xref="GeneID:4619131"
                     /translation="MSLVSAAVGDERGSGGQPHKKSVYKPNGQPLSKEALYRAQLKYG
                     TYKSPARGGNLGVQDSKTASDKAATTANSNKKAVEAYKRMFVDSNASKAASRAGQQPA
                     PASSAVEPAKQDTSPAAARAASGGQGLRGPTNPKAPALDISKVLEGAERAASKRIQER
                     INPEKVNFTYGLRTGPVESRSSSERTFSINNDLALKTKGDYLREIDGETDPDPTKLAN
                     YASSAAIKSYDANNPMDREVIERHARDTEMFKHLSSQQVLAKARANADATISKLDREA
                     KEKLIFSNEGYNKAAIEIAKKNHAERQRLTGGKVNLGGGLWVYPEEVEQVAQGLVNPV
                     LSDVDRRASEQREVDAEIAKRQAQYEADLAEWQAIQREKAENDALEQSQAVDRREIEL
                     YDTEETLQKKTVELAQEHAVIIEGKKLELNELKRQHAALLQQSTALYEQERAHIDAEL
                     SKQRQENAVSLELAREEEEKALEPVIGELCETEEEHARLVEERAKLETSLSTVLSELD
                     EYKKTVLELESQLLSTTASLEEQQKGLRALISSEKELEDDINNNLSTLVISSREEASS
                     TARELQVKEHEAEAVIKEHKADLARSQQLLEEEKQILMQTVDELNKLKEQAKVEEPHI
                     RPAVTLSVTESTIQQSTSSQPASVVQRAPMHQVGQQPQNVSAGESTVHQTVSTHPSGI
                     VQGSSSVSQPHAIHKPSSPMDEFYSKGAQQPEHLAKLTKSSGDKPSLKQRKVNGPAYV
                     ASSPSKKDSALGRFFHKLIPSKKSSGKGQHGVARSSTVPSRKMQTGQRPVQPATTSNQ
                     SVPRHLAREVEEDVDAEDVRDLLETQRASGGKIRKGSLFKEVF"
     gene            <537752..>539803
                     /locus_tag="AGOS_ABR082W"
                     /old_locus_tag="ABR082W"
                     /db_xref="GeneID:4619132"
     mRNA            <537752..>539803
                     /locus_tag="AGOS_ABR082W"
                     /old_locus_tag="ABR082W"
                     /product="ABR082Wp"
                     /transcript_id="NM_208381.2"
                     /db_xref="GeneID:4619132"
     CDS             537752..539803
                     /locus_tag="AGOS_ABR082W"
                     /old_locus_tag="ABR082W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR032W (HOF1)"
                     /codon_start=1
                     /product="ABR082Wp"
                     /protein_id="NP_983028.2"
                     /db_xref="GeneID:4619132"
                     /translation="MAQNYNYQLNFWDDQEEGVRILLRHVAQGLDACKNMVTFFEERS
                     KLEKDYSRKLGAIANRLEQQLESTPDYGNMQKCAELCRAEQSKLAQSHSKQAEQIYRE
                     NYLSLKEFVSDGQARYKTLEGKIRQLRQDKLQKRQMYDELLDKLEKAKAELREIQLNQ
                     INVVSGREMTANERQLNKWSAIVDELHRKIDVLGQEYKSAKRHWLQEWGPLSMDLQLL
                     EESRIQMTKTKLQEFVTFSTDCAIHEQISMDKMTNMLSGFTAQQDIHSFAYNHGTGRI
                     KSKSVEATFNKSASVATPVDKHTENMRILSSKLSRNRPASQRMPSNEFCRDPGSDNSS
                     VIVLDDDIMYGQPAKMCDNRISCISNDLADYSIQSRVSSVKRSSMHGRPIMSAASRSP
                     TEPSYLDRHPIDYADHTPQSAAMKGYLQQQQQTQNTEIRRAVREQQLQHREGRFNTGP
                     LSAGSSSSNSNPTDTTARSMATSADSMVTSISSYASSIDDSQRLAKSWNSRNRRKSRD
                     YSRPREADSRHSSDEDRILGQRTEMSGVTPTRSRSHHRKSLGSDVEGALRALEEDEMR
                     KRNGRDDRSSHAGRSAHSDDFESSRTINRQPQFIPFQRTKSVAMEWPKVTSKGRRVIG
                     YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVELL
                     S"
     gene            complement(<539923..>540537)
                     /locus_tag="AGOS_ABR083C"
                     /old_locus_tag="ABR083C"
                     /db_xref="GeneID:4619133"
     mRNA            complement(<539923..>540537)
                     /locus_tag="AGOS_ABR083C"
                     /old_locus_tag="ABR083C"
                     /product="ABR083Cp"
                     /transcript_id="NM_208382.2"
                     /db_xref="GeneID:4619133"
     CDS             complement(539923..540537)
                     /locus_tag="AGOS_ABR083C"
                     /old_locus_tag="ABR083C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL049C (CSE4)"
                     /codon_start=1
                     /product="ABR083Cp"
                     /protein_id="NP_983029.2"
                     /db_xref="GeneID:4619133"
                     /translation="MEQSMSSEQAERVAGRVEQLGGFQNNESINQRALLLLQRNRQRR
                     QLLQRQEDRTRYIPDDAKRRVVERVAEPAAAESRADGAREEERAARPARPRETRRIAK
                     KPQRYRPSDVALQEIRRYQRSTELLISRMPFARLVKEVTDQFTTVDQQMRWQSMAILA
                     LQEASEAYIVGLLEHTNLLALHAKRVTVMRKDMQLARRIRGQFI"
     gene            <540872..>542324
                     /locus_tag="AGOS_ABR084W"
                     /old_locus_tag="ABR084W"
                     /db_xref="GeneID:4619134"
     mRNA            join(<540872..540901,540960..>542324)
                     /locus_tag="AGOS_ABR084W"
                     /old_locus_tag="ABR084W"
                     /product="ABR084Wp"
                     /transcript_id="NM_208383.1"
                     /db_xref="GeneID:4619134"
     CDS             join(540872..540901,540960..542324)
                     /locus_tag="AGOS_ABR084W"
                     /old_locus_tag="ABR084W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR033W (ARP9); 1-intron"
                     /codon_start=1
                     /product="ABR084Wp"
                     /protein_id="NP_983030.1"
                     /db_xref="GeneID:4619134"
                     /translation="MAPLRQDSYFLIYPRSRTTLVQFGIGEETFVPPSWEVPTRVYRD
                     EEGQLTSFESAEVVYPIVDGRIADLDGLLYFLKLIYKSILSHWIAEHPDTWEAHASNI
                     PMLLLTHYSWSQREQELITQYVFEEMRLNHFMVVPAALSISYAFGSIQNCLVIDIGAT
                     HTDIVPIVDYVPLDYMAYSAPIGGDDINAKLATLLPGWSPEQIEDLKKSPIFEVLSKD
                     AKDQSRFNFDDDAADGEDNDEGTLDVAAIVTSGRDTREILEERERNKNKEQVSNSQLE
                     TNVFADRTGKQINVGKQRFQGCDDLLKGISQACGMVLAQIDEIPKNRAIWENILIAGA
                     TSEITGFREALLTQLCEDNLVLEPEGEKHQREQDMMASMPKQRKNKYIGSASVSGGFL
                     TSLEYLQSPTIIKSPKFPDYFTEWKKHGYGEVAFLGAQIVSKQVFGHSNDSFFMTRDK
                     YDEKGPAIIWDVCF"
     gene            complement(<542415..>543713)
                     /locus_tag="AGOS_ABR085C"
                     /old_locus_tag="ABR085C"
                     /db_xref="GeneID:4619135"
     mRNA            complement(<542415..>543713)
                     /locus_tag="AGOS_ABR085C"
                     /old_locus_tag="ABR085C"
                     /product="ABR085Cp"
                     /transcript_id="NM_208384.2"
                     /db_xref="GeneID:4619135"
     CDS             complement(542415..543713)
                     /locus_tag="AGOS_ABR085C"
                     /old_locus_tag="ABR085C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR034C"
                     /codon_start=1
                     /product="ABR085Cp"
                     /protein_id="NP_983031.2"
                     /db_xref="GeneID:4619135"
                     /translation="MRSMRSLGSRIWEHRVTQLIVGQWFYIGLAVAVVLAYYFPNVGR
                     HGGVISGEYTIGYGVVALIFLQNGLSISTKDLKVNIFNWRAHLVVQVLSFLVTSAITY
                     GLCCWIKSSNDPRIDDWVLVGVLMTSTLPTTVASNVVMTTNAGGNHILALAEVVIGNV
                     LGAFLSPLVAQMYMSTGPMKYGNPASGSSVKALYGQVLKQLSLVVFLPLIVGQVLRNV
                     FPKQVKWTLETLRLRFLGSVCLLFITWSAFSTAFYQKAFETVSRICIIFLVFFNIGMY
                     LFHTMTSFAVCRSPVIKRGFATRPGPDSSVLYTASYRIIQPFYFNRLDTVAVMFCAPA
                     KTATLGVPLVAAQYGSDSPNLGKLLVPVVIYQFEQIVVAAWLVPLLRAWCRKAKPKPD
                     LDQTYHDNISRPTTTTGQGIQTDMTHYLDEEPVKPSNYIH"
     gene            <544050..>544556
                     /locus_tag="AGOS_ABR086W"
                     /old_locus_tag="ABR086W"
                     /db_xref="GeneID:4619136"
     mRNA            <544050..>544556
                     /locus_tag="AGOS_ABR086W"
                     /old_locus_tag="ABR086W"
                     /product="ABR086Wp"
                     /transcript_id="NM_208385.1"
                     /db_xref="GeneID:4619136"
     CDS             544050..544556
                     /locus_tag="AGOS_ABR086W"
                     /old_locus_tag="ABR086W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR035W (IMP2)"
                     /codon_start=1
                     /product="ABR086Wp"
                     /protein_id="NP_983032.1"
                     /db_xref="GeneID:4619136"
                     /translation="MFTSRLAKCSLVAVTWLPVYMTVTHHVVFISKVEGPSMRPTLNP
                     MDGVASDWVLVWKLGKTNIRNLNHGDVVIFRSPMNPKKVYCKRIQGKQYDTVRTRYPY
                     PKSTCEVPKSHIWVEGDNVTQSVDSNHFGPISTGLVVGEVTRVIWPPSRWGADLHEGM
                     GRRAVVAS"
     gene            complement(<544661..>546067)
                     /locus_tag="AGOS_ABR087C"
                     /old_locus_tag="ABR087C"
                     /db_xref="GeneID:4619137"
     mRNA            complement(<544661..>546067)
                     /locus_tag="AGOS_ABR087C"
                     /old_locus_tag="ABR087C"
                     /product="ABR087Cp"
                     /transcript_id="NM_208386.2"
                     /db_xref="GeneID:4619137"
     CDS             complement(544661..546067)
                     /locus_tag="AGOS_ABR087C"
                     /old_locus_tag="ABR087C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR036C (MIH1)"
                     /codon_start=1
                     /product="ABR087Cp"
                     /protein_id="NP_983033.2"
                     /db_xref="GeneID:4619137"
                     /translation="MQEAGDSKGRRSSFHGGSSSFLKNLNSLLKLKKSPGRPAEGAEP
                     ANEPHLGDNAKERDRGLCTRPPGPVSRCSTGTVYRSPSHRRQGSSASAKREFKPSHAT
                     AVQHASHCCNCMLRGMQPPADSPAERGVTRGEAFANPVCSRGLESKSVPPYVYDSRLP
                     ASAIPWHTKDSSTDQLPRISVDVLAAILDGKFSSHYSEVYIIDCRFEYEFQAGHIKNA
                     INVSSRRELEAEFIQKRIQRCSADPGRPPLLVFHCEYSSYRGPIIAAHLRNYDRILNH
                     GQYPRLHYPDIVVLEGGFKSFIEAFPGFCQGHYVGMDSYVNHELELARFKRDSKTILT
                     RQNSQHIFQEQGQEGGHGLAGRAYQPDPVATLLPTRRPSFSFDAPPQSPSLVIGGNSG
                     SSACSCSSSTRSVLTGKMLLMHDLTTDVKACDKDDQDDQFSFDLGDELAITVEDLFSS
                     PVGRRLFPEIVKEEDNDS"
     gene            complement(<546573..>548171)
                     /locus_tag="AGOS_ABR088C"
                     /old_locus_tag="ABR088C"
                     /db_xref="GeneID:4619138"
     mRNA            complement(<546573..>548171)
                     /locus_tag="AGOS_ABR088C"
                     /old_locus_tag="ABR088C"
                     /product="ABR088Cp"
                     /transcript_id="NM_208387.2"
                     /db_xref="GeneID:4619138"
     CDS             complement(546573..548171)
                     /locus_tag="AGOS_ABR088C"
                     /old_locus_tag="ABR088C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL048C (ELM1)"
                     /codon_start=1
                     /product="ABR088Cp"
                     /protein_id="NP_983034.2"
                     /db_xref="GeneID:4619138"
                     /translation="MKSYPTIVQFNEGRHSLLLRSISSRSSSRLTDTVLGRSGCGGDA
                     VTYAALFEEYNKLVEMVLLQKTTRLIGGRESVQVNQYMLEGRLGRGRFGTVLRGRRVA
                     GCRRGQHDTAEVVALKCIMKRPVSSLFSMNQIMRKRARLQSSGGTPPGTLTATPEPTD
                     KVFRRSSTKSLTSIPVEYLDSDWIMIEMNLLRIRKECLIHGQLPPHPHVSRLLEIIDS
                     PRSDRVWLIQEFASLGELQWERASKQQVPEQWCQFMKPSVTRAEFALKVLRDLSLGLA
                     FLQKHGIVHRDIKPSNILLDGTRGTAKISDFGCSILKPDHLPWWKHDPEKQRWSRAFQ
                     DEVSKIVGTPAFIPPELCDFTLEEEGNSRKSPSGRPAADDPDRGFKVDIWSLGVTIYC
                     ILENRLPFFGENEFETYHMVVTAELSPLPEDPADPDLEWLYVFVTHGLLCKDWTRRPT
                     AQEVLTQLALHCGDHSSKMSKVKKKFSTWKRKIARSVVHRSAGQQPSESLTGTIFSHS
                     SSSSSNVSSIFTTDSSIELIESHR"
     gene            complement(<548518..>550233)
                     /locus_tag="AGOS_ABR089C"
                     /old_locus_tag="ABR089C"
                     /db_xref="GeneID:4619139"
     mRNA            complement(<548518..>550233)
                     /locus_tag="AGOS_ABR089C"
                     /old_locus_tag="ABR089C"
                     /product="ABR089Cp"
                     /transcript_id="NM_208388.2"
                     /db_xref="GeneID:4619139"
     CDS             complement(548518..550233)
                     /locus_tag="AGOS_ABR089C"
                     /old_locus_tag="ABR089C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL062W (MSN4) and YMR037C (MSN2)"
                     /codon_start=1
                     /product="ABR089Cp"
                     /protein_id="NP_983035.2"
                     /db_xref="GeneID:4619139"
                     /translation="MTSAEYTAYLLGAELGQGATAMGLTGAEGLYSNNSLNITAQPAD
                     KGMVTPQLVDTPNTLKSSKTQLGTPTAMTDLLAMLDDNTAFSDMVQQQEERQWDLERQ
                     RSKFAAQAASAVTSGRTTTSTELSPQMLLQSEVGGDSGLLDMVHDEHTSLLPLQQAEQ
                     QFINPNLLSSGAGSSMFADDGLIDEPIAHGSASQLIIDEMALSPGQRRLSDVVTGSIP
                     HQQHSRGSISHQVDFWNMSNERQSICSSHSATYPQRNSIDLMSFKKSPTPNMLSGVSG
                     VNIDSTTPVATSATGHMTTASSSHSNSATAVGTVAPSVFKIDNELTQLLNEYNINFNA
                     PSKTASTRMRAGSLNPTGSAAPTTSASGSNIISSAMAAASRRSNSVSEPHRVQKHRAS
                     MSVIDGANPVLMDKLYGDVNKVKPVQWESAVMSDDDDHEEQRLSVAQQLDPKSLPGAG
                     TFITPAVLDGLDNTSYDMRNPSYVVPTRRKRASVSKASRASKSSSPLEEEEKPFKCQE
                     CTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLKTHRKHGDIKDTPP
                     TTKKG"
     gene            <550926..>551180
                     /locus_tag="AGOS_ABR090W"
                     /old_locus_tag="ABR090W"
                     /db_xref="GeneID:4619140"
     mRNA            <550926..>551180
                     /locus_tag="AGOS_ABR090W"
                     /old_locus_tag="ABR090W"
                     /product="ABR090Wp"
                     /transcript_id="NM_208389.1"
                     /db_xref="GeneID:4619140"
     CDS             550926..551180
                     /locus_tag="AGOS_ABR090W"
                     /old_locus_tag="ABR090W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL063C"
                     /codon_start=1
                     /product="ABR090Wp"
                     /protein_id="NP_983036.1"
                     /db_xref="GeneID:4619140"
                     /translation="MQGGIRRKQDLLPRYNTPATRQAGLTTPLKKLLAYLVLLGLVFL
                     AVRTGLSGSAEPPAVELEAPRAPPVEERVAGGREADVAGM"
     gene            complement(<551190..>551906)
                     /locus_tag="AGOS_ABR091C"
                     /old_locus_tag="ABR091C"
                     /db_xref="GeneID:4619141"
     mRNA            complement(<551190..>551906)
                     /locus_tag="AGOS_ABR091C"
                     /old_locus_tag="ABR091C"
                     /product="ABR091Cp"
                     /transcript_id="NM_208390.1"
                     /db_xref="GeneID:4619141"
     CDS             complement(551190..551906)
                     /locus_tag="AGOS_ABR091C"
                     /old_locus_tag="ABR091C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR038C (CCS1)"
                     /codon_start=1
                     /product="ABR091Cp"
                     /protein_id="NP_983037.1"
                     /db_xref="GeneID:4619141"
                     /translation="MIDPSESFEATYAVPMHCGDCTGEISRALRAVPGVQEVTPDLER
                     QLVAVRGIAPPSSIVQALAATGRDAILRGSGEPDSAAVAILESASAGGPPVRGLVRAV
                     QVAPNKTLFDITLNGLPGPAQYYASIRASGDVSRGAASTGPAWHVFEDAVACERASPL
                     GADLCAGSALFVAPLAVQALIGRGFLVGADRGHALAGAAAVGVLARSAGAWQNDKVVC
                     ACSGDTLWQERGSARSANIA"
     gene            complement(<551989..>554994)
                     /locus_tag="AGOS_ABR092C"
                     /old_locus_tag="ABR092C"
                     /db_xref="GeneID:4619142"
     mRNA            complement(<551989..>554994)
                     /locus_tag="AGOS_ABR092C"
                     /old_locus_tag="ABR092C"
                     /product="ABR092Cp"
                     /transcript_id="NM_208391.2"
                     /db_xref="GeneID:4619142"
     CDS             complement(551989..554994)
                     /locus_tag="AGOS_ABR092C"
                     /old_locus_tag="ABR092C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL064W (MNR2)"
                     /codon_start=1
                     /product="ABR092Cp"
                     /protein_id="NP_983038.2"
                     /db_xref="GeneID:4619142"
                     /translation="MSDKASGELAVPLLHESTGQNGKHAKKKKGRRRSVFQHSSPDDG
                     CDGGPTGPAVYAKDFGKPEVWGMLHDSDEDSTMGRRASGGAGASFIDHRQSMAVMDAA
                     ASSQNAASGCMNSIWRRPSTMPRNSTPGAMSMEGTARQGRETSFRDPFGAHSQDDSRP
                     RRRRHSSKASLRDPERAAGGQDYGSLSTFPDKLSQSPLARDRRADVVIDMDKLMEHVK
                     MKREQEQLRDPFSSDAHSDRPSDEYNSQPSSRRSSESSSLDDVCLPIDEVDEDGYKEW
                     PDVSVLEEFSKEEIQRLKREALSDAEDFHFRYEDEDDDDTADSMQNNGIAFLHPIITN
                     IDMPELGNTRVNETEQLRKGRLRPKKLTPWHLKRGSFDLPGLNAAGKPTTRDLSGHGR
                     GDLLAGRNIKYPPHIISNNPETFRFTYFREDLDSTIHSPTISGLLQPGQRFEELFVGS
                     VYSNSGGDRAGSNNANGTAAVSHAPGNINPNVHGAPSNANLANLGAPANNENSTQHAP
                     NHPSVAAAGMNAGTGSGTPVETQASTPVQPASTAQQSGSWDMPDPQPFWLDVLNPTEE
                     EMKVLSKAFGIHPLTTEDIFLGEVREKVELFRDYYLVCFRSFDIVAERSTRKKKRQQQ
                     FQENAGSGAEESSAEEDSKAGWFSRFRKMRRRSSAKNAAGSSTSSYQRRIKKKIEENE
                     KYKKKSGDRRKPRDGELEPLNVYIIVFRTGVLTFHFAPTPHPINVRRRARLLKDYLNV
                     TADWIAYALIDDITDAFAPMIELIEDEVYDIEDAILNMHHIDDSSDDDSDAEDCSDDD
                     GSFPFDRHSRSTAFSRGSKSTGTSRSSSSTESTINANIMGWKKKGDMLRRIGECRKRV
                     MSVIRLLGSKADVIKGFAKRCNEQWEVAPRSEIGMYLGDIQDHIITMVASLNHYEKLL
                     SRSHSNYLAQINIDMTKVNNDMNDVLGKITILGAIVMPMNIITGLWGMNVIVPGQQQD
                     SLTWFVSIALSMLILAYIAYTYMRRRFGF"
     gene            complement(<555260..>555904)
                     /locus_tag="AGOS_ABR093C"
                     /old_locus_tag="ABR093C"
                     /db_xref="GeneID:4619143"
     mRNA            complement(<555260..>555904)
                     /locus_tag="AGOS_ABR093C"
                     /old_locus_tag="ABR093C"
                     /product="ABR093Cp"
                     /transcript_id="NM_208392.2"
                     /db_xref="GeneID:4619143"
     CDS             complement(555260..555904)
                     /locus_tag="AGOS_ABR093C"
                     /old_locus_tag="ABR093C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR039C (SUB1)"
                     /codon_start=1
                     /product="ABR093Cp"
                     /protein_id="NP_983039.2"
                     /db_xref="GeneID:4619143"
                     /translation="MSFNSFPSNQLYGAHRYSSAYNAVAVPDSGPGAGRYRKRKTQEA
                     AEDNVFFELGKNKRVTVRQFRNINLVDIREYYQESATGEMKPGKKGISLTEEQYDELL
                     QHRGQIDEALRSFGSARRRSPPAEPARAEPVRELEPNKKTRIERREKARKRERMPANP
                     RLDNPRLDNPRLDDACPPRPAAHDDDDLNSSDEDFAQALESEVRRRDEDISEEE"
     gene            <556183..>557262
                     /locus_tag="AGOS_ABR094W"
                     /old_locus_tag="ABR094W"
                     /db_xref="GeneID:4619144"
     mRNA            <556183..>557262
                     /locus_tag="AGOS_ABR094W"
                     /old_locus_tag="ABR094W"
                     /product="ABR094Wp"
                     /transcript_id="NM_208393.2"
                     /db_xref="GeneID:4619144"
     CDS             556183..557262
                     /locus_tag="AGOS_ABR094W"
                     /old_locus_tag="ABR094W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR041C (ARA2)"
                     /codon_start=1
                     /product="ABR094Wp"
                     /protein_id="NP_983040.1"
                     /db_xref="GeneID:4619144"
                     /translation="MRCAVFQRRRRREHVMELRTTVRRVKELDIVELPELILGGATLS
                     PRYIDDPYEVPTLGLVRRALEAGICAIDTSPYYGKSEEIYGEALAAVRDEHPRETYFI
                     CTKVGREGPSDFDYSAAHVRASVHRSCARLHTEYLDLVYLHDIEFVEAAGIWEALQEL
                     RRLKDEGVIRFFGISGYPVELLQEVSEQACERPDVGPLDAVLTYCQLTLQSVRLLEQE
                     ERFFRQSRVRVLGNSSIVGMRLLRSGGPRPFHPASVELRQCAEEAAEYCAAHGTDLAD
                     LATRYSLAEWHGRGPTVLGVSTMDELERALKNYHLVLEQGGLSEKDTALVEHIQKRIF
                     ADHLNENWPSGLWSRFLRRPGAVPT"
     gene            complement(<557279..>557845)
                     /locus_tag="AGOS_ABR095C"
                     /old_locus_tag="ABR095C"
                     /db_xref="GeneID:4619145"
     mRNA            complement(<557279..>557845)
                     /locus_tag="AGOS_ABR095C"
                     /old_locus_tag="ABR095C"
                     /product="ABR095Cp"
                     /transcript_id="NM_208394.2"
                     /db_xref="GeneID:4619145"
     CDS             complement(557279..557845)
                     /locus_tag="AGOS_ABR095C"
                     /old_locus_tag="ABR095C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL065C (YET1) and YMR040W (YET2)"
                     /codon_start=1
                     /product="ABR095Cp"
                     /protein_id="NP_983041.2"
                     /db_xref="GeneID:4619145"
                     /translation="MSMYLTLLFLVLILEMSVLFVLVLPLPFRIRRLFVRSYDKLQEL
                     GQLRTVGVILYGLVGMLFLDSWWRAQRATQRFSEGATQDPLNTGLQTFATKAYNERNL
                     YISGFILYFSICIPTVINILKSLIRQYELGAAAAGDDTEEVKLLRQELKGKQASLTAL
                     RAQKKNLETHFDSSTESGPQDTAAKKAQ"
     gene            complement(<558591..>559046)
                     /locus_tag="AGOS_ABR096C"
                     /old_locus_tag="ABR096C"
                     /db_xref="GeneID:4619146"
     mRNA            complement(<558591..>559046)
                     /locus_tag="AGOS_ABR096C"
                     /old_locus_tag="ABR096C"
                     /product="ABR096Cp"
                     /transcript_id="NM_208395.2"
                     /db_xref="GeneID:4619146"
     CDS             complement(558591..559046)
                     /locus_tag="AGOS_ABR096C"
                     /old_locus_tag="ABR096C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL067W (YNK1)"
                     /codon_start=1
                     /product="ABR096Cp"
                     /protein_id="NP_983042.2"
                     /db_xref="GeneID:4619146"
                     /translation="MSDERTFIAIKPDGVQRGLISQILSRFESRGYKLVGIKLVTPTE
                     NLLKQHYAEHVEKPFFPKMLAYMTSGPILATVWEGKDVVKQGRVILGATNPLNSAPGT
                     IRGDFALDMGRNVCHGSDSVESAQREIDLWFKKEELVDWKLNQLSWIYE"
     gene            complement(<559364..>560773)
                     /locus_tag="AGOS_ABR097C"
                     /old_locus_tag="ABR097C"
                     /db_xref="GeneID:4619147"
     mRNA            complement(<559364..>560773)
                     /locus_tag="AGOS_ABR097C"
                     /old_locus_tag="ABR097C"
                     /product="ABR097Cp"
                     /transcript_id="NM_208396.2"
                     /db_xref="GeneID:4619147"
     CDS             complement(559364..560773)
                     /locus_tag="AGOS_ABR097C"
                     /old_locus_tag="ABR097C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR044W (IOC4)"
                     /codon_start=1
                     /product="ABR097Cp"
                     /protein_id="NP_983043.2"
                     /db_xref="GeneID:4619147"
                     /translation="MPTHLYQPTDIVLAKVKGYPSWPAMIIPQEIIPPNVIKLHRRSQ
                     RQQEEADDEGNEDENEDESKYIIYSDLLKFRKFERVQSSYCLKFLCDDTYTWVKAQDI
                     TLLSTERCREWLDRSGSGKRQHKNKKLIQAYEMASKGSGEIDVWEFVEYGSAGRPEED
                     EEEYVDESPAGDDDDAEELQEFGEDEMLDDDDDDDDDDDEMEDRQKRKTRSAVRPTRS
                     SKRQRAAREKVQQERPLRRTRSTRARAEPAPDSDDFDEEMDEESEEVDIPSRSSTRRH
                     TRRTSPADKKQISNGKKAAAEPERYRYEDDEDWQLVGKGPQDLTVHSSNPLVNRLSQK
                     KNLELHNELKLDLQDKLLMTNKLLMEAILNSHATQEEFEVILDELDIALGMKGTHNEL
                     ITVFLGNNELLANFRALFNLKQPALKEFGLWDKFMGIFSDIYGFAYVPEQKPWTLHID
                     ADADTASETVPDGITDDKP"
     gene            complement(<561396..>562016)
                     /locus_tag="AGOS_ABR098C"
                     /old_locus_tag="ABR098C"
                     /db_xref="GeneID:4619148"
     mRNA            complement(<561396..>562016)
                     /locus_tag="AGOS_ABR098C"
                     /old_locus_tag="ABR098C"
                     /product="ABR098Cp"
                     /transcript_id="NM_208397.2"
                     /db_xref="GeneID:4619148"
     CDS             complement(561396..562016)
                     /locus_tag="AGOS_ABR098C"
                     /old_locus_tag="ABR098C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR043W (MCM1) and YMR042W (ARG80); Tandem gene
                     duplication in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABR098Cp"
                     /protein_id="NP_983044.2"
                     /db_xref="GeneID:4619148"
                     /translation="MSDAEKAEQPQQKERRKIEIKFIQDKTRRHITFSKRKHGIMKKA
                     YELSVLTGTQVLLLVVSETGLVYTFTTPKFQPIVTQPEGKNLIQACLNAPEEEEEDED
                     EDEDEVKDEDKPDVSVGGVAGPNAVQDVPGNPGPVDVGVPADHVAAAHSVAAATAHHH
                     AVAAHHHQLSPQQQQNFNNPAAYLNAEQAAVYQQYFNGVNSQQGQY"
     gene            complement(<562402..>565761)
                     /locus_tag="AGOS_ABR099C"
                     /old_locus_tag="ABR099C"
                     /db_xref="GeneID:4619149"
     mRNA            complement(<562402..>565761)
                     /locus_tag="AGOS_ABR099C"
                     /old_locus_tag="ABR099C"
                     /product="ABR099Cp"
                     /transcript_id="NM_208398.2"
                     /db_xref="GeneID:4619149"
     CDS             complement(562402..565761)
                     /locus_tag="AGOS_ABR099C"
                     /old_locus_tag="ABR099C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR047C (NUP116) and YKL068W (NUP100)"
                     /codon_start=1
                     /product="ABR099Cp"
                     /protein_id="NP_983045.2"
                     /db_xref="GeneID:4619149"
                     /translation="MFGASRPAFGNTGAPAFGQQQTGSFGQPQSTTNAFGPSTGTNAH
                     SGFGGFGNTQQQPAASPFGMSTQPQPASGPFGQGTSSVSNPPSLFSGNASGVAASGGT
                     GIKPFTAYTEKDATTGGTNVFQSITCMPEYKSFSFEELRFQDYQANNKVGQAGGGVGG
                     GVSSAFGAPSGTSPFGTNSQGTFGVGTTNAASTGGLFGQNNANTNNSPFGQTSTSNAF
                     GQPANSPFGQSNTTNAFGQNTGMSTNSPFGQGNAAANSPFGMNKTSTTSTGGLFGQQN
                     TTGGFGQAGATGTGLFGQSAGTNTSTPFGQSNTFNQAGTTSAGGLFGQNTNRQQSGNL
                     FGSTNQQNGSMFGQNNQTTTGGLFGSNPTNTFGQNTASGNLFNKPATTGGGLFGQNTT
                     QPSGGGLFGQNNTTNAFGQSNPSSGGLFGQNNQSMPQGGMLGQGTQQQNGFIGQSNQQ
                     QQGGLFGQNMQQSQQQGGLFGQNSANNTFRQNNNTGGLFGNKPAAAGGLFGQNTTGST
                     FGQSNNSGGLFGQTNNQQQGNVFGTNNQQQGGLFGQNNNQQGTGLFGQNSNPQQGNGI
                     LGQNNQQQSGGLFGQNSNPQNNQQGGLFGSKPANTTGGGLFGNNSSTTGNGLFGANNQ
                     QQTQQAGGLFGNNNGQSTTGSGGLFGNKSAGASAGGGLFGNNTTQTGSTGGGLFGNNT
                     STGNTNGTGGGLFGSKPADASSVTGGASGGLFAPKPAGAASGGLFASKPAATTTGGLF
                     GSKPAGSATGGLFGNNSSTSNNTGIGALQQSGINGAAVGAAQQSNPYGTNELFSRVIL
                     PNSLTQPSKPSATKLNADNKKRASLTSAYRLAPKPLFTAKSKPATAMPGTLHRKASLS
                     TSQESLREKIPPSTGSTVFSSETDEIILASCHKLFNPDKKSFKNLVLNRKKMEDAGAG
                     YEESEPKRITFAPADREPSPAEPAPAPAPPKDSLSAEPAPAPAEQPSPAPGLLGDDIG
                     FGDDGYYIAPALDSLAAMSLLQLRRVSGLVVGHHLHGRIEFLAPVDLSNIPLPAICGN
                     LVRFTEKVCEVSYVGSEPPAPGEQLNVRARISLHNTFPTDKASRLPIKDPKHPILKRH
                     IEKLKKIEHTRFEAYDVKTGTYTFIVDTPVA"
     gene            complement(<565990..>566211)
                     /locus_tag="AGOS_ABR099WA"
                     /old_locus_tag="ABR099W-A"
                     /db_xref="GeneID:4619150"
     mRNA            complement(<565990..>566211)
                     /locus_tag="AGOS_ABR099WA"
                     /old_locus_tag="ABR099W-A"
                     /product="ABR099W-Ap"
                     /transcript_id="NM_208399.1"
                     /db_xref="GeneID:4619150"
     CDS             complement(565990..566211)
                     /locus_tag="AGOS_ABR099WA"
                     /old_locus_tag="ABR099W-A"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL068W-A"
                     /codon_start=1
                     /product="ABR099W-Ap"
                     /protein_id="NP_983046.1"
                     /db_xref="GeneID:4619150"
                     /translation="MSLPVGSPKHGKACCSLELCAPHGADVPRVSPYIPYHDEDEDLI
                     VDFSTGSLQATSLKTWQVMEELMGRLERL"
     gene            <566817..>567539
                     /locus_tag="AGOS_ABR100W"
                     /old_locus_tag="ABR100W"
                     /db_xref="GeneID:4619151"
     mRNA            <566817..>567539
                     /locus_tag="AGOS_ABR100W"
                     /old_locus_tag="ABR100W"
                     /product="ABR100Wp"
                     /transcript_id="NM_208400.2"
                     /db_xref="GeneID:4619151"
     CDS             566817..567539
                     /locus_tag="AGOS_ABR100W"
                     /old_locus_tag="ABR100W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR048W (CSM3)"
                     /codon_start=1
                     /product="ABR100Wp"
                     /protein_id="NP_983047.1"
                     /db_xref="GeneID:4619151"
                     /translation="MSSVGPLEDEAAGTELGGSPADPATLTEIDPSAIQVRKTRTVVK
                     LDCERLVSKKGLPYLLKNAPKHARISKRRDTYGNLCHVLQFYQLWAHELYPKAKFKDF
                     VALCDRLGKTDRQLRAYRMQLIREELGLAAEGLDPPPQPLREHTGAGGSQPAGSVAQD
                     TNTNADLSDDDLLYTTSRAAAASSTANPVPRSETPAALAGVDEAELLAQLAEMQRAAE
                     EDVHESEDDEQLALMREMDEFM"
     gene            complement(<567608..>570091)
                     /locus_tag="AGOS_ABR101C"
                     /old_locus_tag="ABR101C"
                     /db_xref="GeneID:4619152"
     mRNA            complement(<567608..>570091)
                     /locus_tag="AGOS_ABR101C"
                     /old_locus_tag="ABR101C"
                     /product="ABR101Cp"
                     /transcript_id="NM_208401.2"
                     /db_xref="GeneID:4619152"
     CDS             complement(567608..570091)
                     /locus_tag="AGOS_ABR101C"
                     /old_locus_tag="ABR101C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR049C (ERB1)"
                     /codon_start=1
                     /product="ABR101Cp"
                     /protein_id="NP_983048.2"
                     /db_xref="GeneID:4619152"
                     /translation="MVHSKKDKSVMKHSDIKKRGAAVLEEEDVLQQDEQLLVDGATID
                     CDSDDDEEFQSAEEEVLSSGSESSSKEGSTPGSPVEGSDEEAEDEDADEEEDEDAEFN
                     RLLAAEEGDSEGEYGSEDFSDDNDTRPLREKLSSMQLKMIPDGESASVKTRYSDGTPR
                     IIKPEITPVYDSDDTDVETANTIGNIPLSAYDEMPHIGYDINGKRIMRPAKGSALDAL
                     LDTIELPEGWTGLLDQNTGSSLNLTPEELDLISKIQKNEQVDDSVDPYEPYVDWFTRH
                     EEIMPVTAIPEPKRRFVPSKHEAKRIMKIVKAIREGRIIPPNKLRELREQEQANNFSY
                     DLWGDSEETNEHIMNLRAPKLPPPTNEESYNPPEEYLLTPEERAEWEKMDPSDRKRNF
                     LPQKYGSLRKVPGYGESVRERFERSLDLYLAPRVRKNKLNIDPESLIPELPSPKDLRP
                     FPIRCSTVYAGHKGKIRTLSIDPSGLWLATGSDDGTVRVWEILTGREVYKATIVDIKN
                     NQDDHIETVEWNPDKTVGLLAVAAGENIYLLVPPIFGFEVENNSRLKIENGYGFDTFG
                     NVKKSALNVNSDDEQAETEATVKKQVAQWNKPTQKQAENDVAIVITCRKTVKKISWHR
                     KGDYFVSVQPESGHTSVLIHQLSKHLTQSPFNKSKGIIMDAKFHPFKPQLFVCSQRYI
                     RIYDLSQQVLVKKLLPGARWLSTIDIHPRGDNLIASSFDKRVLWHDLDLAATPYKTLR
                     YHEKAVRSVGFHKKLPLFCSAADDGTIHVFHGTVYDDMMKNPLLVPLKKLTGHKLVNS
                     LGVLDTVWHPREAWLFSAGADNTARLWTT"
     gene            570576..570649
                     /locus_tag="AGOS_t0037"
                     /db_xref="GeneID:4619153"
     tRNA            570576..570649
                     /locus_tag="AGOS_t0037"
                     /product="tRNA-Val"
                     /codon_recognized="GUU"
                     /db_xref="GeneID:4619153"
     gene            <571124..>573799
                     /locus_tag="AGOS_ABR102W"
                     /old_locus_tag="ABR102W"
                     /db_xref="GeneID:4619001"
     mRNA            <571124..>573799
                     /locus_tag="AGOS_ABR102W"
                     /old_locus_tag="ABR102W"
                     /product="ABR102Wp"
                     /transcript_id="NM_208402.2"
                     /db_xref="GeneID:4619001"
     CDS             571124..573799
                     /locus_tag="AGOS_ABR102W"
                     /old_locus_tag="ABR102W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR095C (SYT1)"
                     /codon_start=1
                     /product="ABR102Wp"
                     /protein_id="NP_983049.2"
                     /db_xref="GeneID:4619001"
                     /translation="MDTLALRAKILPAQEDGVSERESSESCCSSPRLDEDNTATKRRL
                     RKLRSCVSSLPTLSLRIGGPEKKLLGPTVIPRSTKKIFTSSWLSMVANAKRQGGSDVP
                     TINVTPGSHGREATAGVKLNQQHVLSRDMGGEIALRKRALLKRNNSDNDYLTMKHNAR
                     HIPSTCTMRDSSLDNSLLSVDAPMQVRRRSRTMDSFDCSMTSKSLFHLNRLRSNSSTS
                     TTVTSSPAGTGTGHTISPHVISTPRDSLSSSSVGTFNNVNHSGSVRTKRNGSIVNVLT
                     NFVSVKSSTPIPKPLPVLIYLDNMSPPPAADSSLSEDEYIGSLSVYGRYVAAILAEDG
                     NEFKQKCLERYISTEFDFFGEPLDVSLRKLLLLLSLPKESQQIERMISCFATAYYNQN
                     KHDSLWGGCDDISRMAFSLLMLHTDHFNSNNKNKMTKVEFIKLLHDDQKHIPKEIADY
                     LYDAITVREFPHVLLPPFMTMDDEDSQSAALCSELCCNFSPMAIIKSRYLLFRTELWV
                     QAKGKSNSISFLNNHVSSASSVKHMLTDDIDIYYHIVNDSVSSATLAADMEKHGYTIP
                     PVPSMPGVLQLSHKNLATFTEVKGGYLKASKEMLRNFVDIPLGAADTNLFYADSEYRY
                     MKIIQIGKLEDMMVKKFPLVGKTTWKMHHFILTTFALFIFDGNYQLDSSVETDEVTNT
                     TNIVIPFPPTSHVVKVLDCNGLYATAFPGAHKPSVAHEDEILHVHRNGQEYRFHCASS
                     SERQMWLEAINMVAAISNCYIIIPSIPNSVGPIQKWSLHEKWEKLNSSLQEMRSKLDT
                     VVKILECCQTLAPITGRCRSQLLKYVEQNLTRMDWLTYEIARKQAYLEILRSIMKVSQ
                     EAPVPDDQTSIEDSFLFKESHIKGHECARISSWHK"
     gene            complement(<573888..>574211)
                     /locus_tag="AGOS_ABR103C"
                     /old_locus_tag="ABR103C"
                     /db_xref="GeneID:4619154"
     mRNA            complement(<573888..>574211)
                     /locus_tag="AGOS_ABR103C"
                     /old_locus_tag="ABR103C"
                     /product="ABR103Cp"
                     /transcript_id="NM_208403.1"
                     /db_xref="GeneID:4619154"
     CDS             complement(573888..574211)
                     /locus_tag="AGOS_ABR103C"
                     /old_locus_tag="ABR103C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR094W (RDS3)"
                     /codon_start=1
                     /product="ABR103Cp"
                     /protein_id="NP_983050.1"
                     /db_xref="GeneID:4619154"
                     /translation="MSRHQFDLVMCMKLPGTSIGRLCERCDGKCPSCDSNVRPLSKVR
                     ICDQCSFGGQGKKCILCGSIGVSDAYYCWECCKLEKDRDGCPRILNVGSNKTDRHFDR
                     KLTER"
     gene            <574318..>575304
                     /locus_tag="AGOS_ABR104W"
                     /old_locus_tag="ABR104W"
                     /db_xref="GeneID:4619155"
     mRNA            <574318..>575304
