GenomeNet

Database: RefSeq
Entry: NC_005784
LinkDB: NC_005784
Original site: NC_005784 
LOCUS       NC_005784             907494 bp    DNA     linear   CON 14-SEP-2017
DEFINITION  Eremothecium gossypii ATCC 10895 chromosome III, complete sequence.
ACCESSION   NC_005784
VERSION     NC_005784.3
DBLINK      BioProject: PRJNA10623
            BioSample: SAMN03081415
            Assembly: GCF_000091025.4
KEYWORDS    RefSeq.
SOURCE      Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895)
  ORGANISM  Eremothecium gossypii ATCC 10895
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Eremothecium.
REFERENCE   1  (bases 1 to 907494)
  AUTHORS   Dietrich,F.S., Voegeli,S., Brachat,S., Lerch,A., Gates,K.,
            Steiner,S., Mohr,C., Pohlmann,R., Luedi,P., Choi,S., Wing,R.A.,
            Flavier,A., Gaffney,T.D. and Philippsen,P.
  TITLE     The Ashbya gossypii genome as a tool for mapping the ancient
            Saccharomyces cerevisiae genome
  JOURNAL   Science 304 (5668), 304-307 (2004)
   PUBMED   15001715
REFERENCE   2  (bases 1 to 907494)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 907494)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 907494)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 907494)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2007) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   6  (bases 1 to 907494)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2002) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE016816.
            On Aug 5, 2010 this sequence version replaced NC_005784.2.
            This genome has been completely resequenced to high accuracy (derf)
            and reannotated. Gene names have been maintained, though some genes
            have been added, and many protein sequences have been corrected.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..907494
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /culture_collection="ATCC:10895"
                     /db_xref="taxon:284811"
                     /chromosome="III"
     source          2559..57203
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1677"
     source          3631..64548
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1086"
     source          57213..135792
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1274"
     source          107128..176940
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1790"
     source          149823..243459
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1190"
     source          201398..267970
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1174"
     source          264450..332467
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1022"
     source          325912..386547
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1575"
     source          371236..419267
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1061"
     source          404424..464899
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1912"
     source          444094..492746
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1713"
     source          477754..540368
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1901"
     source          523833..587378
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1503"
     source          571891..644277
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1132"
     source          639028..723809
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1591"
     source          715565..785511
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1038"
     source          760870..838803
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1820"
     source          814120..874204
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2333"
     source          832880..895506
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC DNA bAG2449"
     telomere        complement(1..577)
                     /note="Chromosome III left end terminal telomere repeat.
                     Composed of approximately 20 copies of a 24 base repeat
                     unit, and occasionally sequence varients of this repeat."
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_type=terminal
                     /rpt_unit_range=16..39
                     /rpt_unit_seq="ggtgtggtgtatgggtctctcagc"
     telomere        complement(578..1100)
                     /note="Chromosome III left subtelomeric sequence. Shares
                     some sequence similarity with other subtelomeric regions."
     gene            complement(<1205..>3841)
                     /locus_tag="AGOS_ACL205C"
                     /old_locus_tag="ACL205C"
                     /db_xref="GeneID:4619316"
     mRNA            complement(<1205..>3841)
                     /locus_tag="AGOS_ACL205C"
                     /old_locus_tag="ACL205C"
                     /product="ACL205Cp"
                     /transcript_id="NM_208552.2"
                     /db_xref="GeneID:4619316"
     CDS             complement(1205..3841)
                     /locus_tag="AGOS_ACL205C"
                     /old_locus_tag="ACL205C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YPR194C (OPT2)"
                     /codon_start=1
                     /product="ACL205Cp"
                     /protein_id="NP_983199.2"
                     /db_xref="GeneID:4619316"
                     /translation="MSKISEGVGDPPSYGSRSPSLSSHDKEKEKYNAGAEEQVTAEVL
                     TDEQLVYLISRMGYDHPRDLSDVPASVRYLESKLAELDIEKCLRIIDLSFEIHNEDFN
                     LKTDDWNDLVRFSKRDFDPEDPQHVFELKTVAGIFEYYSPYVEVRAVASPVDDPTIPV
                     ETFRAYFLATFWVVVGSALTMFFSERQPSIALSISAVQMLVYPCGLLWARLMPCWGFN
                     VYGRRIALNIDSPWTEKEQMFVTLLYGITTGSFYANYNILTQHIHYRSPMPYAYQLLL
                     SIPLQFLGFGLAGIMRKYVVYPATAMWPSIMTTIALNKAMMSDEHSGGFGRKKMFYLT
                     FAIIFVYNWFPTYLFEALSTFNWITWIKPDNFNLATVTGGINGVGLNPLSTLDWTNIG
                     VGGFYLPFRVTLTMYMGGLLAALITLGVYYMNYSECQFLPIFTQSLYNNKAKVYQVEE
                     ILTEDRLLDEQKFQKYGFPYYTAGNMVAYGCFMCVYTALVVSSILQQGAFYMRVYKAW
                     ILDLWSLRTRSGLREAFSNEKHVLDEFHDPHCRMMRKYKEVPEWWYMSIFVVSIVIGV
                     IVVTTFKTNTPVWGLFLAVGLNFILLLPITLLQATRGVTIGLNLLLQMISGLALPGNP
                     YALMFIKAFGYNIDGQTDNYLSNMKMAHYAKIPPIPLFRGQLLMVLIQVFVNLGVINW