                     /locus_tag="AGOS_ABR104W"
                     /old_locus_tag="ABR104W"
                     /product="ABR104Wp"
                     /transcript_id="NM_208404.1"
                     /db_xref="GeneID:4619155"
     CDS             574318..575304
                     /locus_tag="AGOS_ABR104W"
                     /old_locus_tag="ABR104W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR093C (ASR1)"
                     /codon_start=1
                     /product="ABR104Wp"
                     /protein_id="NP_983051.1"
                     /db_xref="GeneID:4619155"
                     /translation="MLKHISSHIAMGCPQDECSICWESMPSGVGRLMPCGHEYHLACI
                     RKWFHLHSGNRSCPVCRTEASVLVDTDHEVKIDLSVGQLLDFYGLLDEIGSQLLAITL
                     QDHSTQDDEVNEEGLAEQRAQLTLVQCGICGEMNGDIDTCCNRCHHMYHHSCLGQLLV
                     EVNAEREQGWSHCIFCYEQLVPLYISGARRVLSLQDRGVHRGRVRNNRSILTELIYER
                     SGVLVHGIEDQHASQHDINDIEHSWHLLEQNRQRKQLEYQDKCKIQAHVRRILDHYYH
                     CAKVTKAQYTFINKKVSQTLYALSRGVYPAVDLDYDGIAKTLILDEMEKLSS"
     gene            complement(<575349..>576281)
                     /locus_tag="AGOS_ABR105C"
                     /old_locus_tag="ABR105C"
                     /db_xref="GeneID:4619156"
     mRNA            complement(<575349..>576281)
                     /locus_tag="AGOS_ABR105C"
                     /old_locus_tag="ABR105C"
                     /product="ABR105Cp"
                     /transcript_id="NM_208405.2"
                     /db_xref="GeneID:4619156"
     CDS             complement(575349..576281)
                     /locus_tag="AGOS_ABR105C"
                     /old_locus_tag="ABR105C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR080W (TWF1)"
                     /codon_start=1
                     /product="ABR105Cp"
                     /protein_id="NP_983052.2"
                     /db_xref="GeneID:4619156"
                     /translation="MSTQSGINASKHLLDELNNRGDDGLVILGQIDDRSTEIEYRKEF
                     RSVGQLQEYLELKPTKPCYLFIRDSDIWQFVSYTPDTAPVREKMLYASSKNTLLRQVG
                     TNKIGRSVMVTEVHELAERPWAADESPKAYTEDELIKTEVDRKLNSEKNISGGRKLVS
                     MSTGVAFKINEDELLSDLISNGTALIFEIDLTDEQIKLRTKKTPGSAKALVAAMDRDR
                     PSYTLYQDEGRLFFIYTCPSGSKVKERMVYAANKQGFANYVNDSGFKISETFEVGDPE
                     ELELSALEPQSSQPAQEDSKPKFNRPKGPQRRSK"
     gene            complement(<576680..>577624)
                     /locus_tag="AGOS_ABR106C"
                     /old_locus_tag="ABR106C"
                     /db_xref="GeneID:4619157"
     mRNA            complement(join(<576680..577542,577609..>577624))
                     /locus_tag="AGOS_ABR106C"
                     /old_locus_tag="ABR106C"
                     /product="ABR106Cp"
                     /transcript_id="NM_208406.2"
                     /db_xref="GeneID:4619157"
     CDS             complement(join(576680..577542,577609..577624))
                     /locus_tag="AGOS_ABR106C"
                     /old_locus_tag="ABR106C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR079W; 1-intron"
                     /codon_start=1
                     /product="ABR106Cp"
                     /protein_id="NP_983053.2"
                     /db_xref="GeneID:4619157"
                     /translation="MPSTSQTVGSGMTAMRGSKRRTQQFQITNHIITTDVISPLVADN
                     GGDEVAPGEGATEASQQPAFRAEAASAAGSEHEDSDLDELFSPLHEPFSSFSEGDEDE
                     FEFLNMSYPKRFTRQINWDASDECGASAAAGGEETYMDRASSWGPMFDSDDIIVSDSK
                     DFWKNIETSSSVDEQLPFTDTWSWNDAPALGSSTSDALGPSIPVAAADSLEDFINSNI
                     SSDAHLPPAGDSFQYKIRKLTFRDSDGTLSLSASSSGSRNRISKKRIKRKAIRRKSAV
                     SEMFFPGVGIGEFMLL"
     gene            578391..578470
                     /locus_tag="AGOS_AgSNR41"
                     /old_locus_tag="AgSNR41"
                     /db_xref="GeneID:4619158"
     ncRNA           578391..578470
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR41"
                     /old_locus_tag="AgSNR41"
                     /product="AgSNR41"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR41; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149386.1"
                     /db_xref="GeneID:4619158"
     gene            578629..578665
                     /locus_tag="AGOS_AgSNR70"
                     /old_locus_tag="AgSNR70"
                     /db_xref="GeneID:4618939"
     ncRNA           578629..578665
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR70"
                     /old_locus_tag="AgSNR70"
                     /product="AgSNR70"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR70; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149417.1"
                     /db_xref="GeneID:4618939"
     gene            578741..578835
                     /locus_tag="AGOS_AgSNR51"
                     /old_locus_tag="AgSNR51"
                     /db_xref="GeneID:4619159"
     ncRNA           578741..578835
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR51"
                     /old_locus_tag="AgSNR51"
                     /product="AgSNR51"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR51; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149396.1"
                     /db_xref="GeneID:4619159"
     gene            <579169..>581688
                     /locus_tag="AGOS_ABR107W"
                     /old_locus_tag="ABR107W"
                     /db_xref="GeneID:4619160"
     mRNA            <579169..>581688
                     /locus_tag="AGOS_ABR107W"
                     /old_locus_tag="ABR107W"
                     /product="ABR107Wp"
                     /transcript_id="NM_208407.2"
                     /db_xref="GeneID:4619160"
     CDS             579169..581688
                     /locus_tag="AGOS_ABR107W"
                     /old_locus_tag="ABR107W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR091C"
                     /codon_start=1
                     /product="ABR107Wp"
                     /protein_id="NP_983054.2"
                     /db_xref="GeneID:4619160"
                     /translation="MSLWSFVISYLLGGLTFFPLCALAAFYIASKPKGSGGRRTTEPA
                     VLAACDPDFKVGELEEQKGVDAFKKGWVYVTNKYYYHTSELQRVPSPERDALPTRDKM
                     KRKKKFYAVLKHGNLFLYKSDAPNTDVFQVIVLKNSFVTLWPRDSSAELSDASLFTNR
                     TCISICKNGKAYLDEDGKLQFETGGDIGPADQYFVYVDNNVDKEDWYFALINASKISS
                     SGTLLDPARSAKTAHLKTKDSLYLIQTVNSTEGQFATKWLNTLISRLFLSLQQTEMLN
                     DWLLEKVHKKLTKINKPGFLDDFKIEHIDVGNAAPMITNPKLLEFAPEGQTKIRFNLV
                     YRGNLSLIISTKVNINLGSRFKSREVAIELAMTVRELEGPMILLVKPPPSNRMWYAFE
                     SEPLLNLDIEPVVSTRQLSSNMIINVLKSKFKEALRESIVLPYMDDMVFYPTQNEIYR
                     GGIWMHERQEPSEAPQQLSSSGESSDNVPTNIPSGKLDASAPSASISEKLHSPSLSPD
                     QKSSFSSKPSDDELNSSSLRKAAEAHHSSDSDSASERESLGDGSLKTKTMHRVGNLKN
                     MIKARTTADASIRSVESTSSLDSTTSKKYFQTGMKKIGRWYKDQVNNARDAVTDAQLD
                     ILQKAEHGPFVPEPPKPVGPEMISNRRSHPRLKSQSDIRDDFMKSSAESSADMFVNRA
                     RATSFDAPKSPNLNATYPFGSQSPMTPVSPTSAMSRRLSANSQQEQAHSSDSIPVDSP
                     PTTIKETISEVPEFKEFTKENKGEPPAVPDMATAAAATVFSTTPSSILVNGQNVSPKA
                     FARLRPLPVVPNEEIVSQLEDCEPAKDPAPFIPPDLPPRSH"
     gene            complement(<581795..>588769)
                     /locus_tag="AGOS_ABR108C"
                     /old_locus_tag="ABR108C"
                     /db_xref="GeneID:4619161"
     mRNA            complement(<581795..>588769)
                     /locus_tag="AGOS_ABR108C"
                     /old_locus_tag="ABR108C"
                     /product="ABR108Cp"
                     /transcript_id="NM_208408.2"
                     /db_xref="GeneID:4619161"
     CDS             complement(581795..588769)
                     /locus_tag="AGOS_ABR108C"
                     /old_locus_tag="ABR108C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR136W (MEC1)"
                     /codon_start=1
                     /product="ABR108Cp"
                     /protein_id="NP_983055.2"
                     /db_xref="GeneID:4619161"
                     /translation="MDGQTRYLDELVGALRAERAQGRAGGYAGEFPPREGGGRARRVA
                     RTVVAKLADAEVADAAFWRACEALDLVFTGRPMVLAEALDEEAGVLWAVRSCWRVAAV
                     HFGRRERGWALRRASSRWVRLCADLYGQRWRARVGAELDRELCAGEAAVRAVLGGGQE
                     AGEHMRALRALCVAAEWAVSREFWFVTGGAERVGLRLQRLARLARYIGDAVELPLAEY
                     EEVQVRLLGVSVQAYLEPDRPGLGELRFALEQLQYFVRGKHLRREFAAWSRLLLRLYV
                     RCRSDRAALLLVREVLVLDAAELPEAATDAQRSLQLVRYDLERQFAADHALRWDPALR
                     AKLLAAGTPPVILEPFTSNRQLEKLRLRVLCDFQVGDSALLVHQFSAAGVPLGADPVA
                     LYTHLDEGIARAFGRQDTEAQVRYLSLVRKLACLESRKPSPGFDCDLCDHTNLWLPRE
                     SIDPSRPEAASDSLAFKLLVGYYLREQLESSGEALVIGILITLRSIFTHFQPPKLVEN
                     HYGDMVDEHGCIQLFRMAFMSLNRHVRILSVLLIPYWNLSRSYNADEQQTALIIKFLQ
                     RNPDPHITETYLMAWTQLTLSTSGELFDSLLLKLIDIFNSSNFVEHVVMASQLKFIAR
                     VLNKTAYQLLSPILPILLKQIGKNLGEKKLSLERLLNLLEYSAKTVIENFQRYIVPYA
                     LTQYKGDALTEIAKIMCQNNEPSMVSEQKKRLLDRNSRQIFAVALVKHGLFSLETIET
                     LFINNDPTFDRSYVAGFLPDYKTLAEVLKLFKPVEKVDSPMNDNERAVLSSLRFLFLT
                     NFSVDKHRGSKFKNVTEWTQEKEAVFQKKLKDNILGIFQVFSSDMHDIEGKTTYFEKL
                     RVISGISFLIKYASKECIISALAQVSICLQTGLEIPEMRYNTLRCWLHLVKYLSEEEL
                     STVIDVLICFILQKWDEFSGKIQQAAIDILDALILEKQTLLTNSRPYIVLAFLNKSEL
                     HIFENHGFFARTASKLLKNTNWVSVFVSNLKSHNIYVIKQTLQDIRLFLEKKQDAGID
                     IKLISKDGKNISELLGALLDTSHKYRNSDLIICETCALCISMIGVLDVTKHELQRCNV
                     YDNDICDFNNPTQTTKFLINIINERLVPSFWQSENPTKQLFVALVIQESLKYCGLSAS
                     SWDVTKPDLYPNESKLWNRFNDISKTTLYPLLSSLYLAQSWKEYVPLSYPSFKVKDGY
                     STWIKNLSLDLLKTATESSHPLHVFSSLIREDDGTLSDYLLPYIIMDIIIKAESGTKY
                     FDYLQNVIKDFEYIFNYTLYDLNHYQIDGLKMCYDSIFRVFEYCKKWVNQFRQNYSKQ
                     HGTFTIREEKYTRMLNRAGKFADIIPSHVLAQKSLETNSFERSALYLEQSYREKSSNG
                     LQDDKLLPYLQTTYAEINDIDAVVGVLKVFCSNNLTSRIEELQYSDNWKMAQDCFDAL
                     GDSLLNEQGGVENSVPTSRMLKLMYDHQLYDQTLKKLELNIPSKKRQLPLNLDEFYNM
                     GIETASLSGNITELKIWIRRIEQLETLTDPSILLHYNLAKSLLAVLEGKTDMIETHSK
                     YCYRLIGSHFTTPSHSTTLLKRRNLFIKLHGIRDNSILSKCSTDIQFNRSVRNLAVRF
                     KNVGSDFEPNFYLLSMRKSHNLMRSEEFVKQDLADTYFKMAQLARENDRLDIASDCLM
                     HALKLEHTEAELEYAEILWKQGEKELALKTVAEIHQKRKGIKTLKDRDRAKVLLKYTE
                     WLDLSNNATSVQISHQYKEVIGLDKDWDEPYYSFGLYYSRLLEKKRADGFVTTGSLEY
                     KAITYFLSAFEKNTVKVREALPKVITFWLDTASRSVESGSSEGEYHFKRYTKEICKCI
                     DVAIQNCPTHIWYTVLTQLLSRLLHKHTDSATLIMNILLKLTLEYPSIMLWYITVLLN
                     SQENKRVHAGKQIMDAIKKRMPDKSSLISSAISLVQAMTRVCIKDVKNMSSRSGKSLQ
                     NDFKFDINLAPSEMVVPVNINLANLSPSYADTSGKHGSSKRVTINCFTPHYKVYSSLK
                     KPKKINIIGSDGELYGIMCKKEDVRQDNQYMQFANMMVFLLGKDSESRRRSLNITTYA
                     ILSLREDCGLIEIVPNVDTIRSILMAKYDSMKIKYTLSVLYEKWKSVSEEQRLGFYKS
                     CTDTFPPVLYQWFLETFPNPIRWYNARNAFVRSYAVMAMVGHILGLGDRHLENILLDL
                     QTGKVLHVDFDCLFEKGKTLPVPEIVPFRLTQNIQDAFGVTGTEGTFKKSSEVTVRVM
                     RNNELALVNIIETIMYDRNMDHSIQNALRVLRNKVRGIDPRDDLPLSVPGQVDTVVQQ
                     ASSDENLAQMYIGWLPFW"
     gene            complement(<588848..>589207)
                     /locus_tag="AGOS_ABR109C"
                     /old_locus_tag="ABR109C"
                     /db_xref="GeneID:4619162"
     mRNA            complement(<588848..>589207)
                     /locus_tag="AGOS_ABR109C"
                     /old_locus_tag="ABR109C"
                     /product="ABR109Cp"
                     /transcript_id="NM_208409.1"
                     /db_xref="GeneID:4619162"
     CDS             complement(588848..589207)
                     /locus_tag="AGOS_ABR109C"
                     /old_locus_tag="ABR109C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR135W (CKS1)"
                     /codon_start=1
                     /product="ABR109Cp"
                     /protein_id="NP_983056.1"
                     /db_xref="GeneID:4619162"
                     /translation="MFSNHPFQGRKLSDQERARVLEFQESIHYSPRYSDDTHEYRHVM
                     LPKAMLKVIPSDYFNSETGTLRILTEDEWRGLGVTQSLGWEHYECHAPEPHILLFKRP
                     LNFEAELRAAQQQQYGR"
     gene            <589350..>591713
                     /locus_tag="AGOS_ABR110W"
                     /old_locus_tag="ABR110W"
                     /db_xref="GeneID:4619163"
     mRNA            <589350..>591713
                     /locus_tag="AGOS_ABR110W"
                     /old_locus_tag="ABR110W"
                     /product="ABR110Wp"
                     /transcript_id="NM_208410.2"
                     /db_xref="GeneID:4619163"
     CDS             589350..591713
                     /locus_tag="AGOS_ABR110W"
                     /old_locus_tag="ABR110W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR133C (HSL7)"
                     /codon_start=1
                     /product="ABR110Wp"
                     /protein_id="NP_983057.2"
                     /db_xref="GeneID:4619163"
                     /translation="MKSNVFVGIKGHGVLEGAAYREKYDYVLEGVTNGRYRDAVRAAA
                     AAGVAVSPPELAEVGGGPGGGAGRLGLAAPWLELESAEPAIGEVSLRVLEHEYEYARA
                     EGVKQLIVAPPRELGRLNLYAQRLGRLLARAGRGPPLVSVSLPLFEAGDPLSTWELWN
                     TVRRLCRYHPNLTATLAVPRGRTPGHVLRRWLAEPVSCLLVSSSIFATNQYNYPVLHK
                     HNQELIGLFQRLNGRAESVLGELTIVLHGIEKHAERVRGGEPIYLEYINYLLKKGDRA
                     LLQAPGEDGAPRVMQPLQPHAVDLSSEVYQIFEQDKTKYDLYAKAITAALRSIRSTMN
                     KMWLHDDLNIIVVGAGRGGLVDRAYTCLRQLGISRFKLVALEKNPQAVIHLQKKNIEK
                     WGNSVDIVSANMREWSSKVKFDLCISELLGSFGCNELAPECLEAFEKTNCTDRTIFIP
                     QSYTSYVAPVSAPLLYQMLRNKEDNALESPWVVRNVPSCLLSTKVYELWSFKHPGGTS
                     NTARSTVTNMKIKHKGEVHGLLGFFTAEIYGDIRLSILPDDCKIKLRGSAPDSDGRRK
                     SVDLDSKLGHTPNMSSWSPIFFPLLYPMFVGDDTELELTMLRNRCMRGVWYEWSLSSY
                     VYNAISQDRKPGSFLKGTQQLLNSKPEPNFKDTFTRSKKHDGLNSVMLDLQNTATILN
                     AGDLGEPREAQYDGNIEENSASTELLKRTFVGKSEFISPELTGWQSVHDVHELGQTMT
                     EKPNKGDYNNSEYEDKDYSNYEEYHVRVRTNTTELHNIGGHAYMIKL"
     gene            complement(<591905..>594274)
                     /locus_tag="AGOS_ABR111C"
                     /old_locus_tag="ABR111C"
                     /db_xref="GeneID:4619164"
     mRNA            complement(<591905..>594274)
                     /locus_tag="AGOS_ABR111C"
                     /old_locus_tag="ABR111C"
                     /product="ABR111Cp"
                     /transcript_id="NM_208411.2"
                     /db_xref="GeneID:4619164"
     CDS             complement(591905..594274)
                     /locus_tag="AGOS_ABR111C"
                     /old_locus_tag="ABR111C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR089W"
                     /codon_start=1
                     /product="ABR111Cp"
                     /protein_id="NP_983058.2"
                     /db_xref="GeneID:4619164"
                     /translation="MNFQEPWSAATNADGFSLNSDSRTQKVKESLKLLKDTSDPWSAL
                     ALLISEEESQVGRFKQLLQQVAGQVNDISRTSVPLLVYAIVFNHPEYIELLHETRDLD
                     VNIADGLTSYSPLMWCFHLQQQECCVELLNYQDELQFDYRNSSSATALDLLVPGTEMY
                     EFAEHHGLLELKHSPKVEDIFGSSGDLYKAPVRLDELDRTMNDKIRLQTVGLAVADEA
                     GISASLYQPPDTGRPTTQEAATILFDYERLLPGQFIEFADFDIIQILDTLVDLPQRRP
                     HDTVCPAALIFQCLRYARRKSQRSELVESTFHLSITRILSSQQANLGGVVTGNNGDIV
                     SLSYWLSCLAFLYYFLYRDETFFRTHPLLLQELINAMQSLMMELCSSVHSRVEKLLVP
                     AILSHTTIIDVKQTLYKKDWNFFKKKRQSHKKGPDSYDEILRMLYPPSIEEQMKPAPI
                     KIVQIFGALAYVLESHQVHPLLSMQCLSTSIEWFSTSIFNIMVSSKKYLSRAQAMQIR
                     LNLSTIEDWVKNHDMTVPKSKMVDTFIWERFPYTLLKPISEINLKQRTLRNITMYAPV
                     KKEEELVMDPTNTLFYYQSFSRIAQIHLEPVHQLLQWLQVASSIDDEASLSNAMNLLN
                     ALNPAQLLKVVEKYRYEVDEKRFDSNLKKQLANMAKNESCSVLFPEKTQPLVILPMMS
                     ELTELYVTVPDAYRFVPLLPDDVREDIEILHERNVRDRSLEVQQTKQEPSITDDENEE
                     DDTSSNDHRKSTTYEPSENGNIFGTINAPGNAIQRGDWQESSTIEENPW"
     gene            complement(<594492..>600920)
                     /locus_tag="AGOS_ABR112C"
                     /old_locus_tag="ABR112C"
                     /db_xref="GeneID:4619165"
     mRNA            complement(<594492..>600920)
                     /locus_tag="AGOS_ABR112C"
                     /old_locus_tag="ABR112C"
                     /product="ABR112Cp"
                     /transcript_id="NM_208412.2"
                     /db_xref="GeneID:4619165"
     CDS             complement(594492..600920)
                     /locus_tag="AGOS_ABR112C"
                     /old_locus_tag="ABR112C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR093W (CDC39)"
                     /codon_start=1
                     /product="ABR112Cp"
                     /protein_id="NP_983059.2"
                     /db_xref="GeneID:4619165"
                     /translation="MLNLQIEQQTEEDIRASQSIIAHINVCIALLDESNKKEVEAQVN
                     SILEKSPLSVYISYWKKLVQQSSQYIKEHQKLDLRKPTHYLLYNLFRDIVHKNSETVE
                     VLNSAIFEDVAFLDQQHLTKKEILAVLDPTEDKEVIRRLEPEEYINKLKRVKQLQMNT
                     FQALQDFVLKENPHTLEEILANLLLSLEGESLNDFIALILSEILSPGSQGLQSSSNSW
                     FTPIAVAEATQRGAQISNALSKLNPSAVNWNRVFNLMSTKYFLNRVIAPTLASLSATF
                     SALGNGLLIDQFFNCDWNLVFKLNLAILLHQWNPQQGCIDLLQTKDLRKVSKVLPNSK
                     NSLLYLTSVSKLDIELFLSREEFGSSPMFQLFHDCFFDDYNIVPEYLALTLISETKHF
                     SLMVENKAIINELLVTLMVQVFEKSPMVFGELIKKIPNHKVIEVGRIIINKDTTPLAN
                     FVQILYEEKKLEDFIRSIPFKESLKITPSARKVGWTGFEEYIKSKLSPESVNTIIDFI
                     DLQASMDDQNTPFRSSRVYDLSALHFVVTLLDAYTLPKETRRRLNDVEYKLLNTFPRL
                     INFGHGHDEAILANGDLVPIATDVEKEMQTYLQKMYNKEMQIKDVVDILRKLRDSDNS
                     RDQDIFSCITHAVIAETKFFKEYPLEALATTSVLFGSMILFDLLRGFVLDVAFKIIAD
                     FAMEGPESKMFKFSVQALYAFRIRLHEFPEFCRSLVDEIPSLQSQPQIFQILAESAAQ
                     TSGKASGSAGAFPQIPDMITLNYFNVNELPVNVPQENPAREITEKVLFVVNNITMDNF
                     SGKIADLTNLLEEKYYAWFSNYLVNQRAKTEPNYHELYANMLEAVDSKLLHKYMLNST
                     YKQLYLLLSTKDISSNDKNHLKNLGAWLGNITLGVDKPIRHRNIAFRELLLDSYKKGR
                     LEIVVPFVTKVLQQAANSRVFRPPSPWTVGILRVLLELNEKANWKLNLTFEVEVLFKA
                     LGLKLTDLKPSKFVDIPEVTEYLAGNLRTLTIEQQQIEQQQQLISMQTYQQQLALLHR
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSQQPQPQQTQQQMQQTQQQPQTQSTAH
                     QQAQAQQSQQQQQMHAMSNNVNLHGEQPPMDGDGIFNNLVGQSAFVTHPDLKLLFMMA
                     MSKAIREILVPTVEKSTSIAVITTISIMLKDFATEVDEIKLKTAAIGMVRKLAQSLAH
                     STSIELLKENIRTHTQALTPNLISINMNHSPLEELNMAIDDNINSALAPIEKAAMDKV
                     TQDIGDQLMQAIAIRRYHKERRSDQPFLAPNASNYALSLPEPLGLKTTGITPQQFRIY
                     EEFAKLSVVPEQVMHMAPNHAVSSQQVANNQLLQQQKILQQQMQQSQTQIQTDATHQQ
                     PLQQPLAAQPQIHPPLNRIQTELEQNQKVLVQFMDRLVLHIKENADKKLSDLGSDNAI
                     KETIYQILTFIARSAQKDQLALKVSQAVVNSLFGTSESVLCREVLSLLLEKLCSLSIV
                     ARKDVIWWLVYALDTRKFNVPVIRALLEVNLIDIAELDAVLVTAMKNSMDGAIRFAMD
                     LIRDTTLSNNPILMRLDFVCTLEYLRLFDLEETRAFFKEFEECKIMPVAKNTKATNKE
                     RIWLVFTEWVKLLQRVSSNDVVTTVFMRQLMDRGVLDSSDKTIEFVKASLELAVSSFK
                     ESDPTGEVFTAVDALSNLIARLLYLQDFSQTSRTDYLNLIFSTVTLVFAKDHEVNDST
                     FNERPYFRFFSSLLCEWESLRGHNFIKIKDEQCRNELLSFDTDFFNTFASFLHCYQSI
                     AFPGFAFAWITLISHRMFLPNVLRLPNNAGWHSCVLLLSDLLKFLSQYIKKEETSDAV
                     SVVYKGTLRIFLAIANDVPEFLVQNHYELINNVPRSCIQLKNIILSSFPKKMLLPDPY
                     RTDLELDRLELCEQPPKVFYDPVQDLKNLKKPVDNYLRIPSASLIRTISAGVLRSEYE
                     YEAGIGYDINTVDVKLINAIVLHVGIEAALEKQKTSFNAVFSTNATYYTLLSSLINEG
                     SIEVKFHVIQAMVNQLRYPNAHTHWFNFVLRNMFVSDQWGDQTLDVQEIIIRSLLERI
                     ITSKPHCWGVVFTFVSLLRMDNIKLQELPFINDTPEMKLIFQNLSKYLVNSTNSNDKQ
                     SHETPLEQQS"
     gene            complement(<601289..>602920)
                     /locus_tag="AGOS_ABR113C"
                     /old_locus_tag="ABR113C"
                     /db_xref="GeneID:4619166"
     mRNA            complement(<601289..>602920)
                     /locus_tag="AGOS_ABR113C"
                     /old_locus_tag="ABR113C"
                     /product="ABR113Cp"
                     /transcript_id="NM_208413.2"
                     /db_xref="GeneID:4619166"
     CDS             complement(601289..602920)
                     /locus_tag="AGOS_ABR113C"
                     /old_locus_tag="ABR113C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YLL055W (YCT1)"
                     /codon_start=1
                     /product="ABR113Cp"
                     /protein_id="NP_983060.2"
                     /db_xref="GeneID:4619166"
                     /translation="MANPVTADEASEKRIQDSIVHEKQDFELKAELQSKSSVDISTKD
                     EKSLVVNSRNADITLSFLLKHDKDVPPITEAEEKKLARKVMWYIVGLTASINFITYID
                     KAQLSYSTLLGFFEDVNMSLNRYNNVNTLFYVGYITGQINLLFIQKFPLKNVVIVLLT
                     IWCIIMMVQCAMTDYKGVYVLRLCLGFTEAIIIPALNNTMLMFLTENEKAATAPIFVI
                     ATVSVSIPMGVLSYLILLIKNPAISHWKILSIIIGSLTFVVALVALYLYPNNPTDAKF
                     LSLKEKVWVIRRVQDTTGSSIEQKKIKKHQIIEGLRDPISWLFLLFFATQQLANNLSY
                     QRNLLLKSAGHIDDMHASLISSSSGGLAVIGSLVASFIMFKKKNFTAYTVVLWSIPSF
                     IGCVAMMALPDNAHIAMVVMICIASSTDGIPWIMMISWSTTSTSGYSKRLTRIGMVMV
                     GYSISNLISPQLWQEAHGPRYYPAWAVQLSLSFFFAPALAILIRIILARRNKERLALA
                     SDNLGAVEIDGDLVKTNLAMLDLTDLENKHFIYPL"
     gene            complement(<603272..>607111)
                     /locus_tag="AGOS_ABR114C"
                     /old_locus_tag="ABR114C"
                     /db_xref="GeneID:4619167"
     mRNA            complement(<603272..>607111)
                     /locus_tag="AGOS_ABR114C"
                     /old_locus_tag="ABR114C"
                     /product="ABR114Cp"
                     /transcript_id="NM_208414.1"
                     /db_xref="GeneID:4619167"
     CDS             complement(603272..607111)
                     /locus_tag="AGOS_ABR114C"
                     /old_locus_tag="ABR114C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YKL215C (OXP1)"
                     /codon_start=1
                     /product="ABR114Cp"
                     /protein_id="NP_983061.1"
                     /db_xref="GeneID:4619167"
                     /translation="MSFGIRIAIDRGGTFTDCIGTSGTGRPEDDVVIKLLSVDPANYP
                     DAPLEGIRRLLEHFQNKQIPRGLPLCIAGIESIRMGTTLATNCLLERTGERCAFVTTK
                     GFKDALLIGDQTRPRIFDLSIKRPDMLYDVAVEIDERVTLVDYSEDPTRHKSTADSSA
                     GKYAGRSGEIVHVLKVPNEDEVRSTLRVLYAMGIRQVAIALLHSYTYPAHEEIVGRIA
                     EEEGFTHISLSSQVSPMIKFVPRATSAVVDAYLTPVIKDYLKGIYAGLRESDNTSIQF
                     MQSDGGLVDARRFSGLKAILSGPAGGVVGYSQTCSCSDNAPLIGFDMGGTSTDVSRFE
                     GRLEHIFETEIAGVTLRSPQLDINTIAAGGSSRLFWENGLFRVGPESAGADPGPVAYR
                     KGGPLTITDANLVLGRLIPEFFPSIFGPNEDQSLDIEATKGKFSELANIINTELGSNM
                     TVEEVAYGFICVANESMARPIRKMTEGKGHLLSHHRLVSFGGAGGQHAVAVAHSLGIE
                     TVLMHRYSAILSAYGMLLADAVEEEQVPCSIFLQDTSSKDQLNEIFHQLITSTSISLL
                     KQGLADDRLEFERYLNLRYEGTETSLMVLQEGDSWDFVERFTKLHKREFGFVFAEKRI
                     LVDDVRVRALGKSMVRNQEPVDQQLSQVTRSTADPSKDAKFFKDVYFVDGFIKTPIYR
                     LDSLPVGTCIEGPAILADDHQTNIIPPGAEAIILKTHVYIQISCNQQKITNDEVDKIN
                     PVMLSIFGHRFMDIAEQMGSQLRKTSVSTNVKERLDFSCAIFDHEGNLVANAPHVPVH
                     LGSMSTCIKAQATLCKGKLKKGDVLISNHPDIGGTHLPDITIISPVFSDEKDDPLFYV
                     ASRAHHADIGGTLPGSIPPNSKELYEEGAMIYSEKVVKAGQFNEALLKKLLFEDPAKY
                     PGCSGSRRLSDNISDIKAQIAANTRGIQLLNQLVDVFGLGTVTRYMDAIQENAALTVK
                     NVLRKITKHFGKTVYSAEDYMDDGSVIKLRVELNAKEDKYIFDFTGTSPQVHGNLNAP
                     VAITNSAILYCLRCFVDEEIPLNQGCLKPITVIIPESSILWPTKGVAVVGGNVMTSQR
                     VTDVILKTFKVMADSQGDCNNFTFGTGGNDASTGEYTQGFGYYETICGGHGAGGDSWR
                     GPGWHGTHPVHTNMTNTRMTDTEIFERRYPVILREFSIRKGSGGNGLYRGGDGVTRDI
                     EFSVPVQASILSERRSLPPNGLEGGFPGKRGLNLWVRHETGATMNIGGRNTVQVQPGD
                     RMIINTPGGGGFGIPPN"
     gene            complement(<607312..>607887)
                     /locus_tag="AGOS_ABR115C"
                     /old_locus_tag="ABR115C"
                     /db_xref="GeneID:4619168"
     mRNA            complement(<607312..>607887)
                     /locus_tag="AGOS_ABR115C"
                     /old_locus_tag="ABR115C"
                     /product="ABR115Cp"
                     /transcript_id="NM_208415.2"
                     /db_xref="GeneID:4619168"
     CDS             complement(607312..607887)
                     /locus_tag="AGOS_ABR115C"
                     /old_locus_tag="ABR115C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR049C (MSO1)"
                     /codon_start=1
                     /product="ABR115Cp"
                     /protein_id="NP_983062.2"
                     /db_xref="GeneID:4619168"
                     /translation="MSNQNRNDIWNKLKSSTKSFSSSLTQLSTRNDRDGDTPTSTLVH
                     KALLKHYKKREPFVGFPEWLGHTEDIGEEHNAPSIGSSADHSVASMDSGPRRTAGLAF
                     QKIYSSVSVSRPAGEAGSAGTTMQGRLSKSSDHLVGPRTQGATWGSQRQQLLDQDRSQ
                     TSEQPAEPQPRSLHMRERMKRNLTKRGTFDL"
     gene            complement(<608102..>609439)
                     /locus_tag="AGOS_ABR116C"
                     /old_locus_tag="ABR116C"
                     /db_xref="GeneID:4619169"
     mRNA            complement(<608102..>609439)
                     /locus_tag="AGOS_ABR116C"
                     /old_locus_tag="ABR116C"
                     /product="ABR116Cp"
                     /transcript_id="NM_208416.1"
                     /db_xref="GeneID:4619169"
     CDS             complement(608102..609439)
                     /locus_tag="AGOS_ABR116C"
                     /old_locus_tag="ABR116C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR050C (LYS9)"
                     /codon_start=1
                     /product="ABR116Cp"
                     /protein_id="NP_983063.1"
                     /db_xref="GeneID:4619169"
                     /translation="MVKKVLVLGSGFVAKPVVDVLDSTDGIEVTVGCRTLAKAKALTA
                     GTAASAISVDASDSEGLDAAVGEHDVVVSLIPYIHHADVVRAAIRQRKHVVTTSYISP
                     ALRALEPEIKAAGITVMNEIGLDPGIDHLYAVKIIDEVHRAGGKINSFLSYCGGLPAP
                     EDSDNPLGYKFSWSARGLLLALKNQAQFWKDGSKQVVKSEDLMASAEPYFIMPGYAFV
                     CYPNRDSTVFRDLYGIPEAKTVIRGTLRYQGFPEFVKVLVDMGLLKEEPHSAFTQAQP
                     WSAALAAYLGAKSASQEHLVAAIDARTSWKSQADRERIIAGLSWLGLLSDELIAPAGN
                     PLDALCASLEQRMQYEEGERDMVCLQHKFDIEWADGSTETRTATLIDYGRPSGYSSMA
                     ATVGYPCAIATRLVLEGAISGPGLIAPYTPEVIEPIMRELKDKYGIYMKEKTT"
     gene            609848..609934
                     /locus_tag="AGOS_AgSNR49"
                     /old_locus_tag="AgSNR49"
                     /db_xref="GeneID:4619170"
     ncRNA           609848..609934
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR49"
                     /old_locus_tag="AgSNR49"
                     /product="AgSNR49"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR49; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149394.1"
                     /db_xref="GeneID:4619170"
     gene            complement(<610017..>611059)
                     /locus_tag="AGOS_ABR117C"
                     /old_locus_tag="ABR117C"
                     /db_xref="GeneID:4619171"
     mRNA            complement(join(<610017..610960,611014..>611059))
                     /locus_tag="AGOS_ABR117C"
                     /old_locus_tag="ABR117C"
                     /product="ABR117Cp"
                     /transcript_id="NM_208417.4"
                     /db_xref="GeneID:4619171"
     CDS             complement(join(610017..610960,611014..611059))
                     /locus_tag="AGOS_ABR117C"
                     /old_locus_tag="ABR117C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR095C (OCA4); 1-intron"
                     /codon_start=1
                     /product="ABR117Cp"
                     /protein_id="NP_983064.4"
                     /db_xref="GeneID:4619171"
                     /translation="MLVPPANFGIAEEGIYRCSKIETLNLSFLEVLALKTIIFVGGQE
                     PSKFFREFFERYNVQLFVIKRAQNSSLVLPGSNAQKEQPQADTAVSSGCQSSTHYKLS
                     DADDLMIIKTHSLQKIFRLMLNTTNHNMLLVDKTSIVIGLLRRIQKWNISSIISEYRL
                     YTGKNSNYFAETFLEVVDVTVTQDLEKSVTEDIAKLDIQDLRPIELSRNGSGQQVVNE
                     RDLLRGPELPQHMLRIIDQVEQCNSKENSAASTGIKRSPSSRGIFGNRYRLAFNKREL
                     CEYEYYRSGSTNAVHIKIPRESLLPQWFKFQRDLWEQLNTKQTYNFYTERIFM"
     gene            complement(<611450..>613072)
                     /locus_tag="AGOS_ABR118C"
                     /old_locus_tag="ABR118C"
                     /db_xref="GeneID:4619172"
     mRNA            complement(<611450..>613072)
                     /locus_tag="AGOS_ABR118C"
                     /old_locus_tag="ABR118C"
                     /product="ABR118Cp"
                     /transcript_id="NM_208418.2"
                     /db_xref="GeneID:4619172"
     CDS             complement(611450..613072)
                     /locus_tag="AGOS_ABR118C"
                     /old_locus_tag="ABR118C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR051C (BRE5)"
                     /codon_start=1
                     /product="ABR118Cp"
                     /protein_id="NP_983065.2"
                     /db_xref="GeneID:4619172"
                     /translation="MTTATVQDIGYAFLKTYYQRMHTDPSKLFHLYSSTAELTHVNYQ
                     GGLSPTADILPTVKVIGKENISKFYSRNNKVVQDVRVKIDACDFQSTGAGNNGILILA
                     LGEICWSNTPTYRFCQTFVLTPVGNNNKMYDVTNDIMRFIPDVIREELLGAAFSQGAD
                     KKVASKAAASEEVSMKGAVSKEASEEAAPKELTAKEPLTEATAKELASKDVAGKEAAA
                     KDIAVKETAGKDSVNHAKDFAREVVREHQGKDQSHREQAKASRETANREAAKENVGKP
                     TVTATEEDGKKDRRREHRRDEKKEDFKEARKEHGADKKEVFDSGKAHKEEQLPEREPT
                     KSAVADSSSSDISREHSKPKDDIKPDEKKHTTHSEHEVPKKMSWASQLTNSDSKAVPN
                     VVTNYTRVPPEHTRTPDRKTPSPNGNGPKAGNKKLKHVSVPNKDGYYPIYIRNTGGVT
                     NKDLTDALEREFGVVKKISASESFAVVDFEDPQCQQDAIRMHTLKINNQTVFMEPKTE
                     KKRGPIASLSSTSPTLANGNRSNKKHSNRRKD"
     gene            complement(<613571..>614851)
                     /locus_tag="AGOS_ABR119C"
                     /old_locus_tag="ABR119C"
                     /db_xref="GeneID:4619173"
     mRNA            complement(<613571..>614851)
                     /locus_tag="AGOS_ABR119C"
                     /old_locus_tag="ABR119C"
                     /product="ABR119Cp"
                     /transcript_id="NM_208419.2"
                     /db_xref="GeneID:4619173"
     CDS             complement(613571..614851)
                     /locus_tag="AGOS_ABR119C"
                     /old_locus_tag="ABR119C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR052C (POP2)"
                     /codon_start=1
                     /product="ABR119Cp"
                     /protein_id="NP_983066.2"
                     /db_xref="GeneID:4619173"
                     /translation="MQAISGQLTEFADNEQFYMRQQVQQTHPGQQQPGGLPQMFSPQV
                     NHARLLGQQQQLMHGMEGGQDLQATYLLKQKMEAANAAFGHQQQGLQPQQAQQQLLAS
                     GVLNAPPGVSLVQQGVGGMAPPPGALPPQLPLATGVHGSGLGLAPVPLIHHPNHLLVR
                     EVWANNLTAEFASIRRLVDQYNVIALTTEFVGTIVRPIGNFRSKNDYHYQTMRTNIDL
                     LNPVQIGLSLSDAQGNKPDNVPSTWQFNFLFDMSKEMVSPESLDLLKKSGVAFDKHQS
                     IGVNAYDFAQLLVDSGLLLTDEVTWVSFHAAYDFGFLVNILTDASMPNNKEDYEFWVQ
                     KFLPSFYDLNVLSKAVHDLKGQRSIPQPQHSLESLADELGIPRFPLFNTTGGQSLLAL
                     LAFVRLAKFPVFKLSNGSLDFAQFKNSIYGINKE"
     gene            complement(<615060..>616922)
                     /locus_tag="AGOS_ABR120C"
                     /old_locus_tag="ABR120C"
                     /db_xref="GeneID:4619174"
     mRNA            complement(join(<615060..615761,616116..>616922))
                     /locus_tag="AGOS_ABR120C"
                     /old_locus_tag="ABR120C"
                     /product="ABR120Cp"
                     /transcript_id="NM_208420.1"
                     /db_xref="GeneID:4619174"
     CDS             complement(join(615060..615761,616116..616922))
                     /locus_tag="AGOS_ABR120C"
                     /old_locus_tag="ABR120C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR053C (NOG2); 1-intron"
                     /codon_start=1
                     /product="ABR120Cp"
                     /protein_id="NP_983067.1"
                     /db_xref="GeneID:4619174"
                     /translation="MGTAKKEQQRRIREGNTKDGNLRVKGENFYRDGKRVKFLNMYKG
                     GKSIRNAKGDLIRAAPLQSTDVPTARVQPDRRWFGNTRVISQDALQHFRDALGDKKND
                     SYQVLLRRNKLPMSLLEEKDTSESPTAKIIDTEPYGATFGPKAQRKKPRVAAASLEDL
                     AKATDSDSQKYEEKKELDSTLGLMAATEQEDGWSQVAKEAIFHKGQSKRIWNELYKVI
                     DSSDVVIHVLDARDPLGTRCKSVEEYMKKETPHKHLIYVLNKCDLVPTWLAAAWVKHL
                     SKDRPTLAFHASITNSFGKGSLIQLLRQFSQLHKDRQQISVGFIGYPNTGKSSIINTL
                     RKKKVCQVAPIPGETKVWQYITLMKRIFLIDCPGIVPPSAKDTEEDILFRGVVRVEHV
                     SHPEQYIPAVLRRCKRHHLERTYEISGWADATEFIEMLARKQGRLLKGGEPDETGVAK
                     QVLNDFNRGKIPWFVSPPDRDPQPETSKRPADSEPETAQEAPEPPANKRLRV"
     gene            complement(615815..616021)
                     /locus_tag="AGOS_AgSNR191"
                     /old_locus_tag="AgSNR191"
                     /db_xref="GeneID:4619175"
     ncRNA           complement(615815..616021)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR191"
                     /old_locus_tag="AgSNR191"
                     /product="AgSNR191"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR191; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149368.1"
                     /db_xref="GeneID:4619175"
     gene            complement(<617142..>618086)
                     /locus_tag="AGOS_ABR121C"
                     /old_locus_tag="ABR121C"
                     /db_xref="GeneID:4619176"
     mRNA            complement(<617142..>618086)
                     /locus_tag="AGOS_ABR121C"
                     /old_locus_tag="ABR121C"
                     /product="ABR121Cp"
                     /transcript_id="NM_208421.1"
                     /db_xref="GeneID:4619176"
     CDS             complement(617142..618086)
                     /locus_tag="AGOS_ABR121C"
                     /old_locus_tag="ABR121C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR054C (ESF2)"
                     /codon_start=1
                     /product="ABR121Cp"
                     /protein_id="NP_983068.1"
                     /db_xref="GeneID:4619176"
                     /translation="MSDNDSDVQDFSSEEEDHGLLIDRKKQQTLDFAQDGSDSEGGSD
                     LDDDDIAEEESPIQNETKAATGEEPATADGDNIAPQSADELRPEERADQLKQERLRRL
                     KKLKASKKSNHKTGVVYLSKIPPYMKPAKMRQILSRFGDLDRLFLKREDEHSHRQRVK
                     GGGNKKVMFREGWAEFIRKKDAKLCAETLNGNIIGGKKGNFYHDDVMNVKYLSGFKWA
                     DLTEQIARENDVRQSKLQLEISQANKLNAEFIRNVEKSKMLNNIRAKKHKDEDSSERT
                     ESHLPVKQRKVTSNRASAPESQKQPASEKLSNVLHNLF"
     gene            complement(<618456..>619349)
                     /locus_tag="AGOS_ABR122C"
                     /old_locus_tag="ABR122C"
                     /db_xref="GeneID:4619177"
     mRNA            complement(<618456..>619349)
                     /locus_tag="AGOS_ABR122C"
                     /old_locus_tag="ABR122C"
                     /product="ABR122Cp"
                     /transcript_id="NM_208422.2"
                     /db_xref="GeneID:4619177"
     CDS             complement(618456..619349)
                     /locus_tag="AGOS_ABR122C"
                     /old_locus_tag="ABR122C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YFL059W (SNZ3), YNL333W (SNZ2) and YMR096W (SNZ1)"
                     /codon_start=1
                     /product="ABR122Cp"
                     /protein_id="NP_983069.2"
                     /db_xref="GeneID:4619177"
                     /translation="MGREQYKVKAGLAQMLKGGVIMDVVTPEQAIIAEKAGACAVMAL
                     ERIPADMRKSGQVCRMSDPKMIREIMESVSIPVMAKVRIGHKVEAQILEALQVDYIDE
                     SEVLTPADWANHIEKHDFKVPFVCGAKNLGEALRRIEEGAAFIRSKGEAGTGDVSEAV
                     KHINLIYQEIQWCKENLKTDEQFEAHAKELRVPVELLKETVAAGKLPVVTFAAGGVAT
                     PADAALLMQLGCEGIFVGSGIFKSSNPEKLARAIVQATTHYMSPEKLLEVSSDLGEMM
                     PGMTVDSINKSNGVRLSEIGK"
     gene            <619570..>620397
                     /locus_tag="AGOS_ABR123W"
                     /old_locus_tag="ABR123W"
                     /db_xref="GeneID:4619178"
     mRNA            <619570..>620397
                     /locus_tag="AGOS_ABR123W"
                     /old_locus_tag="ABR123W"
                     /product="ABR123Wp"
                     /transcript_id="NM_208423.1"
                     /db_xref="GeneID:4619178"
     CDS             619570..620397
                     /locus_tag="AGOS_ABR123W"
                     /old_locus_tag="ABR123W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YFL060C (SNO3), YNL334C (SNO2) and YMR095C (SNO1)"
                     /codon_start=1
                     /product="ABR123Wp"
                     /protein_id="NP_983070.1"
                     /db_xref="GeneID:4619178"
                     /translation="MNVVANDYAESILLVVERQNSSYLRKRRGRKNAAGVSLSLYLRI
                     YRASAGITTLSQLRNSVRSQFDIMSKVVGVLALQGSFAEHIDCLEACVRENGHNVEVI
                     AVKTQQELARCDSLIIPGGESTAISQIAERTGLHEHLYQFVRTPGKSAWGTCAGLIFL
                     SNQVANQAALLKPLGILDVTVERNAFGRQLQSFEKDCDFSSFWDHDGPFPTVFIRAPV
                     ISKINSKNVEVLYTLQRDDGSEQIVAVRQGSILGTSFHPELGSDTRFHDWFLRTFVL"
     gene            complement(620512..620585)
                     /locus_tag="AGOS_t0038"
                     /db_xref="GeneID:4619179"
     tRNA            complement(620512..620585)
                     /locus_tag="AGOS_t0038"
                     /product="tRNA-Asn"
                     /codon_recognized="AAC"
                     /db_xref="GeneID:4619179"
     gene            complement(<621909..>623696)
                     /locus_tag="AGOS_ABR124C"
                     /old_locus_tag="ABR124C"
                     /db_xref="GeneID:4619002"
     mRNA            complement(<621909..>623696)
                     /locus_tag="AGOS_ABR124C"
                     /old_locus_tag="ABR124C"
                     /product="ABR124Cp"
                     /transcript_id="NM_208424.1"
                     /db_xref="GeneID:4619002"
     CDS             complement(621909..623696)
                     /locus_tag="AGOS_ABR124C"
                     /old_locus_tag="ABR124C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YBR021W (FUR4) and YIR028W (DAL4)"
                     /codon_start=1
                     /product="ABR124Cp"
                     /protein_id="NP_983071.1"
                     /db_xref="GeneID:4619002"
                     /translation="MVGTNHKRGSHDEGPMRSGEDGSTSVLEQTKPAGFYRQHILLSD
                     AQHEGMSLTDTFLYNHDLKPVEQKRRLWSAFNFVCFWTADSINLNNFQVAATGLQLGL
                     TWWQCWLSIWIGYFLAGTLVVLTSRIGSHYHISFPVVIRSSFGIFFSLWPVLNRVMLA
                     VIWYSVQCFVSVGPVSVALKAIFGKDLEQRIPSHINNPNLTTYQLICFLIFWTFSFPF
                     LLVSPHKIRHLFTVKAVIVPIASIAMLFWVLSKSDWQIELGSLTGSTPVRTSVGWAFV
                     RSTMTCLANFATLIINLPDFARFAKTRRSALWSQLISIPLLFSVTSLVGLLTNAAGYK
                     IFAVNYWSPMEVIERILETHYTAATRAGAFFIAVAFMLAQLGTNICANSLAAGTDMTA
                     LLPRFINIRRGSIICAILAWCICPWNLMSSSSRFTETLSAYAIFLSTIGGVMIADYYL
                     VRRGSLKLTHLYSAKPSSYYMYGTKFGINFRALAAYAVGIAPCMPGFIASVADNVTIP
                     KWLMRVYYLNYWVGFGLAFVVYTALSYVNPPKGIPMRKFLTERGWYEKWAEVEDFEEE
                     WLGRAHTPSVLLDQVSSDTSLGSLRDKKV"
     gene            complement(<624121..>628587)
                     /locus_tag="AGOS_ABR125C"
                     /old_locus_tag="ABR125C"
                     /db_xref="GeneID:4619180"
     mRNA            complement(<624121..>628587)
                     /locus_tag="AGOS_ABR125C"
                     /old_locus_tag="ABR125C"
                     /product="ABR125Cp"
                     /transcript_id="NM_208425.3"
                     /db_xref="GeneID:4619180"
     CDS             complement(624121..628587)
                     /locus_tag="AGOS_ABR125C"
                     /old_locus_tag="ABR125C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YDR011W (SNQ2), YNR070W (PDR18) (PDR18) and YPL058C
                     (PDR12)"
                     /codon_start=1
                     /product="ABR125Cp"
                     /protein_id="NP_983072.3"
                     /db_xref="GeneID:4619180"
                     /translation="MLSHHPSTCPDPQRYMIEATGPQWAKTEGHDSRTSLSGSSAPEL
                     VAYGSEAGAEERERLSRVMTLQSMGEARAALDPGMAQKVESLARTLSQHTVRDGRLVV
                     DPADFDMKAILSGLVSASQRQDIPMRQTGVLVEGVTVQGVDSSCVEGHDYGDVLALPL
                     TAVRAVRQAMRRRYRNILESVTLLARPGEMVLVLGRPGAGCTSLLKTVAGETDQFHSV
                     EGAISYDGIPQREMMRRYRAEVVYNSEIDVHFPHLTVKQTLDFALACKTPHMRVNNVS
                     RAEYITLMRELYATVFGLRHTYDTKVGNDYIRGVSGGERKRVSIAEALAANASVYCWD
                     NATRGLDASTALEYAQAMRIMTNLLQSTSLVTLYQASENIYETFDKVLVLFEGRQIYF
                     GDVMSAKAYFEEMGYTCPPRQSTTEFLTALTDTNGYHVVKPGHEATVPRLPEEFEQYW
                     LNSKEYRSLLSEIEDYRREVDAHETRDQLEKFKLKGKSKYTHKRSPFMISFFEQVKLC
                     TIRGFQRIYGDKSFTVINVVSAVVQALITGSLYFSSPSNTSGAFSRGGILYYAILYFS
                     LMGLANINFSNRPILQKHKMYTLYHPSAEALASTISACVFRMIALTLFLIVLYFLSGL
                     TVEAWRFFSIYLFLVLASEGINAMFEVITALSTSLSQANAVAGLVMFGISIYSTYMIQ
                     KPSMHPWFAWISYILPIRYAFESMLNAEFHGRHMDCADTYVPTGPGYEGVTPENRVCA
                     FIGSKPSQSWVLGDDYLSVNYEYEYENQWRNLGILIAFWIGFLTLKCLATEYKRPMKG
                     GGDSLVFKKGTLAKRKVQDDSESRNVSGAAESKMVASTVGTDDVFDGLKNDDVFIWRD
                     ISFSITHNGDKKKLLDQITGYCIPGTLTALMGESGAGKTTLLNTLAQRNVGVITGDML
                     VNGLPIDASFERRTGYVQQQDVHVKEMTVRESLQFSARLRRPESVSEAEKMNYVEKII
                     EILGMSDFADALVGDAGYGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSSWA
                     IVQLLKRLAQSGQAILCTIHQPSATLFEQFDRLLLLQKGGQTVYFGDIGEESRTLLDY
                     FQRNGARPCTPSENPAEYILESIGAGATATTTEDWAELWRNSPECARENEIVNKLVNE
                     LSEKYLSNAPAPISKYATSYFYQFRYVVSRTMLIFYRDLDYLLSKQFLFLSAGLFIGF
                     TFYDVGTSYTGLRNTMFAVFMSIITSAPAMNQIQARAIKMKDLYIVRESKSNLFHWSL
                     LLITQYLAELPYQFLFSTIYFLCMFFPMKLGLSARENGIFFLNFCIVFQAYFVGLGLA
                     VLYLAPNLESANVILGVFLSFLISFCGVVQPYYLMPGFWKFMYRLSPYTYFTQNFLGI
                     MLHDRPVRCNSREFSFLDPPNGVTCGEYMQPFVNSVSGYVDNPDATSNCAYCIYRVGD
                     EYLASIGAKYSYLWRNFGILWGYVAFNIIAMLSLYWLFRVKKVTIKNPFKRD"
     gene            <628857..>633392
                     /locus_tag="AGOS_ABR126W"
                     /old_locus_tag="ABR126W"
                     /db_xref="GeneID:4619181"
     mRNA            <628857..>633392
                     /locus_tag="AGOS_ABR126W"
                     /old_locus_tag="ABR126W"
                     /product="ABR126Wp"
                     /transcript_id="NM_208426.2"
                     /db_xref="GeneID:4619181"
     CDS             628857..633392
                     /locus_tag="AGOS_ABR126W"
                     /old_locus_tag="ABR126W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YOR153W (PDR5) and YDR406W (PDR15)"
                     /codon_start=1
                     /product="ABR126Wp"
                     /protein_id="NP_983073.2"
                     /db_xref="GeneID:4619181"
                     /translation="MSDEQCQSDHQWPMESSKVPPAGLSLSRVSTGASTSADPAHRPY
                     VGLAEDREEQEVIRSLARTLSGSSGAAGRDYQTGTADELAFFGANSDPRLDPESGEFD
                     SQFFVRTLRKLYMSDPDHYKPAELSVVLRNLRVCGEAADTDYQATVGNWPWKTARSLY
                     DMTFRRGHTKAEFDILKPLDAVFEAGRLCVVLGRPGAGCSTLLKTVGARTYGFNVAPE
                     SEVSYSGFTQKEISKNLRGEVIYSAEMDTHFASLPVGYTLEFAARCRCPQVRPGGVSR
                     ETYYKHYASAVMATYGLSHTRNTKVGNDYIRGVSGGERKRVSLAEVTLAGAKVQCWDN
                     STRGLDSATALEFVRALRDNAHVMHTTQLIAIYQCSQDAYDLFDDVLVLYEGYMIYFG
                     PREFAKDYFLRMGWACPPQQTSADYLTSVTSPAERQPRPGYEDKVPRTAKEFYDRWMA
                     SPERAAVQERINMHMADYETGVARQQLKEHHKSRQAKHMRPSSPYLISFYMQFRAVVD
                     RNLKRLGGDPWVYLFNILSNTIMGLILASCFFNQKEDTASFFYRGSALFTAVLFNSFS
                     SMLEIMSLFEARAIVEKHKSYAFYRPSADAFASIFTELPSKVITCVSFNIPFYFMVNL
                     RRSAGAFFFYLLISMTSTFAMSHLFRTLGAATTSLYVTMLPASILLLAISTYVGFVIP
                     QKNIVGWSKWIFYLNPIARSMEAMVANEFDGRTFECSQMMPSGPAYENVPLANKVCVA
                     VGSLPGETTVSGTRYMELSYDYLAKHKWRNWAIVLAYAIFFLGLYLLLIEYNKGEMQK
                     GEMAVFLRSTLKKIRKQNKAVKGDVESGNAQGKESSTIDSDQSRELIKKIGSDKIFHW
                     RNVCYDVQIKKETRRILTNVDGWVKPGTLTALMGSSGAGKTTLLDVLANRVRVGVVTG
                     DMFVDGLPRGASFQRNTGYCQQQDLHGCTQTVRDALKFSAYLRQPQSVSEAEKDAYVE
                     DIIRLLEMEAYADAIVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQT
                     AWSVCQLMRKLANHGQAVLCTIHQPSAILMQEFDRLLLLASGGRTVYFGGLGKGCATM
                     VEYFEKHGSQKFPEGCNPAEFMLEIIGAAPGSHALQDYHEVWKNSEEYRSVQEELLRM
                     ETELSKKPRTESPEQNREFAASLWYQYKVVSKRVFQQYWRSPGYLWSKIFMGTFSALF
                     IGFSFFKSKSSMQGMQNQMFATFLFLLIINPLIQQMLPQYEEQRDLYEVRERHSKTFS
                     WKAFILSQLTAELPWAIFVGTLAFFSVYYPVGFYNNAVDTSDRSERGFLFWLLAVCYY
                     IFSATFGYFCIALLGSRESAAMFANFVFMIWTVFCGVLVNGDNLPRFWIWAYRISPLT
                     YLVSSIMSTGMAKAKIQCAPEELVKFIPPAGQTCEQYLRPFQSYAQGTALLNPTATDL
                     CTMCPMQSSDTFLAGLGIYYKNRWRDWGIFMVFIFTNIAGFILFYWFLRVPKATGVTI
                     KKATNEEEDEEKGQQRK"
     gene            633848..633937
                     /locus_tag="AGOS_t0039"
                     /db_xref="GeneID:4619182"
     tRNA            join(633848..633884,633902..633937)
                     /locus_tag="AGOS_t0039"
                     /product="tRNA-Arg"
                     /codon_recognized="CGU"
                     /db_xref="GeneID:4619182"
     gene            633957..634046
                     /locus_tag="AGOS_t0040"
                     /db_xref="GeneID:4619003"
     tRNA            join(633957..633993,634011..634046)
                     /locus_tag="AGOS_t0040"
                     /product="tRNA-Arg"
                     /codon_recognized="CGU"
                     /db_xref="GeneID:4619003"
     gene            complement(<634437..>635489)
                     /locus_tag="AGOS_ABR127C"
                     /old_locus_tag="ABR127C"
                     /db_xref="GeneID:4619004"
     mRNA            complement(<634437..>635489)
                     /locus_tag="AGOS_ABR127C"
                     /old_locus_tag="ABR127C"
                     /product="ABR127Cp"
                     /transcript_id="NM_208427.2"
                     /db_xref="GeneID:4619004"
     CDS             complement(634437..635489)
                     /locus_tag="AGOS_ABR127C"
                     /old_locus_tag="ABR127C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR313C (SPS4)"
                     /codon_start=1
                     /product="ABR127Cp"
                     /protein_id="NP_983074.2"
                     /db_xref="GeneID:4619004"
                     /translation="MSRLFHKKERHDDVVEAAAAVGEVVADGNEGEMVTVDLPAERSG
                     CKTLTHIGTYPLVQQTKDILEHLPPARILAANTKPIVVSVVHSKPVAIVRPVVNIADS
                     VFDKTLSVTEKVVPSLKTKTYQRLGEEIMLPYTLTKTVIVKTTNGTVSIANNFVYEPA
                     HENILKFRRYYNQRLIDTHGKPLIRGSLDFVVGPANRQYERLITRVLPEGKEVPVNGF
                     SNEVDRSVALTFNLVSRLIPAAAKKTSRIIWSPWNYAKHVNDVFNENLDKQEDLYWAH
                     SWDATKNAITELNAETIGHVKQIIPGVRKANRAPAQNPIPVQQEVPKPAEPVEAPSEP
                     PLEQQQPQVVQEAVVA"
     gene            <637507..>638652
                     /locus_tag="AGOS_ABR128W"
                     /old_locus_tag="ABR128W"
                     /db_xref="GeneID:4619183"
     mRNA            <637507..>638652
                     /locus_tag="AGOS_ABR128W"
                     /old_locus_tag="ABR128W"
                     /product="ABR128Wp"
                     /transcript_id="NM_208428.2"
                     /db_xref="GeneID:4619183"
     CDS             637507..638652
                     /locus_tag="AGOS_ABR128W"
                     /old_locus_tag="ABR128W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR315W (SFG1)"
                     /codon_start=1
                     /product="ABR128Wp"
                     /protein_id="NP_983075.2"
                     /db_xref="GeneID:4619183"
                     /translation="MWPMIEPPKDKIYGPPEHLIMCTPKTHVLEPDDMNLPPLRLGPK
                     IQLRIPAETCGDSIVESPSKPSKVVRQTLSMPFPEQFGIISPLLSSDDDTLSDSSMIS
                     PVSETSSVASCSPEISKKLLPRNFLDREDEPGLLPTSVAEEGEEDDGDLSLNLLFRNE
                     SAAQDAGKVEDKVTDSDLREDVWPLQPTEAEQSPNPLSRKRSFTGLCGEDSWKRVCQP
                     KHCQLQPTKSSLKLQPHRLNFLMDSSNGNVKDATIFATEINSCNAYGVPFPASVLERV
                     TIPVNTHVKEHYKNERGEYLGGYYDDDEDEKTEGDQKTAVANDSAGDSAIIRAYAFER
                     LVTFKEEAPTGLDAQSGKTADLTLDSPYRSSGCGAAKTIRWAPSVTW"
     gene            complement(<639090..>640361)
                     /locus_tag="AGOS_ABR129C"
                     /old_locus_tag="ABR129C"
                     /db_xref="GeneID:4619184"
     mRNA            complement(<639090..>640361)
                     /locus_tag="AGOS_ABR129C"
                     /old_locus_tag="ABR129C"
                     /product="ABR129Cp"
                     /transcript_id="NM_208429.2"
                     /db_xref="GeneID:4619184"
     CDS             complement(639090..640361)
                     /locus_tag="AGOS_ABR129C"
                     /old_locus_tag="ABR129C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR243C (ZRC1) and YOR316C (COT1)"
                     /codon_start=1
                     /product="ABR129Cp"
                     /protein_id="NP_983076.2"
                     /db_xref="GeneID:4619184"
                     /translation="MLSNKEIRIVSLLVLDTVFFLLEIIIGYTVHSLALIADSFHMLN
                     DIVSLIVALWAVNVAKTRNPDARYTYGWKRAEILGALINAVFLIALCVSILIEAIQRF
                     FEPQEVKNPQLILYVGTAGLLSNILGLFLFHEHGHSHSHGTTGEDMEAHSSSHSHSHH
                     IGSHLHEDEPEAIQEFLPAAVVERYMSSSDENTPLVKDHDHKHSAHGADHRSLNMHGV
                     FLHVLGDALGNVGVMLTAIFIWKTDYSWRYYSDPFVSLVITCIIFSSALPLSRKASRI
                     LLQATPSSISADEIKGKILAIPGVISVHDFHIWNLTETFSIASIHVQVDCGQDSYIGT
                     AKVIRSIFHRYGIHSATVQPEFIGSRDVSDDSYRRFSRIAGGGLGSSTSVNEESDSTK
                     DQVPHAYGATNSQTGCLVDDAANCNSDNCLP"
     gene            <641269..>641604
                     /locus_tag="AGOS_ABR130W"
                     /old_locus_tag="ABR130W"
                     /db_xref="GeneID:4619185"
     mRNA            <641269..>641604
                     /locus_tag="AGOS_ABR130W"
                     /old_locus_tag="ABR130W"
                     /product="ABR130Wp"
                     /transcript_id="NM_208430.2"
                     /db_xref="GeneID:4619185"
     CDS             641269..641604
                     /locus_tag="AGOS_ABR130W"
                     /old_locus_tag="ABR130W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR116W (COX23)"
                     /codon_start=1
                     /product="ABR130Wp"
                     /protein_id="NP_983077.2"
                     /db_xref="GeneID:4619185"
                     /translation="MPVDTAAPQSTANPDPSVQTDRAAVNFTPSTDASSFQFYPDNPE
                     SPLARYRFAAKGPSQYFDPCQESANMSMKCLERNNYDRDLCREYFDAYRECKKQWLSA
                     RRKDNSQWT"
     gene            <641859..>643643
                     /locus_tag="AGOS_ABR131W"
                     /old_locus_tag="ABR131W"
                     /db_xref="GeneID:4619186"
     mRNA            <641859..>643643
                     /locus_tag="AGOS_ABR131W"
                     /old_locus_tag="ABR131W"
                     /product="ABR131Wp"
                     /transcript_id="NM_208431.1"
                     /db_xref="GeneID:4619186"
     CDS             641859..643643
                     /locus_tag="AGOS_ABR131W"
                     /old_locus_tag="ABR131W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL121C (TOM70) and YHR117W (TOM71)"
                     /codon_start=1
                     /product="ABR131Wp"
                     /protein_id="NP_983078.1"
                     /db_xref="GeneID:4619186"
                     /translation="MSSENSFAGFVSRNRTAIIATAAAGASAVGAYYYYQQLQRQSSG
                     EVSKDATGSTDVKSKKKKKRNNKKKYPVDQNGEPDLSGMATFTEEQKEKYAMALKDKG
                     NECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD
                     YSKCLLRRATANESLGNYADAMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLKQK
                     LSGGEKHELPSNTSLASFFRIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEI
                     ADEAFTDAVEKFTAAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAID
                     LFPRPNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQA
                     GKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEI
                     LSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFE
                     LACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLSRAFEEKLQATTFAEAAKI
                     QKRIRADPVMSAKIQETLDAYRAQGMVV"
     gene            complement(<643920..>644726)
                     /locus_tag="AGOS_ABR132C"
                     /old_locus_tag="ABR132C"
                     /db_xref="GeneID:4619187"
     mRNA            complement(<643920..>644726)
                     /locus_tag="AGOS_ABR132C"
                     /old_locus_tag="ABR132C"
                     /product="ABR132Cp"
                     /transcript_id="NM_208432.1"
                     /db_xref="GeneID:4619187"
     CDS             complement(643920..644726)
                     /locus_tag="AGOS_ABR132C"
                     /old_locus_tag="ABR132C"
                     /note="NOHBY215; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABR132Cp"
                     /protein_id="NP_983079.1"
                     /db_xref="GeneID:4619187"
                     /translation="MQSEQRKRNADTKLKFMTNIDESDEDRKLGTTEPAPLIISEVES
                     DDDNSSLNSDHDAFPDWQKLVYERLAARDQTTMNAIMLNFEKTGIVDLSTIDAQFLDN
                     FRGAFVSAQQHLRRKGCVDEEQVNEQFGITSMMRILSGRTLYEEPVCSMSLLDQLKVT
                     GAAPKGALQTNGDALPLRNADDTPQVMAKPPYASQVPLADRISMYGLDGCESGASSDY
                     EEGDAADELPFLVDDFDLPYSGLQSPAKKRNVDNNEQDQSNSSKRPRVGY"
     gene            <645024..>645314
                     /locus_tag="AGOS_ABR133W"
                     /old_locus_tag="ABR133W"
                     /db_xref="GeneID:4619188"
     mRNA            <645024..>645314
                     /locus_tag="AGOS_ABR133W"
                     /old_locus_tag="ABR133W"
                     /product="ABR133Wp"
                     /transcript_id="NM_208433.1"
                     /db_xref="GeneID:4619188"
     CDS             645024..645314
                     /locus_tag="AGOS_ABR133W"
                     /old_locus_tag="ABR133W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL122C"
                     /codon_start=1
                     /product="ABR133Wp"
                     /protein_id="NP_983080.1"
                     /db_xref="GeneID:4619188"
                     /translation="MFFNMLRPLTGLPVRFGSGAFAATTQPSLIMVRTLMKTHKGAAK
                     RWRKTAGGYKRSKAGRSHGNTGWGQRALKQLSGRTMAASAHLKRLRRLLPYH"
     gene            complement(<645405..>648338)
                     /locus_tag="AGOS_ABR134C"
                     /old_locus_tag="ABR134C"
                     /db_xref="GeneID:4619191"
     mRNA            complement(<645405..>648338)
                     /locus_tag="AGOS_ABR134C"
                     /old_locus_tag="ABR134C"
                     /product="ABR134Cp"
                     /transcript_id="NM_208434.2"
                     /db_xref="GeneID:4619191"
     CDS             complement(645405..648338)
                     /locus_tag="AGOS_ABR134C"
                     /old_locus_tag="ABR134C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL123W (NMA111)"
                     /codon_start=1
                     /product="ABR134Cp"
                     /protein_id="NP_983081.2"
                     /db_xref="GeneID:4619191"
                     /translation="MTIQAHKRTLSEVSTSSVGQLKRREGYTEDYTDEGSDIDMPEYV
                     TDSANNQQWQDTISRVVQSVVSVHFAQVAPFDCESALVSEATGFVVDAKLGIILTNRH
                     VVGAGPFSGYAVFDNHEECDVIPIYRDPVHDFGFLKFDPSTIKYMNVQALELKPALAK
                     VGSEIRVVGNDAGEKLSILAGFISRVDRNAPDYGELTYNDFNTEYIQAAAAASGGSSG
                     SPVVNIDGYAVALQAGGSTEASTDFFLPLDRILRALRCIQGSQPITRGTIQTQWLLKP
                     YDECRRMGLSPESEAKAREQFPGKIGLLVAETILREGPADKSIKEGDILISINGQMIC
                     SFIQVDAILDENVGKPITLVVQRSGIDITVECTVGDLHAITPSRYVEVCGATFNELSY
                     QMARYYAIPVRAVFLSSATGSFCFDTKEKLGWIVDEVNNQPTPTLDTFIEVMSTIPDC
                     SRVTVQYHHLVDQHSPHVTTVYIDRHWCNEFRIFERNDETGIWDYKNLADPIPALPLK
                     PQTAKFIDLPISNPKLARLARMLVMVSTIGPVPLDSVDPEPRKAAGLVLDAKQGYVIV
                     SRRIVPHDCMDVFVTIAESVLVPASVVFLHPTQNYVIVKYDPAQVQAAVETPILSTER
                     LKRGDKVQFVGYTHNFRSVSSETTVTDISSLSIPSNMVPRYRATNLEAISIESSVGSR
                     CHSGILADDDGTVRALWLSFLGEKQDEKDKIYLMGLDLVDIGEVVEVLKKGKIPRVNI
                     VDSGFGSISVLQARLRGVPEEWIKRMESESENRLQFITVTRVSYTDEEQKLVSGDIIL
                     SVNDQLVKQMRDLEGIVTTTDVPAVQQVLRFKIVRKGSIMDLDIKTIEVEETSKIVIF
                     AGCILQAPHHAVRQAMLNIPSGVYCTFRGQSSPAIQYGISSTNFITHVNEIETPDLDR
                     FLEVVRTIPDNTYCKIRLVTFDNVPFAISLKTNYHYFPTSELSRNSDTGRWIEHLCNA
                     TPAKN"
     gene            complement(<648713..>649957)
                     /locus_tag="AGOS_ABR135C"
                     /old_locus_tag="ABR135C"
                     /db_xref="GeneID:4619192"
     mRNA            complement(<648713..>649957)
                     /locus_tag="AGOS_ABR135C"
                     /old_locus_tag="ABR135C"
                     /product="ABR135Cp"
                     /transcript_id="NM_208435.1"
                     /db_xref="GeneID:4619192"
     CDS             complement(648713..649957)
                     /locus_tag="AGOS_ABR135C"
                     /old_locus_tag="ABR135C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR118C (ORC6)"
                     /codon_start=1
                     /product="ABR135Cp"
                     /protein_id="NP_983082.1"
                     /db_xref="GeneID:4619192"
                     /translation="MSVSQVRQSVSEILGLNAQEETPDWNSGRLKRMAATTATLYNVS
                     LNKVMLKQPEEIARCHICAYLAAEKLSEKYEPELQYYREKIPLEPRKTVKLVGLFKQT
                     LWTSSPVRNLNLSPSPKKDGGRLSARDPVELRAELFGTPVKRAGAVTLPGAGELSPTK
                     QLSPSKPMSPVKPSPRRRLAFEDEDEDYEPDASPQPSPRRSIFPGGFEPDPDESEFDS
                     PTKSPFKSPTRSPTKSAQSSPRKKRGEYNQWNMLYKKYYRITPEEIVGLCNQFELPSR
                     VAFQVLDCFGMHATYLVYPAQLVCGLVMLCCFVVHHRKRASDPTIDDYLLKKMCALLR
                     SNSTSDVLEAMKITKELLDGENWYRALKIEYDYYDAADFEQSLAIRLGSMLQNSNVIA
                     STEQFEEWKKKVMLDLSLRDGS"
     gene            <650249..>653176
                     /locus_tag="AGOS_ABR136W"
                     /old_locus_tag="ABR136W"
                     /db_xref="GeneID:4619193"
     mRNA            <650249..>653176
                     /locus_tag="AGOS_ABR136W"
                     /old_locus_tag="ABR136W"
                     /product="ABR136Wp"
                     /transcript_id="NM_208436.2"
                     /db_xref="GeneID:4619193"
     CDS             650249..653176
                     /locus_tag="AGOS_ABR136W"
                     /old_locus_tag="ABR136W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR119W (SET1)"
                     /codon_start=1
                     /product="ABR136Wp"
                     /protein_id="NP_983083.2"
                     /db_xref="GeneID:4619193"
                     /translation="MSGYYNHVKHQGYSRYGQNSTVRNGQHDGLRYRNPSPAHNGTNE
                     GEGLQGSRYENAGGVTHARRPPPVVKWGEAAFRAKYHYFDVEERKLLHLDEMKHWQNG
                     RLPANGYVLVADAGSKGRPVMRERNPEEQAVDPRGARAAHTVRRVRSLLTALPRIPYD
                     AHWVGPEPPKEVVVFPKQREQALSVQDPIIKNFFGTFGEVAHFESFNDPNNALPLNIY
                     LVRYINVEGNPDSPYKAAYKAVKQFAKQDYLVSGARFAVRLNMNGFLQKTIDKFVTEN
                     LQRAAKLRHEQAKQQSTVQKVTNVSAVPSGVPPPKIPLGLERIVNNKPILRVSARFCA
                     LHGITSEDFKYGLKNYHWTRVINHYSGIYIIFDDIAEAEKCLQMESLRLTFFSRRRKI
                     PVKIKFMLIEPSHQPPASQPLTDQDEVPKVYETEAELIEETLKHIINELKTTLYKDIR
                     RRLLGPTIFDALNPGNYPDIVARRQKEEEAKKEKEKAMVEKTKKEAPSAAAFDIFNLY
                     GTAYKKRDGTKGKKRHVAEGRPEESSGRRRIQSKGTAPMAHMLNYESLKVNGTASPIK
                     EAESETCSSDEEDDDNFDVEMTDQSSIKKLKRESTATTPEQEPLQERVAGLSAERTKE
                     LLSYPEKYRPLAGDQPEPIYPEFLIEKYDDPLLSIVDLQRSVKDKEDMELLKKVIAYD
                     REEVKDVINDIEFFAWRLHRDYKEHKENMQHQSKLSESTYKNLLNAHGGCFKQQGFRK
                     MPDKLKSIYLPHRRKLNQPLNTVYHHGIEDFANTDNNKMDTDPPEDTFTPEQTSSRVN
                     RALQRRFQQDIEAQKAAIGTESELLSLNQLTKRKKPVTFARSAIHNWGLYALEPISAK
                     EMIIEYVGERIRQPVAEMREKRYLKSGIGSSYLFRVDESTVIDATKKGGIARFINHCC
                     DPSCTAKIIKVGGMKRIVIYALRDIAANEELTYDYKFERETDDEERLPCLCGAPNCKG
                     FLN"
     gene            <653347..>656214
                     /locus_tag="AGOS_ABR137W"
                     /old_locus_tag="ABR137W"
                     /db_xref="GeneID:4619194"
     mRNA            <653347..>656214
                     /locus_tag="AGOS_ABR137W"
                     /old_locus_tag="ABR137W"
                     /product="ABR137Wp"
                     /transcript_id="NM_208437.2"
                     /db_xref="GeneID:4619194"
     CDS             653347..656214
                     /locus_tag="AGOS_ABR137W"
                     /old_locus_tag="ABR137W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR120W (MSH1)"
                     /codon_start=1
                     /product="ABR137Wp"
                     /protein_id="NP_983084.2"
                     /db_xref="GeneID:4619194"
                     /translation="MLLHVGTLLRCTGHRILRRYTIVPAARDINPVVAKLKFSLDVIP
                     ATQIESQESDDSEPNKKIDRGNRMYSNSLPPSLQFVRDMMDKYPDYVLLTQMGSFYEL
                     YYEHAEKYAPKLNITLTRREYSHGKVPFAGFPLEQLSRHLKVLVKEYGYSVAVVEQFR
                     KDDIADNERYKFNRRVTRVVTPGTFIDEAFENLQENQFLLSVEFPDRCMEKLSDPSIK
                     VGLSWCDISTGELFVQQVQLKGLISAITKIKPREILLSEDLLAYQIQNGNWYPELVEF
                     KKYFIKYYKTPSRHRTMETFSHLFAFGANNASKRNLDIVLHSLSQKETAALRANLTYI
                     EQHLPEMLANLAFPKRSLTTDSMQIDSRTSAALELHNTFRDNLKRGSLLSAIRRTVTP
                     SGTRLLTQWLSAPSMHLDEIKQRQNLVRLFMQNPFVTDNLIAQLKATADMTRILQKFS
                     FKRGDAAHLLQMAQSLQQCSAIGDTIHSFTTEGPISKDLAAVLDKLSSALRFEGGIVQ
                     EILAAINLKKFSEFEGPQLVTAPEDEPALSLEDSNETTEFPVHPGMLNPEVSPRLGDL
                     YSKYDKLLTRQQQLLQEYRDFFVHTHKARTITTRNNKRDTGYALYLTGGGNSLKKILR
                     NVNEGAEVADSRFRIIRSSANTCWLSHEPWNELGKAMHLTTLELLDEERYILDNLQRK
                     IITYSTEIRAIAQTVDYLDVLSSFAILASEKNLVCPQVDESSALEIVGGRHLVVEDGL
                     QSRAPGNFTANDCSLQNGDIWIVTGPNMGGKSTFLRQTAIIVILAQIGCYVPCASAHI
                     GLVDKIFSRVGSADDLYNDMSTFMVEMLETSFMLKGATKRSLAILDEIGRGTNAEDGV
                     GIAYTTLHHMLTKNRCRALFASHFGRELSELVEQHLPPGARKRVHFYRTNVREHNGRS
                     FYDHKITPGICLSSDAIRVAQMAGFPQEALDVARRVLAAST"
     gene            complement(<656302..>657966)
                     /locus_tag="AGOS_ABR138C"
                     /old_locus_tag="ABR138C"
                     /db_xref="GeneID:4619195"
     mRNA            complement(<656302..>657966)
                     /locus_tag="AGOS_ABR138C"
                     /old_locus_tag="ABR138C"
                     /product="ABR138Cp"
                     /transcript_id="NM_208438.2"
                     /db_xref="GeneID:4619195"
     CDS             complement(656302..657966)
                     /locus_tag="AGOS_ABR138C"
                     /old_locus_tag="ABR138C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL124W (NAF1)"
                     /codon_start=1
                     /product="ABR138Cp"
                     /protein_id="NP_983085.2"
                     /db_xref="GeneID:4619195"
                     /translation="MRWASVAAALRSASDIGRMALEDSEATHSTTGVQPDDATGPDRE
                     AQGAESSSTAAPEHIHTQNADGTQPGEGSAALVADGETVAAGLRAGAQWADETVTVEL
                     PEDVSEADCLSSDEEGLGATPAAAAMQTSAEQGGSDGGSAEQGGSDDSSSESSADEAD
                     AALSDAELDEEEDAPQGPVRSKNELVEEPLPEIPADFVVESDTPILEIGTIKSAFDQN
                     IIVQAMLSGEQRVLQEGSIFCLADRTVVGPVCEVFGKLSNPFYRVTFPKDAAEKFELF
                     KNQLGAQVFLVQPKAHWLDTFEIKQVRGTDASNGVDEEVPEDEQEFSDDEAEAEFKRQ
                     KKLAKKRKAGNQDEKPRGKLSLEGRTGLPRMQVPSSLARASDRAPTYKPRSARQQRPV
                     PPSHSRPQDQRASVAQPAHSAVPYAPLAAQPAPPVSYSQTAFPQATQPQMYPTSDPMA
                     APNQWYHNAAMQQVFHPAMMPQQYNPQQYAPPHFPQQYAGTYLPPQQYQEQLAPQPPV
                     GQYNQAQLLQQLLLQQHNQNQQQQNQQNQQNQYPYPYNYQQHQPPH"
     gene            <658370..>662350
                     /locus_tag="AGOS_ABR139W"
                     /old_locus_tag="ABR139W"
                     /db_xref="GeneID:4619196"
     mRNA            <658370..>662350
                     /locus_tag="AGOS_ABR139W"
                     /old_locus_tag="ABR139W"
                     /product="ABR139Wp"
                     /transcript_id="NM_208439.2"
                     /db_xref="GeneID:4619196"
     CDS             658370..662350
                     /locus_tag="AGOS_ABR139W"
                     /old_locus_tag="ABR139W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR270W (YTA7)"
                     /codon_start=1
                     /product="ABR139Wp"
                     /protein_id="NP_983086.2"
                     /db_xref="GeneID:4619196"
                     /translation="MARHTRRSHQHVNDEDTGSEIYDKNGIKHTTPRSLKKINYAEIE
                     NSYDYMEDYDEGDKEEEPAELENNGRSKGLVGRERGREPEEDEDEEGPVRGRRSRKRT
                     YVDVEEDESFHEEEAEDEDEEALDDDEDEDEEERNWRRRREHQFVVEDEDDDEDEEDD
                     YGAQKKRGRRRTRRGRSRLTERRSPPRKLRTRRTRSSVNMYDSEHDGTGEALTLEDEI
                     RELQEDSPIREKRSLRERTKPVNYTLPPPLTDNQMNVDGTAAPAYGSFHSPRGKRGLH
                     SGQSFGPIRRLFPTGGPFGGNDVTAIFGHNTNFYATAQDPTVANNKFIDSDSSDDEIL
                     PLGSTPKPKSSEAKKKKKPEIADLDPLGVDMNINFDDIGGLDNYIDQLKEMVALPLLY
                     PELYQNFNITPPRGVLFYGPPGTGKTLMARALAASCSTEKRKITFYMRKGADILSKWV
                     GEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRSSKQEQIHASIVSTMLALMDGMDN
                     RGQVIVIGATNRPDAVDPALRRPGRFDREFYFPLPDIRARAKILEIHTRKWHPPVSSA
                     FIEKLASLTKGYGGADLRALCTEAALNSIQRRFPQIYQSEVKLAINPREVQVKAKDFM
                     IAMEKITPSSARSSGNLAEPLPRTIAVLLNDQFEEIKQKLNSILPEASSKSHRGSSLI
                     KEYLEYEDEEDEEDGEDNIEGTGIHSSNGFSRHEFFKMLDQARTVKPKLLITGPAGNG
                     QQYIGSALLHHLEDYNIQNLDLGTLLSESLRTMESAIVQTFIEAKKRQPSVIYIPNAD
                     IWSRTVPESAIMTLASLFRSLKTNERVLLLAIAEGFTEEELHNTPLSLFGFDLNIVSI
                     REPSTAQRHNYFKTLEELLKMKPTKFREKRKRKKPLPVLPVCDTPSNDDIGSDGELLT
                     EDEKLRRKLKSYHHQDMKLKNTLKIKLSGLMDLFKGRYKRFRKPPIEDSLLIHLFEPE
                     AYASNPEWQPAYVREDDMILEVSTGRKYYNMDLDIIEERLWNGYYSEPKQYLKDIELI
                     YRDANTTGDRERIIKASEMFANAQMGIEEISTPELIQECRDTRQRELLRQQLYLRDQQ
                     KKIHEEEAKLEQEKKDPTFPNDDNHPEEADLSVGAGQQLHSPSQMSHEACESHAEDGL
                     GVPHGFENNTYAIGDNTPETIDNGSPKPLEDFCGEDKTVPDDKSVPERFVQEGEASEM
                     GFIPKTPSARPVSMHSNPSSKESVVAPMQKTGLEVNSIEDTSVAVQSELTRDEDLPMT
                     PEPAFILDETVLAKIISMLKTKTQGFTVEQLETCYAAVLELVWEARSSWDKTSVIKQI
                     EKYIGM"
     gene            complement(<662417..>663808)
                     /locus_tag="AGOS_ABR140C"
                     /old_locus_tag="ABR140C"
                     /db_xref="GeneID:4619197"
     mRNA            complement(<662417..>663808)
                     /locus_tag="AGOS_ABR140C"
                     /old_locus_tag="ABR140C"
                     /product="ABR140Cp"
                     /transcript_id="NM_208440.2"
                     /db_xref="GeneID:4619197"
     CDS             complement(662417..663808)
                     /locus_tag="AGOS_ABR140C"
                     /old_locus_tag="ABR140C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR293C (HER2)"
                     /codon_start=1
                     /product="ABR140Cp"
                     /protein_id="NP_983087.2"
                     /db_xref="GeneID:4619197"
                     /translation="MKRALERLRQLPRANERFNIFNSVNLSAAQQVMPSEKPLGNLVV
                     GIKDNIVTKKLPTTCSSGVLAGYMSPYDATVVELLDEAGAVTAGKTNMDEFGMGSGGI
                     HSFFGPTLNPAFPERPTVAGGSSSGSAAAVAAGVVDFALGTDTGGSVRMPAAYTSTVG
                     FKPSYGRVSRHGVIAYAQSLDTVGIGARDVGLVRRVFEVLDRHDPKDPTSLPDELRQQ
                     AAALRREKKHLKIGIPAELLHGSVAAEIRERLLVVLDKLQAQGHELYPVSVPAVKNSL
                     LVYYMLAPAEAASNLARYDGIRYGCRDEDLDMSDEVLFAPTRGKFGKEVKNRIVLGNY
                     NLCSGAFKNNYMKAQKLRVELINQFDSIFAFENICTGNKPNPAGVDVLLSLTCMAPPP
                     SLEAFTSKENKSPVNSYINDVFTVPMSLAGLPCISVPLAGMKGVGIQLTAQFADDYGL
                     LDAAEDVMQEQLN"
     gene            <663924..>665015
                     /locus_tag="AGOS_ABR141W"
                     /old_locus_tag="ABR141W"
                     /db_xref="GeneID:4619198"
     mRNA            <663924..>665015
                     /locus_tag="AGOS_ABR141W"
                     /old_locus_tag="ABR141W"
                     /product="ABR141Wp"
                     /transcript_id="NM_208441.2"
                     /db_xref="GeneID:4619198"
     CDS             663924..665015
                     /locus_tag="AGOS_ABR141W"
                     /old_locus_tag="ABR141W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR294W (JNM1)"