                     QLHNVENYCDPKQRFKFTCPGVRTYFNASVMWGAIGPRRIFEHVYPIMKWCWLIGACV
                     GLFFGIWKRLSIMYDKIPYPRRFSPVIFIIGMLSFGPPYNLQYSTSGLYVGFISMFYL
                     KRYHLRIWERYNYVIAAAITCGVVFSAILMFFSVQWKDIELNWWGNSISYAGLDYARV
                     PLLNVTETERGYFGPELGHIPK"
     gene            <3901..>4620
                     /locus_tag="AGOS_ACL204W"
                     /old_locus_tag="ACL204W"
                     /db_xref="GeneID:4619320"
     mRNA            <3901..>4620
                     /locus_tag="AGOS_ACL204W"
                     /old_locus_tag="ACL204W"
                     /product="ACL204Wp"
                     /transcript_id="NM_208553.2"
                     /db_xref="GeneID:4619320"
     CDS             3901..4620
                     /locus_tag="AGOS_ACL204W"
                     /old_locus_tag="ACL204W"
                     /note="NOHBY315; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACL204Wp"
                     /protein_id="NP_983200.2"
                     /db_xref="GeneID:4619320"
                     /translation="MLLHIYRYPYLSIYRSSKYLRIRLYVCCCVTPRRSRLECLVQIS
                     LLECGFCPIPHLSRLLLLVILLITAIRTTEDSIMGTHYRIQATHILRRALDEPWRYVS
                     MRLHPSRVSKRRCQLQRELRTTYFGGQYVDNRNPHLRTWCGRVYSLHYLPSHYYKLHR
                     WEFQRYKCNIRELLFRISRNSVLQDVCHALRRQNKHPQIGDTAFSIGNCDKVTQGNAN
                     CGDGAKARSWSRNGVASVLMV"
     gene            complement(<4853..>6466)
                     /locus_tag="AGOS_ACL203C"
                     /old_locus_tag="ACL203C"
                     /db_xref="GeneID:4619321"
     mRNA            complement(<4853..>6466)
                     /locus_tag="AGOS_ACL203C"
                     /old_locus_tag="ACL203C"
                     /product="ACL203Cp"
                     /transcript_id="NM_208554.1"
                     /db_xref="GeneID:4619321"
     CDS             complement(4853..6466)
                     /locus_tag="AGOS_ACL203C"
                     /old_locus_tag="ACL203C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIL166C, YOL162W and YOL163W; YOL162W and YOL163W
                     represent one ORF in this genome"
                     /codon_start=1
                     /product="ACL203Cp"
                     /protein_id="NP_983201.1"
                     /db_xref="GeneID:4619321"
                     /translation="MEVRASEEVSSKSEEGCDIVELEHFTGTNPFADPVVAEYYRNLY
                     REANYECRNHFDPELKWSKDEEKRLVRRLDFKVAFIACILFCAMEADRFNYFQGTSDE
                     MLEELNVTTNDYNLGNQLFNVFHLLGTVPVQLIAKRYGVERVVPCQMIIWGCVAMAQA
                     GMRNKVGLIILRVFMGLAEAGFAAIMVTWLTSFYTAKELGMRVSYFWVAQGLMNSVLP
                     LASYGIFRMRGICGLSGWQWLFLFEGVITCVMGIFGFFYFVPSIVETKSLLHPKGWFT
                     ERQELIAVNRLLRDDPSKGDMNNKTGVSAKLFIEALLDYDLWPLYLLALVHFFPEAAA
                     GPYMLIILKDVGFSTFTVQLLSISNFFSNTVAILVMLKIYEVVDERSLLSLVSCVWKL
                     VLLGFLRWWKGAFETRWETYALMVVLLACPYIFPMMFSWASRNSHSIKTRSVSAAVLQ
                     VFNVIGFVCGNQIYRMDDAPLYHRGNTILFFLMLANIPIFIGVKLYYMWRNRRRELVW
                     NAMTEQDRQSYIENTTDKGNKRLDFRFAH"
     gene            7554..7635
                     /locus_tag="AGOS_t0043"
                     /db_xref="GeneID:4619322"
     tRNA            7554..7635
                     /locus_tag="AGOS_t0043"
                     /product="tRNA-Ser"
                     /codon_recognized="UCU"
                     /db_xref="GeneID:4619322"
     gene            <8390..>9742
                     /locus_tag="AGOS_ACL202W"
                     /old_locus_tag="ACL202W"
                     /db_xref="GeneID:4619313"
     mRNA            <8390..>9742
                     /locus_tag="AGOS_ACL202W"
                     /old_locus_tag="ACL202W"
                     /product="ACL202Wp"
                     /transcript_id="NM_208555.1"
                     /db_xref="GeneID:4619313"
     CDS             8390..9742
                     /locus_tag="AGOS_ACL202W"
                     /old_locus_tag="ACL202W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YMR238W (DFG5); Tandem gene triplication in this genome"
                     /codon_start=1
                     /product="ACL202Wp"
                     /protein_id="NP_983202.1"
                     /db_xref="GeneID:4619313"
                     /translation="MYALVIFNIVLCNALDVNFNSSASICNATKLIQQGILDYYEGLR
                     PGGRVGFFQEPYYWWMAGDVFGGMVENWYLCDNTEYKDLLTEAMVSQIGENKDYVPWH
                     QRMVEGNDDQGIWGLLVMDAAERDFPDAPPDQAPGWLALAQAVFNTMWARWDMDNCAG
                     GLLWQIYPWNVGYDYKNTISNGYLFQIAARLARFTGNSTYGRVAETVFDWLVDSKLVQ
                     LDNVALVLDGAHVYTNCTDFTRYEWTYNYGVVLGGCAYMYNFTNGSPVWANRLNRVLN
                     GALLFFENGIMYERTCQDVDRCNNDQRFFKSIFTRMLALTSVLAPHTKARIEPNIRKS
                     AEAAAKSCNGGSDGHTCGLVWRNYTWDGKAGLGEQLCALEIIQNTLIHTKRPPLTAKQ
                     GAKSKGDPAAGLNSSRYDLPIVHPPSGQKSSILTTLRSLSSSAKVHRHYASTSTRVVQ
                     "
     gene            <10277..>11623
                     /locus_tag="AGOS_ACL201W"
                     /old_locus_tag="ACL201W"
                     /db_xref="GeneID:4619323"
     mRNA            <10277..>11623
                     /locus_tag="AGOS_ACL201W"
                     /old_locus_tag="ACL201W"
                     /product="ACL201Wp"
                     /transcript_id="NM_208556.1"
                     /db_xref="GeneID:4619323"
     CDS             10277..11623
                     /locus_tag="AGOS_ACL201W"
                     /old_locus_tag="ACL201W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YMR238W (DFG5); Tandem gene triplication in this genome"
                     /codon_start=1
                     /product="ACL201Wp"
                     /protein_id="NP_983203.1"
                     /db_xref="GeneID:4619323"
                     /translation="MYVLLVILNIVLSNALDVDFNSSESICDATKLIQVGILDYYEGA
                     KPGGRAGFLVKPYYWWMAGEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYMPS
                     HQKMVEGNDDQGIWGLLVMGAAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCG
                     GGLRWQIFPWNGGYDYKNTISNACLFQIAARLARFTGNSTYQDVAETVFDWLVDVKLV
                     ELENDARVLDGAHISERCEDHSQLEWTYNHGVVLGGCAYMYNITNGSAVWGDRLNKVL
                     NGSLLFFENGILYERACQDVNKCNDDQRSFRSIFSRMLALTSVLAPHTKARIEPNIRK
                     SAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQLSALEIIQNTLIHTKPPPTTAN
                     EGAKSQGDPGAGLQLSSPNSITLPTRQIRLKDRVGAGFATVVFLLPFITGSIWMSI"
     gene            <12145..>13536
                     /locus_tag="AGOS_ACL200W"
                     /old_locus_tag="ACL200W"
                     /db_xref="GeneID:4619324"
     mRNA            <12145..>13536
                     /locus_tag="AGOS_ACL200W"
                     /old_locus_tag="ACL200W"
                     /product="ACL200Wp"
                     /transcript_id="NM_208557.1"
                     /db_xref="GeneID:4619324"
     CDS             12145..13536
                     /locus_tag="AGOS_ACL200W"
                     /old_locus_tag="ACL200W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YMR238W (DFG5); Tandem gene triplication in this genome"
                     /codon_start=1
                     /product="ACL200Wp"
                     /protein_id="NP_983204.1"
                     /db_xref="GeneID:4619324"
                     /translation="MTVAFVRVGAEPSLPMYVLLVILNIVLSNALDVDFNSSESICDA
                     TKLIQVGILDYYEGLRPGGRVGFFQKPYYWWMAGEAFGGMVENWYLCNNTEYQDLLTD
                     AMVSQIGENKDYVPSHQKMIEGNDDQGIWGLLVMGAAERNFPDAPPERAPGWLALAQA
                     VFNTMWARWDPENCGGGLRWQIFPWNNGYDYKNTISNACLFQIAARLARFTGNSTYQD
                     VAETVFDWLVDSKLVQLENDAKVLDGAHISERCEDHSKLEWTYNHGVVLAGCAYMYNI
                     TNGSAVWGDRLNKVLNGSLLFFPNGILYERACQDVQKCNDDQRSFRSIFSRMLALTSV
                     LAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQLSALEII
                     QNTLIHTKPPPTTANEGAKSKGDPSAGLYDNSPNIITLSTRQIGLKDRVGAGFMTVVL
                     LIPFITGSIWMSI"
     gene            complement(<13961..>15061)
                     /locus_tag="AGOS_ACL199C"
                     /old_locus_tag="ACL199C"
                     /db_xref="GeneID:4619325"
     mRNA            complement(<13961..>15061)
                     /locus_tag="AGOS_ACL199C"
                     /old_locus_tag="ACL199C"
                     /product="ACL199Cp"
                     /transcript_id="NM_208558.2"
                     /db_xref="GeneID:4619325"
     CDS             complement(13961..15061)
                     /locus_tag="AGOS_ACL199C"
                     /old_locus_tag="ACL199C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR191W (QCR2)"
                     /codon_start=1
                     /product="ACL199Cp"
                     /protein_id="NP_983205.2"
                     /db_xref="GeneID:4619325"
                     /translation="MLSQRLQCSKQFARHLSVAAKDGSGKVSTLSVQVQGGSRYATKD
                     GVAHLLSRFNFHNTGNKSALRLVRESELLGGRFQSTVDREHITLSATFLKEDLPYFVN
                     ALADVLYKTSFRPHELAESVLPAATRDAAVARACPVAAAEEALYSVTYRHGLGKPVLY
                     DGVEKVTLEDIKAYADKVYTKENVTVLGQGINEADLKRFVNDSLLASLPSGTSLAGSG
                     NAKTHSGEARLRHAGSSVAAIAVPVAKADFATYEVLARYLTSDLYALSPLVHKAKLDK
                     YTDGGLFSLYVKSAEAAKAAADIKKVVADLKAGKDISVARKYAALQLAVENDSAASPV
                     SLKLENAKDFKLGKFNYVAVGDVSNLPFADEL"
     gene            <15600..>16784
                     /locus_tag="AGOS_ACL198W"
                     /old_locus_tag="ACL198W"
                     /db_xref="GeneID:4619326"
     mRNA            <15600..>16784
                     /locus_tag="AGOS_ACL198W"
                     /old_locus_tag="ACL198W"
                     /product="ACL198Wp"
                     /transcript_id="NM_208559.2"
                     /db_xref="GeneID:4619326"
     CDS             15600..16784
                     /locus_tag="AGOS_ACL198W"
                     /old_locus_tag="ACL198W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR355C (ILV5)"
                     /codon_start=1
                     /product="ACL198Wp"
                     /protein_id="NP_983206.2"
                     /db_xref="GeneID:4619326"
                     /translation="MFRAAGRQMIAGTRAAAWRALSGARARAAMRPVRSARAAPLVQS
                     RGVKQISFGGTPETVYERADWPREKLLEYFKNDTLALIGYGSQGHGQGLNLRDTGLKV
                     VVGVRKGGASWKAAVEDGWVPGENLFDVVEAVERGTIVMNLLSDAAQSETWPTLRPLL
                     TPGKTLYFSHGFSPVFKDLTHVEPPKDIDVILVAPKGSGRTVRSLFLEGRGINSSYAV
                     WNDATGRAHEKAQALAVAVGSGYVYETTFEKEVNSDLYGERGCLMGGIHGMFLAQYEV
                     LRENGHSPSEAFNETVEEATQSLYPLIGKHGMDYMYDACSTTARRGALDWYPIFKDAL
                     KPVFRDLYESTRNGSETKRSLEFNSQPDYRDKLEAELQTIRDMEIWKVGKEVRKLRPE
                     NN"
     gene            <16997..>17677
                     /locus_tag="AGOS_ACL197W"
                     /old_locus_tag="ACL197W"
                     /db_xref="GeneID:4619327"
     mRNA            <16997..>17677
                     /locus_tag="AGOS_ACL197W"
                     /old_locus_tag="ACL197W"
                     /product="ACL197Wp"
                     /transcript_id="NM_208560.1"
                     /db_xref="GeneID:4619327"
     CDS             16997..17677
                     /locus_tag="AGOS_ACL197W"
                     /old_locus_tag="ACL197W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YBL064C (PRX1)"
                     /codon_start=1
                     /product="ACL197Wp"
                     /protein_id="NP_983207.1"
                     /db_xref="GeneID:4619327"
                     /translation="MSNTLRPQIYVGCKAPNFQVQSSQGIIDFYDYIGDSWCLFFSHP
                     ADFTPVCTTEIGALASLAEEFAMRRCKLLGLSTNNRATHVKWLKDIERVTGFRVNFPL
                     LCDVDRRLSTVFGMLDARTLDADGHPVPLRSTYFVDPNKVIRLVQSYPLSTGRNTAEL
                     LRCLDSLQLSDATSHQFMTPVNWIPGDDVVLAPDLDAPTMQEKYPEHRTIRDYLRLAP
                     FDPDQLDR"
     gene            <18016..>19020
                     /locus_tag="AGOS_ACL196W"
                     /old_locus_tag="ACL196W"
                     /db_xref="GeneID:4619328"
     mRNA            <18016..>19020
                     /locus_tag="AGOS_ACL196W"
                     /old_locus_tag="ACL196W"
                     /product="ACL196Wp"
                     /transcript_id="NM_208561.2"
                     /db_xref="GeneID:4619328"
     CDS             18016..19020
                     /locus_tag="AGOS_ACL196W"