                     /codon_start=1
                     /product="ABR141Wp"
                     /protein_id="NP_983088.2"
                     /db_xref="GeneID:4619198"
                     /translation="MKVEVIDLSATQAQDPLDEEEPKEQEVFETSDNEGLVDEETDEA
                     RQDQEVVSDPVASQDEARTVFESTVVVSTGDFSGRIDRCADLCRTGRADESVDQRLAR
                     IGRELQEIELERGAEEYADEAQGLQEMYRALERERARELGRMQARLQLAPSEEGAVRL
                     PRVTLDAGDCERIVELERKIASLEASVGQTSSTKSVVTCVNELFHKVSLLENNEPLLE
                     KFETSMKRISKEYEESIIGRRATKDPALQKHITEDLKTTDTKVAEIYNSYNLLKKYAG
                     VLPDLINRVQSLNTLHREVRDAATTVQDFDQNVAQLSAQADRWDTMLTEMEEKLDQHE
                     ASFEKNKETIFHWVSALEAKLDGQKGSSL"
     gene            <665108..>670984
                     /locus_tag="AGOS_ABR142W"
                     /old_locus_tag="ABR142W"
                     /db_xref="GeneID:4619199"
     mRNA            <665108..>670984
                     /locus_tag="AGOS_ABR142W"
                     /old_locus_tag="ABR142W"
                     /product="ABR142Wp"
                     /transcript_id="NM_208442.2"
                     /db_xref="GeneID:4619199"
     CDS             665108..670984
                     /locus_tag="AGOS_ABR142W"
                     /old_locus_tag="ABR142W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR271W (SLH1)"
                     /codon_start=1
                     /product="ABR142Wp"
                     /protein_id="NP_983089.2"
                     /db_xref="GeneID:4619199"
                     /translation="MSVAYSTDSVSSYMRAMQAMIGSAQEFRFTKRELELPEVEVECV
                     DIASATESEELTTLSLDRNVWDEVFDLFEDLDSRRLETLAENNDQAKAVRVYKKLFQL
                     LDESTLHSSEEEVVKQLVVILKTHGEDGMLEQVLFDCLGSENIELLSYVIQQQAVLKQ
                     LPVDEGVDLRQFLMEQPTLLSETDIRAQVLLTAAEGRNQELRKLQRIERYPNIYRNSE
                     VNSSAFSFGGQEYVLPVGTTRLSLHTHEEVVIPCSENKNEYLSSSRLLKVEDLDRFCQ
                     SVFPYETLNAIQTLVYPVAYKTNENMLICAPTGAGKTDIALLTILNTVKQFSEINGDE
                     VDIFYEDFKVIYVAPLKALAAEIVDKFSQRLAPYKIRVRELTGDMQLTKAEIIETQVI
                     VTTPEKWDVVTRKANGDNDLVSKVKLLIIDEVHLLHEDRGSVIETLVARTLRQVESSQ
                     SMIRILGLSATLPNFFDVADFLGVNRHVGMFYFDQSFRPKPLEQQLLGCRGKAGSKQG
                     RENIDKVSYEKLYEHVLNGSQVMVFVHSRKDTVRTARNYISFAQANQQSDVFLSSDQS
                     VTKFSRDISKHKDRDMKELFQHGFGIHHAGMSRSDRNLTEKMFKEGAINVLICTATLA
                     WGVNLPADVVLIKGTQIYDSKKGGFIDLGISDVIQIFGRAGRPGFGSLHGTGILCTTS
                     DRLDHYISLITQQYPIESKFSSKLVDNLNAEISLGTVTNVEEGITWLGYTYLYVRMKQ
                     NPLIYGLDWNEVSNDPQLYDKRRSMIMQAARRLHALQMIVFNDTTMNFIPKDLGRVAS
                     DFYLLNESVEIFNQLCNPRVTEADVLAMISMSSEFDSIKYREDEAGELAKLFDTAVEC
                     QVGGQVESSAGKTNILLQAYISQTRINDSALISDSNYVAQNSARICRALFLIGINKRW
                     GRFAIIMLDICKAIERRMWAFEHPLSQFALPETILRQLRDKSPPIENMLDMEASELGE
                     LVHNNKMGAKLYRILRTFPRVEITAECFPITTNVMRIHATLEPDFIWDFHIHGNAQFF
                     WVLVEESDNSEILHFEKFILSRKQMGHVHEMDFMIPLSDPLPPQVVIKVVSDTWIGSE
                     STHVISFQHLIRPHNETLLTRLLRLRPLPTTALNNPLVESIYQFKYFNPLQTMTFHTL
                     YNTNENVFVGSPTGSGKTVVAELAIWHAFRDFPGSKVVYIAPMKALVRERLHDWKKRI
                     TPVTGDRLVELTGDSVPDPRDVKDATIIITTPEKFDGISRNWQTRKFVQNVSLVIMDE
                     IHLLASDRGPILEMIVSRMNYISAQTKKPIRLLGMSTAVANAYDMAGWLGVKNNGLYN
                     FPSSIRPVPLKMYIDGFPDNLAFCPLMKTMNKPAFMAISQHSPDKPVLIFVASRRQTR
                     LTALDLIHLCGMEDNPRRFMKMDDEGELRYYLDQVSDETLKLSLQFGIGLHHAGLVEK
                     DRSISHQLFQLNKIQILVATSTLAWGVNLPAHLVIIKGTQFYDAKIEGYRDMDLTDIL
                     QMMGRAGRPAYDTSGTAIVYTKESKKMFYKHFLNVGFPVESSLHKVLDDHIGAEISSG
                     TITTRQEAMDFLTYTFLFRRAHHNPTYYGILEDTTAAGVNEYLSSLIDTTVQNLAQSQ
                     CIMTEGKRIIPTAFLSISAYYYISHKTVRQLLSQLYNSCKFQDVLKWLSLAVEYDELP
                     VRGGETIMNVEMSENSRYSVESTFTGEQELPIWDPHVKAFLLLQAYLSRADLAIADYY
                     QDTISVLDQALRILQAYIDIASESGYLRTVMTMIKAMQCIKQGTWYEDNPVTALPGIT
                     LQRLDPELFGDDGFPYEYSGEMLTLEKLGRMGYAALCSVCRVHNIQGAAKDKFIREAS
                     MLPVLDKVHFKDQSNPDKLTLVAFRHNESYKDGFRVWCDKFPKAQKELWFAIGFQGDE
                     LLMIKRCQPRRDEGRVIITCDFVVPEELYGETLGFVLINDAMDLHYELSHTLAGGPKK
                     "
     gene            complement(<671072..>671737)
                     /locus_tag="AGOS_ABR143C"
                     /old_locus_tag="ABR143C"
                     /db_xref="GeneID:4619200"
     mRNA            complement(<671072..>671737)
                     /locus_tag="AGOS_ABR143C"
                     /old_locus_tag="ABR143C"
                     /product="ABR143Cp"
                     /transcript_id="NM_208443.3"
                     /db_xref="GeneID:4619200"
     CDS             complement(671072..671737)
                     /locus_tag="AGOS_ABR143C"
                     /old_locus_tag="ABR143C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR271C-A (EFG1)"
                     /codon_start=1
                     /product="ABR143Cp"
                     /protein_id="NP_983090.3"
                     /db_xref="GeneID:4619200"
                     /translation="MANLKSARHRKAAYDSSLQLANALGAGANKIKKQIRNVERLLAK
                     KRDTLPDTVIVEKERTLEALRLELASAEKRALARKNAKKYHMVRFFERKKATRRYKQA
                     LKKVETSAGDDAALTDLRQRELELCYVVNFPKTTKYIALYPVEEDPEAAKETAAKRDA
                     FLKVVAKQLSEGTLPVPLEQILKGKKLNKESTGISVSDSEDEEEPGRNEEAHEEEEDD
                     FFE"
     gene            complement(<671937..>672632)
                     /locus_tag="AGOS_ABR144C"
                     /old_locus_tag="ABR144C"
                     /db_xref="GeneID:4619201"
     mRNA            complement(<671937..>672632)
                     /locus_tag="AGOS_ABR144C"
                     /old_locus_tag="ABR144C"
                     /product="ABR144Cp"
                     /transcript_id="NM_208444.1"
                     /db_xref="GeneID:4619201"
     CDS             complement(671937..672632)
                     /locus_tag="AGOS_ABR144C"
                     /old_locus_tag="ABR144C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR295C and YGR273C"
                     /codon_start=1
                     /product="ABR144Cp"
                     /protein_id="NP_983091.1"
                     /db_xref="GeneID:4619201"
                     /translation="MDTPTHRIKRRSSMPCRALCLSLAAEEVKPRNILHFIYAYIYIV
                     KSASDVPHCWRPGSSMGIFRRESSSRSATQKLAKSDTEKLAPRTIHDPILEAVNEAQP
                     FEQAVATFTENENHTLCSDQRVTKDVFGKPVVQPDISNPTRSRDERPLDTIRGFEYAI
                     TGDQQWMQQLETHRYGFSVRPDFPGLPVGAYMAGAGGYPSFQREQPVFEAPKVSPPRT
                     QSKRRGLFGTRKK"
     gene            complement(<672814..>674487)
                     /locus_tag="AGOS_ABR145C"
                     /old_locus_tag="ABR145C"
                     /db_xref="GeneID:4619202"
     mRNA            complement(<672814..>674487)
                     /locus_tag="AGOS_ABR145C"
                     /old_locus_tag="ABR145C"
                     /product="ABR145Cp"
                     /transcript_id="NM_208445.2"
                     /db_xref="GeneID:4619202"
     CDS             complement(672814..674487)
                     /locus_tag="AGOS_ABR145C"
                     /old_locus_tag="ABR145C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR296C (LCB1)"
                     /codon_start=1
                     /product="ABR145Cp"
                     /protein_id="NP_983092.2"
                     /db_xref="GeneID:4619202"
                     /translation="MIESLENVSELLPSSIPVPTSVITVTSYVLFYLQRIIMAIPGAH
                     YMVEYIAKSHQDDPYRTMVELGLILYGIVYYLNKPRKQGQAEQARFTAREEEQLIAEW
                     EPEPLVDPDFREGWRLAKMPQRRSDDMGNRVTVMRDDGRETHADVLDMASYNCLRLSQ
                     QDAVVARVEKTIRNYGVGSCGPAGFYGNQDLHYNLEYELARFFGTENAVLYGQDFCVA
                     SSVIPAFTKRGDVIVADDQVSVALQNALQLSRSTVYYFKHNDMKSLEELLTKLDERDR
                     AEHLPALPRKFIVTEGLFQNSGDIAPLPELVKLKGAFHYRLVVDETNSLGVLGNTGRG
                     LSEHFNVQRCSSIDITIGSMATALGSSGGFVLGDNVMSRHQRIGSNAYCFSASLPPYT
                     CAGALAMLQTMDADNSAVQNLRTLAKAFHASFTSDLELAEYILVTSNENSSVLHLQLA
                     PAFRMRLFGSSAESIYDELVQLRARHATSLYVDSWEQEERFLQRIVDRVLKDGVLITR
                     NTVVLKHESLPIVPSLKAYCHAAMSCSELERAHEVIKAAIIACCAQPSL"
     gene            <674887..>676224
                     /locus_tag="AGOS_ABR146W"
                     /old_locus_tag="ABR146W"
                     /db_xref="GeneID:4619203"
     mRNA            <674887..>676224
                     /locus_tag="AGOS_ABR146W"
                     /old_locus_tag="ABR146W"
                     /product="ABR146Wp"
                     /transcript_id="NM_208446.2"
                     /db_xref="GeneID:4619203"
     CDS             674887..676224
                     /locus_tag="AGOS_ABR146W"
                     /old_locus_tag="ABR146W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL045C (COR1)"
                     /codon_start=1
                     /product="ABR146Wp"
                     /protein_id="NP_983093.2"
                     /db_xref="GeneID:4619203"
                     /translation="MLRSIARSPLLKRSIATQAAPKAEITELSNGLVVATEPNSNAGS
                     ASVGIVFGSGAAAENPYNNGVSHVLSSAFKSINGAAAAKEGFSLSTAVERDFQSYILD
                     TEAANAGRALDFLQSKLFAPVSDGAFASVRDATLKRVAAFEEQEHAERVLEHLHATAF
                     QNTPLSLPKRGTVESIETLEKSDMESFAKSHFVASNAVVVGSGNISHEALVKAVESQL
                     SLAGGSKPVSKKVSSFLGSEIRLRDDTLPKAWISIAAEGEPISSPNYYVAKVAAQIFG
                     SYVASEPASNLQGVKLLDTVKEYHLADSFNHFSLSYKDAGLWGFSTEISNIHQIDDLM
                     HFALKEWNRLSVSITETEVARGKALLKLNLATAASSNAAAATALGAQTLATGSKLALT
                     EVFAKIDAITAKDVKKWANERLWDQDIAIAGTGQIEGLLDYMRMRNDMSMMRW"
     gene            complement(<676762..>677832)
                     /locus_tag="AGOS_ABR147C"
                     /old_locus_tag="ABR147C"
                     /db_xref="GeneID:4619204"
     mRNA            complement(<676762..>677832)
                     /locus_tag="AGOS_ABR147C"
                     /old_locus_tag="ABR147C"
                     /product="ABR147Cp"
                     /transcript_id="NM_208447.2"
                     /db_xref="GeneID:4619204"
     CDS             complement(676762..677832)
                     /locus_tag="AGOS_ABR147C"
                     /old_locus_tag="ABR147C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL046W (PSY4)"
                     /codon_start=1
                     /product="ABR147Cp"
                     /protein_id="NP_983094.2"
                     /db_xref="GeneID:4619204"
                     /translation="MQSGEESRLGIKCASLHEELTQIVIDQDVGPLQRVPASEFLARL
                     VEHMGQTIPREVFGAEAETGTRDLERLGAIVAYIDENFAAQNVLPFTIQRICELCYHP
                     LHYFRVGELRKFVNALEKVCYVRSSWSAGYGAVPSPAEGTPTREASVDVSMSKIPWLP
                     DDGGRDLRQFIEKIESIVSVNFGYEDDEDEGRDAAIQEYYDNEGAGDDEDDDQDYVDE
                     DSATSEDEEEDVEEEEEEEGPEPEVGLEPVHAESAPEECVGTNKRTTAEREDCHMQPC
                     AAAHSTDGAHPCGLKRSKLQEDGATMASPPDIVAEGGSHDPQVVDASKPPQLTTSATN
                     VSCNASIEATVSLDDDSTAGGE"
     gene            <678180..>679049
                     /locus_tag="AGOS_ABR148W"
                     /old_locus_tag="ABR148W"
                     /db_xref="GeneID:4619205"
     mRNA            <678180..>679049
                     /locus_tag="AGOS_ABR148W"
                     /old_locus_tag="ABR148W"
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /transcript_id="NM_208448.2"
                     /db_xref="GeneID:4619205"
     CDS             678180..679049
                     /locus_tag="AGOS_ABR148W"
                     /old_locus_tag="ABR148W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR113C (RSM7)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /protein_id="NP_983095.2"
                     /db_xref="GeneID:4619205"
                     /translation="MLKNFLLVNSPTSSTAELRGMFGLRRWIAGSAWRAAGAARPAMP
                     RATPALRPAAVAQRRAQTTAAGGNAARAADTAAVDEADKQADEWLAALDELEAEFSAT
                     EYQPEVSLAGEGQKLDLLEEAARARRAFQPTAEQQAEWERLQQVPLPPRRDEVIEHVT
                     NMLMRHGKKEKARKQLARALYVVFCATRQDPVVQLRRALDELAPLMVVKTFKTGVAKA
                     AVIPVPLNQRQRQRLAWRWIVEGSEKRSSSDFAVRLGEELVAVLSGRGSGLSKRDAMH
                     KTAIAHRAYIKLK"
     gene            complement(<679070..>679505)
                     /locus_tag="AGOS_ABR148CA"
                     /old_locus_tag="ABR148C-A"
                     /db_xref="GeneID:4619206"
     mRNA            complement(<679070..>679505)
                     /locus_tag="AGOS_ABR148CA"
                     /old_locus_tag="ABR148C-A"
                     /product="ABR148C-Ap"
                     /transcript_id="NM_208449.3"
                     /db_xref="GeneID:4619206"
     CDS             complement(join(679070..679426,679428..679505))
                     /locus_tag="AGOS_ABR148CA"
                     /old_locus_tag="ABR148C-A"
                     /ribosomal_slippage
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR112W-A; Unclear methionine; Potential case of naturally
                     occuring frameshift"
                     /codon_start=1
                     /product="ABR148C-Ap"
                     /protein_id="NP_983096.2"
                     /db_xref="GeneID:4619206"
                     /translation="MELSGLGIRWRYFGLLCATGCVAVFLGITTDKRFNAITAEHDKA
                     AHFAVFALESWLFTRSIVTRHVAVPGRWLQGGDVEQGAQAARVSKYWVAGLACGAAAA
                     VLSEVAQHVVSRGRRVFDVWDVACNAAGALVGVGAAWWRERR"
     gene            <679805..>683485
                     /locus_tag="AGOS_ABR149W"
                     /old_locus_tag="ABR149W"
                     /db_xref="GeneID:4619207"
     mRNA            <679805..>683485
                     /locus_tag="AGOS_ABR149W"
                     /old_locus_tag="ABR149W"
                     /product="ABR149Wp"
                     /transcript_id="NM_208450.2"
                     /db_xref="GeneID:4619207"
     CDS             679805..683485
                     /locus_tag="AGOS_ABR149W"
                     /old_locus_tag="ABR149W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL047C (EDE1)"
                     /codon_start=1
                     /product="ABR149Wp"
                     /protein_id="NP_983097.2"
                     /db_xref="GeneID:4619207"
                     /translation="MSKIVFRVPLLADEQASFGAQFRELDSDELGIVTGETLKELFGK
                     SGLSSQQLSRVWALVDTEKQGFLNLTQFSAAMRAIGHLQATPHAAITPELYQTPATRL
                     ATFTGVVTGGIPAISAHDAGKYGQLFERSAEGRVISGARAKDVFLKAKLPHVVLGSIW
                     TLCDRNNSGSLDRAEFIMAMHLIQLSLSKHPSVATFPQALPAYLWNSIAAAVPLSSES
                     TGVSASSVSRPVSLARIPSSSFSNASSDWVMTPEKKQQFDSLFDSLDKNRAGALGADI
                     LVPFFLTSKLSQDTLATVWDLADIHNSPVFTKTEFAIAMFLIQKKNAGVELPDVVPEQ
                     LLASPTLGLYQTAGQPRSPQSTSHGGPPAAPPQTYLQPVPSRDTKPHFEQLQQQQTTS
                     SSLTELLGLNPSFNAPASHTVQSTSVSSVNASPRQPTSNRSQPVNVANRGINSAENTS
                     RSIPALSPQGTPQNQAMRHSSYISTLPTVPDFASLQVSEQLAPVKDIYMDSETSGQLS
                     QATTDVANLSNQVSSLTTQVTKTTERKEHAQQELSRINELKASLEAKLTTLHSSYQQE
                     TQQMEEVEQLLTKARAETEVLTQQLQNTESTCHSTQSELTNLQLELQECEKTNTQLKE
                     KISNYNNLILSLQQDLAGKQQQVKQQRALVDVNTQQADLNATTVAGLEEEIKGLDDRL
                     AKLIEKRKELDDYQTNIERQHKDLEEKHLQFVSRSQELENKYLEFSQREKDLQERTKQ
                     IVEQEHVYNEQVSRLQQLFKDLNIQRAAFEKAEQDLQECRVEYTQQVQKLSDKQLKLA
                     MRELPEDRSNNASHSENEDAVAKYVEETVTNSKLNVGGHATTLDTARVATVLPQDEEG
                     KQDSVFDKDFPTSPSQTELEEEEHPATAETAAQALDESDMNIYRIPRTESVTSSTANN
                     APQSLRDEAVSDTQGPVADEENESATITKRATANSDDEENSTQAASRSLPGEWGDLNY
                     PDHATEKSNNKLKENLSVENSPTPASFDKMTLSVDSTDDSGMEAEKYHSTSDIPATVL
                     PQRVMSPLVPARNVVVKAVDSISGHTFSFDDEFADLEQASPEDEATGSKRVSSIEGFE
                     TIDHADLEDELHETGFTGAGTAEMLTPSNYSTQTGHPTSAQVASSPVGNDEWDEIFSG
                     FGNNSPGLKQPTAQTTMGGSSQANTPQLKSPLNRKIATTPKSLAVEELGSMGFTEQEA
                     RKALEKCKWNLEAATNMLLDGS"
     gene            complement(<683574..>684173)
                     /locus_tag="AGOS_ABR150C"
                     /old_locus_tag="ABR150C"
                     /db_xref="GeneID:4619208"
     mRNA            complement(<683574..>684173)
                     /locus_tag="AGOS_ABR150C"
                     /old_locus_tag="ABR150C"
                     /product="ABR150Cp"
                     /transcript_id="NM_208451.1"
                     /db_xref="GeneID:4619208"
     CDS             complement(683574..684173)
                     /locus_tag="AGOS_ABR150C"
                     /old_locus_tag="ABR150C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR112W (NNF1)"
                     /codon_start=1
                     /product="ABR150Cp"
                     /protein_id="NP_983098.1"
                     /db_xref="GeneID:4619208"
                     /translation="MSHDHRIRFKRLNQVCEKALAQSISKLQNWDKLSSCYPGYISTR
                     EGYANLKTCQVQVCDFWSQLCRQEFQAIFEERDVKAKLDELDDLILKAKERARSHRDG
                     TGSHTRVEDLTPAQLIRGSIRRAQSETLEQLDTRLRSLDGKNAKLRAELEELNKAVGS
                     ELEELDRLYEKWLGKGLGNGAGELQQGVENMVVETREGP"
     gene            <684314..>685192
                     /locus_tag="AGOS_ABR151W"
                     /old_locus_tag="ABR151W"
                     /db_xref="GeneID:4619209"
     mRNA            <684314..>685192
                     /locus_tag="AGOS_ABR151W"
                     /old_locus_tag="ABR151W"
                     /product="ABR151Wp"
                     /transcript_id="NM_208452.1"
                     /db_xref="GeneID:4619209"
     CDS             684314..685192
                     /locus_tag="AGOS_ABR151W"
                     /old_locus_tag="ABR151W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR111C"
                     /codon_start=1
                     /product="ABR151Wp"
                     /protein_id="NP_983099.1"
                     /db_xref="GeneID:4619209"
                     /translation="MARYPIAQTSNILNAARLVHLAQLPAAMRSGPQMDNIWYLVAAA
                     AFNTCNEPREIPLLYHFALLRHTSGAVDDPSDEEVARKVVKLFDRDEGSRRATFNQWY
                     RTPTAGQRQITQRFRETLLKSVALSGLPRAINSLHVLAQETPESLLPEHGAVKLDERN
                     NGQLFAHAARNNGMDHEALVARGLEHWCHIYGKVSERVANNLNASYPDLWYHAIVNVY
                     APLLSHSGPLDARETSLVIIANLVPQDVNAQLWGHLRGAQNIGCEAEAIECSRQLSIE
                     VSRMCGVRWKGAVAKL"
     gene            complement(<685277..>687214)
                     /locus_tag="AGOS_ABR152C"
                     /old_locus_tag="ABR152C"
                     /db_xref="GeneID:4619210"
     mRNA            complement(join(<685277..687142,687191..>687214))
                     /locus_tag="AGOS_ABR152C"
                     /old_locus_tag="ABR152C"
                     /product="ABR152Cp"
                     /transcript_id="NM_208453.2"
                     /db_xref="GeneID:4619210"
     CDS             complement(join(685277..687142,687191..687214))
                     /locus_tag="AGOS_ABR152C"
                     /old_locus_tag="ABR152C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR110W (YMR1); 1-intron"
                     /codon_start=1
                     /product="ABR152Cp"
                     /protein_id="NP_983100.2"
                     /db_xref="GeneID:4619210"
                     /translation="MDYIKVAKVNNVILHRRGQSVEGTLHLTTHHLIFTGRGLAREFW
                     VSYPTIGAVFKNRGSALISKQRSGEGVAESLYWDKDIWSVAQIKVVGKDYTVFSLDFA
                     VEASAQDVFESLLHLTVLHQVSQLYAFIYLPNRVEAPFDSWKLYKPLEEYARQGLTLD
                     RGSPWRSTAINDNYQFCATYPAVLVVPASISDTLLTHASKYRSQNRIPVLTYYYKKTG
                     ASITRSAQPLPGLTQQRSIQDEKLVYEAFQCAPEKTKKDLIVDARPATNAMAQTALGG
                     GTENMDNYGFGSTCSRMFLGIDNIHVMRDTLNFLVENFLVDNDLNLPIDAHSLNSGKA
                     SNWLKYIKVLLSATDTLVKSIIFNKSNILVHCSDGWDRTAQVCSLVQLCLDPYYRTFE
                     GFMVLVEKDWLSFGHRFAERCGHLSSEYIFRDNSINRINLTSNSVQLADNETIDQSLS
                     TNDLVVRKSSFIRKKTNLKLTSPIFQQFLDCVYQLLLQNPEQFEFNERFLRRLVYHLY
                     SCQYGTFIFDNEQERVLREASKVTRSVWDYFRSRPREFTNPAYKPVGPDEEEDWLLPD
                     LNKLQWWWQLFGRRQHEFSDAGSSPNTQGTSNAMSAAASENGKNIYKLTSKLTTFSLE
                     IFGKK"
     gene            complement(<687563..>687937)
                     /locus_tag="AGOS_ABR153C"
                     /old_locus_tag="ABR153C"
                     /db_xref="GeneID:4619211"
     mRNA            complement(<687563..>687937)
                     /locus_tag="AGOS_ABR153C"
                     /old_locus_tag="ABR153C"
                     /product="ABR153Cp"
                     /transcript_id="NM_208454.1"
                     /db_xref="GeneID:4619211"
     CDS             complement(687563..687937)
                     /locus_tag="AGOS_ABR153C"
                     /old_locus_tag="ABR153C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL049W (MOH1)"
                     /codon_start=1
                     /product="ABR153Cp"
                     /protein_id="NP_983101.1"
                     /db_xref="GeneID:4619211"
                     /translation="MAIGYSMYIERPVPDTTSAKNKYAKMAIYGCAHCKTHLSSSNYF
                     MSDDYRGRTGAAYLMQKVINVMEGRRETRCMSTGRYVVCDIYCHTCKNLVGWKYLLSE
                     KRDQEYKEGKYILELEPITECD"
     gene            complement(<688484..>690643)
                     /locus_tag="AGOS_ABR154C"
                     /old_locus_tag="ABR154C"
                     /db_xref="GeneID:4619212"
     mRNA            complement(<688484..>690643)
                     /locus_tag="AGOS_ABR154C"
                     /old_locus_tag="ABR154C"
                     /product="ABR154Cp"
                     /transcript_id="NM_208455.1"
                     /db_xref="GeneID:4619212"
     CDS             complement(688484..690643)
                     /locus_tag="AGOS_ABR154C"
                     /old_locus_tag="ABR154C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YOR381W (FRE3) and YKL220C (FRE2)"
                     /codon_start=1
                     /product="ABR154Cp"
                     /protein_id="NP_983102.1"
                     /db_xref="GeneID:4619212"
                     /translation="MKLSIVLTLATLPSALASSASSGYKRTPVGQYVSAGCKHATEAK
                     AAFCKKSHPKRFECQCTNENALASLVYCAYKETEHDPKERHSFEESFIETCKGKVTQE
                     GIEAAYNRALKKIVSVKDIPNFNKTIPVKVPVKHDHAAYVSGYRTKRSRSRNKDDALE
                     MSFVLLCFWGLVTVLSGLAHVSRRMAPRLWMSASRSLNSVTAFRKLRQYVTMPATHRG
                     KHTEKYGFLGFMPTRLESVIIFIFVTLSVVFHAVRYEYVYPNTVYKTRHAQMGRLVGD
                     RSGMLANCLFVLTWLFASRNSIILAFTGWKQSTMLTYHKAIARTAIASTLVHTISMLV
                     HTLDLGRSKYTTRSQTGWWRWGSVATVAACVILIQAQSWFRMYSYEIFLYLHILLAVF
                     VLAGAWMHTAWFSDEQWYFACAALWCFDRFIRLVRMGYFGFRTAHARVLSAENGIFEL
                     VVPKHKAWIAFPGSVAYVYFLGTPLFWQSHPFTIAPAEDGKLRFVIKAKRGATAHILR
                     RLLASPDQSASFRVCVEGPYGNYAPIKHYDHLLLYAGGSGIPGPLCYAKHLGELGLSS
                     RVPFVKLYWVVRHAADLDWYKDDLTALARYSNIQPIVYITRPDSASPLKAEADSLSDD
                     DSEGRACSPQKEGSLTEVTTSLLYSKQFAHVEFRYNRPDTSQLIAGDMADLAGASVAV
                     MSCASPNMVDDIRAAVALAAGSYKSSTIDYYEELQVW"
     gene            complement(<691310..>692185)
                     /locus_tag="AGOS_ABR155C"
                     /old_locus_tag="ABR155C"
                     /db_xref="GeneID:4619213"
     mRNA            complement(<691310..>692185)
                     /locus_tag="AGOS_ABR155C"
                     /old_locus_tag="ABR155C"
                     /product="ABR155Cp"
                     /transcript_id="NM_208456.1"
                     /db_xref="GeneID:4619213"
     CDS             complement(691310..692185)
                     /locus_tag="AGOS_ABR155C"
                     /old_locus_tag="ABR155C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL050W (SEC17)"
                     /codon_start=1
                     /product="ABR155Cp"
                     /protein_id="NP_983103.1"
                     /db_xref="GeneID:4619213"
                     /translation="MSEAKDLIARAEKKAQPASGLMKWLTGGDSYRLEEASDLYVEAA
                     NLYRLSKELSAAGDTFWKAAECQVEAGNEDEAGNTFVEAYKCYKGANPERACEALERA
                     IAIFTRKGQFRRGAYFKFELAEVQETDLQDYGRARENYELAGDWYMQDQALALSNKAY
                     IKCADLNALDEKYLAAAELYRKIISNSVGNRLSQWSLRDYYLKLCLCFLAASDTVAAE
                     KTLQEALQEDSSFHGSREHDLLAAIIEDVKQGDVEAFSNHVFEFDKFSKLDKWKTTVL
                     LRVKTSITEVEDDLL"
     gene            <693159..>695549
                     /locus_tag="AGOS_ABR156W"
                     /old_locus_tag="ABR156W"
                     /db_xref="GeneID:4619214"
     mRNA            <693159..>695549
                     /locus_tag="AGOS_ABR156W"
                     /old_locus_tag="ABR156W"
                     /product="ABR156Wp"
                     /transcript_id="NM_208457.2"
                     /db_xref="GeneID:4619214"
     CDS             693159..695549
                     /locus_tag="AGOS_ABR156W"
                     /old_locus_tag="ABR156W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YJL212C (OPT1)"
                     /codon_start=1
                     /product="ABR156Wp"
                     /protein_id="NP_983104.2"
                     /db_xref="GeneID:4619214"
                     /translation="MADLSGTAVKREPEKGPASALDTTGDLPHIYDTVSVETPGPFET
                     SEKKVDKEGADTEGDSGEFTDVLVEDDSPYPEVRAAVPSFDDTTMLQNTVRMWTIGLL
                     MTTIGSAVNMLFSMHAPSMAVSTFVTSMLAWPLGRFWARWVPNVRIFGRFGGPFLNPG
                     PFSLKEHALITVMGNISFGGGAAYATDILLSMNMFYKRDYGWLFDLLAIWSTQCIGFS
                     LAGLCYKILITPPLMIWPSTLVQCTFLSNIHIHNNKVANGWKVSRLKFFMIIFIAGFI
                     YYWLPGYLFQALSSFAWVTWIAPKNVVVNQIFGSSTGLGLLPITFDWNQIAGYVGSPL
                     VPPISAIFTILCSMVTIFWIVVPIVHYSNTWYGNYVPISDSTSMDRFQQRYNVTKVVN
                     QRLSLDLEAYHSYSRLYLPTTFAISYGMSFASVMATISHTACFHWRTIYNGVRNINTQ
                     DRDVHARLMERYKAPPYWWYLVTFFVFLALSIATVRAWDTQLPVWALFLALAIAGFFL
                     LPVGIIYALTNMAVGLNVITEFIIGYMLPGRPIAMMFFKTFGYITNSQAITFAQDMKL
                     GHYLKVAPKLMFTAQFIATIWGSTVQIAVLRWSEANIKGLCTKAQPGHFTCPGATVFF
                     TASIIWGVIGPQRMFSAGQMYSSLNYFFVLGFFLPIVNWLILSKWPKRFEKSGRGLKF
                     VAKYLSWPVFFSGTGLIPPATPYNYGSYCIVGIFFGYFIKRYYFQWWCKYNYSLSAAL
                     DIGLAWGALIIFFSTGIAVRKAPVWWGNTVIDTLDTNGQAIKYILQEGEYFDRASP"
     gene            <695969..>699310
                     /locus_tag="AGOS_ABR157W"
                     /old_locus_tag="ABR157W"
                     /db_xref="GeneID:4619215"
     mRNA            <695969..>699310
                     /locus_tag="AGOS_ABR157W"
                     /old_locus_tag="ABR157W"
                     /product="ABR157Wp"
                     /transcript_id="NM_208458.2"
                     /db_xref="GeneID:4619215"
     CDS             695969..699310
                     /locus_tag="AGOS_ABR157W"
                     /old_locus_tag="ABR157W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR109C (CPA2)"
                     /codon_start=1
                     /product="ABR157Wp"
                     /protein_id="NP_983105.2"
                     /db_xref="GeneID:4619215"
                     /translation="MSTAGISDEASASAFTTAGYCPQLIKGIDSVLIIGSGGLSIGQA
                     GEFDYSGSQAIKALKETGKRTILINPNIATNQTSYSLADEVYFLPVTPEFITHVIKRE
                     RPDGILLTFGGQTGLNCGVALQRAGTLEKYGVTVLGTPISVLETTEDRELFARALKEI
                     NMPIAESVACSTVEDAVAAANDIGYPVIVRSAYALGGLGSGFADDDLQLRQLCAQSLA
                     LSPQVLVEKSLKGWKEIEYEVVRDRVGNCITVCNMENFDPLGIHTGDSIVLAPSQTLS
                     DEEFHMLRTAAIEIIRHLGVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASKATG
                     YPLAYTAAKIALGYTLPELPNPVTKSTVANFEPSLDYIVAKVPRWDLSKFQHVDKTIG
                     SAMKSVGEVMAIGRNFEEAFQKAFRQVDPSLLGFQGSDEFADLDEALQFPTDRRWLAV
                     GEALMNRGYSVERVHELTKIDRFFLHKCMNIVRMQKQLETLGSINRLDEVLLRKAKKL
                     GFCDKQIARAISDDLSELDIRALRKSFGILPFVKRIDTMAAEVPAVTNYLYVTYNAVK
                     DDVTFGDNGIMVLGSGVYRIGSSVEFDWCAVNTVQALRKEGHKTIMINYNPETVSTDF
                     DEVDRLYFEELSFERVMDIYEAECASGCVISMGGQQPQNIASQLYEQGANILGTSPED
                     IDKAEDRHKFSTILDTLGLDQPRWSELKSLSEVKHFLDDVGYPVLVRPSYVLSGAAMS
                     TVYNSEDLEGVFESAVAVSPEHPVVISKFIEGAQELDIDAVAYKGSLLVHAISEHVEN
                     AGVHSGDATLVLPPQSLKEEEKTRLKQLAAQVAAAWNITGPFNMQIIKTAEGGHTCLK
                     IIECNIRASRSFPFVSKVLGVNFVEIAVKAFLGGDLVPPSCDLMARSYNYVATKCPQF
                     SFTRLPGADPFLGVEMASVGEVAAFGSNALESYWVALQGLMSFCVPLPPSGILLGGDL
                     SKEHLGRVAALLAPHGFTLLALSEATCEYLSRYLPAESSVTVLQMPETGREVRALFEQ
                     HNVQCVVNLAARRASSPIDPDYRIRRSAIDFAVPLFNEPQTTMLFARALSAYLPAELE
                     MRQSDGPETPSYVLPWREYLGFKPT"
     gene            <699464..>699676
                     /locus_tag="AGOS_ABR158WA"
                     /old_locus_tag="ABR158W-A"
                     /db_xref="GeneID:9487544"
     mRNA            <699464..>699676
                     /locus_tag="AGOS_ABR158WA"
                     /old_locus_tag="ABR158W-A"
                     /product="ABR158WAp"
                     /transcript_id="NM_001355301.1"
                     /db_xref="GeneID:9487544"
     CDS             699464..699676
                     /locus_tag="AGOS_ABR158WA"
                     /old_locus_tag="ABR158W-A"
                     /note="NOHBY222; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0F14630g"
                     /codon_start=1
                     /product="ABR158WAp"
                     /protein_id="NP_001342243.1"
                     /db_xref="GeneID:9487544"
                     /translation="MDEDGPYSWYLQHTPAPDARKLEDLRIWQNEQIYERSRKVYSPP
                     LEPLGVGCQEKRAATAQRGPAKRRRT"
     gene            <699980..>701227
                     /locus_tag="AGOS_ABR158W"
                     /old_locus_tag="ABR158W"
                     /db_xref="GeneID:4619216"
     mRNA            <699980..>701227
                     /locus_tag="AGOS_ABR158W"
                     /old_locus_tag="ABR158W"
                     /product="ABR158Wp"
                     /transcript_id="NM_208459.1"
                     /db_xref="GeneID:4619216"
     CDS             699980..701227
                     /locus_tag="AGOS_ABR158W"
                     /old_locus_tag="ABR158W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER020W (GPA2)"
                     /codon_start=1
                     /product="ABR158Wp"
                     /protein_id="NP_983106.1"
                     /db_xref="GeneID:4619216"
                     /translation="MGLCASKDKGSATHAEKRRQDRHGASQKVETGAKRVDYGAEVKP
                     ETSPSHSTSGATAGGRKRSVVSGTSQQTTAVAGPGSMGQPSASNRALKVLLLGSGESG
                     KSTVLQQLKILHQNGFTQEELLDFKPFIIDNIVETGKDLLNARAKFNVLLEPDCGLTE
                     NDLQQVLEYSRPAGSTPLLPRGLAGILSRIWQLPSTKELLTGPERSSFYLMDNAGYFF
                     KSLDRISQPDYVPTVADVLRTRKKTSGIFDTTIEMDADLKLHIYDVGGQRSERKKWIR
                     CFDNVTLIIFCVSLSEYDQTLIEDKTQNRLQESLILFDSVVNSRWFTRTSVVLFLNKI
                     DAFAEKLQTVPLEKYFPDYTGGQDINRAAKYILWRFVQLNRANLNIYPHVTQATDTSN
                     IRLVFAAIKETILENTLRDSGVL"
     gene            complement(<701563..>702711)
                     /locus_tag="AGOS_ABR159C"
                     /old_locus_tag="ABR159C"
                     /db_xref="GeneID:4619217"
     mRNA            complement(<701563..>702711)
                     /locus_tag="AGOS_ABR159C"
                     /old_locus_tag="ABR159C"
                     /product="ABR159Cp"
                     /transcript_id="NM_208460.1"
                     /db_xref="GeneID:4619217"
     CDS             complement(701563..702711)
                     /locus_tag="AGOS_ABR159C"
                     /old_locus_tag="ABR159C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR107W"
                     /codon_start=1
                     /product="ABR159Cp"
                     /protein_id="NP_983107.1"
                     /db_xref="GeneID:4619217"
                     /translation="MHLMMILTLLCLFGRFGRGLAPRLGGLVGIGGVADVGGEELNSS
                     ALQTSETLAAEASHVTITRAGYDKLVYFSKICALTYCIKDRTLVENKTFYDGGCPADL
                     EFCSNLTVNPTAKRTRVELVLEAERNELGTGYVAVDHGRQVVILAFRGSSTQQDWFSD
                     MQIHPIAYVPASLTRYNKLVADGVIPPCVDCKVHRGFYRFAKTLNRNFLERIERIYNL
                     YPNYKLVVTGHSLGAALASLCGIELALRGFEPLVLTYATPRMFNHSLRDWVNALFKTE
                     QIHFESVQKKELQLNKGYFRVVHTRDYIPMVPPLYVAAGLEIYIEKLHFPHELKDLHY
                     RGMNLEPLWHIEGDLLSPRSRFNERIEKWLHMYEHRSYFIMINTCSGF"
     gene            complement(<703001..>704953)
                     /locus_tag="AGOS_ABR160C"
                     /old_locus_tag="ABR160C"
                     /db_xref="GeneID:4619218"
     mRNA            complement(<703001..>704953)
                     /locus_tag="AGOS_ABR160C"
                     /old_locus_tag="ABR160C"
                     /product="ABR160Cp"
                     /transcript_id="NM_208461.1"
                     /db_xref="GeneID:4619218"
     CDS             complement(703001..704953)
                     /locus_tag="AGOS_ABR160C"
                     /old_locus_tag="ABR160C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR106W (ECM27)"
                     /codon_start=1
                     /product="ABR160Cp"
                     /protein_id="NP_983108.1"
                     /db_xref="GeneID:4619218"
                     /translation="MDHAPSTWARITHPVYLYETNKLSLGFVVLTVLHLSVCFVLLGV
                     SASDYLCPIVVTLTSQRNRPHKGILAAILLAWCNSSPDLFSSLMSWNAANNAAALSVG
                     EVLGACGVIICVVQGAIFMVMRSAWVNLSAAERHSIIVDLLFAMLAVCIIGYVCLMNA
                     VSVLDCVVMLLIYAAYIVSKISAGQRHAPPTIEVSSPANQSDQMPPELVGPYSDMNDS
                     DSQFFISDIDTGIKPSLLTSIDYNSLLKVLETAMPRETADTISLETMATPHTEHRPVT
                     EPNERVDPARQPGITRTAPPMFQPYSDNPELQLLTPQPLRSEDLFKRRIMQLKSNALY
                     IFAPQLANFREKSHVSQVLSVALTPFMLLLRITIPQYSKFAQVAPGGASISLPRTTIA
                     MAVINAVAAPLWAVMLYMSFAESRAPVTVWLLAGLVATAMLTMTVLLYARVHRAGKFS
                     LTPDPHTSVADAERAAHTATYLFNGIGVCCSMLWISYLANTLIEIMTLYQRITDVSEA
                     ILGLTIFSWGNSVSDLMSNVAMARLYHKLPGDEGTHQDTKFLAISLGACLGGVLLNTM
                     IGVGISGLVTMLPLKRWSITLRDQGVDSKFLVSCVAIVLQLIFLLWLFLTNARFLQSH
                     MKTVGLAMCAWWLAATLLNLVLEASI"
     gene            complement(<705271..>706491)
                     /locus_tag="AGOS_ABR161C"
                     /old_locus_tag="ABR161C"
                     /db_xref="GeneID:4619219"
     mRNA            complement(<705271..>706491)
                     /locus_tag="AGOS_ABR161C"
                     /old_locus_tag="ABR161C"
                     /product="ABR161Cp"
                     /transcript_id="NM_208462.1"
                     /db_xref="GeneID:4619219"
     CDS             complement(705271..706491)
                     /locus_tag="AGOS_ABR161C"
                     /old_locus_tag="ABR161C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR105W (ADO1)"
                     /codon_start=1
                     /product="ABR161Cp"
                     /protein_id="NP_983109.1"
                     /db_xref="GeneID:4619219"