                     /old_locus_tag="ACL196W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR354C (TAL1) and YGR043C (NQM1)"
                     /codon_start=1
                     /product="ACL196Wp"
                     /protein_id="NP_983208.2"
                     /db_xref="GeneID:4619328"
                     /translation="MVEPTLKKQRTGNSLAQLKATGTTVVADTGDFEAIAKYAPQDAT
                     TNPSLILAAARKEGYQALIDRAVEYGRSRDGSVEQQTEAAVDRLLVEFGKEILKVVPG
                     RVSTEVDARLSFDKDATVRKALEIISLYEQQGVSKDRVLIKIASTWEGIQAARELESQ
                     HGIHVNCTLLFSFCQAVAAAEAGVTLISPFVGRILDWYKASTGKTYSGDEDPGVLSVR
                     RIYNYFKKHDYPTIVMGASFRNLDEIKALAGVDFLTISPALLEQLMTSADPVPQVLDP
                     ASAKAQGDDKVSYVEDEPAFRFALNDDAMATEKLAEGIRKFSEDIVTLFAMVEERIRA
                     "
     gene            complement(<19203..>19532)
                     /locus_tag="AGOS_ACL195C"
                     /old_locus_tag="ACL195C"
                     /db_xref="GeneID:4619329"
     mRNA            complement(<19203..>19532)
                     /locus_tag="AGOS_ACL195C"
                     /old_locus_tag="ACL195C"
                     /product="ACL195Cp"
                     /transcript_id="NM_208562.1"
                     /db_xref="GeneID:4619329"
     CDS             complement(19203..19532)
                     /locus_tag="AGOS_ACL195C"
                     /old_locus_tag="ACL195C"
                     /note="NOHBY314; No homolog in Saccharomyces cerevisiae;
                     Non-syntenic homolog of Kluyveromyces lactis KLLA0D00396g"
                     /codon_start=1
                     /product="ACL195Cp"
                     /protein_id="NP_983209.1"
                     /db_xref="GeneID:4619329"
                     /translation="MADSGSDSHGDKRAAGYVHSTWKMKKPLRSCVRCRKNKIKCDSA
                     TRRPKPCSSCLKKGVGCELEYVIPPQRSKELRSLYENVAYVRLKLNELMESCDQLLDY
                     CHASVDA"
     gene            complement(<19831..>20496)
                     /locus_tag="AGOS_ACL194C"
                     /old_locus_tag="ACL194C"
                     /db_xref="GeneID:4619330"
     mRNA            complement(<19831..>20496)
                     /locus_tag="AGOS_ACL194C"
                     /old_locus_tag="ACL194C"
                     /product="ACL194Cp"
                     /transcript_id="NM_208563.2"
                     /db_xref="GeneID:4619330"
     CDS             complement(19831..20496)
                     /locus_tag="AGOS_ACL194C"
                     /old_locus_tag="ACL194C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR042W"
                     /codon_start=1
                     /product="ACL194Cp"
                     /protein_id="NP_983210.2"
                     /db_xref="GeneID:4619330"
                     /translation="MSSGKTVSHVVEYFCQYTDQLRKKHKVWHDGKLKYYTLTNKFQL
                     YTEEGGTLLGSEFVTNSRQLAHILDERGFGAEEHHIFAAFLIIIAELDRAYDKEISLF
                     RPGHTPRALPGPVVSLAHRRAPSSPSGSQQSRARALPHARHSLSLAKNEPFRRPRQAA
                     RQRSRSPAAREPARSASQPTPRAAPLATLPAAAHASQPAGLALATRIPPRKRTIVHSP
                     ITL"
     gene            complement(<21009..>22628)
                     /locus_tag="AGOS_ACL193C"
                     /old_locus_tag="ACL193C"
                     /db_xref="GeneID:4619331"
     mRNA            complement(<21009..>22628)
                     /locus_tag="AGOS_ACL193C"
                     /old_locus_tag="ACL193C"
                     /product="ACL193Cp"
                     /transcript_id="NM_208564.1"
                     /db_xref="GeneID:4619331"
     CDS             complement(21009..22628)
                     /locus_tag="AGOS_ACL193C"
                     /old_locus_tag="ACL193C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR041W (BUD9) and YLR353W (BUD8)"
                     /codon_start=1
                     /product="ACL193Cp"
                     /protein_id="NP_983211.1"
                     /db_xref="GeneID:4619331"
                     /translation="MSYIRSLLDQQDSQEDSTDPETNSSTSSAGSGLLCGLQHSQARR
                     TDSFFRESFNSPKATARSTNSPPKMDSRVSVYSQAASGTTLENDQATITQHSRPFLPA
                     LMSSSRTLANRRSVATQRDHDSQPPQSGGSSSMESTHTQVPSPTDTLLSDSRSPAKSI
                     SSRGKPGLSNYRLPNNSFAESLESHVPVHQQNTSASSSDNMRVDSHKTMPGSYLLSDR
                     IAQEPIEEEQESDTDMYTTARYSFSSKRGSHMAHNVPYVFRTTSNWATLSTAPDGSIA
                     SLVEASNIMHDTLENEAKASQTSKSSRHATSEHGSPQKEAATKGSRISLPLQSLRSKS
                     DKGEHTTPSSKPKSRHGSRDLNVHSKAASASPASGLDSSPQSSAMSSDPLLARPQRSR
                     SKSMDSADYELQQIYQYYEYKGIRRHMMDLEKGCTTVRETDSDQFSPSQWTKSTLFSI
                     PRVMLILFFGLFIPPLLFMIGGGTYSGVSDRILIKMIIHKAHRHKADRGYLWDVDVRW
                     FRRLAIAVGVVELLTIIALIGVGFGLGLATE"
     gene            complement(<23513..>25966)
                     /locus_tag="AGOS_ACL192C"
                     /old_locus_tag="ACL192C"
                     /db_xref="GeneID:4619332"
     mRNA            complement(<23513..>25966)
                     /locus_tag="AGOS_ACL192C"
                     /old_locus_tag="ACL192C"
                     /product="ACL192Cp"
                     /transcript_id="NM_208565.1"
                     /db_xref="GeneID:4619332"
     CDS             complement(23513..25966)
                     /locus_tag="AGOS_ACL192C"
                     /old_locus_tag="ACL192C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR352W"
                     /codon_start=1
                     /product="ACL192Cp"
                     /protein_id="NP_983212.1"
                     /db_xref="GeneID:4619332"
                     /translation="MGEEFVGRKQLPPEIVYEILSYQFRDLMSNDHPPSSEKYHNNLR
                     MFLRSNSTVNKTFNHVCRVLTYRYLNFTTARCFNKILEVLKHDKTGLSGLVQVADFQE
                     LTSIGLGRTGEMNRIIKNLTNETLFEFLQLTTHSLREFLASEHIQGDLDEQVIYHLVR
                     PGSLFNVLDFCGCSGPSFTETFVRVIDRLYDADSDEPREQNYQLTSVGLNDCTDLPAL
                     TLGRFLKTQPELQKLDLSHTSIDDHTLLHSLPHWKNLTHLSLACCSQLTPRAILEFFS
                     YHPAITDENNTTLQWLNLKAHKHTSSWTETQTMFLLKKLCRYGHNNTLQYLNIDGLPL
                     HYSEDNKITKTPYYYQCQDTLKFIKWNFPKLKSLSIRKSSVPIPSLVKLLSSFDSYEE
                     ENVEDMSPSSPRSPLLEGALPVPSQQLKFLDVAGNSYINKWTINDPALFTCSDSLVAL
                     EVSFECWQQIESRANSEVIFMRPKSPNNSRSSIIQDYSRVEEVKWKCYIDASYGRRYW
                     LFRTDDYLNGDDLDARGSVTRYDEEGNRVIDITKQPDFLKFAQNKIMLGCGIVSLNSV
                     RRHNTYRDTKPPISRFFQKDGKLTMGGSRTLPIRSPRLPPGAWRHVNNETIMSTDAEL
                     DDIPDSAASNNYQLSPGGVELNFGHQEPLRRSGTRDGLYWDRSVTDLHLLGATEPAIT
                     GRPDSLMTIGSNHASAAADEYDTSYDYLNNPELQRRRSQFSLFRRRPSSIPNESVIPR
                     PSLLTKTFKNHALMARGLPPQYYNMYPYRDLLRDSCIYYSPSAETNERYRKHLEMVQE
                     YEVFGCLERGMYRYYSLRT"
     gene            complement(<26476..>27573)
                     /locus_tag="AGOS_ACL191C"
                     /old_locus_tag="ACL191C"
                     /db_xref="GeneID:4619333"
     mRNA            complement(<26476..>27573)
                     /locus_tag="AGOS_ACL191C"
                     /old_locus_tag="ACL191C"
                     /product="ACL191Cp"
                     /transcript_id="NM_208566.1"
                     /db_xref="GeneID:4619333"
     CDS             complement(26476..27573)
                     /locus_tag="AGOS_ACL191C"
                     /old_locus_tag="ACL191C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR040W (KSS1)"
                     /codon_start=1
                     /product="ACL191Cp"
                     /protein_id="NP_983213.1"
                     /db_xref="GeneID:4619333"
                     /translation="MPRTITFDIPSHYKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKI
                     QPFTRPMFVTRTLRELKLLKFFHSHENIISVLDIVRPTSYQDFEAVYLVQELMETDLQ
                     RIISQPNSFLSDDHIQYFTYQILRALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFG
                     LSRCLASSDRSRENMVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMIS
                     GKPLFPGRDYHHQLWIILEILGTPSFEDFEQIKSKRAKAYIANLPMRPKIPWNVALST
                     NDINPLAMDLLDKMLTFNPDKRISAADALKHPYLETYHDAEDEPDYELLNLQDNFWKV
                     DNEARQKTEEEELSMDTLKAMLYEEVMKPLQ"
     gene            <27999..>28874
                     /locus_tag="AGOS_ACL190W"
                     /old_locus_tag="ACL190W"
                     /db_xref="GeneID:4619334"
     mRNA            <27999..>28874
                     /locus_tag="AGOS_ACL190W"
                     /old_locus_tag="ACL190W"
                     /product="ACL190Wp"
                     /transcript_id="NM_208567.1"
                     /db_xref="GeneID:4619334"
     CDS             27999..28874
                     /locus_tag="AGOS_ACL190W"
                     /old_locus_tag="ACL190W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR351C (NIT3)"
                     /codon_start=1
                     /product="ACL190Wp"
                     /protein_id="NP_983214.1"
                     /db_xref="GeneID:4619334"
                     /translation="MSEILRAKVKVALVQLAGSSASKAANLARAGQFIERAMTEQPDT
                     GLVVLPECFNAPYEIGKFREFAEVAAEGPESPSVGFLAGQARRWGVTLVGGTIPELEP
                     DTQRVYNTCLVFDGKGALVGKHRKVHLFDVDIPGKITFTESRTLAAGRHVTQVDTPAG
                     ALGVGVCYDLRFPELAMVCARRGAYAMVYPSAFNTTTGPLHWHLLARARSVDNQIYTL
                     LCSPARVAGASYQAYGHSLVVDPTGRVVAEAGEGEEILYATLDPAELDWVRRAIPVTR
                     QRRFDVYADVAASSP"
     gene            complement(<28911..>29510)
                     /locus_tag="AGOS_ACL189C"
                     /old_locus_tag="ACL189C"
                     /db_xref="GeneID:4619335"
     mRNA            complement(<28911..>29510)
                     /locus_tag="AGOS_ACL189C"
                     /old_locus_tag="ACL189C"
                     /product="ACL189Cp"
                     /transcript_id="NM_208568.1"
                     /db_xref="GeneID:4619335"
     CDS             complement(28911..29510)
                     /locus_tag="AGOS_ACL189C"
                     /old_locus_tag="ACL189C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR038W (ORM1) and YLR350W (ORM2)"
                     /codon_start=1
                     /product="ACL189Cp"
                     /protein_id="NP_983215.1"
                     /db_xref="GeneID:4619335"
                     /translation="MTQLKTFPSYGSERMVVEPVSDHRRRRSSSIISHVEPETFEEEN
                     DQQLLPNMNATWVEQRGAWGIHVVIIVLLKVFYNLVPGLSNEWSWTMTNMTYVVGSYI
                     MFHLMKGTPFEFNGGAYDNLTMWEQLDNGMLYTPTRKFLISVPIALFLLSTHYTRYDL
                     QLFVLNFVLTTMVAVVPKLPLTHRVRISIPGITGPAQIG"
     gene            <29727..>30035
                     /locus_tag="AGOS_ACL188W"
                     /old_locus_tag="ACL188W"
                     /db_xref="GeneID:4619336"
     mRNA            join(<29727..29753,29802..>30035)
                     /locus_tag="AGOS_ACL188W"
                     /old_locus_tag="ACL188W"
                     /product="ACL188Wp"
                     /transcript_id="NM_208569.1"
                     /db_xref="GeneID:4619336"
     CDS             join(29727..29753,29802..30035)
                     /locus_tag="AGOS_ACL188W"
                     /old_locus_tag="ACL188W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR037C (ACB1); 1-intron"
                     /codon_start=1
                     /product="ACL188Wp"
                     /protein_id="NP_983216.1"
                     /db_xref="GeneID:4619336"
                     /translation="MVSQLFEEKAAAINKVTTAPTQDEMLQLYGLYKQATVGDNTKEK
                     PGIFNMKDRYKWDAWEKLKGKSPAEAEQEYIALVDALLAKYA"
     gene            <30323..>32908
                     /locus_tag="AGOS_ACL187W"
                     /old_locus_tag="ACL187W"
                     /db_xref="GeneID:4619337"
     mRNA            <30323..>32908
                     /locus_tag="AGOS_ACL187W"
                     /old_locus_tag="ACL187W"
                     /product="ACL187Wp"
                     /transcript_id="NM_208570.2"
                     /db_xref="GeneID:4619337"
     CDS             30323..32908
                     /locus_tag="AGOS_ACL187W"
                     /old_locus_tag="ACL187W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR347C (KAP95)"
                     /codon_start=1
                     /product="ACL187Wp"
                     /protein_id="NP_983217.2"
                     /db_xref="GeneID:4619337"
                     /translation="MSAQEIAQLLSNTILSPDAGVRLQSETQLRKLSNDNFLQYAGTL
                     SQLLADESVILEARILAALTLKNELVSKDPVKGQQFAQRWLGLVDAESRHHIKQFALA
                     ALVDKQPRVANASAQLIAAIADIELPRDEWPDLMKILVENTTQHQPENVKRASLLVLG