                     /translation="MSSRGFGLLRGVFRARTARHLVYHVTGPRLHMGMPGDTAKFASA
                     SRLSAVTRTSTSGYRSVERTAKAGMSESFKLVCLGNPLLDISATVDPEYLERYSLKSN
                     DAILVDAAGDDGRMKIFDEMLEFPGMRYVAGGAAQNTARGAAYVLGRDQVAYFGCVGR
                     DQFSEKLMSANKAAGVSTFYQEEPEISTGKCAVMITGHDRSMVTDLGAANHFKPEHLD
                     KHWNVVESAKMFYVGGFHLTVSPEAIVKLGKHAQENGKPFVLNFSAPFIPQFFRSALE
                     QVLPYTTHIIANESEAASYAESFGLDCDREDLVSIAKHVIGDSSRTVVFTHGLEPTIV
                     VSPAGEAAYPVHPVDKEKIVDTNGAGDAFAGGFVAALVQGRDLPTAVDMGQWLAALSI
                     QEFGPCYPTEKLQY"
     gene            <706673..>707488
                     /locus_tag="AGOS_ABR162W"
                     /old_locus_tag="ABR162W"
                     /db_xref="GeneID:4619220"
     mRNA            <706673..>707488
                     /locus_tag="AGOS_ABR162W"
                     /old_locus_tag="ABR162W"
                     /product="ABR162Wp"
                     /transcript_id="NM_208463.1"
                     /db_xref="GeneID:4619220"
     CDS             706673..707488
                     /locus_tag="AGOS_ABR162W"
                     /old_locus_tag="ABR162W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR116W (TDA4)"
                     /codon_start=1
                     /product="ABR162Wp"
                     /protein_id="NP_983110.1"
                     /db_xref="GeneID:4619220"
                     /translation="MRDPFLKYSLFSDHDSLLLRHSHEVLVSFLMYQFVLYPVVAPAV
                     NRMIFGQHYTRAAPRTRANFDIHTVSTVQAVLCVGMIWPLLRLPAALPVFGFYDEYAS
                     LVAATMVGYFVWDVYLCTRYLAVFGPGFLGHALGSLAVLLSALTPAFQPWLGKFLIFE
                     ASTPLVNVNWFITQLARGSTSAVVPRWLPVVNGLLLLVTFFCVRIVWGVMALIAMDYY
                     VWRQWGPETPKLVGLLVPAINFFMTLLNFYWFYKMVRIAKKMVRASKHVAKVT"
     gene            <707714..>709075
                     /locus_tag="AGOS_ABR163W"
                     /old_locus_tag="ABR163W"
                     /db_xref="GeneID:4619221"
     mRNA            <707714..>709075
                     /locus_tag="AGOS_ABR163W"
                     /old_locus_tag="ABR163W"
                     /product="ABR163Wp"
                     /transcript_id="NM_208464.1"
                     /db_xref="GeneID:4619221"
     CDS             707714..709075
                     /locus_tag="AGOS_ABR163W"
                     /old_locus_tag="ABR163W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR117W (STE24)"
                     /codon_start=1
                     /product="ABR163Wp"
                     /protein_id="NP_983111.1"
                     /db_xref="GeneID:4619221"
                     /translation="MKLVEGVQVLLDRGDIPWKKVIAGLNIAQFGFETYLATREYKKL
                     NELSLPSELEGVIDKETMQKTQAYERAKLRYRMVRDLVFLGLNLVMIKYDWLPRMWNL
                     GVAVGQRMPAMLVPVSTISQSLYFLIVYLQLNWWQGLFGSYYYNFVLEEKFGFNKSTV
                     KLWLTDQLKVFMISSMITTPAAYALLKVIEKFSTGFVSYVSILMLFFYLVLTALQPVF
                     TALFNKLTPLEDGELKTSIVEISKRVNFPLDKIYLSDGSRRSAHSNAYFTGLPFFSKR
                     IVLFDTLVNDSTVEEVVAVMGHEIGHWKLNHISYRLLLLWATSGFTVSLFSAIYMNTS
                     LYEAYGFFIGNNASSDPARVVVSTVPVMIGFMLFNDLFQPAGAALQFITNWYTQYQEL
                     QADQFAKELGYQDALGSSLIMLARGNLHTPEGDPLYTAYHDSHPSTIRRLRALQYKPA
                     KKQ"
     gene            <710257..>711762
                     /locus_tag="AGOS_ABR164W"
                     /old_locus_tag="ABR164W"
                     /db_xref="GeneID:4619222"
     mRNA            <710257..>711762
                     /locus_tag="AGOS_ABR164W"
                     /old_locus_tag="ABR164W"
                     /product="ABR164Wp"
                     /transcript_id="NM_208465.1"
                     /db_xref="GeneID:4619222"
     CDS             710257..711762
                     /locus_tag="AGOS_ABR164W"
                     /old_locus_tag="ABR164W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER021W (RPN3)"
                     /codon_start=1
                     /product="ABR164Wp"
                     /protein_id="NP_983112.1"
                     /db_xref="GeneID:4619222"
                     /translation="MTSDLMEVDSAHTPDVYSASKDNVDKFVDLLRQVSKTTITLDSR
                     YVWKSLRELMSLRKELQQQTLTILITLLYPDDSAFKVPLLRVVNQNLKSSVEDAEAFR
                     AKYPADFYQLTADGKIDLSAELNSFMHLLVQLYLLDSGQVEALESFNLKTVIPGVLHY
                     YNNRSLDLINAKLWFYIARAHEILGNKFDHTIRMDMMKFLRTATLKYDNETKAMLITL
                     ILRNFLQSGDVEIASDFISKVEFPCDQGVSSPLEARYYFYLSKINAIQLDYSSANEYV
                     IAAIKKAPNSPSSLGFLQQANKLHCVIQLLMGDIPELSFFHQKGMEATLTPYFHLSKA
                     VKLGDLKKFTATISKYKVQLLEDGNYQLCVRLRSNVIKTGIRIISLTYKKISLKDICL
                     RLHLDSEQTVEYMVSRAIRDGVIEAKINHEGGYIETSELLNVYATMQPQQAFDDRINF
                     VNQLHDECVMAMRYPGSREKKKNVKTDDHEGEIDPDIMDLSDYGSDIEDLI"
     gene            <711983..>713902
                     /locus_tag="AGOS_ABR165W"
                     /old_locus_tag="ABR165W"
                     /db_xref="GeneID:4619223"
     mRNA            <711983..>713902
                     /locus_tag="AGOS_ABR165W"
                     /old_locus_tag="ABR165W"
                     /product="ABR165Wp"
                     /transcript_id="NM_208466.1"
                     /db_xref="GeneID:4619223"
     CDS             711983..713902
                     /locus_tag="AGOS_ABR165W"
                     /old_locus_tag="ABR165W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER022W (SRB4)"
                     /codon_start=1
                     /product="ABR165Wp"
                     /protein_id="NP_983113.1"
                     /db_xref="GeneID:4619223"
                     /translation="MEPDDGHNSLNQDNGIPIVLDPNLINLRSRAASATVTTNGTTAD
                     SSEDSGSQQSVSSAPIQQNSEEHSLVSNPYETYGRMPLQKLIPLILQMRNASSFSELT
                     EEDLLRDIEREEKGILTTGLDVEGDIEMGDADEESDLKPQEITDDDSNARLKPNNDSA
                     IPQEEFNQMKREVLEHINLALNESSLSLEFISLLLSSVRPSVGVGSMSPFLKRSVPTA
                     SLNADKVELPPKNKTETLTLAVINRGWKLRSLEDSKALLKENYAKLQKSLEVEHAHWA
                     MISQHISSTDVVFKMRDRQTGKRSLAVKYGYEDSGSLYKQDRGVAVLRHNMDLNKLEL
                     VPISNSKEEVHITANSVERFMRVHIYTKIEEEDDYILSGESSIDDQSLLQPCHDDISR
                     QIARLKFFIFERELMYQLKKEAVSLMPYGVNFENENKVVLESPGERIEFEMVPLDDSA
                     LLSTHEPRRVNDKRANIILILLRMLLVVIHKKQLRRGLKPATSKHKYRADGDLLLLRP
                     VLGRIRHRNYLQVVKRVVTECVLNIVPGSSIELLPQRSEPDTLHAREANIASLNKQIG
                     LFDKILRMPRSELRTSLGAKGVIDLTLKSSNYCNAIIQVIYADSAGKTVFDTVFTELK
                     ELEEFLHFIVSEYVL"
     gene            complement(<713950..>714483)
                     /locus_tag="AGOS_ABR166C"
                     /old_locus_tag="ABR166C"
                     /db_xref="GeneID:4619224"
     mRNA            complement(<713950..>714483)
                     /locus_tag="AGOS_ABR166C"
                     /old_locus_tag="ABR166C"
                     /product="ABR166Cp"
                     /transcript_id="NM_208467.2"
                     /db_xref="GeneID:4619224"
     CDS             complement(713950..714483)
                     /locus_tag="AGOS_ABR166C"
                     /old_locus_tag="ABR166C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR118C (ILM1)"
                     /codon_start=1
                     /product="ABR166Cp"
                     /protein_id="NP_983114.2"
                     /db_xref="GeneID:4619224"
                     /translation="MAVFSHVTVIYARIGFLLTLAFFSVKDVELILNHNFIIILARAM
                     YLPELHIPRHSAQLGMVSVLFFLLAVSDLLPLLENNLAYFDSVVPFRLLAFFVLAGVS
                     YLRESNLYFHNNAVFVYCFCEIIMHFMIYTAIKDDQSVVNTHRLADTTNAEDEASEDE
                     LEELVSSTAHSGDATSE"
     gene            complement(<714647..>716977)
                     /locus_tag="AGOS_ABR167C"
                     /old_locus_tag="ABR167C"
                     /db_xref="GeneID:4619225"
     mRNA            complement(<714647..>716977)
                     /locus_tag="AGOS_ABR167C"
                     /old_locus_tag="ABR167C"
                     /product="ABR167Cp"
                     /transcript_id="NM_208468.1"
                     /db_xref="GeneID:4619225"
     CDS             complement(714647..716977)
                     /locus_tag="AGOS_ABR167C"
                     /old_locus_tag="ABR167C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR119C (JHD2)"
                     /codon_start=1
                     /product="ABR167Cp"
                     /protein_id="NP_983115.1"
                     /db_xref="GeneID:4619225"
                     /translation="MGKRMLQNVPVLHPTEDEFRDPIGYLSKAAVQRLGHVYGMVKLV
                     PPRGFQPPMTVNDDIFRFHVRLQTLSELGLLNRSRLFFMRQLNNFMMKEGQLQRPLQR
                     LPYAEADGQRVYLYDLFIEVLKFYSGEPAGPGAGIRKRRRGHSETVGVPQLTMRPLDM
                     VLSDTGLWRALGRLFRVQTSSVLSIFTTKISKYYRFLQRQSCSDASSSFIKKLIYQDE
                     LPKSLIHDDSSDESESDSDVEDDCVICQKRTTPTRRVVCKTCRNFFHRACVQAPQQDQ
                     NEGIWICNNCIVGNGYYGFKEEEHLYNRVEFKSQCAEYDAKHFPEGKPLDNIGLLEDM
                     FWDLVHDVENRATVKYGADIHNEGPGVVTAFPTLEWVPPHITKGTPEYDAFLQYVEHP
                     MNLLNLPMARGSLLPVFGRSISGMTVPWLYIGSTFSTFCWHLEDQYTLSANYQHEGDP
                     KVWYSIPEQSATAFNKLMKNIAPDLFEKQPDLMHQLVTLISPYDEKFEAANIACYKAV
                     QYPGEYIITYPKCYHAGFNTGYNFNEAVNFTLDLWVPYGLSASEDYRLTGKRCVFDMW
                     ELMLNVLLQYLERPQTHQEALIRRCHLELQNIFHSEMKYIQLLKGITHREDVLVGSRK
                     LACTSASGQEHILKHEPTKSQPPSVRPDSSVYDDDPEQNECEIFCTKCNTICPFAFVV
                     HYHRGYSRKRRRHHEMSPSKWNRLASKGSVSILCLVDYVSLLESIDSEDGSLGSSTSE
                     ESTCHKFEDDELFYIRRPNDINRILQITEKKLDSCL"
     gene            <717291..>718142
                     /locus_tag="AGOS_ABR168W"
                     /old_locus_tag="ABR168W"
                     /db_xref="GeneID:4619226"
     mRNA            <717291..>718142
                     /locus_tag="AGOS_ABR168W"
                     /old_locus_tag="ABR168W"
                     /product="ABR168Wp"
                     /transcript_id="NM_208469.1"
                     /db_xref="GeneID:4619226"
     CDS             717291..718142
                     /locus_tag="AGOS_ABR168W"
                     /old_locus_tag="ABR168W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER023W (PRO3)"
                     /codon_start=1
                     /product="ABR168Wp"
                     /protein_id="NP_983116.1"
                     /db_xref="GeneID:4619226"
                     /translation="MGYTLTILGCGVMGQAVLSAIYNAPKADDESRAMYPSRIITCNN
                     NAQSAKQVTELVRGFGTSPNGIEVESTSGDNAKAVAEARVVVLGTKPYLVEEVLQDVR
                     TQVADKLLISLAAGWTLDQLVDYTARVARVMTNTPAKYGYGAAAVSHSPDVTADERAL
                     VSRLVGHLGLCVELPEKNMDAATALIGSGPAFALLMLESMMEAGVKLGIPLDVSRRCA
                     AKVLEGTARMAEETGSHPAALKHQVCTPGGTTIAGLCVMEDSGVRSGIVKGIEEAANV
                     AARLGRK"
     gene            <719559..>721076
                     /locus_tag="AGOS_ABR169W"
                     /old_locus_tag="ABR169W"
                     /db_xref="GeneID:4619227"
     mRNA            <719559..>721076
                     /locus_tag="AGOS_ABR169W"
                     /old_locus_tag="ABR169W"
                     /product="ABR169Wp"
                     /transcript_id="NM_208470.2"
                     /db_xref="GeneID:4619227"
     CDS             719559..721076
                     /locus_tag="AGOS_ABR169W"
                     /old_locus_tag="ABR169W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR121W (ATP2)"
                     /codon_start=1
                     /product="ABR169Wp"
                     /protein_id="NP_983117.2"
                     /db_xref="GeneID:4619227"
                     /translation="MVLPRVYAASSRAALQAARRAAPFHGARCLATAAASEGKVRAVI
                     GAVVDVQFEQGNLPAILNALEINTADGKLVLEVAQHLGENTVRTIAMDGTEGLVRGER
                     VVDTGAPISIPVGRETLGRILNVVGDPIDERGPINSKTRMPIHADPPAYVEQSTEAEV
                     LETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERT
                     REGNDLYREMRETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQ
                     DVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSV
                     QAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDASVVGQ
                     EHYDVATKVQQTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEV
                     FTGIPGRLVRLKDTIASFKAVLEGKYDHLPENAFYMVGGIEDVVAKAEKLAAEAN"
     gene            <721523..>722911
                     /locus_tag="AGOS_ABR170W"
                     /old_locus_tag="ABR170W"
                     /db_xref="GeneID:4619228"
     mRNA            <721523..>722911
                     /locus_tag="AGOS_ABR170W"
                     /old_locus_tag="ABR170W"
                     /product="ABR170Wp"
                     /transcript_id="NM_208471.1"
                     /db_xref="GeneID:4619228"
     CDS             721523..722911
                     /locus_tag="AGOS_ABR170W"
                     /old_locus_tag="ABR170W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR122W (IBA57)"
                     /codon_start=1
                     /product="ABR170Wp"
                     /protein_id="NP_983118.1"
                     /db_xref="GeneID:4619228"
                     /translation="MRFNSSIIVRRLTKVTTSNSAHEAPQFLSCRLPGKAFISVRGPD
                     AVKFLNGLITAKLAPEVVKKSLTTVNPDVREVERHPSISGFDLRRGNWGIYKEGTRAR
                     GPYISRFGTYSAFLNSKGKVLTDTVVYPAPLGLPDGAAAKYPEYLLQCDAIFVEPLEH
                     LLQRHKLLQRVKIARRDDLSVWHVAIDMDAYPEWEQSFSWRSEFWKPMVSLHNQDDAL
                     RFARWFIAQFFAGAEGRLVGAYYDTRNVDPTKKSNIFYMVTTGDVDDIATLFSPQMVS
                     SKTTAVSVPYTEVRRARLRRGVLEGVSELRSEAVLPLEVNFDLYEDAVSFDKGCYVGQ
                     ELTARTHATGVLRKRCAPVIVSNSASLDTLATSSRLDLYTDYVIPAASTSPSPTNSPF
                     ASQNPRPRKKQPIGKLLCVDGTDGVALVKLIYIERSRSCGSIECYVTHPETGERVPIY
                     IDLQNRPIHLPE"
     gene            <723331..>724008
                     /locus_tag="AGOS_ABR171W"
                     /old_locus_tag="ABR171W"
                     /db_xref="GeneID:4619229"
     mRNA            <723331..>724008
                     /locus_tag="AGOS_ABR171W"
                     /old_locus_tag="ABR171W"
                     /product="40S ribosomal protein S5"
                     /transcript_id="NM_208472.1"
                     /db_xref="GeneID:4619229"
     CDS             723331..724008
                     /locus_tag="AGOS_ABR171W"
                     /old_locus_tag="ABR171W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR123W (RPS5)"
                     /codon_start=1
                     /product="40S ribosomal protein S5"
                     /protein_id="NP_983119.1"
                     /db_xref="GeneID:4619229"
                     /translation="MSDHEAPVEVQEDFEVVQEFVPTKLATAIPEEVQLAQQEIKLFN
                     KWSFEEIEVKDPSLVDYIQVRQPIFVSHTAGRYANKRFRKAQCPIIERLTNSLMMNGR
                     NNGKKLKAVRIIKHTLEIINVLTDQNPLQVVVDAIINSGPREDTTRVGGGGAARRQAV
                     DVSPLRRVNQAIALLTIGAREASFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELE
                     RVAKSNR"
     gene            <724609..>727143
                     /locus_tag="AGOS_ABR172W"
                     /old_locus_tag="ABR172W"
                     /db_xref="GeneID:4619230"
     mRNA            <724609..>727143
                     /locus_tag="AGOS_ABR172W"
                     /old_locus_tag="ABR172W"
                     /product="ABR172Wp"
                     /transcript_id="NM_208473.2"
                     /db_xref="GeneID:4619230"
     CDS             724609..727143
                     /locus_tag="AGOS_ABR172W"
                     /old_locus_tag="ABR172W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER024W (YAT2)"
                     /codon_start=1
                     /product="ABR172Wp"
                     /protein_id="NP_983120.2"
                     /db_xref="GeneID:4619230"
                     /translation="MVEDDSAPAMELTFAHETRLRKLPLPGLRSTASLLTAALEPFHS
                     GGTHDGGGADVELASYLGSLADSSGALKLQAKLEEFDKHSACYLDRLHLNIHNHVAGK
                     EISQDILPRNPFLVLAEDAEIDISQEDRAGVLCYSALRFVSAVRRQQLPPDHSRGQAL
                     SMKPYLNLFGTTRCPIFEPGEVESFDLNKPYSESDVEAETRSDLMEPATKVTSPDDRP
                     RSEGSDEPFNHHGISMKQYPASKHILILSKGQYYTLDVLDDDHRILYTDKDMAKVFAS
                     VLEDSRKSYSVDRSTALGSLTSYSFRNWKYARKRLQKRFPVELEMIDSALFVIVMDES
                     DRSDEDQSYAKRLFYGTSVIDEVTGLQVGSCTTRWYDKLQLVVTADAKACIIWDSFTC
                     EGSAVLRFTSEVYAESVMRLARDVNENSSAFSLWPSIETRRILDVGDNADKFLRKIEW
                     SFLNEMNTHIHLSETKLSDIISKHDIINYTLPFGRHIARRLNIRPDSMIQVGLQIAHY
                     ALYGKIIFALEPVSVRSFQNSMSAFIPIQSTKLAELCRQFISNSLDTSLKYMQFIEAC
                     RAHSELIEQAKQGHAAEKHFNALRHLFKFRRHFGIDLDVDEIEQLSGLFDSPQLVPFF
                     TPEMIASNCGNAAMTMFGVTPAMRQGFGIGYILKNEQCDLTVISQYRQGKRLMFMLEW
                     VLTEICEYWKSTRKHSEDIKISPTVDLLYGIDNALKSEKVERSERRPSAFYNGGYGLF
                     DLKGHVESRSSVCSTPVSRSGSHLKLTELITSLSFNNVNALTTEEDKQVTGYEIAKID
                     QPKSSSPDTDELATDDKPSRKSNVINSKFVINFDRSSVGRKVNTSD"
     gene            complement(<727263..>728573)
                     /locus_tag="AGOS_ABR173C"
                     /old_locus_tag="ABR173C"
                     /db_xref="GeneID:4619231"
     mRNA            complement(<727263..>728573)
                     /locus_tag="AGOS_ABR173C"
                     /old_locus_tag="ABR173C"
                     /product="ABR173Cp"
                     /transcript_id="NM_208474.2"
                     /db_xref="GeneID:4619231"
     CDS             complement(727263..728573)
                     /locus_tag="AGOS_ABR173C"
                     /old_locus_tag="ABR173C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR124C"
                     /codon_start=1
                     /product="ABR173Cp"
                     /protein_id="NP_983121.2"
                     /db_xref="GeneID:4619231"
                     /translation="MQVRKVWRSAGPDVRLLWLSVFVRLMSYGLSNQVLTLFLHEVGC
                     SEAQMGWFMSLTLVGDVGLSYVLTWYADRWGRRKVLVVGGVLMAASGAVFSTMRNFYV
                     LLAFAVAGVISPSSDEVGPFKSIEESMMAHMTPHHKRPEVYSMHALVGTLGGALGSVA
                     SGWLVDALRGYGLATDLACYRVVFAVYTALALAKVVLMLLLSDTAERNLTEEESAGVL
                     SRLAADDDSAPLLPRNTGRLAPGTVAVLLKLLVVFMLDSLGSGFMTSSWTVYYYSKVF
                     GMSAFALGVLFFACRLIMAVSNIPSAKIARLFGPVKATLLVQIPSGIFSILIPFAEPH
                     LGSSVALLLLFNFTTAMDVTPRQILLTNIIHPNDLTRVMGIVNIGKTSVRCVGPIFTG
                     MLASSGRLWVCYVISGALVILADIILGAFFYGIDGKILSKMNIY"
     gene            <728790..>731384
                     /locus_tag="AGOS_ABR174W"
                     /old_locus_tag="ABR174W"
                     /db_xref="GeneID:4619232"
     mRNA            <728790..>731384
                     /locus_tag="AGOS_ABR174W"
                     /old_locus_tag="ABR174W"
                     /product="ABR174Wp"
                     /transcript_id="NM_208475.2"
                     /db_xref="GeneID:4619232"
     CDS             728790..731384
                     /locus_tag="AGOS_ABR174W"
                     /old_locus_tag="ABR174W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR451W (LEU3)"
                     /codon_start=1
                     /product="ABR174Wp"
                     /protein_id="NP_983122.2"
                     /db_xref="GeneID:4619232"
                     /translation="MSEGMKSSSVSQDEDAGANGTEDEELSRACSPYMRRQNRKKFAC
                     VECRQQKSKCNAHDRAPEPCSRCAKKNVPCVLQRDFRRTYKRVRNEVIERRFRELTSS
                     LSNLGAEEILQRLEEEQRVISNNGNFTKEKIKRLRELGDLGLEAARAPEPPAAQTELE
                     ESGPLTAEQLKCAAKSLGDVHLAPEEIAHVFQEYAERYHRFLPVVEISKGPEKIYALS
                     PCLFWVIVLIGLRREFGTIETMRKLSKLVKVVLAEISVSPIIRNSQLETSEPALNVAS
                     VYSVQALLLYTYWPPLTSSLSADTSWNTIGLTMFQAIQLGLNTVQYSEGFTHANAELV
                     REHTKTWLYCNVVSQTIASAFGFPAFVCFDHTVMSTFNHSISTARTARMPSRLKQMAQ
                     VAHFENQLASTMHSNPLSPSGLLNKNEMLPLLRILDRQLDVLEMELNDSNADEFRRFS
                     FLVSKVHLYSYYFILAGEGSTSQIDGHSATLREAEIDSVTKHGLLKAYNAAVALLQHT
                     NSMWERNPSMVKYFPGVFVLSIWQSACIVAKLAQSSLCEVLDIALGEKVYQNAVSLCF
                     NASVLKHDMAYRSSGIMKSMWLMFSDMHDNWNHQGQPSDPLSPSSFNLAINVKSRMAV
                     SVFFDCLYILRRKCGMAKLRRQARRRPDDTDIATTQSAGNDRSVSMAIDSSQNPVESA
                     RRIIQTIPLDPEPINASTATDASSCDSGSDEALLLRKILHHTSSIADGHSLRTAASGG
                     TPIPAESTRPFSDSRGASVQPSTHATTLHHSVFDRPGGAYRSVSSVDTTVSGILLDTS
                     ARLPEHSTDRSVPEPYNAISDLQSSDLQPSDPATRSWGSWDEWESDLIFKDVGILMNE
                     FAFNPEVL"
     gene            <731729..>733282
                     /locus_tag="AGOS_ABR175W"
                     /old_locus_tag="ABR175W"
                     /db_xref="GeneID:4619233"
     mRNA            <731729..>733282
                     /locus_tag="AGOS_ABR175W"
                     /old_locus_tag="ABR175W"
                     /product="ABR175Wp"
                     /transcript_id="NM_208476.2"
                     /db_xref="GeneID:4619233"
     CDS             731729..733282
                     /locus_tag="AGOS_ABR175W"
                     /old_locus_tag="ABR175W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER025W (GCD11)"
                     /codon_start=1
                     /product="ABR175Wp"
                     /protein_id="NP_983123.2"
                     /db_xref="GeneID:4619233"
                     /translation="MSKLSNQEPSAVIEGDMTEEYPAEVGQDDFNDDVKPKKTVTFSG
                     VEDLESEEERRHREFMDGGGLPEQPTNPDFTKLNPLSPEIINRQATINIGTIGHVAHG
                     KSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCEEPTCPEPDCYRSFKSDKEV
                     SPRCERPGCTGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESCPQPQ
                     TSEHLAAIEIMKLKHVIILQNKVDLMREESAMEHQKSILKFIRGTIADGAPIVPISAQ
                     LKYNIDAVNEFIVKTIPVPPRDFLASPRLIVIRSFDVNKPGAEIDDLKGGVAGGSILN
                     GVFKLDDEIEIRPGIVTKDEQGKIQCRPIFSSIVSLFAEHNDLKFAVPGGLIGVGTKV
                     DPTLCRADRLVGQVVGAKGHLPSIYTDIEINYFLLRRLLGVKTDGQKQAKVRKLEPNE
                     VLMVNIGSTATGARVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWRLIGWATIK
                     KGTTLEPIA"
     gene            complement(<733446..>735551)
                     /locus_tag="AGOS_ABR176C"
                     /old_locus_tag="ABR176C"
                     /db_xref="GeneID:4619234"
     mRNA            complement(<733446..>735551)
                     /locus_tag="AGOS_ABR176C"
                     /old_locus_tag="ABR176C"
                     /product="ABR176Cp"
                     /transcript_id="NM_208477.2"
                     /db_xref="GeneID:4619234"
     CDS             complement(733446..735551)
                     /locus_tag="AGOS_ABR176C"
                     /old_locus_tag="ABR176C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR452C (SST2)"
                     /codon_start=1
                     /product="ABR176Cp"
                     /protein_id="NP_983124.2"
                     /db_xref="GeneID:4619234"
                     /translation="MLEKGSSKLHEVVSASFNRSPNNLIFTHDLKQVYSLLLICLDLK
                     ERPRDSSKNIFNALSKSFPYSFSVQDAVEKMKDLQLHVDLTTTSVHIKYAIKPDLAYN
                     LLTLFMDAKLLHTPADRTRDAPKENVLLQPTPKGTAILQHYVSRMGLKIIPPVLKSSF
                     NSMQLFTFERSSTSDAILHSDSFIQLLFVNAMGPEPNVWQPTNQVDKIPPLSAHLGHE
                     NIFSFESTVVDFCRRADYSVSCYNGNKADNKYERKELREKPRESPFAHRFFTNPDSDA
                     HIQYYISEKGVRLFESKMFGKKVLIDYSFTTKALWQWLMDCTDIMYPKEAISIAALFL
                     KKGLITPILLPPSLNIPGKFAVSKNAYYTLSNSGWQIVRWMQGLRCSRDYYPLFGIKR
                     KYVYELRIDTTVISCDSSKERPKKSDGSDEVFGTKQTMRCSRHILDLRTILKDPGMRY
                     LFRRHLEREFCTENFDVYLEIKKFSKRMTILKKLLDFRTRKQECAVTSDSFHFSQKTC
                     DSIDSRIITNIDECLAVGCHIFLTYIASGAPFQVNIDHELRTSIISLMTDPGSSLKQV
                     FENPFSDEAEIAQPFCISPNDYISSMEAFMTPITRQRKIIINSLKTNLDPETPSSLTN
                     YVTGDLNDKGCSQIPLSSSPTAFIVSNLKILKELYVLLDRVAKHIYRLMNIDSIPKFL
                     NSDLYKEAINFIDTRKIDC"
     gene            complement(<736049..>738310)
                     /locus_tag="AGOS_ABR177C"
                     /old_locus_tag="ABR177C"
                     /db_xref="GeneID:4619235"
     mRNA            complement(<736049..>738310)
                     /locus_tag="AGOS_ABR177C"
                     /old_locus_tag="ABR177C"
                     /product="ABR177Cp"
                     /transcript_id="NM_208478.1"
                     /db_xref="GeneID:4619235"
     CDS             complement(736049..738310)
                     /locus_tag="AGOS_ABR177C"
                     /old_locus_tag="ABR177C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR161C (SGV1)"
                     /codon_start=1
                     /product="ABR177Cp"
                     /protein_id="NP_983125.1"
                     /db_xref="GeneID:4619235"
                     /translation="MSQEGSAKRADFKYKIGKIKHTPPVLKDVRSGLEFIELEKRDDE
                     KVYGVTKFLGNYKEEKKLGQGTFGEVYRGVHLATQRQVAMKKILVKTENDLFPITAQR
                     EITILKRLNHRNVVQLIEMVYDYPPAQNGAAYGQDSSQASASADTMKSFYMILPYMVA
                     DLSGILHNPRVTLEMADIKNMMLQILEGINYIHCKKFMHRDIKTANILLDHKGILKIA
                     DFGLARNYYGAPPNLKYPGGAGTDAKYTSVVVTRWYRAPELVLGDKNYTTAVDIWGIG
                     CVFAEFFEKRPILQGKTDIDQGHVIFKLMGTPSDSDWQLARYLPGAELTRTSYEPTYK
                     ERFGKYLTEKGLDLLSTLLSLDPYKRLTAMAAMQHPFFSEDPLPKLQLTLPCEESHET
                     DIARYGQEMQKTVSNLPPAAPSGHAVEQSQTQQQSSRHHQSQPYQSLPPQKSSQPHPQ
                     QIPEAAPVQQPSQQPPQEPSAHQQQYSSRGPQQHRTTPAPTSLPPKPKPAPPGARYNR
                     EAPPQNKPVKPLTRHLGAQYQHNNYGNYYNHWQGGERYYETYNDGYPHADRYSDDTHY
                     NGYGYRSRGYQRYDMRREGESRYNQRPYAPQQGAAYRPNRRDTYKLVDRTGQPYPPER
                     VPNPELHPSPAPRPKRTLTNTTQLSSHSSAATGSTAASGSAVSNSSEPVRRSSTASLD
                     NSESGNILQQKPPPPVANPLEARIYGRDEVQSNHPGGRLYPRSTPDSKNSEGAAPSEA
                     STDPTKRNIVDYY"
     gene            complement(<738566..>740251)
                     /locus_tag="AGOS_ABR178C"
                     /old_locus_tag="ABR178C"
                     /db_xref="GeneID:4619236"
     mRNA            complement(<738566..>740251)
                     /locus_tag="AGOS_ABR178C"
                     /old_locus_tag="ABR178C"
                     /product="ABR178Cp"
                     /transcript_id="NM_208479.1"
                     /db_xref="GeneID:4619236"
     CDS             complement(738566..740251)
                     /locus_tag="AGOS_ABR178C"
                     /old_locus_tag="ABR178C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR162C (ORC4)"
                     /codon_start=1
                     /product="ABR178Cp"
                     /protein_id="NP_983126.1"
                     /db_xref="GeneID:4619236"
                     /translation="MGAFDNDFGPIKRCTTSAHPSNIIKSGLEEQDQNHKLKKIKLIT
                     KEMHASQQEEDELTSAQKSILHRLPLQVAPNSSGQSSTVCGATAADPQAFEELKTMLL
                     RKLNNRLPPEESGLPEFVRSASNEVERILVQSVIQKESHSAILVSPRSWYKTSIINHH
                     LARLRRQHDQQFVTVRLNGLIHTENAAINSIATQLENELRRVRKDVPATDFQLSQGSL
                     TEVFENILKLLNTVAVQMGRSSSVLPRSAKLTVIFIFDEIDQFAGPIRQTLLYNLFDM
                     VEHARVPVCIVGCTTKLNILEFLEKRVKSRFSQRLIFVPQITSYQSFCKEVIRILSIG
                     RPGPYTHAWDKKVKSELEDEQTELSCLVKGNYETFRDLALLKNAFVSMVGAADSFDSL
                     LCSLVNCNTLKLYNKLQLSNSLVNRVRALGELELVILLSAARVALKNEENVNFNLMYE
                     EYSKLVKGLNSRIPASSSLSDTGISIEHAVRIWNKKDIKSIWETLIELELLVERGIIA
                     IRQSAQAAFQATNHYSANSVMPYDLKMFQVPITLHELRRVVSKSSMFYSWTQL"
     gene            complement(<740584..>741789)
                     /locus_tag="AGOS_ABR179C"
                     /old_locus_tag="ABR179C"
                     /db_xref="GeneID:4619237"
     mRNA            complement(<740584..>741789)
                     /locus_tag="AGOS_ABR179C"
                     /old_locus_tag="ABR179C"
                     /product="ABR179Cp"
                     /transcript_id="NM_208480.2"
                     /db_xref="GeneID:4619237"
     CDS             complement(740584..741789)
                     /locus_tag="AGOS_ABR179C"
                     /old_locus_tag="ABR179C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR163C (TIF3)"
                     /codon_start=1
                     /product="ABR179Cp"
                     /protein_id="NP_983127.2"
                     /db_xref="GeneID:4619237"
                     /translation="MAPPKKNAIKMDLTSFLNDDSFGDSWADDQVDLNNINLPIQNVA
                     ASNTIPLEQLGSAAMGKGGHLDSALGSKRERVEYPVPNAPPYRARISNLPWDVSEEGV
                     HAWTEDMLERPGCVEKVIAPKDQDSDRLKGWAFVTFRERDDLVKSLTLNATKLNDRTV
                     YVAVAAPKDGVFDESNWNGARGANFQASGEDPVDLDWGAVRGSNYHPSERKPRREDPD
                     LDWTTSRGSNFRPSEHKPAQQESDVPWSVAKGYNFQSSERKVRHEEPDIDWTVARGSN
                     YQSRERKPRSDEPDLDWGAAKGSHYQAAKSRPKRNGHELNLGAARSAKAAPQVARKST
                     TPALKEDTPRIQKSSYDILNVESDSEHDAETSGQNSQPDDDVAHLEKAAQNLTLEEDG
                     EWEVVGKKQ"
     gene            <742677..>750467
                     /locus_tag="AGOS_ABR180W"
                     /old_locus_tag="ABR180W"
                     /db_xref="GeneID:4619238"
     mRNA            <742677..>750467
                     /locus_tag="AGOS_ABR180W"
                     /old_locus_tag="ABR180W"
                     /product="ABR180Wp"
                     /transcript_id="NM_208481.2"
                     /db_xref="GeneID:4619238"
     CDS             742677..750467
                     /locus_tag="AGOS_ABR180W"
                     /old_locus_tag="ABR180W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR454W (FMP27)"
                     /codon_start=1
                     /product="ABR180Wp"
                     /protein_id="NP_983128.2"
                     /db_xref="GeneID:4619238"
                     /translation="MLEYTELYSFLPYVLLTVSLIIVLDLALWYKAGIWIGGFNPFLL
                     KLSGITVRDRLYVGQVRYHLLRRAVFVGDLKFTSGERVRRGIQRDGSQKIQLRVPESG
                     LLWLEGVLRFFRTLSVTIENSEIEDISVRWMSLDVKYMGDRLAFSVSLQNIKHNKVCL
                     LKSGALEVLGCFTKDSPFGLTCVELSVKFLQLTVPVSNLLALFTLGKEEDEDVEGFAR
                     NIFDGMTEDPQLNAQNCVEMMRSRVTTLHSYFSHLTKVDFFVDKVNLADIPPSLLPEL
                     SSACEPLKYEVALSSFTFQVTRFSTEQPGYSILFKKSDRPVRVRITLSSLQCALKLNA
                     PKNPSEKASEYIRFFDVPSIILYGDTNIFSERFLTGSTAVSDTIVKLVGHVSSPTIDI
                     EIEKLSILKSLYANIMVLTSMFNKMRSASGKELPTATSRLNALEKKTILSYLTQIIPS
                     VESKITVEDPVIIINDGEDFIFQKCSILSFQTITHKCNLARRRSNAQLGYNFDVNFEI
                     LDFDTSHHSKNIGYVNQILKLDSINMKLVSQLIPTLLMSLHFTVDLLKCDLSDLKTLV
                     FLNRIIRKLNSQMLNVEEEYFLQIYQQFASQLEELGKREENTNVIPIDRKLFQHLPSY
                     LDSINLEITDFSLLVGSRSVFLPEDKYVSMLQQSTYDFVNGELRKLHCTFGSAQLVLN
                     NTGRRAMEKGDRTNAGNFESTNGEGFSYDDSGLEAHTTDFGTSDPELWSLSFQCKQVL
                     GTVFSETKRNSDCLVSKTVFKLPTASALFHPQLEAEKLVLELKIDKSEVLVSLMTLFL
                     VFSALQTFKQVFSKEITAHRRFTYAEKYQEYVASTRRKFRPKFDKARLLKLLEFHLEF
                     KHLDMVTVLPNGVKCRFEICTSQSSFADANDISIYGHYFRMCVESPLMNQKWFRMLAI
                     VDFNARLDIRSWKIRRNWDEFKAMEPAVIIENQSCHWQIPHRFEMHRIFDNISTMFKT
                     IKQMVYSLKTCKHSVVVFPTVTAAPELPKITMRSKRLIFSVEDDPFETDLAMIFQIGM
                     QEQRSRLEKYHVFDEWLNTKLQANGNRNARDSDFNERPITPSSATFAQQFASKGIHHP
                     TNDVLEHSTIESVLSQHEYDICLDRYNKLQENISASWIRRVQMCHRKEKKVFKDGFTF
                     LWGKTDSLKLPSTIDKGVIDFVPSPNLMTIIAEGVNIDIFRPSCGLDNTADFIYSVGK
                     GVPKDTRYTLMLPFYIDAKLDELRWHLKDYPLPLVHMPKLLPSQQGSFPAIHLYGDLF
                     ITEDMIQSTKELRTIFVPLVPSVTSSEIDLYYSLRFRRSLTPIKIYSQVTMDIHSKDI
                     TMVTWGGSYEAAIQQAMNCLDNFSKPPVDPSKKIGFWDKIRNMFHAKINIRWPSEGLF
                     EVSLKGLKDPYAIGGKSAGFVIGLRGNAELKINADNDPKKFLACSADDIYFAIPNYFA
                     KPLLVWCNSSENAVFIPSQNDTNLQRSAAYYYFIDLMPVPNAKMEREIMYRRYIEKSA
                     IKLSGGIIFNIGIVFERLLPGSKDRTFTSLAHYKVRLCDPEHVADPGHDSYRGFRSEF
                     IHLSFTLQSNNSNAYNTMQLTPGVFSVFFSWWSSFSANLPVRRGSLFGVLTKSPKFGD
                     HIHSISYRADIAPFFICHTYQNTDTETYTSEAFDGTLEFVGLKAKMDKFVMDLHQRKE
                     VLHERNKGLDVIKRVMRSKFKEGDVSTFNIDIRTMDAVFKPMAYDGGLNTPEYNIFDG
                     DMTWYDPLDFKEFKYHALDNYVPIVTIGPLLYAPKFVYRKKASYGDKYQVDFNTCERV
                     KPFDNSISHTCCLKPQIEVPLETVEERKDFLLKKRREAQRLLEVATTTNERQHILSEL
                     DKLDAVLSKVVELIEAIKNIQNDERADSHNEKTTDEGFKYSIRDFVDRSTGSVSPFEN
                     KFFVFCMQLKWDEDARDVIFKYLHLLELSSQAVTLTRSKTLQVIERLCHRKLAYTKSD
                     ESIFSSISDIPIDGHDLSTAETSSEEQPKSQSLFELFEEKIYSLNTDAPYMTHDDHFI
                     QFVAPQIQLSTKESPGTCVLVTAPSMKLKIIDFDSNTSDNEYNENVFMTRYTAALIQA
                     NVFIFQESDYKVFENSLFNPKGYGAKSTESWQPWLGLELCFEPEPLQTNTVIKEFSSV
                     FKYDRVSSFANVSDLLSDAISMDSVICYLPRFVLASDSKQYIALYNIIANVFVYVEPN
                     SARLKKQVNQLLLGYDPSNLTEYIKIVEKIQRMLVALDVIEEELSFKKYLLDDVGEAD
                     LHAIRKSKVESFAKLSIFMKVLTSSNVDEVTEDKKMMFIMKAEEVILHMLKENGEPFL
                     DAALANSYFHRIQSSAGSNSNKIVINMLQVFNLEQDVKFHNLLGPLDKRATVNEKPLI
                     YLEWDMDRPVGGIKVVKNVWTELQGLEFRAEQDTIDNLIRWTMPEMLQELLNNNDDIY
                     GDNDSHASSNSTSSAAVVRDNMFSWALSPIKNPLKLKNSNELHEMVQRSSDYMIIENM
                     VLNSFPLVISYRGHGARRIINVTDFMFTFPKLQFINQTITVGEVLNAIRRVVIKSLLK
                     HTGQFITNKLRKRPHQKQLYIDTTTSSQDDDQKSGQVHTPLKQIQRYKSYTDVNELRQ
                     "
     gene            <750835..>754347
                     /locus_tag="AGOS_ABR181W"
                     /old_locus_tag="ABR181W"
                     /db_xref="GeneID:4619239"
     mRNA            <750835..>754347
                     /locus_tag="AGOS_ABR181W"
                     /old_locus_tag="ABR181W"
                     /product="ABR181Wp"
                     /transcript_id="NM_208482.1"
                     /db_xref="GeneID:4619239"
     CDS             750835..754347
                     /locus_tag="AGOS_ABR181W"
                     /old_locus_tag="ABR181W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR164W (MMS1)"
                     /codon_start=1
                     /product="ABR181Wp"
                     /protein_id="NP_983129.1"
                     /db_xref="GeneID:4619239"
                     /translation="MDEYELFNVNRAGSTASVFSTTSSVTYEFKLGNALEAAAQRCIV
                     PMRINKTAGKLEVLDELADRSVINKTFAPRERVMPHNPDTLDDPDIEQLLLTGGAQPT
                     YKEVPVNGEIINTTLVVLKSSISIAGSANYFRLHGQVTDCKTIRHDKPEFIDDTLLIT
                     TADNILYSVVFNDNLEPQIVHWWALAKPTKALTWKIIIHPEKDRFMLYEKETSAVKFF
                     KLQNSCPYYVELVRNMHMLNTKILACSYLFSKSEVIVFISGLKASRIYYYLVTWPIDS
                     VGIPEVHQFVVPDGKVLEDIIPLNNNYCLAISKKTVDLFSVHQLLTSESHGIPLILEK
                     SFGTITHFEYDVQILSRLQQLDPGKYLPLTRAVIFSTSIYLLGLILADDRGTINFYGL
                     TRFKGLKGFTLVPSQPQSAKAYKLQIISFGKVFEITLDLSGIAILDDRAYVESMSNIL
                     RRHTKDTSFAYAEELISFRDKTPAISGTIQEELWSCSSSVLSNISTNGHVAHFKNILY
                     LREFLRFNSIWTIGLDAVAEEVYTRLCGDDRRYKGYLVIGSDGATITRAFVLYFSSEE
                     DMECDEVDGILSDLAGATIYYFVTNNYLVQVTKRQLLLSSVIDERDRWNHDLPFVANG
                     ALSLGPTVVFWAGTQISYIENVELMGRSHAIATFDIGNSLRSQEALSHLDLNGLLADE