                     YICEGADLSNKALIAQSNNILIAIVQGAQISEPSKAVRLTALNSLADSLAFIKNNMER
                     EGERNYLMQVVCEATQADDEEIQAAAFGCLCKIMAQFYFLMKPYMEQALYALTISTMQ
                     SQNEKVASMAVEFWSTICEEEIDIAYELSQFPESPLQSFNFALSSLQEVVPNLLVLLT
                     KQNEDPEDDDWNLAMSAGACLQLFAQNCGNYIVEPVLQYVEQNITSENWRQREAAVMS
                     FGSILDGPDKVQLVSLVHQALPPILNLINDPVLQVKETVAWCIGRIADLVVGAIDPQR
                     HLSDVINACLLGLNDHPKVATNCAWTIINLVEQLADNPGSPIYNYYPVLVDSLMKTAN
                     RPDNEHGVRASAFSALTTLVEFSTDQVGESVTSISSYVLDKLGHTINIDEGQLSTDDR
                     QSLEELQSNILTVLSASIRKNPQSVSAVSDMLMDLFLKLLSKKDSSYIEDDVFYVISS
                     LATSMGKGFERYLETFSPYLVHALNQVQSQVSVTAVGLIADISNSLEDDFKKFAPAFM
                     NVLGSMISSQDARMELKPAVLSVFGDIASNIGDDFIPYLNQVMALCVAAQNSGPESAS
                     LDALEYNVKVQEAVLDAYVGMVAGLHSQPDALFQYAGTIFQFLSSFAENPALSSEDTS
                     ARSAVGIIGDIASMFPDGRIKQLYAQTWVTEFIKKTRSNPNFSQATKDTARWAREQQK
                     HQLTL"
     gene            <33458..>34162
                     /locus_tag="AGOS_ACL186W"
                     /old_locus_tag="ACL186W"
                     /db_xref="GeneID:4619338"
     mRNA            <33458..>34162
                     /locus_tag="AGOS_ACL186W"
                     /old_locus_tag="ACL186W"
                     /product="ACL186Wp"
                     /transcript_id="NM_208571.1"
                     /db_xref="GeneID:4619338"
     CDS             33458..34162
                     /locus_tag="AGOS_ACL186W"
                     /old_locus_tag="ACL186W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR036C (CAX4)"
                     /codon_start=1
                     /product="ACL186Wp"
                     /protein_id="NP_983218.1"
                     /db_xref="GeneID:4619338"
                     /translation="MIGTQMFPMDNLIPFDDTYVLYDPNDIVSFISCYFSLLPIAILV
                     FYFSWFVTNREMEAVFIAIGHLMNEILNNVVKNVIREPRPNNFGTFQKETLRSGFGMP
                     SAHSQFMGFFALYHCMRIWLQWTGLRRVHKVLGSVAVVIATTCVAGSRVYLGYHDVPQ
                     VLVGVSIGAFLGSLYFLLVGLIRHSGLSDWVLTWRLAKWFLVKDSCYHAPISLREEYE
                     AYWRRRSRIEGPGKTE"
     gene            complement(<34360..>36060)
                     /locus_tag="AGOS_ACL185C"
                     /old_locus_tag="ACL185C"
                     /db_xref="GeneID:4619339"
     mRNA            complement(<34360..>36060)
                     /locus_tag="AGOS_ACL185C"
                     /old_locus_tag="ACL185C"
                     /product="ACL185Cp"
                     /transcript_id="NM_208572.1"
                     /db_xref="GeneID:4619339"
     CDS             complement(34360..36060)
                     /locus_tag="AGOS_ACL185C"
                     /old_locus_tag="ACL185C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR345W"
                     /codon_start=1
                     /product="ACL185Cp"
                     /protein_id="NP_983219.1"
                     /db_xref="GeneID:4619339"
                     /translation="MSAIISSDEDTDSGCESRSSGIKQTDAGQVAVAAGNHQARTRKR
                     WSSHSKEKGRLRSSVLADGVHEGVKDNHISPGQLYSTESGRLFHAGKILIVLVGLPAT
                     SKTLVSVAITRYTRWLGVRTQSFHVSEYRRARVPQGMVKLPLDYFSARPVTPEGIRLR
                     RTLIAEIQADMKKFFEQGQLAVYDGMNIMREERRMLAEEFAALNVKVFFVESVVSESI
                     LRARTVEMAAASADYKGWNRQDALEDYKQRIELNRPLYEEMSPSEGLSYVKYFNFGEK
                     LVVNNNYHGFLINKTVFFLMNLRDKKGCVYFARCGTSDKDKYIDDEVLNDEGIEYSKV
                     LTDTVLERINNRRREQNDTPGQYESLPLTSSCKSYSSDLESPLISTSATLKRTESLGK
                     AALRQHASGDGTDEDSFVVWTAPRKRTHDTAMYFVDKKITVRQRSQLQQLHPGVVADL
                     SEEEIVSQFATEHKEYMKDPYHYRFPRAESYHDLAVRIEPLLLEMERMYGDILIIGHE
                     STLKILYGYVTACSCHDIPSLSFTRDELIEVSFGPFENKIAKIPLVVDKKRVSKQVPG
                     "
     gene            complement(<36438..>36983)
                     /locus_tag="AGOS_ACL184C"
                     /old_locus_tag="ACL184C"
                     /db_xref="GeneID:4619340"
     mRNA            complement(join(<36438..36802,36965..>36983))
                     /locus_tag="AGOS_ACL184C"
                     /old_locus_tag="ACL184C"
                     /product="60S ribosomal protein L26"
                     /transcript_id="NM_208573.1"
                     /db_xref="GeneID:4619340"
     CDS             complement(join(36438..36802,36965..36983))
                     /locus_tag="AGOS_ACL184C"
                     /old_locus_tag="ACL184C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR344W (RPL26A) and YGR034W (RPL26B); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L26"
                     /protein_id="NP_983220.1"
                     /db_xref="GeneID:4619340"
                     /translation="MAKQSLDVSSDRRKARKAYFNAPSSERRVIMSAPLSKELREQYN
                     IKSLPIRKDDEIMVVRGSKKGQEGKVSSVYRLKYAVRVDKVTKEKSNGASVPLDVHPS
                     KVVITKLHLDKDRKALIERKGGKLE"
     gene            complement(37262..37333)
                     /locus_tag="AGOS_t0044"
                     /db_xref="GeneID:4619341"
     tRNA            complement(37262..37333)
                     /locus_tag="AGOS_t0044"
                     /product="tRNA-Arg"
                     /codon_recognized="CGG"
                     /db_xref="GeneID:4619341"
     gene            <37474..>38178
                     /locus_tag="AGOS_ACL183W"
                     /old_locus_tag="ACL183W"
                     /db_xref="GeneID:4619317"
     mRNA            <37474..>38178
                     /locus_tag="AGOS_ACL183W"
                     /old_locus_tag="ACL183W"
                     /product="ACL183Wp"
                     /transcript_id="NM_208574.1"
                     /db_xref="GeneID:4619317"
     CDS             37474..38178
                     /locus_tag="AGOS_ACL183W"
                     /old_locus_tag="ACL183W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR033C (TIM21)"
                     /codon_start=1
                     /product="ACL183Wp"
                     /protein_id="NP_983221.1"
                     /db_xref="GeneID:4619317"
                     /translation="MLAFGSICGRLRAPAGAGLRVNVGKMPGRAWQVANGQPYSTFYA
                     PPEQAGNRQKERRVTAWKKVRAAATFSASGMLVLGAAGVAGIVLYLILSELFSPSGDT