                     LFHIEKVLLDEPSAEWTIKINCLFLVYKFMASDSEPTLVRLHLESASAIISDTLLIDR
                     HTILCSDATVITPSHNYENAPRAVNTHKIKGYYSFEPFGERGILCYSASEIFLYDLEH
                     KQEIKLPGWKKNNSIIQVCANQRHVLVLFSDGLGVYENSYQSYTGSNIVLSSTHCAKR
                     FIYISSINRLLIVTCKKKSVECMKLESRKQCRLETHAIFADVDEILDVKQLGQVTADA
                     SPSSPDITLAFSCRLRCSRTSYIVKVVLLIPAPGRLTLRLLTATEFPELACAGEIRTG
                     TGNTFWVATETGLVQYSLQDMPDSPQLVLLRMFPMPLLRQFDTAATFAAALTTDGRLH
                     LLLPDGSVCAQDPRNTARHDTLRMRTDGSVLAYTEPLAHGAGAAAAALVLYYRDSTDP
                     TRLCPTTRLALSKTVTSIHLISDVRAYLLHSDGTVAPVDIEPSSSGPCVASPSPASPL
                     HLASAPPPPTNNIGIWDIEYRPVL"
     gene            <754738..>755367
                     /locus_tag="AGOS_ABR182W"
                     /old_locus_tag="ABR182W"
                     /db_xref="GeneID:4619240"
     mRNA            <754738..>755367
                     /locus_tag="AGOS_ABR182W"
                     /old_locus_tag="ABR182W"
                     /product="ABR182Wp"
                     /transcript_id="NM_208483.1"
                     /db_xref="GeneID:4619240"
     CDS             754738..755367
                     /locus_tag="AGOS_ABR182W"
                     /old_locus_tag="ABR182W"
                     /note="Rho1a; Syntenic homolog of Saccharomyces cerevisiae
                     YPR165W (RHO1); Tandem gene duplication in this organism"
                     /codon_start=1
                     /product="ABR182Wp"
                     /protein_id="NP_983130.1"
                     /db_xref="GeneID:4619240"
                     /translation="MAYQTGGNIRKKLVIVGDGACGKTCLLVVFSKGQFPEIHVPTVF
                     ENYVADVDIDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSVDLPDSLDNVQE
                     KWVSEVLHFCQGVPILLVGCKVDLRNDPQVLQQLQAEGQRPVTAAEGSAVAGKIGAVA
                     YLECSARTGQGVKEVFDTATRAALSGKPAASAGKKKVHGDKKKKKCLVL"
     gene            <756135..>756758
                     /locus_tag="AGOS_ABR183W"
                     /old_locus_tag="ABR183W"
                     /db_xref="GeneID:4619241"
     mRNA            <756135..>756758
                     /locus_tag="AGOS_ABR183W"
                     /old_locus_tag="ABR183W"
                     /product="ABR183Wp"
                     /transcript_id="NM_208484.1"
                     /db_xref="GeneID:4619241"
     CDS             756135..756758
                     /locus_tag="AGOS_ABR183W"
                     /old_locus_tag="ABR183W"
                     /note="Rho1b; Syntenic homolog of Saccharomyces cerevisiae
                     YPR165W (RHO1); Tandem gene duplication in this organism"
                     /codon_start=1
                     /product="ABR183Wp"
                     /protein_id="NP_983131.1"
                     /db_xref="GeneID:4619241"
                     /translation="MSQQMHNPSIRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTV
                     FDNYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVM
                     EKWISEVLYFCQGVPIILVGCKADLRNDPQVIEQLRQQGQQPVSQAQAQEVADQIGAV
                     EYIECSAKTGFGVREVFEAATRASLMGKQGKSKAKSDKKKKKKCVVL"
     gene            complement(<757250..>757594)
                     /locus_tag="AGOS_ABR184C"
                     /old_locus_tag="ABR184C"
                     /db_xref="GeneID:4619242"
     mRNA            complement(<757250..>757594)
                     /locus_tag="AGOS_ABR184C"
                     /old_locus_tag="ABR184C"
                     /product="mitochondrial 37S ribosomal protein MRP2"
                     /transcript_id="NM_208485.1"
                     /db_xref="GeneID:4619242"
     CDS             complement(757250..757594)
                     /locus_tag="AGOS_ABR184C"
                     /old_locus_tag="ABR184C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR166C (MRP2)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP2"
                     /protein_id="NP_983132.1"
                     /db_xref="GeneID:4619242"
                     /translation="MGFRFPVKTKLPPGFINARVLKDSFKRQQAADHEVTVTALKYIA
                     RNTALPTRARMEAQLQLAVMPNYTRMTQVRNRCIATGHARSVITDFRLCRTQFREKAK
                     NGELPGVKKGVW"
     gene            757926..757997
                     /locus_tag="AGOS_t0041"
                     /db_xref="GeneID:4619243"
     tRNA            757926..757997
                     /locus_tag="AGOS_t0041"
                     /product="tRNA-Glu"
                     /codon_recognized="GAG"
                     /db_xref="GeneID:4619243"
     gene            <758346..>759719
                     /locus_tag="AGOS_ABR185W"
                     /old_locus_tag="ABR185W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YCL057W (PRD1); mutant allele with 3 frameshifts and 1
                     stop-codon; An intact copy of this gene is found at this
                     position in Ashbya aceri"
                     /pseudo
                     /db_xref="GeneID:4619189"
     mRNA            <758346..>759719
                     /locus_tag="AGOS_ABR185W"
                     /old_locus_tag="ABR185W"
                     /product="ABR185Wp"
                     /pseudo
                     /db_xref="GeneID:4619189"
     misc_feature    758346..759719
                     /locus_tag="AGOS_ABR185W"
                     /old_locus_tag="ABR185W"
                     /note="ABR185Wp; non-syntenic homolog of Saccharomyces
                     cerevisiae YCL057W (PRD1); mutant allele with 3
                     frameshifts and 1 stop-codon; intact copy of this gene is
                     found at this position in Ashbya aceri"
                     /pseudo
     gene            <760204..>761130
                     /locus_tag="AGOS_ABR186W"
                     /old_locus_tag="ABR186W"
                     /db_xref="GeneID:4619244"
     mRNA            <760204..>761130
                     /locus_tag="AGOS_ABR186W"
                     /old_locus_tag="ABR186W"
                     /product="ABR186Wp"
                     /transcript_id="NM_208487.1"
                     /db_xref="GeneID:4619244"
     CDS             760204..761130
                     /locus_tag="AGOS_ABR186W"
                     /old_locus_tag="ABR186W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR176W (ECM31)"
                     /codon_start=1
                     /product="ABR186Wp"
                     /protein_id="NP_983134.1"
                     /db_xref="GeneID:4619244"
                     /translation="MLASRPIKAMALRRMYSIHSSSKQKTIPDIFKKYHAKEPISMIT
                     AYDYITATWAHAAHTDMILVGDSLAMSTLGHVSTVDLDLQEFQYHVRSVCRAPGSSFI
                     IADMPYGSFERSIEQGVETAISLMKTSSRVGAVKLEVGAEENDYCLELAAELCRRGIP
                     VMGHVGLTPQRMHALGGYKVQGAKDLGQALAAYHRAKDLQAAGCFSIVIECIPTKLAG
                     IITEKLSIPTIGIGAGPQTSGQVLVQSDLLGMLPGKAPKFVQKYADFHGDAIGSLCSY
                     VEDVRQGVFPKVGQHTFTVSEELLEEFSKQVD"
     gene            complement(<761183..>762544)
                     /locus_tag="AGOS_ABR187C"
                     /old_locus_tag="ABR187C"
                     /db_xref="GeneID:4619245"
     mRNA            complement(<761183..>762544)
                     /locus_tag="AGOS_ABR187C"
                     /old_locus_tag="ABR187C"
                     /product="ABR187Cp"
                     /transcript_id="NM_208488.1"
                     /db_xref="GeneID:4619245"
     CDS             complement(761183..762544)
                     /locus_tag="AGOS_ABR187C"
                     /old_locus_tag="ABR187C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL103C (FMP30)"
                     /codon_start=1
                     /product="ABR187Cp"
                     /protein_id="NP_983135.1"
                     /db_xref="GeneID:4619245"
                     /translation="MRKLFRHIQNVHFCGNPFGRFCSSIRGASTPRQEKCRNRRMGIP
                     VAKALLGLATPYTAYALYISLQSNREITARENKLQDKESMDFADTLIKYSQLEILGRF
                     ENPFTEYRIQTVYEFFFNRLVEVFERNRGGIPVQQSAMDDLMPVHKPSWTNGENMECE
                     VKFSYEVLGPDQAPAQRQAQQLPPLHVTWLGQSCSYIVYRSVKILTDPLMSDYLLHNK
                     LGPKRITKMPAQPEEVPVPDVILVSHNHPDHLDEVSMKKWGSGSSAALWIVPKGLGEY
                     VERHGVERYVELSWWETCRLKFQGTGELPSSLDVVCTPAMHWSGRTLFDANRSLWASF
                     LIRDKDMPVLFHAGDTGYVADLFLRIKERFGAGVKLALLPCGQYCPEWHQKPRHISPS
                     EVLMIMKDMEAKSVLGVHWGTFVLSGEYFREPKEKLEILAEFEGVRDNCYCPELGKTI
                     TIY"
     gene            <762763..>764163
                     /locus_tag="AGOS_ABR188W"
                     /old_locus_tag="ABR188W"
                     /db_xref="GeneID:4619246"
     mRNA            <762763..>764163
                     /locus_tag="AGOS_ABR188W"
                     /old_locus_tag="ABR188W"
                     /product="ABR188Wp"
                     /transcript_id="NM_208489.2"
                     /db_xref="GeneID:4619246"
     CDS             762763..764163
                     /locus_tag="AGOS_ABR188W"
                     /old_locus_tag="ABR188W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL101W (ELP4)"
                     /codon_start=1
                     /product="ABR188Wp"
                     /protein_id="NP_983136.2"
                     /db_xref="GeneID:4619246"
                     /translation="MSFRKRSEIISGSRTVPNRGFTPIRGAPVRSDEVTGLRAVTSRG
                     RDMGTARAGQIDTSNVSRLSRGVEKLGIHSEVAGQSHPGLRPSPATSHPTTSTGCADM
                     DRLLGHMGLPMGQMLLVEEQGGTDFASVLGKLFAAQGAAHNRAESRGAQRGGNTHVVV
                     ITLNTQYAKELPGIFQGTRKEVKKSRISQEESKVTVQNLAGGGAKPVARSQDLRIAWR
                     YGLGDNCGASQRSEPEIDPHPHYRHQFDITSRMLPAPTATEVSTLSPQQPIATLLRQL
                     ELKLEAQPSQLFRIVIPAFLHPAMYAPSAVQLHEAITLLHGVRSLVKKHREHCVLLAT
                     ISRDLFSQRGSLFMSQIEAVFDAAICLEPFNQEMQQFLERAYKSQPNKVQHGLVHVLK
                     LPVISDRGEMHVIRSEWAFKNGRKNFAIEEWGIPVEETEQEKDDNQLVGTASSTRDIG
                     SSSCAGGKVAISSHDF"
     gene            <764358..>765587
                     /locus_tag="AGOS_ABR189W"
                     /old_locus_tag="ABR189W"
                     /db_xref="GeneID:4619247"
     mRNA            <764358..>765587
                     /locus_tag="AGOS_ABR189W"
                     /old_locus_tag="ABR189W"
                     /product="ABR189Wp"
                     /transcript_id="NM_208490.2"
                     /db_xref="GeneID:4619247"
     CDS             764358..765587
                     /locus_tag="AGOS_ABR189W"
                     /old_locus_tag="ABR189W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL100W (ATG21)"
                     /codon_start=1
                     /product="ABR189Wp"
                     /protein_id="NP_983137.2"
                     /db_xref="GeneID:4619247"
                     /translation="MKVLRFNQDASCFSAVSRPHSMTIYNCDPFGKCFELENSVVTSE
                     SCDTECLTKAQGDQCSNFVTEMLFATSLIAVVNRDQGLQKARKLRIVNTKRKTTICEL
                     TFPHEVVDIVMNRKRMCVLLSSDQIFIYDISCMKLLQTISVLEDKLKMAVSDQGHVST
                     SVVGRQLQGETSMVRIALCSDDKSILCYTAYCRTNKNSYILNDLVVYDALNMTPLNYL
                     NTVHKGNVACLCISNDGKMVATASDKGTIVRIFSTGDENTLQSGNTLLHEFRRGTRPC
                     SIYEMKIDPTRRYLACVGHTDTIHIFDLERQGQQNKSLSDSQSTALLREGKLSKESTL
                     QFASFLSKKVISKIPNQNMERHFAHIKVDDSVRHCLGFPDEFSDRVYVASNNGEFQVW
                     NIPQSGGECILVKKSKF"
     gene            complement(<765679..>766158)
                     /locus_tag="AGOS_ABR190C"
                     /old_locus_tag="ABR190C"
                     /db_xref="GeneID:4619248"
     mRNA            complement(<765679..>766158)
                     /locus_tag="AGOS_ABR190C"
                     /old_locus_tag="ABR190C"
                     /product="ABR190Cp"
                     /transcript_id="NM_208491.2"
                     /db_xref="GeneID:4619248"
     CDS             complement(765679..766158)
                     /locus_tag="AGOS_ABR190C"
                     /old_locus_tag="ABR190C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL099C (AIM43)"
                     /codon_start=1
                     /product="ABR190Cp"
                     /protein_id="NP_983138.2"
                     /db_xref="GeneID:4619248"
                     /translation="MIRYALLRSGRRTLQTRPSPQTLEELARLKSLEDVDSSVIRKLI
                     NQRTEEVNAQNEAQMLKKLSAEGRDLQNVPGSRYARPLWLLLIGCASVYLVRDWLRMK
                     AEYDARETTLETRVEGLEAELKYLLEPKPGVLEVEVVQTEVASSAPWYKRWLWSGSR"
     gene            complement(<766283..>766621)
                     /locus_tag="AGOS_ABR191C"
                     /old_locus_tag="ABR191C"
                     /db_xref="GeneID:4619249"
     mRNA            complement(<766283..>766621)
                     /locus_tag="AGOS_ABR191C"
                     /old_locus_tag="ABR191C"
                     /product="ABR191Cp"
                     /transcript_id="NM_208492.1"
                     /db_xref="GeneID:4619249"
     CDS             complement(766283..766621)
                     /locus_tag="AGOS_ABR191C"
                     /old_locus_tag="ABR191C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL098C (MGR2)"
                     /codon_start=1
                     /product="ABR191Cp"
                     /protein_id="NP_983139.1"
                     /db_xref="GeneID:4619249"
                     /translation="MPPVPASSYAHQQPSNWEKFKMGLMMGTTVGICTGILFGGFSIL
                     TQGPGPNGVIRSLGQYIAVSSATFGLFMSIGSVIRSDSQLLHPASQLQQEARMHAWKL
                     RAQYGLYRRD"
     gene            <766801..>768186
                     /locus_tag="AGOS_ABR192W"
                     /old_locus_tag="ABR192W"
                     /db_xref="GeneID:4619250"
     mRNA            <766801..>768186
                     /locus_tag="AGOS_ABR192W"
                     /old_locus_tag="ABR192W"
                     /product="ABR192Wp"
                     /transcript_id="NM_208493.2"
                     /db_xref="GeneID:4619250"
     CDS             766801..768186
                     /locus_tag="AGOS_ABR192W"
                     /old_locus_tag="ABR192W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL097W (MSY1)"
                     /codon_start=1
                     /product="ABR192Wp"
                     /protein_id="NP_983140.2"
                     /db_xref="GeneID:4619250"
                     /translation="MSCFMRTMRPWLHGGTRQRWFSTGSGTVLDELRARGLVQQISEP
                     VDALVQQLREGKRPRLYCGADPTASSLHLGNLMPLMVLLHCYVRGHDVVALIGGATGM
                     VGDPSGRSTERTALADATRLENVRRISGQFKRFFENGREYHGSRVAPAQSGHAVVVNN
                     VEWWKDMGLLDFLARYGRHIRVQNMLGRDSVSARLSSGSGMGFNEFSYQILQAYDFYH
                     LHTHHGVAIQVGGGDQWGNITAGIDLIGRLSPGAAANPAFGVTVPLLLTASGAKFGKS
                     AGNAVFVDPVITPSYQLYQFFVNTSDADVARFLRLFTMLPLSAIDEAVAAHTVAPQRR
                     LAQRLLAREVVDLLHGLGHGKDAETVSDVLFGGARVDLPAGELLRLFTDAGILREAPR
                     SASLVDLMCLATGSSRAEARRKLVQGAVYLGPDRSRPAQDIADLSPHMIEDRVLLLRI
                     GKQQCYVFHIQ"
     gene            complement(<768226..>768441)
                     /locus_tag="AGOS_ABR192CA"
                     /old_locus_tag="ABR192C-A"
                     /db_xref="GeneID:4619251"
     mRNA            complement(<768226..>768441)
                     /locus_tag="AGOS_ABR192CA"
                     /old_locus_tag="ABR192C-A"
                     /product="ABR192C-Ap"
                     /transcript_id="NM_208494.1"
                     /db_xref="GeneID:4619251"
     CDS             complement(768226..768441)
                     /locus_tag="AGOS_ABR192CA"
                     /old_locus_tag="ABR192C-A"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL096C-A (ERI1)"
                     /codon_start=1
                     /product="ABR192C-Ap"
                     /protein_id="NP_983141.1"
                     /db_xref="GeneID:4619251"
                     /translation="MNDKVAATLVLVVTYSIVGASLWCLTYAWHDETKLYYWCIVQLL
                     PVMLWVWCVISWCGAQLFGYAKRGKAD"
     gene            <768570..>769622
                     /locus_tag="AGOS_ABR193W"
                     /old_locus_tag="ABR193W"
                     /db_xref="GeneID:4619252"
     mRNA            <768570..>769622
                     /locus_tag="AGOS_ABR193W"
                     /old_locus_tag="ABR193W"
                     /product="ABR193Wp"
                     /transcript_id="NM_208495.1"
                     /db_xref="GeneID:4619252"
     CDS             768570..769622
                     /locus_tag="AGOS_ABR193W"
                     /old_locus_tag="ABR193W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL096W (PNG1)"
                     /codon_start=1
                     /product="ABR193Wp"
                     /protein_id="NP_983142.1"
                     /db_xref="GeneID:4619252"
                     /translation="MRVSEDTSTKEVFERVAADFLQLYKRCVLAQTREVRSSDRERCE
                     ELVRRNALARELCKLHQTLCFVYENDALYGIVLDALDLEGIYGRVEEGPGADDYQDRL
                     VQELLRYFKDEFFTWCDKPLCARCGTAKKQAAVGHGKPTVEEARYRCTVVELFRCEDC
                     GDVARFPRYNDPLKLLETRTGRCGEWCNLFMLILRSFGIEARYTWNREDHVWCEVYSN
                     ALKRWVHVDSCEKSFDEPHIYSVNWNKAMSYVIAFSNRSVKDVSRRYIVRNRLPRDQI
                     DEDDLQFLTKYLTKLLRLQLPDEERYLLHCRDELEAIDLLGSKTAPMEIPPAAGAAGR
                     QSGSADWKRQRGEDGR"
     gene            complement(<769690..>771042)
                     /locus_tag="AGOS_ABR194C"
                     /old_locus_tag="ABR194C"
                     /db_xref="GeneID:4619253"
     mRNA            complement(<769690..>771042)
                     /locus_tag="AGOS_ABR194C"
                     /old_locus_tag="ABR194C"
                     /product="ABR194Cp"
                     /transcript_id="NM_208496.1"
                     /db_xref="GeneID:4619253"
     CDS             complement(769690..771042)
                     /locus_tag="AGOS_ABR194C"
                     /old_locus_tag="ABR194C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR177C (EHT1) and YPL095C (EEB1)"
                     /codon_start=1
                     /product="ABR194Cp"
                     /protein_id="NP_983143.1"
                     /db_xref="GeneID:4619253"
                     /translation="MGLPTFAPRSWGYRGTITHRPHEEGLVKLPLKDKEKEPVTLSDL
                     LNEHVPELKDGARFYLHPYLYNGILQTMYLYGADFSQQYKPFYGREIVSYSDGGVSTA
                     DWAMREWDDLYAAPEGYNKEKFDADAAKTHPENWPRLQPNTRFLDEEELAKIPKDTRP
                     LIVVAHGLAGGSHENIIRALVTELLSVGNGQFNVVVLNSRGCARSKIANKKLFSAFHT
                     MDIREFINREHARQPERKIYGLGFSFGSVIFGNYLGEEGDKSPLSGAVCCAGPWDMFA
                     SSKMLNDDFWISRLFGKNLVKHLSRLLHVNRKELEYDGSKGDDVEDASPTNPASHIFT
                     KENLARASTMACTRDFDNFFTAPALGFKNANDYYKAASPVNIVGKIRVPTLLINALDD
                     PMVGAEGFLPIEKLRSNKHILLCTTDIGGHLAYLDKNYTPWMAGRVAEFLSKMDTLVA
                     "
     gene            complement(<771315..>773741)
                     /locus_tag="AGOS_ABR195C"
                     /old_locus_tag="ABR195C"
                     /db_xref="GeneID:4619254"
     mRNA            complement(<771315..>773741)
                     /locus_tag="AGOS_ABR195C"
                     /old_locus_tag="ABR195C"
                     /product="ABR195Cp"
                     /transcript_id="NM_208497.2"
                     /db_xref="GeneID:4619254"
     CDS             complement(771315..773741)
                     /locus_tag="AGOS_ABR195C"
                     /old_locus_tag="ABR195C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR179C (FZO1)"
                     /codon_start=1
                     /product="ABR195Cp"
                     /protein_id="NP_983144.2"
                     /db_xref="GeneID:4619254"
                     /translation="MSEDKRNGKDAPWELSYGRDGAGFNGDDLDKFLEHGSKAARRAS
                     NEQLVSSHLSQWNYNQNRGALMQGIEEASELVSDLVRENDERPMHVPDNDLQILQVSL
                     RLDGNWKDDLTLDKEALAQIFKTRATSALEHLAKLLVRVQDTSSKVFITGDLNAGKST
                     LCNALLRKRLLPEDQLPCTNVFCEILEARENENVEQVHAIPVSIAATVKEAYDAYNIL
                     DQTTYQVFPLEKLNSLVHKNTEYSLLKIYIRDDQRPAESSLLRNGTADIALIDSPGLN
                     MDSVQTTEVMSRQEEIDLVIFVVNAENQLTLSGKEFISTASKEKKLMFFVVNKFDHIK
                     DKQRCKKLILDQIKEISPETYKQSTEFVHFISSEGVFIDDSNGNPDGSDPDDNDNDNE
                     NRHEPDPDFDGLENSLRNFVLKKRSLSKLLPAKTYLMKLLYDIEKISLWNVHVYKEEE
                     NQLTSELEELAPVINGTRTHCSKLTEAVDRKTDELVNDVYDFTKRRILSSLEVTHSDF
                     PRYDGLSNIHDYIFRARQYIIDQIKSSVVSSELYARNSTQQVVNEINELAKNELGNDF
                     MSDRVFQSDLMFSRKKHSLGKKLSVPFNVQDLWAPSWDGFLSYVTCGFQVWNSGVSTE
                     PVKSHELTDRLGLSTYSINKYWTSPSLLLTSRIPALAVYSYGGVKLVTNLLLYGTRFF
                     SWQSLRKISTSLLLVGSALGAAYIISDLPRALPINLSNNYRKKLHDLDYIHANADRIS
                     KEVREVLKIPTREVVKSCELVLDKKQEQKRKLEVKMQNNALSVDFFHRLAQRASVHRG
                     MVEEINLEVD"
     STS             772563..772586
                     /standard_name="PMC151488P1"
                     /db_xref="UniSTS:271146"
     gene            complement(<774011..>774745)
                     /locus_tag="AGOS_ABR196C"
                     /old_locus_tag="ABR196C"
                     /db_xref="GeneID:4619255"
     mRNA            complement(<774011..>774745)
                     /locus_tag="AGOS_ABR196C"
                     /old_locus_tag="ABR196C"
                     /product="ABR196Cp"
                     /transcript_id="NM_208498.2"
                     /db_xref="GeneID:4619255"
     CDS             complement(774011..774745)
                     /locus_tag="AGOS_ABR196C"
                     /old_locus_tag="ABR196C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL094C (SEC62); Newly annotated start codon according to
                     sequence correction 75bp upstream of original start
                     codon."
                     /codon_start=1
                     /product="ABR196Cp"
                     /protein_id="NP_983145.2"
                     /db_xref="GeneID:4619255"
                     /translation="MSDPESPLWVATLLRHHKELKQRQGMFQSRHMEFFRFKRFVRAL
                     NSDEYRAKSEREPEKYPPVRSEEDARDVFVSLIKAQLVLPCTKLHTAQCREHGLAPSK
                     DYPHLLLSTKATLDADEYYVWTHNPKTLTDYLTVVGVIVGILAFVCYPLWPHSMKRVV
                     YYLSLGLLGLLAVFSALALVRFVIYVLSLAFCSERGGFWIFPNLFEDCGVIASFKPLY
                     GFGETECYGYIKKQKRRKRKLEKKKQ"
     gene            <775206..>776612
                     /locus_tag="AGOS_ABR197W"
                     /old_locus_tag="ABR197W"
                     /db_xref="GeneID:4619256"
     mRNA            <775206..>776612
                     /locus_tag="AGOS_ABR197W"
                     /old_locus_tag="ABR197W"
                     /product="ABR197Wp"
                     /transcript_id="NM_208499.2"
                     /db_xref="GeneID:4619256"
     CDS             775206..776612
                     /locus_tag="AGOS_ABR197W"
                     /old_locus_tag="ABR197W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR229W (IVY1)"
                     /codon_start=1
                     /product="ABR197Wp"
                     /protein_id="NP_983146.2"
                     /db_xref="GeneID:4619256"
                     /translation="MGSPTRYAPHLSEFYSIVNQDAQDGRQAALPQDDTGHEQALGLN
                     KQANRSDVRRSMSLAESADSFAQLRRPSSIRSTTTSITDLQTLITKKDMVQTHDAMTQ
                     LVREMSEYALSLVSNATKASSVAFALENMAHLKGCNDGSADKFLNASGVFHLLSNHDR
                     IIANLVTETLAPSLRDRIGAFGASFKTSELSFKKRLKEETFKLKLQEGYNIKLSKRKN
                     RNLFSYRENLMNMQQQLDSIEALKHDYYQESYDLVEAFCQEVLKDIATLTRAQVEISE
                     NLARKGWSGGGLDDLIVSADDPFSKNRSEEEESYQETQDSLEGYTGGVDSPEPHRSAT
                     PVTGGTGAGSNKNEDTIRSASMGTNDRISDRHASPVPSTGTITVAHSSPTDINYVGFH
                     RNHSDASVMVDYSFSLPLAGSKNHIHEIKSSSGTQQNYTSEADSPRSPVPDNTSEDIL
                     EAVSAASNLNIRHVGNDD"
     gene            complement(<776840..>777886)
                     /locus_tag="AGOS_ABR198C"
                     /old_locus_tag="ABR198C"
                     /db_xref="GeneID:4619257"
     mRNA            complement(<776840..>777886)
                     /locus_tag="AGOS_ABR198C"
                     /old_locus_tag="ABR198C"
                     /product="ABR198Cp"
                     /transcript_id="NM_208500.1"
                     /db_xref="GeneID:4619257"
     CDS             complement(776840..777886)
                     /locus_tag="AGOS_ABR198C"
                     /old_locus_tag="ABR198C"
                     /note="NOHBY216; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0C14993g"
                     /codon_start=1
                     /product="ABR198Cp"
                     /protein_id="NP_983147.1"
                     /db_xref="GeneID:4619257"
                     /translation="MAYRGWVPGSDSMRSDSLHSLFSTVKPRMPVFFISHGAPTFMYP
                     DEKFCADPGAYRATQNLGKYIREVIKPNFILVVSAHWQSNKPGTVKIAIPTALRLWQQ
                     QGSVPFQDGESDVTKGHPLENELIYDFYGFSTRMYEEEFHSKSSMALATDIADTINHV
                     RSPLCAVLTERGIDHGVWVPLKVAFSASKCVDDDWDVPVPLVQISLAAGNDLRDQYAL
                     GRLLSRYRDLGGLIITSGMAVHNLRDLFCGSAIAKSHSRSSAFHWALSNVLLTTPPNA
                     CKFGRLLRLFSSAEGRELLQAAHPTLEHFLPIIVGLGAGEGLDGPDKYTIRELYQNDA
                     PSLGWSIYQYGTYS"
     gene            complement(<778197..>778781)
                     /locus_tag="AGOS_ABR199C"
                     /old_locus_tag="ABR199C"
                     /db_xref="GeneID:4619258"
     mRNA            complement(<778197..>778781)
                     /locus_tag="AGOS_ABR199C"
                     /old_locus_tag="ABR199C"
                     /product="ABR199Cp"
                     /transcript_id="NM_208501.1"
                     /db_xref="GeneID:4619258"
     CDS             complement(778197..778781)
                     /locus_tag="AGOS_ABR199C"
                     /old_locus_tag="ABR199C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR231C (COX20)"
                     /codon_start=1
                     /product="ABR199Cp"
                     /protein_id="NP_983148.1"
                     /db_xref="GeneID:4619258"
                     /translation="MAWWPFSRNNKPGVPEQDQVAAAPVQQRPAEPLPTNYTPGQRLL
                     LEDTRPRFDTQSSASQQAVQRERATLADAWKTVRWEDFSLERMAGIPCFRDAGMAGFS
                     AMVVAGSVTFLFHKNPVRAANWGVGGLLLGSIVGWEQCRMQRRRSFQVAEMARQTVAA
                     KEAPMLRKPDNAQKAGAVSQASELPPKKPWYRFW"
     gene            <779297..>780910
                     /locus_tag="AGOS_ABR200W"
                     /old_locus_tag="ABR200W"
                     /db_xref="GeneID:4619259"
     mRNA            <779297..>780910
                     /locus_tag="AGOS_ABR200W"
                     /old_locus_tag="ABR200W"
                     /product="ABR200Wp"
                     /transcript_id="NM_208502.2"
                     /db_xref="GeneID:4619259"
     CDS             779297..780910
                     /locus_tag="AGOS_ABR200W"
                     /old_locus_tag="ABR200W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL203C (ACK1)"
                     /codon_start=1
                     /product="ABR200Wp"
                     /protein_id="NP_983149.1"
                     /db_xref="GeneID:4619259"
                     /translation="MAMGREQLYDGHINMYPHTEQQSKRKSVVFNGKGEVVNDGGYAP
                     YPVEEMPVRMGTGFLPPQRPALESRTGSMDSGVLKPSIYLQPGQHKSSPGLPTENRPT
                     TWYASPTKSSLDGGSPSSTASRERAHKARNRPLPEFSKDALYFYKIFEKTISDSGTFT
                     PSVQMKWCETLLEYAFKPDFIAHYSINAEKLKRELTPEEQQKNKTTLLEHALKVLSKL
                     MRMKYAPALYLMGTLYSQQPYLRVDHDGIVSKNDQKALEYYKSAAKLKNADGCYRAGV
                     SYEYNRGMPANISRRDRLLTAVSFYEKGAACADASSGQSSSMYKLGMFQLNGLVDDDT
                     GEIIVEQDVISAIRWFERAAAHDKTVSPQALYELAKIYEFDCLHPQLQQAVKLQHVPQ
                     DTLKALDLYIRCAIKFNYPLAQWKLGHCYEYAELHLPYSPEKSIVWYLKAANAAPKGN
                     AMAMLALSGWYLTGVKGVLEPNASESYKWAYKASIASEGRLPKAEYALGFYTEHAVGC
                     HPDMHRAMDHYRRAAELGHQKAVERLSNI"
     gene            <781235..>781861
                     /locus_tag="AGOS_ABR201W"
                     /old_locus_tag="ABR201W"
                     /db_xref="GeneID:4619260"
     mRNA            join(<781235..781493,781534..781724,781775..>781861)
                     /locus_tag="AGOS_ABR201W"
                     /old_locus_tag="ABR201W"
                     /product="ABR201Wp"
                     /transcript_id="NM_208503.2"
                     /db_xref="GeneID:4619260"
     CDS             join(781235..781493,781534..781724,781775..781861)
                     /locus_tag="AGOS_ABR201W"
                     /old_locus_tag="ABR201W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML036W (CGI121); 2-intron"
                     /codon_start=1
                     /product="ABR201Wp"
                     /protein_id="NP_983150.2"
                     /db_xref="GeneID:4619260"
                     /translation="MLTTTIPQFPDTKLYISLFRNVSNAPEIVDSLAELPYSIIDART
                     LLSREQLLSAVYRAMLEKHCNKLRTRNLHTEVLLCLSPTSNVMSQIGDAMKRFGIKKD
                     STSVVLVKAVTGDETFDPKGFSEVIRGEELEFSDTALRESADIDTIRENYKLKCFECE
                     RLEELSAALVHAIQLRGL"
     gene            complement(<781847..>782803)
                     /locus_tag="AGOS_ABR202C"
                     /old_locus_tag="ABR202C"
                     /db_xref="GeneID:4619261"
     mRNA            complement(<781847..>782803)
                     /locus_tag="AGOS_ABR202C"
                     /old_locus_tag="ABR202C"
                     /product="ABR202Cp"
                     /transcript_id="NM_208504.1"
                     /db_xref="GeneID:4619261"
     CDS             complement(781847..782803)
                     /locus_tag="AGOS_ABR202C"
                     /old_locus_tag="ABR202C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR460W (TFB3)"
                     /codon_start=1
                     /product="ABR202Cp"
                     /protein_id="NP_983151.1"
                     /db_xref="GeneID:4619261"
                     /translation="MDDDEKKDMCPICKTDRYLSPDMKFLVNPECYHKICESCVDRIF
                     SLGPAQCPYEGCDKILRKNKFKTQIFADVDVEREVDIRKRVFNVFNKTIEDFDGDTAA
                     YDQYLEEVEDIVYGLDNGIDVAKNEEKLRTYEELNKQLILANMERNKQTLENFEQRQK
                     FEKEIKLKKRQLEKQIEDEERANREWVKWEIVNQLTTSEDAEQVIENVKKTVKLKKSS
                     ARRKLEELNKVLRNNPYMTISNGRMKKQEHVPFTPFNGDRDRHKRYVIDEESYHDPVV
                     KELQTKKEYIASGFRAEYVYNRVLTEAFMGLGCIIQDELQPS"
     gene            <782954..>784033
                     /locus_tag="AGOS_ABR203W"
                     /old_locus_tag="ABR203W"
                     /db_xref="GeneID:4619262"
     mRNA            <782954..>784033
                     /locus_tag="AGOS_ABR203W"
                     /old_locus_tag="ABR203W"
                     /product="ABR203Wp"
                     /transcript_id="NM_208505.2"
                     /db_xref="GeneID:4619262"
     CDS             782954..784033
                     /locus_tag="AGOS_ABR203W"
                     /old_locus_tag="ABR203W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR459C (PFA5)"
                     /codon_start=1
                     /product="ABR203Wp"
                     /protein_id="NP_983152.2"
                     /db_xref="GeneID:4619262"
                     /translation="MWQCKNKSRWWYSLVPILCICIMCYGAIAYSYSFCYVEVWTHLG
                     MKAAAIGMTCLHLIIVILLWIIWAQIIMMGPGRQPRVAPFMILPEMADAGERAKEGAA
                     TSVLPPDVYQCDTQGYPVWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRR
                     NYRLFNQFLMCFLMHALIIFVSVVSLQRRIASSARMRGEREDPNVLVVLSLSCLVLLM
                     VGALFISFLNYMANNQTTIEKLYTPKRQPRTMCFCVYNPADQYRYVVKSLPHENWNMW
                     DKGSAYANYKDFLGSSIWRWFIPIGSNIPEFQTSAWEDDYNAILGPYKEELGSHYRDI
                     LMQRIEQGKYVTRLRVYGDKFREGL"
     STS             783242..784642
                     /standard_name="D1S3694"
                     /db_xref="UniSTS:474272"
     gene            complement(<784184..>786499)
                     /locus_tag="AGOS_ABR204C"
                     /old_locus_tag="ABR204C"
                     /db_xref="GeneID:4619263"
     mRNA            complement(<784184..>786499)
                     /locus_tag="AGOS_ABR204C"
                     /old_locus_tag="ABR204C"
                     /product="ABR204Cp"
                     /transcript_id="NM_208506.2"
                     /db_xref="GeneID:4619263"
     CDS             complement(784184..786499)
                     /locus_tag="AGOS_ABR204C"
                     /old_locus_tag="ABR204C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML035C (AMD1)"
                     /codon_start=1
                     /product="ABR204Cp"
                     /protein_id="NP_983153.1"
                     /db_xref="GeneID:4619263"
                     /translation="MMEGQGYEKECLAPHLESPVDGNPRDMHKHSAGSTEDEDISRRS
                     SPEYDGVEVHSVNTNFSYHEEKLMLEHSTKMNALEQGLAPHITQSPQPSRFQAEGGAA
                     ERRLSASAQASLPEPPSMKFLGKSHAPEDDQTSYKMGQVAGDLPQYFGAPSQELVELY
                     TKVQECRNLRARYQGLSMQRHGQNPKNRQEWEIYPPPPKPSYNSETKTVLKVTNQPDC
                     EVFDFTQCEIPGEDTEWEFTANSDDVFAVHRATEDGEPQLIADVPSLRDYYVDLEKLV
                     AISSDGPAKSFAFRRLQYLEARWNLYSLLNEYQETAISKKNPHRDFYNVRKVDTHVHH
                     SACMNQKHLLRFIKYKLRTAANEEVIFRDGKVLTLSEVFQSLKLTGYDLSIDTLDMHA
                     HKDTFHRFDKFNLKYNPIGESRLREIFLKTDNYIKGSYLAAITKQVISDLENSKYQNC
                     EYRISIYGRSIDEWDKLAAWVIDNKILSHNVRWLIQVPRLYDIYKKTGTVKTFNDILV
                     NLFQPLFEVTKNPQSHPKLHIFLQRVIGFDSVDDESKIDRRFHRKFPKSSLWESSQNP
                     PYSYYLYYLYSNMSYLNQWRSRRGFNTLVLRPHCGEAGDPEHLISAYLLSQGISHGIL
                     LRKLPFVQYLYYLDQIGIAMSPLSNNALFLTYDKNPFPYYFRRGLNVSLSTDDPLQFS
                     YTREPLIEEYSVAAQIYKLSNVDMCELARNSVLQSGWEAQIKRHWIGKDFEKAGIDGN
                     DVEKTNVPNIRINYRYETLSTELELVEHYAK"
     gene            complement(<786648..>787451)
                     /locus_tag="AGOS_ABR205C"
                     /old_locus_tag="ABR205C"
                     /db_xref="GeneID:4619264"
     mRNA            complement(<786648..>787451)
                     /locus_tag="AGOS_ABR205C"
                     /old_locus_tag="ABR205C"
                     /product="ABR205Cp"
                     /transcript_id="NM_208507.2"
                     /db_xref="GeneID:4619264"
     CDS             complement(786648..787451)
                     /locus_tag="AGOS_ABR205C"
                     /old_locus_tag="ABR205C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR167W (THP2)"
                     /codon_start=1
                     /product="ABR205Cp"
                     /protein_id="NP_983154.2"
                     /db_xref="GeneID:4619264"
                     /translation="MTTRYMDLLSEQQGQLDENYRNAMGVLDALETLAAPEQHKEEQV
                     AALHALKAQSEPLLRSLVMLRVNNVNCVEAYATRAKIGPASDVAKSKLHASAGDNSAG
                     NVLGLVARVRELQMTWLQHLQLVNQLSVELAYPLGRRGSEHVTVNREGPPPELVAALA
                     AYDAGPDAPAAAELRAELLRYLDDIKATRARYLLENKYLLADSLRQLTRDVSSWSQKW
                     ESLEGTLFGDAPSSLRSLLRSVDTTKATITQKVAAPDPAAPSSSTIQPT"
     gene            <787639..>789483
                     /locus_tag="AGOS_ABR206W"
                     /old_locus_tag="ABR206W"