                     QIFNRAVSTVEGDAVARSLLQCEDGVHRSERLKAYGDSVGDDRWTRNRPISSTRRLDA
                     SGREHYYMRFHVETGRRRGVVSLEAQQSDDSYQPEFVRMYLDVPGEKRHYLIRPEPSV
                     AKPKGFLGLNWGPRKD"
     gene            complement(<38290..>39900)
                     /locus_tag="AGOS_ACL182C"
                     /old_locus_tag="ACL182C"
                     /db_xref="GeneID:4619342"
     mRNA            complement(<38290..>39900)
                     /locus_tag="AGOS_ACL182C"
                     /old_locus_tag="ACL182C"
                     /product="ACL182Cp"
                     /transcript_id="NM_208575.1"
                     /db_xref="GeneID:4619342"
     CDS             complement(38290..39900)
                     /locus_tag="AGOS_ACL182C"
                     /old_locus_tag="ACL182C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR343W (GAS2)"
                     /codon_start=1
                     /product="ACL182Cp"
                     /protein_id="NP_983222.1"
                     /db_xref="GeneID:4619342"
                     /translation="MKLQAVLAKTALFSAAVAKASQNTTLAQSGLPVIEVVGNKFFDS
                     RSGEQFFIKGIAYQPSSAPQELEVGYPADTKYIDPLAEVEICKRDLPYLKKLGVNTIR
                     VYSIDPTKPHDVCMEELSKLGIYVLIDLSEPDTSIIRETPTWDVKVFQRYKDVVDSMQ
                     KYNNVLGFFAGNEVTNDRTNTDASPFVKAAIRDVKNYIKQMGYRTLPVGYSTNDDQET
                     RDHLADYFVCGSVSADFYGINMYEWCGHSSYGTSGYRERTNEFRNFPVPVFFSEFGCN
                     TIRPRPFTEIQALYGTMMTPVWSGGLAYMYFEEDNEYGVVKVTKDNQVLELPDFRNLQ
                     KEFEKARPKGVKRSVYEKTYKVNSRTCPEKSATWKASEELPPTPDARKCGCLEQALPC
                     LSLSLQDPMSYKNYFEYVCGFVNCMDINGDGSLGVYGEYSDCDTRQKLSLQLSKLYLR
                     RKISKNECPIASNDFFFNAKSIGIPQQCQGVMEDVKVQANKKLVEPKPAAPAGKDVNA
                     AGSSALHRLNTATLVLVSTTAFIFHLLL"
     gene            complement(<40325..>46105)
                     /locus_tag="AGOS_ACL181C"
                     /old_locus_tag="ACL181C"
                     /db_xref="GeneID:4619343"
     mRNA            complement(<40325..>46105)
                     /locus_tag="AGOS_ACL181C"
                     /old_locus_tag="ACL181C"
                     /product="ACL181Cp"
                     /transcript_id="NM_208576.2"
                     /db_xref="GeneID:4619343"
     CDS             complement(40325..46105)
                     /locus_tag="AGOS_ACL181C"
                     /old_locus_tag="ACL181C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR342W (FKS1) and YGR032W (GSC2)"
                     /codon_start=1
                     /product="ACL181Cp"
                     /protein_id="NP_983223.2"
                     /db_xref="GeneID:4619343"
                     /translation="MSYPNDPNQHRYEPGEQGGVPHGQSPYGQQPQYDQYGNVYDPQQ
                     AYAQDGAYYDQTGNGYYDPQQAYDPQQAYDPEHGAYYGQPRGVGPEGENFSDFSYGPP
                     GTPGGYDSYAQGGGVDQYTPSRMSYGGDPRTSGTSTPIYGGAGFDPSAAAMALPADPY
                     PAWTADAQSPVSVEQIEDVFIDLTNRFGFQRDSMRNVFDHFMVLLDSRASRMSPEQAL
                     LSLHADYIGGDTANYKKWYFAAQLDLDDQVGFRNMNLGKLSRKARKAKKKNKKAIAEN
                     VADTEATLSQLEGDDSLEAADFRWKAKMNKLTPLERVRQIALYLLIWGEANQVRFTAE
                     CLCFLYKCASDYLDSPLCQQRAEPLPEGDYLNRVITPIYRFLRSEVYEIVDGRYMKRE
                     RDHNKVIGYDDVNQLFWYPQGIARIVFEDGTRLIDLPAEERYLRLGDVAWNDVFFKTY
                     KEVRTWLHMILNFNRIWIIHGSVYWMYTAYNAPTLYTAHYQQLLNNRPVPSFPFVACS
                     FAGTFACIVQLLATFLEWTYVPRKWAGAQHLSRRFFFLLMITAINIAPPVFVIAYSGD
                     LSTYSKLAYAISVVGFVIALITVIFFSIMPLGGLFTSYMKNSTRKYVASQTFTASVAP
                     LHGMDMWMSYLLWAAVFAAKLAESYFFLTLSLRDPIRILYMNYSRCVGIKYLNNRLCP
                     YQGQVVLVLMVITDFILFFLDTYMWYIVCNTVFSVGRSFYLGISILTPWRNIFTRLPK
                     RIYSKILATTDMEIKYKPKVLISQVWNAIVISMYREHLLAIDHVQKLLYHQVPSEIEG
                     KRTLRAPTFFVSQDDNNFETEFFPANSEAERRISFFAQSLATPIPEPLPVDNMPTFTV
                     LTPHYSERVLLSLREIIREDDQFSRVTLLEYLKQLHPVEWDCFVKDTKILAEETAAFE
                     GGDEEDPEKAGGLKSQIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTVSGMMN
                     YARAIKLLYRVENPEIVQMFGGNAEGLERELEKMARRKFKFLVSMQRLAKFKPHEMEN
                     AEFLLRAYPDLQIAYLDEEPPLNEGEEPRIYSALIDGHCELMENGRRRPKFRIQLSGN
                     PILGDGKSDNQNHALIFYRGEYIQLVDANQDNYLEECLKIRSVLAEFEELNVEHVNPY
                     TPTLKYEERENNHPVAIVGAREYIFSENSGVLGDAAAGKEQTFGTLFSRTLAQIGGKL
                     HYGHPDFINATFMTTRCGISKAQKGLHLNEDIYAGMNALLRGGRIKHCEYFQCGKGRD
                     LGFGTILNFTTKIGAGMGEQMLSREYYYLGTQLPIDRFLSFYYAHPGFHLNNLFIQLS
                     LQMFILTLMNMNALAHESLFCEYDKNKPITDALSPNGCYNLAPVVDWVRRYTLSIFIV
                     FFIAFVPIVVQELIERGIWKAIQRFVRHLVSLSPMFEVFAGQIYSASLVSDMTFGGAR
                     YISTGRGFATSRIPFSILYSRFAGSAIYMGGRSMLMLLFASVARWQPALLWFWASMVA
                     MIFSPFIFNPHQFAWQDFFLDYRDFIRWLSRGNNKFHKNSWIAHVRVARSRVTGFKRK
                     LIGDESEKSSGDSARAHRSNILFAEVLPTLVYAIGCVIAYAFINSRTGLVSRAEPPPK
                     TIPIGNPLIRLAICTLLPVVLNAGVLAGIMGLSCCAGPLLGLCCKNTGPVMAAIAHGV
                     SVIGHIIAILAMWVLQRMNLARMLMGFVTMIQCERVLLKLLTLIFLTREFKNDRANAS
                     FWSGKWYSAGLGYMAWTQPAREYVVKIIELSEFAADFFLGHIILFCQLPVLCVPQIDK
                     FHSIMLFWLRPSRQIRPPIYSLKQTRLRKRMVRKYSALYFLILIFFVCLIAGPAVAFK
                     QTELKHKEKDTDGNLGESTFFNGFLNDKFGPGGMSMLANVLQPYQSSDATDDSSPSFT
                     YDTGGHQYFSTILPDQIHTTWSTKAP"
     gene            complement(<46850..>47815)
                     /locus_tag="AGOS_ACL180C"
                     /old_locus_tag="ACL180C"
                     /db_xref="GeneID:4619344"
     mRNA            complement(<46850..>47815)
                     /locus_tag="AGOS_ACL180C"
                     /old_locus_tag="ACL180C"
                     /product="ACL180Cp"
                     /transcript_id="NM_208577.2"
                     /db_xref="GeneID:4619344"
     CDS             complement(46850..47815)
                     /locus_tag="AGOS_ACL180C"
                     /old_locus_tag="ACL180C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR031W (IMO32)"
                     /codon_start=1
                     /product="ACL180Cp"
                     /protein_id="NP_983224.2"
                     /db_xref="GeneID:4619344"
                     /translation="MNSLLTRLLPVGRPVALGTAAPRGRVLYSTRLADPELERIETVP