                     /db_xref="GeneID:4619265"
     mRNA            <787639..>789483
                     /locus_tag="AGOS_ABR206W"
                     /old_locus_tag="ABR206W"
                     /product="ABR206Wp"
                     /transcript_id="NM_208508.2"
                     /db_xref="GeneID:4619265"
     CDS             787639..789483
                     /locus_tag="AGOS_ABR206W"
                     /old_locus_tag="ABR206W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR166C (CDC23)"
                     /codon_start=1
                     /product="ABR206Wp"
                     /protein_id="NP_983155.2"
                     /db_xref="GeneID:4619265"
                     /translation="MEPLIEIRSRLRKSSQDLLQLKLYQSARWSSEALIGMCEGGVED
                     TTADEGSPLRNRRGKGDTGIQVSMDSEPFGERQYDLFLLASSLFDCKEYDRCAYFLRN
                     EKHPRLKFLRLYSRFMSWDKKTQESSSDVLTKPADIAQKDPGVGTNVVDWIDERNVDT
                     RKEANIQSQMVVDLGTGEKISITLILRELELYLVEQLANSKEPADVGYALLYYLRGIL
                     EKKQGLASEAIKSFVRSLELYPYNWTCWCELATCITRTDESLLLVKHLRDLFPANGER
                     GDNAVMLRFFKISIFKDFGGDFDHFMDELDYLMGLFPNFSFLKSELALLNYHYMDYVN
                     AELIFDEIVKLDPYRLDDLDIYSNILYVIQKPHKLAYLSQFAADLDAYRPETCCIIAN
                     YFSAKQQHEKAIMYFRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPC
                     DFKAWYGLGQAYEVLDRHLYALYYLQKACSLKPLDKRMWQALANCYDKLDRPNQAIKC
                     FQRASQLSNDQDITILYYLATLYERVQDAISCKNYMLKCIEVESANQGIILDECAKAR
                     LWLARHEVKHRNFPAAYNYASGVTHGTSQEIEAARVIARECRKRMEYQ"
     gene            <789754..>796962
                     /locus_tag="AGOS_ABR207W"
                     /old_locus_tag="ABR207W"
                     /db_xref="GeneID:4619266"
     mRNA            <789754..>796962
                     /locus_tag="AGOS_ABR207W"
                     /old_locus_tag="ABR207W"
                     /product="ABR207Wp"
                     /transcript_id="NM_208509.2"
                     /db_xref="GeneID:4619266"
     CDS             789754..796962
                     /locus_tag="AGOS_ABR207W"
                     /old_locus_tag="ABR207W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR165C (PRP8)"
                     /codon_start=1
                     /product="ABR207Wp"
                     /protein_id="NP_983156.2"
                     /db_xref="GeneID:4619266"
                     /translation="MSGLPPPPPPPPGFRRNNKSGASSGDAPPPPPPPPPGMHRTYSG
                     YPSVPPPPPPPPPPPMSLEEGPPQKKNKVEPMHQIFAELPSRELLTRKKEWLALQKQR
                     FSGQRRKGKEKKKRGGVSHAQKVDLPPEHLRQIISDHSDMSSRRFNYDKRAFLGALKY
                     LPHAVLKLLENMPQPWEQTKEVKVLYHNTGAITFVNEIPRVIEPVYIAQWSTMWIAMR
                     REKRDRKHFKRMRFPPFDDEEPPLSYPDHVEEIEPLDAIALDLDEDEDKYVKDWLYRT
                     RPLENSVGMVNGPSYKSWRLNNKVMSNLHRLSAPLLTDVTDNNYYYLFDKKAFFTAKA
                     LNNAIPGGPKFEPLYPHEEEEDYNEFNSIDRIIFRIPIRTEYRIAFPHLYNPRPRSVE
                     ISWYHDPVSCLLPEDDDDAMPAFHFSSQFSPIINQGFKHAKTDYEMSASKHEFSLPAD
                     FAPLLDSEELEPEGTKDSISLYHAPYPFNRRSGRMVRAQDVALIKKWYLQHPDSEYPI
                     KVRVSYQKLLKNYVLNELHTQRPSKQKKVKLLKSLKNTKYFQQTTIDWVEAGLQICRQ
                     GFNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRFGNSFHLMREILKVVKLL
                     VDAHVQYRLGNVDSFQLADGIYYILNHLGQLTGIYRYKYRVMHQIRACKDLKHVVYYR
                     FNKIIGKGPGCGFWQPAWRVWIFFMRGIIPLLERWLGNLLSRQFEGRSTEIVKTTTKQ
                     RVDAYYDLELRASVMNDILDMIPEGMKKSKAHTILQHLSEAWRCWKANIPWDVPGMPL
                     PIKNIIERYVKAKADGWVSSAHFNRERIKSGVHVEKVVVKKNLGRLTRLWIKNEQERQ
                     QQIEKNGPEVTPAEATAVFSCMVDWLESRNFTPIPFPPLTYKNDTKILVLALENLKDA
                     YTAKVRLNASEREELALIEEAYDNPHDTLNRIKKYLLTQRIFNSVELSMLDHYQYITP
                     VYTVDPLEKITDAYLDQYLWYEADKRQLFPNWVKPSDSEIAPLLVYKWCQGINNLKEV
                     WDVSRSQSTVMLQTSLENLAEKMDFTLVNRLLRLVMDPNLADYITAKNNVSITFKDMS
                     HVNKYGLIRGLQFASFVYQYYGLMMDLLILGPERAHELAGPPDAPNEFLQFKNLQTET
                     KNPIRLYSRYLDKVHILFHFEENEAEELIEDYLSENPDPNFESAVGYNNKKCWPRDSR
                     MRLIRQDVNLGRAVFWEIENRVPPSFADILWENTLSSVYSKNNPNLLFTMCGFEVRIL
                     PRFRMEEVMSSSEGVWDLVDVVTKERTAKAYLKVSDTEISNFESNIRGIMLSSGSTTF
                     TKIASKWNTALIGLFTYFREAIVSTDRLLDILVKCETRVQNRVKLGLNSKMPTRFPPA
                     VFYTPKELGGLGMLSASHILIPASDLSWSKQTDTGITHFRAGLTHEDEKLIPTIFRYI
                     TTWENEFLDSQRVWADYLAKRKEAMQENRRLAFEELEGSWERGIPRISTLFQKDRHTL
                     AYDKGHRIRKEFKQYSLERFNSFWWTNGRHDGKLWNLNAYRADVIQALGGIETILEHT
                     LFKGTGFSSWEGLFWEKASGFEDSLQFKKLTHAQRTGLSQIPNRRFTLWWSPTINRAN
                     VYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESIVFDICQILDGEMDVL
                     QIESVNKEAIHPRKSYKMNSSAADVTLSSVYKWELSKPTLLHQTNDTFDFTSSSKMWI
                     DVQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSPTGIMVGIDLAYNMYDAYGYWFD
                     GMKPLLQNSMKTIMKANPSLYVLRERIRKGLQIYQSQTQEPFLNSSNYAELFSDETKF
                     FVDDTNVYRVTVHRTYEGNVATKPINGCVFILNPKTGQLYLKIIHTSVWAGQKRLSQL
                     AKWKTAEEMTALVKSLPKEEQPKQIIVTRKAMMDPLEVHMLDFPNISIRPTELRLPFS
                     AVLSIEKLNDVVMKATEPQMVLFNIFDDWLERVSPFTAFSRLILLLRALKANEEKAQM
                     IIKADPTIPFKSHHLWPSFTDQQWIEVELKMRDLILSEYAKKYNVDISVLTQSEIKDI
                     ILGQNIRAPSVKRQQMAEIEGSAATGANAETPSVANAMKVTSVNAQGEEITVVTSANY
                     ETQAFSSKNEWRKRAVASSLLYLRLKNIYVSSEDFIEEKSIIVLPRNLLKKFVGIADV
                     KIQIAGFLYGQSPPEHPNIKEIRKIVLCPQLGSNQTVQLSNLPGQSEYLEDLELLGWI
                     NTFAQDKKYMLPADITTHVRTFGRANTEVINLTVGLIPGAISLSAFTVTKEGLDWGME
                     NKDIFDPSPEGFDPSFSEHAQLLLSERIMGNFLVPKSGIWNYAFMGAGFNRELRYELS
                     LDIPLGFYDEQHRATHFLQFNEVAADDTLEAEQEDLFS"
     gene            <797119..>798474
                     /locus_tag="AGOS_ABR208W"
                     /old_locus_tag="ABR208W"
                     /db_xref="GeneID:4619267"
     mRNA            <797119..>798474
                     /locus_tag="AGOS_ABR208W"
                     /old_locus_tag="ABR208W"
                     /product="ABR208Wp"
                     /transcript_id="NM_208510.1"
                     /db_xref="GeneID:4619267"
     CDS             797119..798474
                     /locus_tag="AGOS_ABR208W"
                     /old_locus_tag="ABR208W"
                     /note="NOHBY217; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0A05302g"
                     /codon_start=1
                     /product="ABR208Wp"
                     /protein_id="NP_983157.1"
                     /db_xref="GeneID:4619267"
                     /translation="MILFIGDDFSLYNAHYRRPSMQHQAEADGNVEPRQAGLNSSTYG
                     TSQDMCFEHQSDVSAKIAVKMEALMRSVEEKKRIIDARQEKLLQAHDYVLDLLRLGYT
                     FTQIKNEGAIHEEFLTELFELLNIPITEKYTPDPHAVPENAAVRPCMARTFSNCDLSV
                     ADGTFATDHREVPVKDDLKNPDQNDTGTASTQQLQDNEDYASLSSDVSKSSQSLCTSM
                     RSQSASDSMMNSLTNQFREPQNSPVSSDRAAFELHRVLTKFQIDLRCVKILASGETSM
                     PSAELRQRIGMRYQDILLQLDGILDQLGILASPGGKAGTRAQVTPAANILLKDVEKVN
                     PAPAVPARSIVGKSKKTLHGAISHQGTANRSPQSHIRLPDKEEPRQDLIEDSFVRIKK
                     HKPQMFTPYQSLLSSYTQFIPVPFATGTEDMLCPVETLNGGCEDPKCPYTHFQGLTAK
                     D"
     gene            <798762..>800267
                     /locus_tag="AGOS_ABR209W"
                     /old_locus_tag="ABR209W"
                     /db_xref="GeneID:4619268"
     mRNA            <798762..>800267
                     /locus_tag="AGOS_ABR209W"
                     /old_locus_tag="ABR209W"
                     /product="ABR209Wp"
                     /transcript_id="NM_208511.2"
                     /db_xref="GeneID:4619268"
     CDS             798762..800267
                     /locus_tag="AGOS_ABR209W"
                     /old_locus_tag="ABR209W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER090W (TRP2)"
                     /codon_start=1
                     /product="ABR209Wp"
                     /protein_id="NP_983158.1"
                     /db_xref="GeneID:4619268"
                     /translation="MTVTIEPGLEALERCIADNGPDVTLYPLYTYVSAEETTPHAAYL
                     KLARLDQNDHVPSFLLESAKTMDAMARFSYMGVAPRRVLRTNAGAGDPLKLLAAEFAR
                     LRPARNTPQLPGLSGGAVGYVSYDCVRYFEPRTARELADPLELPEAALMLFDTVVAYD
                     HVFHRFQVVHNMQLEPGIDLNAAYEDATRAIRDVVDRLTASTPVPQPPQPPIRRGQEF
                     SSNVGQQGYEEYVRRLKEHIYAGDIIQAVPSQRVARPTSLHPFNIYRQLRMVNPSPYM
                     FYLDYGDFQVVGASPELLCKVDEERQVVTHPIAGTIRRGVTQQEDDALAAELRNSVKD
                     RAEHVMLVDLARNDINRVCDPLTTRVDKLMTVQRFSHVQHLVSEVTGTLRPDKDRFDA
                     FRSVFPAGTVSGAPKVRAMELIGELEGERRGVYAGAVGHWSYDGVSMDTCIALRTMVY
                     KGGVAYLQAGGGIVHDSDPYDEYVETMNKMLANHNTILQAEELWAEKIGSE"
     gene            <800416..>801042
                     /locus_tag="AGOS_ABR210W"
                     /old_locus_tag="ABR210W"
                     /db_xref="GeneID:4619269"
     mRNA            <800416..>801042
                     /locus_tag="AGOS_ABR210W"
                     /old_locus_tag="ABR210W"
                     /product="ABR210Wp"
                     /transcript_id="NM_208512.1"
                     /db_xref="GeneID:4619269"
     CDS             800416..801042
                     /locus_tag="AGOS_ABR210W"
                     /old_locus_tag="ABR210W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL057C (PTH2)"
                     /codon_start=1
                     /product="ABR210Wp"
                     /protein_id="NP_983159.1"
                     /db_xref="GeneID:4619269"
                     /translation="MAGINLPFILSVTMASLATGYYLGQIYGGATHACLSELNAQAVL
                     KQVKDRAESASRDAEELDSTYEDDSDEEVVEVSSLPLNDIPGEVRMALVIRQDLGMTK
                     GKIAAQCCHAALACYRLMAEDVTRVSYNRDMVMRWLQRGQAKITLKCPDKETMDELFA
                     KAMALGVNCHVVHDAGRTQIAAGSATVLGLGPAPKAVLDEITGELKLY"
     gene            complement(<801108..>802277)
                     /locus_tag="AGOS_ABR211C"
                     /old_locus_tag="ABR211C"
                     /db_xref="GeneID:4619270"
     mRNA            complement(<801108..>802277)
                     /locus_tag="AGOS_ABR211C"
                     /old_locus_tag="ABR211C"
                     /product="ABR211Cp"
                     /transcript_id="NM_208513.1"
                     /db_xref="GeneID:4619270"
     CDS             complement(801108..802277)
                     /locus_tag="AGOS_ABR211C"
                     /old_locus_tag="ABR211C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL058W (SHP1)"
                     /codon_start=1
                     /product="ABR211Cp"
                     /protein_id="NP_983160.1"
                     /db_xref="GeneID:4619270"
                     /translation="MSDEQIQQFMMLTNSSAEVARKYLGEHEDDLEDALNGFYANQQR
                     PGSVEGQRNSYSDPNSSQEPRSSSPQLPSQASAKSGGSSGRSKKEKPWFRTFSQIMKE
                     SQEEDDDDEARHTFAGGETSGLEVTDPNDSNSLIRDLLEKARKGGERGDNGQGRSVAA
                     HNFFKGRGYRLGSSAEAEPEVVTQPEEPERPRKVTREITFWKEGFQVGEDGPLYRYDD
                     PANSYYLNELNQGRAPLRLLNVEFGQEVDVNVYKKLDESYKPPKKKHGGFGGSGRRLG
                     SPIPGDIARAEEAVEQESSATSPAPEAKQESPKPAEQQGNTSVQIRYANGKREVLRCN
                     SFDKVGFLYDHVKQNTSEARPFTLNQVCPVQPLEDFECTIGEQNLCNSVVVQRWV"
     gene            complement(<802640..>804946)
                     /locus_tag="AGOS_ABR212C"
                     /old_locus_tag="ABR212C"
                     /db_xref="GeneID:4619271"
     mRNA            complement(<802640..>804946)
                     /locus_tag="AGOS_ABR212C"
                     /old_locus_tag="ABR212C"
                     /product="ABR212Cp"
                     /transcript_id="NM_208514.2"
                     /db_xref="GeneID:4619271"
     CDS             complement(802640..804946)
                     /locus_tag="AGOS_ABR212C"
                     /old_locus_tag="ABR212C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER091C (MET6)"
                     /codon_start=1
                     /product="ABR212Cp"
                     /protein_id="NP_983161.2"
                     /db_xref="GeneID:4619271"
                     /translation="MVLSSVLGFPRIGANRELKKVTESYWAGKATEEELLKVGRELRA
                     SNWKLQKEAGVDVIASNDFSYYDQVLDLSLLFNVVPDRYRKHDLSAVDTMFAMGRGLQ
                     RLAKDGAPAVDVTALEMVKWFDSNYHYVRPTFSHSTDFKLNGNKPVEEYLEAKQLGIE
                     TRPVVLGPVSFLYLGKSDKDSLDLEPLSLLPKVLPLYAELLKQLSDAGAKSVQLDEPV
                     LVLDLAEDVQSAFKTAYEHLGAEKSLDIVLTTYFGTVVPNLKALVDLPVAGLHFDLVR
                     NPEQLDDVLAIVGENQSLSVGVVDGRNIWKNDFAKSAATISKAIEKLGGDRVIVATSS
                     SLLHTPVDLENESALEPEIKDWFSFATQKLHEVVVLAKNASGEDFSSELKANADSIAA
                     RAASAITNDPAVQERVAGLNEKLSTRAAPFGERLKEQQPIFKLPLFPTTTIGSFPQTK
                     DIRINRNKHAKGAISTEEYTNFINSQIEEVIRFQEEVGLDVLVHGEPERNDMVQYFGE
                     KIKGYVFTVNGWVQSYGSRYVRPPIIVGDLSRPLPMSVRESVYAQSITTKPVKGMLTG
                     PVTCLRWSFPRDDIDQRTQALQLAFALRDEVNDLEAAGIKVIQVDEPAIREGLPLRAG
                     EERSAYLNWAAQAFRVATSGVSNKTQIHSHFCYSDLDPKHIKALDADVVSIEFSKKDD
                     PNYIAEFQDYPNHIGLGLFDIHSPRVPSKEEFIQKIDAILKSYPADKFWVNPDCGLKT
                     RGWEETKASLTNMVEAAKHFRNIHTKKD"
     gene            <805915..>806253
                     /locus_tag="AGOS_ABR213W"
                     /old_locus_tag="ABR213W"
                     /db_xref="GeneID:4619272"
     mRNA            <805915..>806253
                     /locus_tag="AGOS_ABR213W"
                     /old_locus_tag="ABR213W"
                     /product="ABR213Wp"
                     /transcript_id="NM_208515.1"
                     /db_xref="GeneID:4619272"
     CDS             805915..806253
                     /locus_tag="AGOS_ABR213W"
                     /old_locus_tag="ABR213W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER092W (IES5)"
                     /codon_start=1
                     /product="ABR213Wp"
                     /protein_id="NP_983162.1"
                     /db_xref="GeneID:4619272"
                     /translation="MTLDQEYTKLVSRRDELQKQEVTLRREFTTLVRKIASITAVLET
                     IESPQVIERNLPSDEVLQKAPGLQPLIEMLVTLDETPLAEIEIPEKLMHSYELFRNTP
                     LLYKDNPGHL"
     gene            complement(<806271..>810317)
                     /locus_tag="AGOS_ABR214C"
                     /old_locus_tag="ABR214C"
                     /db_xref="GeneID:4619273"
     mRNA            complement(<806271..>810317)
                     /locus_tag="AGOS_ABR214C"
                     /old_locus_tag="ABR214C"
                     /product="ABR214Cp"
                     /transcript_id="NM_208516.2"
                     /db_xref="GeneID:4619273"
     CDS             complement(806271..810317)
                     /locus_tag="AGOS_ABR214C"
                     /old_locus_tag="ABR214C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER093C (TSC11)"
                     /codon_start=1
                     /product="ABR214Cp"
                     /protein_id="NP_983163.2"
                     /db_xref="GeneID:4619273"
                     /translation="MYGSALQMKSRSSGSRKRQNVVLSTSFVSTRRMQADEGAVTVPS
                     SPLHTRQRNNTLGSLRQEVRTLESELERLQSQRQEVEKAREATSTEIYQGTYTRDHLQ
                     RHSQRLQANTQLRDIGKNIKRLEEQLSQVKAKIDAILSLVNKLPEEPAEGEKADERTT
                     GIGVPLGASVSASNSSSAGRLSTPVAYHDAENVYYTDFADDYIQYSYFTDDEGDRTVD
                     NTFQDFGSELEGDSDTRSDQHNSLQPDKKAKEIATATWLFSDYLQSLQDSNASREFIL
                     TKANSLVALLSKNPEIKHDMVFSAFSNTINSLLMSPDKLVTSAGYRICRYLITDNKFI
                     ENLMLLRIDVFLVISLTKDNRHDMEREQAIKLVREFITYDAGINQAIVQVIISCVEKT
                     DDKLRMVCIETLLELALVKPAIVKKCGGFRVLESLLTDSRLQVSLLVLETFLSMMDLQ
                     ATRCYVVEYCNVSSILSALSDWQSKSSLNVERLQNSMCMMARLFKNYNGLIILSRNEF
                     RPLKELISFLQAPVVARYVLDLLLDVLLIKPLPYNEKKGTSSRLITSQFPNSPAANQY
                     VALVVRMLGEANLVDALVSILLNTRYNDNLNHPKRNVLFSKTRHALAEYLSLAVNINS
                     WNPDYVSKIHQSLSSIKFTEAFLIERINSKLNKHRTTLGIPNLNMQKTIINFSKAVTR
                     ATLLTDVDELVFKKMVFDTRVLQTKDFSQWNWDVLSDLCEGPLCNPRRLEELSRTTKF
                     IRRLLVFYRPFRYRFSTVYSKANNAKQYVKVGCQFFNTLLQHYEGIKVLLDDSKIIPQ
                     LASTLYKAMEGHILPSKLFSSWALQNTLCGSYFKFLGLLMKSKEGINILEKWNMFTVI
                     YKMFQPSPLAEEYLLLMLPELDLSHSIHCRIIFSKALVDSREVIRINATRVLGEMISS
                     VKLSDPTLEEFMLNLLVAQLYDLSSEVVAVADQILYHYCLSQSITLALKPAIAASLNQ
                     LVFIGSPILFELMASSAGFKLLNNISYIEKERLLWLERKNREYVHIVEEFLEKELRNG
                     ASSDNSIHTNLPLHFYHSLARSEEGINMIQKNGDFLAFTSSIKRALQEMPKTLDEYSI
                     LKSNIWCCGYIGSTELGIKLLDKHNVIGDLVELAMTDENPTARFTAFYALGLISKTEE
                     GCELLDELGWDCCIDVRRQPVGICVPNNITTFLSYPQESVEKTTVSEGIDQFDHGISE
                     EDFPPLEVSQYKLIQYSEKVERDVLTDNQELKSILEHRARQVNAQRRIDSTPLQFQDD
                     PVSAKIFRLVGKLGNHILTNSAIKELTELESRHGASKFETQEMFNAVFNLMAQYRFKP
                     SVRKFLCDVFINKRALENIARRERRRRK"
     gene            complement(<810464..>811059)
                     /locus_tag="AGOS_ABR215C"
                     /old_locus_tag="ABR215C"
                     /db_xref="GeneID:4619274"
     mRNA            complement(join(<810464..810759,810816..>811059))
                     /locus_tag="AGOS_ABR215C"
                     /old_locus_tag="ABR215C"
                     /product="ABR215Cp"
                     /transcript_id="NM_208517.2"
                     /db_xref="GeneID:4619274"
     CDS             complement(join(810464..810759,810816..811059))
                     /locus_tag="AGOS_ABR215C"
                     /old_locus_tag="ABR215C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER093C-A (AIM11) and YBL059W; 1-intron"
                     /codon_start=1
                     /product="ABR215Cp"
                     /protein_id="NP_983164.2"
                     /db_xref="GeneID:4619274"
                     /translation="MSLAIIPFITIGWLRCTRKSRDTMSSSPEPQAPMHVTQRQISVF
                     SDEFRQRRRQQMLRFFGATAFTLLSARLAFRGTINRKYVPNMFQLNHRVPLASSQGEA
                     LHAFAYGSGLATGGFAMLILGTCWLADVSTVPEFSLRIKALLGESDTQSGRLESAHQD
                     KETRELAAMLDSLLQEKKD"
     gene            <811170..>811539
                     /locus_tag="AGOS_ABR216W"
                     /old_locus_tag="ABR216W"
                     /db_xref="GeneID:4619275"
     mRNA            join(<811170..811203,811256..>811539)
                     /locus_tag="AGOS_ABR216W"
                     /old_locus_tag="ABR216W"
                     /product="ABR216Wp"
                     /transcript_id="NM_208518.1"
                     /db_xref="GeneID:4619275"
     CDS             join(811170..811203,811256..811539)
                     /locus_tag="AGOS_ABR216W"
                     /old_locus_tag="ABR216W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL059C-A (CMC2); 1-intron"
                     /codon_start=1
                     /product="ABR216Wp"
                     /protein_id="NP_983165.1"
                     /db_xref="GeneID:4619275"
                     /translation="MHPQLEAQRFHSCLDLVQALEKCHQADFYKQAFGLCNPEKEALT
                     QCLHNARLEGEKYHILANREKRKEMDAKWKQMQEEEYGEDALLKILLQRQLERKQSGK
                     TAE"
     gene            complement(<811607..>812382)
                     /locus_tag="AGOS_ABR217C"
                     /old_locus_tag="ABR217C"
                     /db_xref="GeneID:4619276"
     mRNA            complement(join(<811607..812199,812358..>812382))
                     /locus_tag="AGOS_ABR217C"
                     /old_locus_tag="ABR217C"
                     /product="ABR217Cp"
                     /transcript_id="NM_208519.2"
                     /db_xref="GeneID:4619276"
     CDS             complement(join(811607..812199,812358..812382))
                     /locus_tag="AGOS_ABR217C"
                     /old_locus_tag="ABR217C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER094C (PUP3); 1-intron"
                     /codon_start=1
                     /product="ABR217Cp"
                     /protein_id="NP_983166.2"
                     /db_xref="GeneID:4619276"
                     /translation="MSDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNRFEKIF
                     NFGHVFLGLTGLATDVTTLYETFRYKTNMYKMQEDRPIEPNTFSQLVSSTLYERRFGP
                     YFVGPVVAGIHSKTKKPYIAGFDLIGCIEESKDFIVSGTASDQLFGMCESLYEPNLES
                     EDLFETISQALLNAADRDALSGWGAVVYLIEKDRVVKRYLKTRQD"
     gene            complement(<812627..>814750)
                     /locus_tag="AGOS_ABR218C"
                     /old_locus_tag="ABR218C"
                     /db_xref="GeneID:4619277"
     mRNA            complement(<812627..>814750)
                     /locus_tag="AGOS_ABR218C"
                     /old_locus_tag="ABR218C"
                     /product="ABR218Cp"
                     /transcript_id="NM_208520.1"
                     /db_xref="GeneID:4619277"
     CDS             complement(812627..814750)
                     /locus_tag="AGOS_ABR218C"
                     /old_locus_tag="ABR218C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL060W (YEL1)"
                     /codon_start=1
                     /product="ABR218Cp"
                     /protein_id="NP_983167.1"
                     /db_xref="GeneID:4619277"
                     /translation="MRSNHLFFRKVMTRLEVHPLNNSRLFCISDSSSTSLYSEPSKGS
                     TIFAQQALDRFDWDLSIGETAFENMTDDAKMRNDPGMLVGPDGMLITPELLIASPGKI
                     DVFDCASLDDTAGALEGMSLASGEGSNCMQAMRPRSETRSTNTTTSRSVAKQILRNTY
                     GPVRYKDYANYLGSPENREVLREFIALLQPLPVSLLFSLRKLSKSIYFIAEAGAIDAM
                     LEEMSIQWVERHKPLHYQDNYKLVHIVLFSLLILNSDLYNDMAQMKFTSAQFVDNTVY
                     ALLRESPTIDKQSFEAELRVYYDLLAMDQLPLHKPPITASHSRDSANPTKKSSVFYSR
                     GHRMERTYSNSSTYSMSTISLQRTTTAIAAKQTAAVASWRFHNFSDLPLIYCKEPFDD
                     EMNNTNDSSWLMDHIIQFQEPLGSVSRAAAASMVSPTAQPRRKLFNWLKKGQPDSIFK
                     SHHEFGSAEGKWYNARVRISEGRLYIFNFKNQPALDPKTADLELCRRRAASYTVQNLF
                     GAMATFVQDNIVYKSNSQTTWNFAITFPKTIDCETERTYQFQTSNMTMAQRFVQAATF
                     WSARITPLPSAQFEMVSNQEYGWGEKLLSRQVAATDVRLTDWMPLIGIDSIYDEIEDS
                     GDLTVDSQLQNLRVFTEHLTQLLDQHNSYKPKMVEIWTQNPSTQQFEMAMENWNRRYL
                     YLNSMYEKHYTYLRALETAFETVTG"
     gene            <816320..>817138
                     /locus_tag="AGOS_ABR219W"
                     /old_locus_tag="ABR219W"
                     /db_xref="GeneID:4619278"
     mRNA            <816320..>817138
                     /locus_tag="AGOS_ABR219W"
                     /old_locus_tag="ABR219W"
                     /product="ABR219Wp"
                     /transcript_id="NM_208521.1"
                     /db_xref="GeneID:4619278"
     CDS             816320..817138
                     /locus_tag="AGOS_ABR219W"
                     /old_locus_tag="ABR219W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR064W (PER33)"
                     /codon_start=1
                     /product="ABR219Wp"
                     /protein_id="NP_983168.1"
                     /db_xref="GeneID:4619278"
                     /translation="MQKCSSTMHSRAKNTDAVEPPSALLWSKIKQPQFYWFLGHFLTL
                     YHYGCYTLSFRQAAIRYQYGSVLFYVAVTYGIVLYQFYKSGQLKPSTLKVQMRTLDNL
                     QYFVLTLVLWSCRHAKIISTATMSPVIFALFHSINYFKESLLPLLPLQAATKSALAGR
                     ISFFITNYNERFLMIAQNSEFVTLVQVLLLLPVDCTALLLHLTVTNLLKVLAVVTYAW
                     FFKLRYLQSPQMKAMVHTYDVRADQLVRQSTPQLLPYWLRVKHLVLRFFKAIPC"
     gene            <817544..>818158
                     /locus_tag="AGOS_ABR220W"
                     /old_locus_tag="ABR220W"
                     /db_xref="GeneID:4619279"
     mRNA            <817544..>818158
                     /locus_tag="AGOS_ABR220W"
                     /old_locus_tag="ABR220W"
                     /product="ABR220Wp"
                     /transcript_id="NM_208522.1"
                     /db_xref="GeneID:4619279"
     CDS             817544..818158
                     /locus_tag="AGOS_ABR220W"
                     /old_locus_tag="ABR220W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL038C (YPT1)"
                     /codon_start=1
                     /product="ABR220Wp"
                     /protein_id="NP_983169.1"
                     /db_xref="GeneID:4619279"
                     /translation="MNSEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVD
                     FKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTW
                     LQEIDRYGTAGVVKLLVGNKNDLKDKKVVDFEVAREFADSLNIPVLETSALDSSNVEE
                     AFLTMARQIKETMSHQQKESGKKDDKSGVNLKGQSLANSGGGCC"
     gene            complement(<818270..>818680)
                     /locus_tag="AGOS_ABR221C"
                     /old_locus_tag="ABR221C"
                     /db_xref="GeneID:4619280"
     mRNA            complement(<818270..>818680)
                     /locus_tag="AGOS_ABR221C"
                     /old_locus_tag="ABR221C"
                     /product="ABR221Cp"
                     /transcript_id="NM_208523.1"
                     /db_xref="GeneID:4619280"
     CDS             complement(818270..818680)
                     /locus_tag="AGOS_ABR221C"
                     /old_locus_tag="ABR221C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR065C (ENV10)"
                     /codon_start=1
                     /product="ABR221Cp"
                     /protein_id="NP_983170.1"
                     /db_xref="GeneID:4619280"
                     /translation="MAGKADKKQAAANTAALRRLYTYVVPAVILSALRQLVFGDASVA
                     RYVLWHVPLAGALYTLERSGRPHYDGGRLARVGVALDASSGLTGALFDVVYTSVACDA
                     VAAALGTAAQWWLLFAWPVYWAYGGWRMLRPART"
     gene            <818971..>820404
                     /locus_tag="AGOS_ABR222W"
                     /old_locus_tag="ABR222W"
                     /db_xref="GeneID:4619281"
     mRNA            join(<818971..818980,819284..>820404)
                     /locus_tag="AGOS_ABR222W"
                     /old_locus_tag="ABR222W"
                     /product="ABR222Wp"
                     /transcript_id="NM_208524.1"
                     /db_xref="GeneID:4619281"
     CDS             join(818971..818980,819284..820404)
                     /locus_tag="AGOS_ABR222W"
                     /old_locus_tag="ABR222W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL039C (ACT1); 1-intron"
                     /codon_start=1
                     /product="ABR222Wp"
                     /protein_id="NP_983171.1"
                     /db_xref="GeneID:4619281"
                     /translation="MDSGEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGI
                     MVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH
                     PVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGV
                     THVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLC
                     YVALDFEQEMQTAAQSSAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGID
                     QTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP
                     ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF"
     STS             819420..819920
                     /locus_tag="AGOS_ABR222W"
                     /old_locus_tag="ABR222W"
                     /standard_name="PMC209527P1"
                     /db_xref="UniSTS:271999"
     gene            complement(<820886..>822760)
                     /locus_tag="AGOS_ABR223C"
                     /old_locus_tag="ABR223C"
                     /db_xref="GeneID:4619282"
     mRNA            complement(<820886..>822760)
                     /locus_tag="AGOS_ABR223C"
                     /old_locus_tag="ABR223C"
                     /product="ABR223Cp"
                     /transcript_id="NM_208525.2"
                     /db_xref="GeneID:4619282"
     CDS             complement(820886..822760)
                     /locus_tag="AGOS_ABR223C"
                     /old_locus_tag="ABR223C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL040W"
                     /codon_start=1
                     /product="ABR223Cp"
                     /protein_id="NP_983172.2"
                     /db_xref="GeneID:4619282"
                     /translation="MGKVYDLPRISGFLVIVGLVLGIDISAMAVFISSDYFNRYFHYP
                     NAFEQGMVSGAHPMGGLTGCLLFGYVGERVSRLGCFRYFTFIWIIGCIVSVLVMDIYM
                     VAIGRFIKGVAVGSLSVVASVYLVEIFPSNRKGIATALVQLTLTFGIFLMYMLCWTFS
                     RFNNHMAFRISWGLEIIPAVALISGTLFVPESPRWFVMQGQYKKAQEILTLLNCRSKN
                     EFNKQTLLNMYGDTAKASFKDLIKLPYIKQLIMGMTIQALVQFTGINVVMYYVVYICE
                     MAGLEGREKMNVASIPYLLNILFTFIPLHLLDRVQRKVLIVYGSFALAAIMNLIGLTM
                     WIHGHDVSPINGNPALVWKLSPLGGQITISLCFAFIAIFASTLSCAGWLYTNEVLADK
                     IRSRGLSICMSVSWICNAVLTFLSPLMMSTMKWGTFFLFGMVTTMLTIIVWLAFPETL
                     DISSSAPKTESYEGGNTKPIAETKEHAEILENELKVASSASMQGQSTDTEELVEISYR
                     SAAPPPESINEDITLQPPPPAIQKETLAPKRKTVQTQIESLFAAKAAGQRLSPEDEDI
                     MITLTAISSDFSGVSVRDLHNKFRSSRLGTERDVFSAAPGLDLNGLGTSDGKLSDRKS
                     "
     gene            <823072..>823689
                     /locus_tag="AGOS_ABR224W"
                     /old_locus_tag="ABR224W"
                     /db_xref="GeneID:4619283"
     mRNA            <823072..>823689
                     /locus_tag="AGOS_ABR224W"
                     /old_locus_tag="ABR224W"
                     /product="ABR224Wp"
                     /transcript_id="NM_208526.2"
                     /db_xref="GeneID:4619283"
     CDS             823072..823689
                     /locus_tag="AGOS_ABR224W"
                     /old_locus_tag="ABR224W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR066W (SPC3)"
                     /codon_start=1
                     /product="ABR224Wp"
                     /protein_id="NP_983173.2"
                     /db_xref="GeneID:4619283"
                     /translation="MFSLAQRFQVVSNKAMSWSLVTMAFVIVTSWIQLLHDNVFSLDS
                     SIANIMPTVRVRSSRYFGSSNGKPKENVRLEFDLDADLAPLFNWNTKQVFVYLTAEYN
                     EPDGLGGNVVTFWDHIIQDKAKSKVTLRAAKSKYSVWDATDRLSEKELSFKLHWNIQP
                     WVGPLAYGETAGEHVITIQRPEEGHAKSNKTKKARRHANQRAKNA"
     gene            complement(<823810..>826641)
                     /locus_tag="AGOS_ABR225C"
                     /old_locus_tag="ABR225C"
                     /db_xref="GeneID:4619284"
     mRNA            complement(<823810..>826641)
                     /locus_tag="AGOS_ABR225C"
                     /old_locus_tag="ABR225C"
                     /product="ABR225Cp"
                     /transcript_id="NM_208527.1"
                     /db_xref="GeneID:4619284"
     CDS             complement(823810..826641)
                     /locus_tag="AGOS_ABR225C"
                     /old_locus_tag="ABR225C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR067C (PET309)"
                     /codon_start=1
                     /product="ABR225Cp"
                     /protein_id="NP_983174.1"
                     /db_xref="GeneID:4619284"
                     /translation="MKCLSALRHVQCVRFMQVAAQVSKRISPVQNAQAAYQSLPPGTQ
                     SAMQNAREKADLGEEDLTLISQCNIRNSTVLRGAVLQYFKTFEQYGAVKKVAARLLME
                     PNGDFRGDLTLAETKLYLESLVELRQFADAVQAVEKMIRQSALRSPWQAHKLVCVLFT
                     RLWAHIPPQEVLAYLASMLRALHGTCSFGPPWVNTDIVKLFFHFFRAFPEIESYQHQA
                     LSLIESQLDACAAAEFSSTLLQIHLVHRRFQLCEQVWKYKVQKKFPTTSADLTAIMEA
                     YSHKGDWQGVVDLYESHSSVRNLSNHFELKLYAHARLHDWRNLKDSFNCLFGLGKLPS
                     LEHYSVVMLALAHNGNTDLVEQLYLQLLRRGLTPTNAILRSMVLAGYKAGDLSRAVNN
                     FELFKHNGIKPTSGDYLLLLRVYRRLGDLELSFKALRRLTQESYTLYDKHFACIIDTC
                     AKTCSHGVASELFKLMEEHYGVTATGHSVSSLMRVYLSSMLPQKAVNLFKIYSNKPLD
                     SKFLLYPVLLEAYLQLRNYKRFEETLKEFTSIEQSSYLNVCEVTIRYLAEHKHDTKAA
                     EAVLDQFIKKNPSSIRANLFEPILKEYDRTQDTDASLALFKNMAELKVAMSTKTLLYL
                     LKSTFKRSLKTHQDLNDYVEWSINILKRVRDKNIIMENSFLYPAVVAYPVKMLAKHHH
                     PNTAVRLLTEYYEIFGKKIPRSDESIVVTKALMVVAGEAQNWQEFEEHYSNLMEKISK
                     MKGPENKVQDNKRISNVLFGVLGYKMESMQATGKIQEIPSVLQEYEQMGLILTNSMWN
                     KIIKTLVSDDKTIKLGIGFANENFIQGYSLRNANKLIQTSDEQFLSPFQKHIKERQKV
                     NPKAFKPKKYLNYSTYCEIAKSLDEYLNRRCDQLDEEVAQLTNTYPRFMKRYLRRSRN
                     VRNWRDFERRHNNFFEHLHMQNELLLQAL"
     gene            <827027..>827449
                     /locus_tag="AGOS_ABR226W"
                     /old_locus_tag="ABR226W"
                     /db_xref="GeneID:4619285"
     mRNA            <827027..>827449
                     /locus_tag="AGOS_ABR226W"
                     /old_locus_tag="ABR226W"
                     /product="ABR226Wp"
                     /transcript_id="NM_208528.1"
                     /db_xref="GeneID:4619285"
     CDS             827027..827449
                     /locus_tag="AGOS_ABR226W"
                     /old_locus_tag="ABR226W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR068W (FYV7)"
                     /codon_start=1
                     /product="ABR226Wp"
                     /protein_id="NP_983175.1"
                     /db_xref="GeneID:4619285"
                     /translation="MVGVGKKFTKESKVREIQKNLHKRAKLKRQYLKTLEQEGYEVPE
                     EQKRQKPSFEQRKGEKKQKVDEKKEHARRRKREQKEEMEAKRQRELDELERAKVRQVE
                     RERRNKRIQQKTRSGQPKMGPRINDLLDKIQKDTTYTS"
     gene            complement(<827537..>829810)
                     /locus_tag="AGOS_ABR227C"
                     /old_locus_tag="ABR227C"
                     /db_xref="GeneID:4619286"
     mRNA            complement(<827537..>829810)
                     /locus_tag="AGOS_ABR227C"
                     /old_locus_tag="ABR227C"
                     /product="ABR227Cp"
                     /transcript_id="NM_208529.2"
                     /db_xref="GeneID:4619286"
     CDS             complement(827537..829810)
                     /locus_tag="AGOS_ABR227C"
                     /old_locus_tag="ABR227C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR069C (MEF1)"
                     /codon_start=1
                     /product="ABR227Cp"
                     /protein_id="NP_983176.2"
                     /db_xref="GeneID:4619286"
                     /translation="MLERAALLHRLRLPAHSLPFIYNGALFGGAKRSFSATSKRCTYE
                     EEKAVLDELKPQLTADDLKHSKLLRNIGVSAHIDSGKTTFTERVLYYTGRIKAIHEVR
                     GRDSVGAKMDHMDLEREKGITIQSAATYCSWDKDQESYHFNLIDTPGHIDFTIEVERA
                     LRVLDGAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGADPFKAIQQINT
                     KLRIPAAAVHVPIGSESDLCGVVDIINRVAIYNEGENGEVLRKGPVPEELQDLVEEKR
                     LLLVETLADVDDEMAEIFLDEQEPTVQQIKDAIRRATIARKFTPVLMGSALANTGIQN
                     VLDAIVDYLPEPSEVLNTALDVSNNETKVNLIPSSHHPFVGLAFKLEEGNYGQLTYIR
                     VYQGKLKKGGYITNVRTGKKVKVSRLVRMHSNEMEDVNEIGAGEICATFGIDCSSGDT
                     FTDGKLKYSMSSMYVPDAVISLSISPNSKDSATNFSKALNRFQKEDPTFRVRFDPESK
                     QTIISGMGELHLEIYVERMRREYNVACTTGKPQVSYRESIQIPATFDYTHKKQSGGAG
                     QYARVMGNLTPVANSSENTFTTAVVGGRIPDKYLAACAKGFEEVCEKGPLIGHKVLGI
                     NMLINDGAIHAVDSNELAFKTATTAAFVQSFMQAQPVVLEPIMTVTVTAPNEFQGNVI
                     TLLNKLQAVIQDTENGHDEFTMTSECSLNTMFGFATSLRASTQGKGEFSLEFKQYSPA
                     SPQLQKQLIEEYRKSKK"
     gene            complement(<830015..>831853)
                     /locus_tag="AGOS_ABR228C"
                     /old_locus_tag="ABR228C"
                     /db_xref="GeneID:4619287"
     mRNA            complement(<830015..>831853)
                     /locus_tag="AGOS_ABR228C"
                     /old_locus_tag="ABR228C"
                     /product="ABR228Cp"
                     /transcript_id="NM_208530.2"
                     /db_xref="GeneID:4619287"
     CDS             complement(830015..831853)
                     /locus_tag="AGOS_ABR228C"
                     /old_locus_tag="ABR228C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL041W (FET5)"
                     /codon_start=1
                     /product="ABR228Cp"
                     /protein_id="NP_983177.2"
                     /db_xref="GeneID:4619287"
                     /translation="MAQRVFFHMVALVLCQLLNLGLVAAKVHRFNFTTGWVTARPDGV
                     AKQVIGFNGQWPLPDIHVDKGDRVELYLTNGFADVGTTLHFHGLFHNSSEGNLAAMDG
                     PDMVTQCGIPPGQTYLYNFSVPTQVGTYWYHSHTGAQYADGMRGAFVVHDPDAPFEYD
                     EEMTLMVGDIYHKPYTQLVHEFLSRYNPTGAEPVPQNLLFNNTVDGSLYFKPNKTYLL
                     RIINGAFFVSQYLYLEGHEFTIVETDGVYVQPNATNLLYLASGQRVSVLVHTKETTDR
                     NFAFMQLFDEDMLDDIPSSLQLNRTNHVIYDDSKPRANPYFLPDYNNPAEEFYLTPLH
                     GKPLYEHYDRQVVLDLHMDNLADGVNYAFFNNITYTTPKVPTLTTALTAGEFASNPLI
                     YGNVNPFVLRYGEIVEIVINNYDDGKHPFHLHGHNFQLVQKSPASISEDGETVRYNES
                     APVMPYPEFPATRDTVVLEPNGHIVLRFRADNPGVWIFHCHVNWHMEQGLAAVFIEAP
                     HELQAGDPLSDNYRQVCAASNIPNAGNAGGNSANWLDLSDAPRQQDPLPAGFTAKGYF
                     AFALTTLAGLLGLYTITNFGLQKSVIDDAEMYNKLSVLLKENNVLD"
     gene            complement(<832147..>833208)
                     /locus_tag="AGOS_ABR229C"
                     /old_locus_tag="ABR229C"
                     /db_xref="GeneID:4619288"
     mRNA            complement(<832147..>833208)
                     /locus_tag="AGOS_ABR229C"
                     /old_locus_tag="ABR229C"
                     /product="ABR229Cp"
                     /transcript_id="NM_208531.1"
                     /db_xref="GeneID:4619288"
     CDS             complement(832147..833208)
                     /locus_tag="AGOS_ABR229C"
                     /old_locus_tag="ABR229C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR070C (XYL2)"
                     /codon_start=1
                     /product="ABR229Cp"
                     /protein_id="NP_983178.1"
                     /db_xref="GeneID:4619288"
                     /translation="MSSSMQQAVVLREKGAIVYEHRPVPVIEDPHYVKVKIEKTGICG
                     SDVHYYLHGSIGPFVVRSPMVLGHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSE
                     ETKSGHYNLCREMRFAATPPYDGTLVKYYISPEDFLVKLPDSVSLEEGALCEPLAVAV
                     HANRLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTH
                     PVDSSDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPGGTHVQVGSSR
                     DYVSFPLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAARLVTHRFPFDRAVEA
                     YKFNATADEHIIKTIIEGP"
     gene            complement(<833468..>836371)
                     /locus_tag="AGOS_ABR230C"
                     /old_locus_tag="ABR230C"
                     /db_xref="GeneID:4619289"
     mRNA            complement(<833468..>836371)
                     /locus_tag="AGOS_ABR230C"
                     /old_locus_tag="ABR230C"
                     /product="ABR230Cp"
                     /transcript_id="NM_208532.2"
                     /db_xref="GeneID:4619289"
     CDS             complement(833468..836371)
                     /locus_tag="AGOS_ABR230C"
                     /old_locus_tag="ABR230C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR071C (RGR1)"
                     /codon_start=1
                     /product="ABR230Cp"
                     /protein_id="NP_983179.2"
                     /db_xref="GeneID:4619289"
                     /translation="MTIAVKESKILYGNFDKAKSGIMKGSGGIVEQGPGLQQRIITPA
                     KEMPPEIPHVEFNQLPLSVLIRNLTVYAAKELSQYMKTNVRSTQDASTRKMEFLRLII
                     FLRNQFLRLYVLVKWCKTIRQNNFHTMIDLLNWFRGTNIIVNNCLLALKDMSTSMAGA
                     KLPNPDLITALEVLMLGRPDLPTHGFLLTGDENGQQANKIPAKLILKRFRDLNTCLSV
                     KISLMDLPAEMHTYSIKDGRITFTVFPEFEISLSTIDRESPLFFVDVKFLFNENKFPL
                     NTTKIALLVNDILYKSPTPLLSLYQFLHRYVLTLQLYMIHVELQDIETNGKYSGGNLA
                     HHYDPKKNIISLRYWLQSKMNSKCKALIGVEKTSQSIILQWHLPDTKEEGKTTKYNNL
                     LGNIEAILDEITFNHARIIMSELLDTGLFEGDDNKNDTSDTLFFHVPVICVATAPVQL
                     KINTISGIFYFKNPSALLLSYAKQLNQTSDLDDVVNILERLRMDKIVHILRNMFEKTG
                     WICEDVVKLNKPILYDKHKDKKRILTRDLFIRIKDWPANWFFILNLVASGATCIVEKL
                     IGKVQSVKGTWEVKYLDQGNLQVSKLESITYQNVMHMQKTIIQKILNHMIIDSLNELK
                     ISKVICQGEASQKLPAYVQTNTAGASNVSIIAIGLESFLQGSKALSDTLESTIFLKMD
                     YEQNEVKLFGKFKKDTQMIRYQCDDLLINFIDKRGLAFHMTEDFTSLNHVVQYLTKFR
                     QKLMQLVVLTDVTEKLHNNFRSEHFQIVKLRPNEISFRYLKNSKDDQDCTIQIVTNET
                     KIEKLQVQLSPLNPQNIIQKYLECDKYDPHFIFNYLHFTSKLFSAVKSIESITNTNTM
                     TITLHLHTLAAYQLSYHDRLTGGQIALCIDLRNSPSRAGSMYHLYFAQEDYSASKNPM
                     YPAILQVINNVFMLNNNTKRKVPSVIRLGTGVACPLGDIEPLLEEIHSILIRS"
     gene            <837016..>839661
                     /locus_tag="AGOS_ABR231W"
                     /old_locus_tag="ABR231W"
                     /db_xref="GeneID:4619290"
     mRNA            <837016..>839661
                     /locus_tag="AGOS_ABR231W"
                     /old_locus_tag="ABR231W"
                     /product="ABR231Wp"
                     /transcript_id="NM_208533.1"
                     /db_xref="GeneID:4619290"
     CDS             837016..839661
                     /locus_tag="AGOS_ABR231W"
                     /old_locus_tag="ABR231W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL042C and YLR072W"
                     /codon_start=1
                     /product="ABR231Wp"
                     /protein_id="NP_983180.1"
                     /db_xref="GeneID:4619290"
                     /translation="MDSRRTTSDLDLYGKTGSVNEVDECAMAEEEAGREESEGVQGGP
                     PLGAPVPEVFIIPSITPLRTSARPVASVGSLDFAHTPTKTGMYHVRGHRDSTTSIDSV
                     ALKSTPASPHVTPLNGVTSVEYVGQHSSALASVTGIIEQDAGIESVENHMNADQATHE
                     PEINKAQKFFSNMISSLSFRTVGTSPSPASNKGSQSPCESAEPSKYTTVTSNSLGSKV
                     TASDENKSLAESGLEPNSDALRGQSSTQTVDTSDTKKGYNKKLYTDKMLPGTKYRFAT
                     WKRNSDFHKLFGSVDADDRLLDDFSCALSREFLYQGRLYVSESYICFNSNILGWVTNL
                     VVPIRDILSFEKTTTAGLFPNGIALTMDSTKHYFASFLSRDSTFDFLEAVRTAYHTNS
                     KAVIKSNAYLDVPLNISGEEFFLKPIAELMQITAPPSRASAAADENSDIQDAIMSVDY
                     VTPSGTVDGSEQFRNDAYEDTSDSDILSPSDDSGKVMSEVFHLKEGCRYTYDGPYYHH
                     ETSFRYIPEEHAEYTLAELTLNAPPGVVFQLIFSETNSSFIEEFLTAHNSTNLSEISP
                     FTEVNPEGQHFRNYTYTKALAYPVGPRSTKCIVQETVLHRDYEDYINVVNTTKTPDVP
                     SGNSFSVKTRYMFKWESPTTSLLKVSFWVEWVGSSWIRSMVNNSCKSGQIEATKSLVS
                     QLYHYIDTYVEQRIISVELNTNEKSSLRTAAEQDYIEVASHPQQKQLLSASSELSSSA
                     SSILGNSAVSATSTAVSNSAPARGSSWKFYTLYAMLTAIALLLIANLILQARIASRLN
                     HRINLGDRMEWSTTSLDELADKISAVIAVRSDRLAVVPSQAFRPDPTTGGQYVALTPE
                     YSAFMEKLERLLAYLDAHAVQRPAD"
     gene            complement(<839750..>840331)
                     /locus_tag="AGOS_ABR232C"
                     /old_locus_tag="ABR232C"
                     /db_xref="GeneID:4619291"
     mRNA            complement(<839750..>840331)
                     /locus_tag="AGOS_ABR232C"
                     /old_locus_tag="ABR232C"
                     /product="ABR232Cp"
                     /transcript_id="NM_208534.2"
                     /db_xref="GeneID:4619291"
     CDS             complement(839750..840331)
                     /locus_tag="AGOS_ABR232C"
                     /old_locus_tag="ABR232C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR073C (RFU1)"
                     /codon_start=1
                     /product="ABR232Cp"
                     /protein_id="NP_983181.2"
                     /db_xref="GeneID:4619291"
                     /translation="MKSSAQLCMEARNYNFNAAAPLRLYLATCVRLVEEAQAAAQADD
                     VARAYMLYVRYLDLCMHQLSGHREVQQPVTDAERLSRDEYEQLLRLEVPAVLRLTEEL
                     KSAVDLRHERGRASLARSVVPEAGRGEHSRQEVQLPPSFDEERFNRTVQWFLAAGRSM
                     SLPVSAEEPAVREVFSYPELPKLSMAAESWAPS"
     gene            <840635..>841576
                     /locus_tag="AGOS_ABR233W"
                     /old_locus_tag="ABR233W"
                     /db_xref="GeneID:4619292"
     mRNA            <840635..>841576
                     /locus_tag="AGOS_ABR233W"
                     /old_locus_tag="ABR233W"
                     /product="ABR233Wp"
                     /transcript_id="NM_208535.2"
                     /db_xref="GeneID:4619292"
     CDS             840635..841576
                     /locus_tag="AGOS_ABR233W"
                     /old_locus_tag="ABR233W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL044C (OTU1)"
                     /codon_start=1
                     /product="ABR233Wp"
                     /protein_id="NP_983182.2"
                     /db_xref="GeneID:4619292"
                     /translation="MKIKVTVSSFGEQVLEVGADASLNELLTLVKEAYGGEVPLKSMR
                     FGYPPQQVELCGHDGKEELGELGISGGERIVFACESGGLDARESRIPPNLDGALSPPN
                     KITMQPGMTLEIHEVPDDNSCLFHAISYALYKDTATSQQLREVVAREVEADPVAYSDS
                     IVGRPNREYAAWIRKRDSWGGAIEIAILSKYLATAMFVLDIDAGRYEKFNEDKYNEFI
                     VLVFSGIHYDTLQLSIAGAAVPQTVFDSSEPDSDVLLVRASEVASKMKKAGLSFNTYR
                     ERIRCNQCGTVLLGDREVSQHAKQTGHIDFGQVSAYQ"
     gene            complement(<841612..>842139)
                     /locus_tag="AGOS_ABR234C"
                     /old_locus_tag="ABR234C"
                     /db_xref="GeneID:4619293"
     mRNA            complement(<841612..>842139)
                     /locus_tag="AGOS_ABR234C"
                     /old_locus_tag="ABR234C"
                     /product="ABR234Cp"
                     /transcript_id="NM_208536.1"
                     /db_xref="GeneID:4619293"
     CDS             complement(841612..842139)
                     /locus_tag="AGOS_ABR234C"
                     /old_locus_tag="ABR234C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR074C (BUD20)"
                     /codon_start=1
                     /product="ABR234Cp"
                     /protein_id="NP_983183.1"
                     /db_xref="GeneID:4619293"
                     /translation="MPRQYSKDARTRNGEMGRYSVKRYKTKRRTKDLDLIFEDLASEQ
                     RVNALLKQPLDETKPGLGQHYCIHCAKYFETPAALKTHLKGKVHKRRVKELRGVPYTQ
                     EVANAAAGTDVGRFMARVEQIKTSVGPQKERNEAALAAQLETALENAATREAPLPHCA
                     SAEAGFMADGEVEMN"
     gene            <842307..>843029
                     /locus_tag="AGOS_ABR235W"
                     /old_locus_tag="ABR235W"
                     /db_xref="GeneID:4619294"
     mRNA            <842307..>843029
                     /locus_tag="AGOS_ABR235W"
                     /old_locus_tag="ABR235W"
                     /product="60S ribosomal protein L10"
                     /transcript_id="NM_208537.1"
                     /db_xref="GeneID:4619294"
     CDS             842307..843029
                     /locus_tag="AGOS_ABR235W"
                     /old_locus_tag="ABR235W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR075W (RPL10)"
                     /codon_start=1
                     /product="60S ribosomal protein L10"
                     /protein_id="NP_983184.1"
                     /db_xref="GeneID:4619294"
                     /translation="MELRTRPDSASSETTTSSKMARRPARCYRYQKNKPYPKSRYNRA
                     VPDSKIRIYDLGKKKATVDEFPLCVHLVSNELEQLSSEALEAARICANKYITKMTGRD
                     SFHLRVRVHPFHVLRINKMLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTK
                     DNNKDIVVEALRRARYKFPGQQKIIMSKKWGFTNLDRAEYVRRRDAGEVKDDGAFVKF
                     LSKKGALENNFREFPEYFTAQA"
     gene            <843347..>844108
                     /locus_tag="AGOS_ABR236W"
                     /old_locus_tag="ABR236W"
                     /db_xref="GeneID:4619295"
     mRNA            <843347..>844108
                     /locus_tag="AGOS_ABR236W"
                     /old_locus_tag="ABR236W"
                     /product="ABR236Wp"
                     /transcript_id="NM_208538.1"
                     /db_xref="GeneID:4619295"
     CDS             843347..844108
                     /locus_tag="AGOS_ABR236W"
                     /old_locus_tag="ABR236W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL045C (SEC53)"
                     /codon_start=1
                     /product="ABR236Wp"
                     /protein_id="NP_983185.1"
                     /db_xref="GeneID:4619295"
                     /translation="MISEFAYKERPDTLVLFDVDGTLTPARLTISDEVKFVLQALREK
                     VVIGFVGGSDLSKQVEQLGATVLADFDYCFSENGLTAYRLGTELASQSFIDWIGEEEY
                     NRFVVFVLKYLSSIELPKRRGTFLEFRNGMVNISPIGRNASVQERNEFEAYDKEHQVR
                     AKFVQALKKEFSHLDLTYSIGGQISFDVFPTGWDKTYCLRHVESENFKEIHFFGDKTF
                     EGGNDWEIYNDPRTIGHSVRSPEDTVRILRELFDL"
     gene            complement(<844184..>844813)
                     /locus_tag="AGOS_ABR237C"
                     /old_locus_tag="ABR237C"
                     /db_xref="GeneID:4619296"
     mRNA            complement(<844184..>844813)
                     /locus_tag="AGOS_ABR237C"
                     /old_locus_tag="ABR237C"
                     /product="ABR237Cp"
                     /transcript_id="NM_208539.2"
                     /db_xref="GeneID:4619296"
     CDS             complement(844184..844813)
                     /locus_tag="AGOS_ABR237C"
                     /old_locus_tag="ABR237C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL046W (FMP32)"
                     /codon_start=1
                     /product="ABR237Cp"
                     /protein_id="NP_983186.2"
                     /db_xref="GeneID:4619296"
                     /translation="MFMTRRPLAMLATRRGFQSSSRVYEDFETVHIRNTNRFRQLLVE
                     KGDFSTQQANAIVDIMSDALRGGVTHVSQDLASREKLTKLTYQQRVDFAKLRDQLLTA
                     DRSEIHSIQNEQERIRNDLEQLRNRLREEITKANAGFKLDLSLEKGRIREESSNHNLQ
                     IKEIDTRIDQEVSNMKMQIDSVKTQVMQWLIGVCTGTFALVLAYVRLLS"
     gene            <844991..>846742
                     /locus_tag="AGOS_ABR238W"
                     /old_locus_tag="ABR238W"
                     /db_xref="GeneID:4619297"
     mRNA            <844991..>846742
                     /locus_tag="AGOS_ABR238W"
                     /old_locus_tag="ABR238W"
                     /product="ABR238Wp"
                     /transcript_id="NM_208540.2"
                     /db_xref="GeneID:4619297"
     CDS             844991..846742
                     /locus_tag="AGOS_ABR238W"
                     /old_locus_tag="ABR238W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR077W (FMP25)"
                     /codon_start=1
                     /product="ABR238Wp"
                     /protein_id="NP_983187.2"
                     /db_xref="GeneID:4619297"
                     /translation="MLQRNVPLGLRVARRSLWKQGALRKGQRFDEAEMMAEQLNHGTY
                     KAKRSKLDYQWSDKSPRQLEQEYADKVEKMQKLMAVFQGLAVVVGIGVAGTVYLQWPQ
                     IKGWILARDRRVDDNTLERLKEIKRKKELRGIPEIPVTAPQPGEPGLYYWGARLGEDA
                     GSTRFPLRVPGFEGERLRDVALAEEGCNLAIDRRGDLYAWTTRSRELLLPGQDLCQVQ
                     ISNGVAYGLRGNGDLLVIPYTDRARLAEHASWRRSLLMPWSRYCVYDWKVDSGLLARG
                     EKRVVKFATGKRHLVAVTDRGHVYTCATGLENDAGATSCGQFGVPEYSKFDGAPPVNQ
                     LLEVELLNKTIAPDGQLVERTITHIACGNYHTLAIDSKGELYAFGANTYGQLGLPVTY
                     DLETVPFPRRIANFGAHFMSGAALRCVDIHCCGETSFVSVVPQTGGADMPQQLTYFSF
                     GNGIWGQLGNGRFKHSQNEATKLKAVNGIYDHPERDVKRRVKIATWACGDHHVLCSLD
                     NGDVLAWGYNDRGQLGNGRGVKWAQPQNVPALLAPGVNYARDPEGTLFAPNNRMQLLP
                     DQRLAAGPAASCIYWQA"
     gene            complement(<846752..>847468)
                     /locus_tag="AGOS_ABR239C"
                     /old_locus_tag="ABR239C"
                     /db_xref="GeneID:4619298"
     mRNA            complement(join(<846752..847411,847466..>847468))
                     /locus_tag="AGOS_ABR239C"
                     /old_locus_tag="ABR239C"
                     /product="ABR239Cp"
                     /transcript_id="NM_208541.2"
                     /db_xref="GeneID:4619298"
     CDS             complement(join(846752..847411,847466..847468))
                     /locus_tag="AGOS_ABR239C"
                     /old_locus_tag="ABR239C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR078C (BOS1); 1-intron"
                     /codon_start=1
                     /product="ABR239Cp"
                     /protein_id="NP_983188.2"
                     /db_xref="GeneID:4619298"
                     /translation="MNALYNHAVKQKKLLEQELNRFELGVAAPVGLQGSISTALVGLE
                     RTIEQYQAQVAQTGSGAEAGKHAQRVGELTECAASARRRFEGLRAASMQPVAFQSGAA
                     APEGAVSQRAAGARTTINSAGGLPLYEGLRREQNMLARGNARLDSILQMGQESLEDMV
                     EQHRILQRVAERMQGSLRTLGVSDATIERIGRRVKKDKAIFWSSLTLLVVGVYYVLRI
                     FG"
     gene            <847752..>848435
                     /locus_tag="AGOS_ABR240W"
                     /old_locus_tag="ABR240W"
                     /db_xref="GeneID:4619299"
     mRNA            <847752..>848435
                     /locus_tag="AGOS_ABR240W"
                     /old_locus_tag="ABR240W"
                     /product="ABR240Wp"
                     /transcript_id="NM_208542.1"
                     /db_xref="GeneID:4619299"
     CDS             847752..848435
                     /locus_tag="AGOS_ABR240W"
                     /old_locus_tag="ABR240W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR079W (SIC1)"
                     /codon_start=1
                     /product="ABR240Wp"
                     /protein_id="NP_983189.1"
                     /db_xref="GeneID:4619299"
                     /translation="MTPATPPRSRSRRADQDEMATPRRAVTGGGLLTPGTVGCKGEAG
                     VARPRTPEGEVRSPEQTPRRAGRRAGALDELGTTARVLFPAAREGGAPGRQGARRGDA
                     RPARRKAARQEPGTPSSRIVTFELAEAWHNQSGCGSSDDEGEEDVRPLRLENPFLARG
                     VAGADERRERARQLEAADPSIGHAVTLVDKRGRPVHQRELTPEEQELFKPRMLFAREL
                     EDGRPGDGM"
     gene            complement(<848499..>850688)
                     /locus_tag="AGOS_ABR241C"
                     /old_locus_tag="ABR241C"
                     /db_xref="GeneID:4619300"
     mRNA            complement(<848499..>850688)
                     /locus_tag="AGOS_ABR241C"
                     /old_locus_tag="ABR241C"
                     /product="ABR241Cp"
                     /transcript_id="NM_208543.1"
                     /db_xref="GeneID:4619300"
     CDS             complement(848499..850688)
                     /locus_tag="AGOS_ABR241C"
                     /old_locus_tag="ABR241C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL047W (RGD2)"
                     /codon_start=1
                     /product="ABR241Cp"
                     /protein_id="NP_983190.1"
                     /db_xref="GeneID:4619300"
                     /translation="MGAFVESFWGDDIAAGAEALFGQLRRGCEQNGLFIQLFASRMQF
                     EVAHGRQLCGIETGVDSFDATETTAGAALRELLDQTAQEGAQHLAIAANIESTVLSPF
                     SRWCEGHQERVEESEKAVRRQLTSLGRARRQVEKLEQTYFNKCRAYEDYKREQLTEEE
                     LAAALEALQLQRERESQAARDREFQEFGSFGPARLDYRSARELVHALLTRLEKHEYRV
                     PLINYVFQGTNNGSEIARFLFEYMSLDDLDEAEAAGQDLLNKGFLKYCNGVGGGFVNS
                     KKFQYQWKAYAYEFARVANQAQNSEEASQQGDAESDLASVRSSTDTNRFSLFVQDFAS
                     RITSADSAAASVHSRDSEPPSPATPQLTEQQKMLSKLATEVEKADANYRRECSKLDML
                     RCSTEELMMEHYDALEQSERERLEMLKNVTLDFCATIGNKIATMKIAIERMISCENAM
                     DPAADLLALVERHRTGAFQPKVVPYNNYYNPGGFQIFGIDLETRCRLDKKVVPVLVSS
                     ILSYMDQLYPDMPDDHARATVWTAPVRLQYVHHLRKLINEKPGSAEEDIFRIFGEANA
                     EPAHVASVLKLYLLELPVPLISNDIYDVMRGLYTEFPPGSDADEDQRLVNSQRVQGLT
                     STLGTLSKPRVATLDVLTNHFYRLIKIIRMSESQESKDLADHLVAEIAKEFAPCIIKA
                     CFPIGPELGRQIFSDLLMYKKQVFRDLKRQGSRRKTSGTATEESRPE"
     gene            <850800..>851186
                     /locus_tag="AGOS_ABR242W"
                     /old_locus_tag="ABR242W"
                     /db_xref="GeneID:4619301"
     mRNA            <850800..>851186
                     /locus_tag="AGOS_ABR242W"
                     /old_locus_tag="ABR242W"
                     /product="ABR242Wp"
                     /transcript_id="NM_208544.2"
                     /db_xref="GeneID:4619301"
     CDS             850800..851186
                     /locus_tag="AGOS_ABR242W"
                     /old_locus_tag="ABR242W"
                     /experiment="RACE analysis of 5' end of mRNA"
                     /note="NOHBY218; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0D05841g;
                     Newly annotated start codon"
                     /codon_start=1
                     /product="ABR242Wp"
                     /protein_id="NP_983191.2"
                     /db_xref="GeneID:4619301"
                     /translation="MPYPKVAIVFCTGCRWGLRASWYAQELLQTFGDSLAEIALVPGP
                     SGQFQVLCYASQEQEATDSGNTIWDRRRDNGFPDSKYLKQAVKATLFADSGPALGAHI
                     ARAAPAALLKAPAEPLQHCDDCVGDT"
     gene            <851231..>852586
                     /locus_tag="AGOS_ABR243W"
                     /old_locus_tag="ABR243W"
                     /db_xref="GeneID:4619302"
     mRNA            <851231..>852586
                     /locus_tag="AGOS_ABR243W"
                     /old_locus_tag="ABR243W"
                     /product="ABR243Wp"
                     /transcript_id="NM_208545.1"
                     /db_xref="GeneID:4619302"
     CDS             851231..852586
                     /locus_tag="AGOS_ABR243W"
                     /old_locus_tag="ABR243W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL048C (EMP47) and YLR080W (EMP46)"
                     /codon_start=1
                     /product="ABR243Wp"
                     /protein_id="NP_983192.1"
                     /db_xref="GeneID:4619302"
                     /translation="MPMTQAFSPAALTVPYHQLLAVNSNGMKLSKIAKLAVCFAATGA
                     AAHAVSGDDGASAHNKEFSMPELVRQTKLPPHWLLTGDAAFEEGRIVLTPREKSKGGV
                     WHKKSYEVAGDFTVEWTLRARGHNDKSAGGLAFWLLTENTGKDTGLYYGPSRFDGLQV
                     LVDSNGPLREALTARLSDGSKPLTREDVHESTFGSCIVPYQDSDVPTTVRLSYDSART
                     LLKVQIDHNVCLQTRQVQLPQGNYQIGITADNSVTPEVFELLKFDLYNGLTAEATLPN
                     AVSMPQPKLVLKSVDEETGEKHMKEMNTLELMASEFTNVDIYKKLDGLEGKLLANDIG
                     ELFTHVRKLQEAQRSQLQKLDMLLENIQRLTRTDSDGNPEYSFEKFYQFDSKLEKMLK
                     EQQQLKEATKQQALMQAGPHVDDIVQKLLIWMIPLGLIMLVMAYYTFQIRQDIVKAKL
                     L"
     gene            complement(<852620..>854134)
                     /locus_tag="AGOS_ABR244C"
                     /old_locus_tag="ABR244C"
                     /db_xref="GeneID:4619303"
     mRNA            complement(<852620..>854134)
                     /locus_tag="AGOS_ABR244C"
                     /old_locus_tag="ABR244C"
                     /product="ABR244Cp"
                     /transcript_id="NM_208546.1"
                     /db_xref="GeneID:4619303"
     CDS             complement(852620..854134)
                     /locus_tag="AGOS_ABR244C"
                     /old_locus_tag="ABR244C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL049W (SWP82)"
                     /codon_start=1
                     /product="ABR244Cp"
                     /protein_id="NP_983193.1"
                     /db_xref="GeneID:4619303"
                     /translation="MSDLKPEKPQVVIHKVSGKTIEEHNLYVLKQCTQICHDKELAGG
                     NELTRPPVRQPILPPHVIKTRMDDDKDAYFLGKRDPGGDTKVDRHGRLLGGRNYLVDT
                     FQLPQKTHNFYVLVDELIEILHFEGSGSDFLHLHNQLYPLELKDNERALLADAGLIKG
                     ELRSPYYVTALSSYIIFGAAIVASGCRIIDDYWEQPLKEQGFTMHHRVFSLNGTQLSL
                     LRLLKPPRPESHQQGEKLDTNWLQKWEDPYPTIQEQPNAEARREYAREHARGEHITMI
                     VPGQSISGSIELSLNYKLPKYHYKNSFANALQNNIQDVPIGQHRTVETTPNAPVGRPS
                     KRTDEQKDHLSERDHSLNINGWKFEAIPLAPSRFNPGRTAKGLPYYEKEKLLQRLRKL
                     TPNQVRELEYLHDSVHLNTGLGKIRQNRRRKWSKYWQHKAGAPVGLTSDQVTEFREKY
                     LPALLNQVDTEIIYDEERNLDIIHSTHRRPNANFFGHSNISGFKPPYKEDPKYR"
     gene            complement(854472..854543)
                     /locus_tag="AGOS_t0042"
                     /db_xref="GeneID:4619304"
     tRNA            complement(854472..854543)
                     /locus_tag="AGOS_t0042"
                     /product="tRNA-Glu"
                     /codon_recognized="GAG"
                     /db_xref="GeneID:4619304"
     gene            complement(<854838..>856763)
                     /locus_tag="AGOS_ABR245C"
                     /old_locus_tag="ABR245C"
                     /db_xref="GeneID:4619190"
     mRNA            complement(<854838..>856763)
                     /locus_tag="AGOS_ABR245C"
                     /old_locus_tag="ABR245C"
                     /product="ABR245Cp"
                     /transcript_id="NM_208547.2"
                     /db_xref="GeneID:4619190"
     CDS             complement(854838..856763)
                     /locus_tag="AGOS_ABR245C"
                     /old_locus_tag="ABR245C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIL014W (MNT3)"
                     /codon_start=1
                     /product="ABR245Cp"
                     /protein_id="NP_983194.2"
                     /db_xref="GeneID:4619190"
                     /translation="MCKWCGRWIVLAWEHQMSYRRSLSIWRLRTIRVPLLLALLGSVS
                     VLLLLSLTPHMWPGWPSPAAREVPASPESQAPASPELQAPASTQPQSPAGSKTLLQDL
                     LLDSKKPEGASTPQMQCKRYFEGTYLREPSWANSVLRMADDFLTATQYTARLLERWRI
                     FADCFVIQDFRISDTLSNKIDMHDFHQRMFPFLAKKREWRDMWPVITDINTGMTFEGG
                     AVWEGRQSEIDDGASFWKNWRSFSHGKGITMSVGDGHLEMLLRMLTVLDYLGNELPIE
                     IVEKGGELSQQFRDKLTEFVRNKSKQKVRIISCARTLDETHARLIFGFSCKWVALMFN
                     TFEEAIFLDVDAVPYILPEQFFDMEGYKSTGIMLFRDRLIDQHVSKECPDAVRQMIPT
                     QEETSIWNHKAKFSGPAANKEAYDNTKDEGAAAVYDRFFRDHYYHVVESGVVVFNKKN
                     KLQSIVNSFMLNLNFYYVGCFYGDKELMWVGQLLSAEDYYIHPAPPAILGSAEEFERE
                     GNTVSYRVCGAQIGHMELDGSLLWTNGGLRTCKFTDTAEQDFSKSPEYFNPKYSSPQQ
                     LQEHYSKPLEIQLIFIPELTYSVWEKSVECQGYTWCSTVTLNPENPSEFKSIVMKGDT
                     RLEHYNNISQRWNSASF"
     gene            <857668..>858423
                     /locus_tag="AGOS_ABR246W"
                     /old_locus_tag="ABR246W"
                     /db_xref="GeneID:4619305"
     mRNA            <857668..>858423
                     /locus_tag="AGOS_ABR246W"
                     /old_locus_tag="ABR246W"
                     /product="ABR246Wp"
                     /transcript_id="NM_208548.2"
                     /db_xref="GeneID:4619305"
     CDS             857668..858423
                     /locus_tag="AGOS_ABR246W"
                     /old_locus_tag="ABR246W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIR035C and YIR036C (IRC24) (IRC24) (IRC24) (IRC24)
                     (IRC24); Tandem gene quadruplication in this organism;
                     Tandem gene duplication in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABR246Wp"
                     /protein_id="NP_983195.2"
                     /db_xref="GeneID:4619305"
                     /translation="MVRVIIVTGASRGIGEATVEKLCTAPDVVVVGVARAEKTLKVLK
                     ERYGSKFDYVAGDVTDESVVQAVLDKVSSDYGRLDAIIANAGVSRFERIAEADIQQWK
                     RTFEINLFSAVSLVSKALPMLRKSQGTVIVVTSGLSKVGYRASASYASSKIALNHFIR
                     ILAAEEPALRAVAVAPGVVRTDMTVEALDASEDAPGARDNFFKAVLKQGRVVLPDAPG
                     AVLAALAVKGIPQELNGRFVQFDSEKLAAYAKL"
     gene            <858845..>859597
                     /locus_tag="AGOS_ABR247W"
                     /old_locus_tag="ABR247W"
                     /db_xref="GeneID:4619306"
     mRNA            <858845..>859597
                     /locus_tag="AGOS_ABR247W"
                     /old_locus_tag="ABR247W"
                     /product="ABR247Wp"
                     /transcript_id="NM_208549.1"
                     /db_xref="GeneID:4619306"
     CDS             858845..859597
                     /locus_tag="AGOS_ABR247W"
                     /old_locus_tag="ABR247W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIR035C and YIR036C (IRC24) (IRC24) (IRC24) (IRC24)
                     (IRC24); Tandem gene quadruplication in this organism;
                     Tandem gene duplication in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABR247Wp"
                     /protein_id="NP_983196.1"
                     /db_xref="GeneID:4619306"
                     /translation="MRVVIVTGASRGIGEATVEKLCPTADVVVVGVARAETKLQKLKA
                     RHGKKFDYVVGDVTDERVVQAVIDKVSSEYGRLDAVVANAGVSRHERIATADIKEWRR
                     LFEINLFSVVNLVSKALPLLRESQGTVIVVSSGLSQMGHPALAAYASSKIALNHFALI
                     LAMEEPEIRTIALDPGAVQTDMLAEGINAADEAAGSQDNAVRELLKQVRVATPEEPGA
                     VLAALAARGIPEELNGKYVRADSEKLAAYTSL"
     gene            <859919..>860704
                     /locus_tag="AGOS_ABR248W"
                     /old_locus_tag="ABR248W"
                     /db_xref="GeneID:4619307"
     mRNA            <859919..>860704
                     /locus_tag="AGOS_ABR248W"
                     /old_locus_tag="ABR248W"
                     /product="ABR248Wp"
                     /transcript_id="NM_208550.1"
                     /db_xref="GeneID:4619307"
     CDS             859919..860704
                     /locus_tag="AGOS_ABR248W"
                     /old_locus_tag="ABR248W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIR035C and YIR036C (IRC24) (IRC24) (IRC24) (IRC24)
                     (IRC24); Tandem gene quadruplication in this organism;
                     Tandem gene duplication in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABR248Wp"
                     /protein_id="NP_983197.1"
                     /db_xref="GeneID:4619307"
                     /translation="MGLLKINYQARMKVIIVTGASRGIGAATVDRLCSTPEVVVVGVA
                     RAETKLQELKARHGKKFDYVVGDVTDERVVQAVIDKVSSGYGRLDAVVANAGVAGHER
                     IEDADIKEWRRLFEINLFSVVNLASKALPLLRKSQGAFLVVSSMLSQMGVPAVATYAS
                     SKIALNHFAMILAMEEPEIRTIALDPGVAQTDMLTDGLNAADQAAGTQDNAAREMMRH
                     VRVASPDEPGTVLAALAAKGIPEELNGKFVVYDSEELAAYTKL"
     gene            <861492..>862244
                     /locus_tag="AGOS_ABR249W"
                     /old_locus_tag="ABR249W"
                     /db_xref="GeneID:4619308"
     mRNA            <861492..>862244
                     /locus_tag="AGOS_ABR249W"
                     /old_locus_tag="ABR249W"
                     /product="ABR249Wp"
                     /transcript_id="NM_208551.1"
                     /db_xref="GeneID:4619308"
     CDS             861492..862244
                     /locus_tag="AGOS_ABR249W"
                     /old_locus_tag="ABR249W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIR035C and YIR036C (IRC24) (IRC24) (IRC24) (IRC24)
                     (IRC24); Tandem gene quadruplication in this organism;
                     Tandem gene duplication in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABR249Wp"
                     /protein_id="NP_983198.1"
                     /db_xref="GeneID:4619308"
                     /translation="MKVIIVTGASRGIGAATVDRLCSTPDVVVVGVARAETKLQELKA
                     RHGKKFDYVVGDVTDERVVQAVIDKVSSEYGRLDAVVANAGVSYQQRIAEADIKEWRR
                     LFEINLFSVVNLASKALPLLRKSQGAFIAVTSGLSQMGHPALAAYASSKIALNHFALI
                     LAMEETEIRSLALDPGLVQTDMTAAALVAADKAAGTQDNSVRELTKQIRMVSPEEPGT
                     VLAALAAKGIPEELNGKYVTFDSEKLAAYTKL"
     gene            <863058..>863636
                     /locus_tag="AGOS_ABR250W"
                     /db_xref="GeneID:9487545"
     mRNA            <863058..>863636
                     /locus_tag="AGOS_ABR250W"
                     /product="ABR250Wp"
                     /transcript_id="NM_001355302.1"
                     /db_xref="GeneID:9487545"
     CDS             863058..863636
                     /locus_tag="AGOS_ABR250W"
                     /note="NOHBY220; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ABR250Wp"
                     /protein_id="NP_001342244.1"
                     /db_xref="GeneID:9487545"
                     /translation="MVLNTMAVVRLLLFAQFCLVLALAAATHTPARDSLTSLITGPQI
                     TRRPSVGKKPKFVGHHAHLDKVPARRVIDNNPGFHSALDVAASVDARKEEFHDAPEFI
                     SAALSKIPQIDSELRNELSTRAVNLYGHYSSCMPVINVFCQSTNQVSSHKAWHTSSTA
                     DTKGGLITSNHANFNFMYSFLPTVAVCCAFLL"
     gene            complement(<867781..>868725)
                     /locus_tag="AGOS_ABR251C"
                     /db_xref="GeneID:9487546"
     mRNA            complement(<867781..>868725)
                     /locus_tag="AGOS_ABR251C"
                     /product="ABR251Cp"
                     /transcript_id="NM_001355303.1"
                     /db_xref="GeneID:9487546"
     CDS             complement(867781..868725)
                     /locus_tag="AGOS_ABR251C"
                     /note="NOHBY221; No homolog in Saccharomyces cerevisiae;
                     Similar to Ashbya gossypii ABL211W"
                     /codon_start=1
                     /product="ABR251Cp"
                     /protein_id="NP_001342245.1"
                     /db_xref="GeneID:9487546"
                     /translation="MLRDIESTPLIEEHEHLEQLYLFYRYQYRLAICWLFCCVSHLSF
                     CSCILTRTWQLPQDEHVKKFISMLEYYDFYSSTACVAISIPMVPYLIMKRWEFTILPF
                     FLIPLIVYASMLWWVGDCLLNLFPLVKSWSLDDIATYCIWEGCILCAVVVLVPPAASL
                     ILFRKAAPTGERAPELYLGAHLDAPGNDAELNDDSLSMKSARTLPKLKLVKMFLAGLV
                     FPYLLIQVFFVIRAYSGSILRDISGKSELYAHALLVLLYAKVVRLLSMLFCICYSLIS
                     SKRTETVSVVGPLVFLYQSGFVMDSFYGYIVSTVDLVG"
     telomere        868825..870274
                     /note="Chromosome II right subtelomeric sequence. Shares
                     some sequence similarity with other subtelomeric regions."
     telomere        870275..870771
                     /note="chromosome II right end terminal telomere repeat;
                     composed of approximately 20 copies of a 24 base repeat
                     unit, and occasional sequence varients of this repeat"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_type=terminal
                     /rpt_unit_range=870744..870767
                     /rpt_unit_seq="ggtgtggtgtatgggtctctcagc"
CONTIG      join(AE016815.5:1..870771)
//
DBGET integrated database retrieval system