                     LQATRLAGEPARAGAQPAAPVVILHGLFGSRRNNRRLAQLLNGRLGRDVYTLDLRNHG
                     ASPRTPRHDYPAMVADVARWLRENTGRAAPVLVGHSMGAKVAMGLALRQPHLCSALVS
                     IENAPVATVPEPEFPRYIGALERLAAQPELSAAQAQRALAAVESDPDVRLFLLSLMEH
                     YRDPASGKLRYRPRIPLRTLKDAVVRGAIAGWELSPATHRYTGPALFLRGTRSNYVAD
                     DYLPAVGSYFPNFDVRDVAGGHWINSQQPQLCADLIVDFLGRRDL"
     gene            complement(<48041..>49843)
                     /locus_tag="AGOS_ACL179C"
                     /old_locus_tag="ACL179C"
                     /db_xref="GeneID:4619345"
     mRNA            complement(<48041..>49843)
                     /locus_tag="AGOS_ACL179C"
                     /old_locus_tag="ACL179C"
                     /product="ACL179Cp"
                     /transcript_id="NM_208578.2"
                     /db_xref="GeneID:4619345"
     CDS             complement(48041..49843)
                     /locus_tag="AGOS_ACL179C"
                     /old_locus_tag="ACL179C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR341W (SPO77)"
                     /codon_start=1
                     /product="ACL179Cp"
                     /protein_id="NP_983225.2"
                     /db_xref="GeneID:4619345"
                     /translation="MSLSLRDVNKGKYNFPDGYDSIGKTKRTLHPSANAKLLFAEEQL
                     PHSIDAIFAPLEENKEYDGDDGNAAAIEGEYETERFGLRSNSVVQQIGEFAPIEDFTR
                     DDSRMMYESMGTSLRLDSQGVVKYSIREDSMIMHTPPSNRGYFLPSVMTSFSSALDML
                     YELVHDSLMVPANYRYAGVDIDAESESLNTNLFIIPLQRKICHLVDVLVHLNHLELTL
                     EVFKQCGDSAVEPEQCKRLDACLHEILELVANFVNEDQHEATIFQSFMASKAFSRKFK
                     FSQVGADVLDEVRPLLTLANTPQLTLQSFKFDVQLIDNDDTSLQEELRYHVNYMLAYQ
                     LLFQKLKGFFINCLSFEQNEDSGIVLHCLEGFLTNSVELESAELLVGLDTAIDAWARK
                     DHDRSIVLASWCNEMARKQAKLGQQAEEDDDTLGGGDKYNVAKLFIQQLKDITAGHSL
                     SSGFTVLTAGLDSGAVPNSELVLYQNQSRNINIKRWVFGQQKSLSHKQRLLEKCHKLK
                     WKLVKWSQGFSRKKQTTERRQYLASRGNNSELVSLSISGSYHNWRNAYHNPVFNNLHN
                     GSRKLGELQDRAKKIDEFKRKRDRLMFLFFGEDS"
     gene            complement(<50147..>51076)
                     /locus_tag="AGOS_ACL178C"
                     /old_locus_tag="ACL178C"
                     /db_xref="GeneID:4619346"
     mRNA            complement(<50147..>51076)
                     /locus_tag="AGOS_ACL178C"
                     /old_locus_tag="ACL178C"
                     /product="60S acidic ribosomal protein P0"
                     /transcript_id="NM_208579.2"
                     /db_xref="GeneID:4619346"
     CDS             complement(50147..51076)
                     /locus_tag="AGOS_ACL178C"
                     /old_locus_tag="ACL178C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR340W (RPP0)"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P0"
                     /protein_id="NP_983226.2"
                     /db_xref="GeneID:4619346"
                     /translation="MGGVREKKSEYFAKLREYLEEYKSVFVVGVDNVSSQQMHEVRKA
                     LRGKAVVLMGKNTMVRRAIRGFIADFPDYEKLLPFVKGNVGFVFTNEPLTDIKEVIVA
                     NKVAAPARAGAVAPEDIWVLAVNTGMEPGKTSFFQALGVPTKIARGTIEITSDVKVVE
                     AGNRVGASEASLLNLLNISPFTYGLTVVQVYDNGQVFPASILDITDEELVSHFVTAVN
                     TIASISLAIGYPTLPSVGHTLINNYKDLLAVAIAANYVYPEIEELVDRIENPDKYASA
                     APAAAASSAPAEEAAAEEDEESEDDDMGFGLFD"
     gene            <51359..>51808
                     /locus_tag="AGOS_ACL177W"
                     /old_locus_tag="ACL177W"
                     /db_xref="GeneID:4619347"
     mRNA            <51359..>51808
                     /locus_tag="AGOS_ACL177W"
                     /old_locus_tag="ACL177W"
                     /product="ACL177Wp"
                     /transcript_id="NM_208580.1"
                     /db_xref="GeneID:4619347"
     CDS             51359..51808
                     /locus_tag="AGOS_ACL177W"
                     /old_locus_tag="ACL177W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR030C (POP6)"
                     /codon_start=1
                     /product="ACL177Wp"
                     /protein_id="NP_983227.1"
                     /db_xref="GeneID:4619347"
                     /translation="MQYQGEEIDAQLDVPESCFNYIRNELLNHVLDADKRALFNNEET
                     CIQISKATHVEVGVQRAMQSIAENRAVLLYSYGQHVQRQLGAVEILKATLQERKIGYE
                     QFNHLSCLAHVGPGRNELLETRVNIPVLLVIVAPAGSLTSLAGFQRQ"
     gene            52178..52249
                     /locus_tag="AGOS_t0045"
                     /db_xref="GeneID:4619348"
     tRNA            52178..52249
                     /locus_tag="AGOS_t0045"
                     /product="tRNA-Asp"
                     /codon_recognized="GAC"
                     /db_xref="GeneID:4619348"
     gene            <52436..>53308
                     /locus_tag="AGOS_ACL176W"
                     /old_locus_tag="ACL176W"
                     /db_xref="GeneID:4619318"
     mRNA            <52436..>53308
                     /locus_tag="AGOS_ACL176W"
                     /old_locus_tag="ACL176W"
                     /product="ACL176Wp"
                     /transcript_id="NM_208581.2"
                     /db_xref="GeneID:4619318"
     CDS             52436..53308
                     /locus_tag="AGOS_ACL176W"
                     /old_locus_tag="ACL176W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR039W (ATP3)"
                     /codon_start=1
                     /product="ACL176Wp"
                     /protein_id="NP_983228.2"
                     /db_xref="GeneID:4619318"
                     /translation="MFIRSRAAIGAVQGASRSYATLREIEMRLKSIKNIEKITKTMKI
                     VASTRLGKADRAKQTARQYSKAEAEFYSNAGTAVGEGEARDLVIAITSDKGLCGSIHS
                     QLAKAVRAHLANHPSSDVVTVGDKVKNQIMRSHADNLKMSFNGVGKEAPTFEESALIA
                     DKILEHDAAKYGKITVFYNSPISSLSFEPSQKPVYNADTIEQSPSFSKYEVDSDSNVP
                     QDLFEFTLANQILSAMADGYSAEISARRNAMDNASKNAGEMINKYSILYNRTRQAVIT
                     NELVDIITGASSLD"
     gene            <53707..>54591
                     /locus_tag="AGOS_ACL175W"
                     /old_locus_tag="ACL175W"
                     /db_xref="GeneID:4619349"
     mRNA            <53707..>54591
                     /locus_tag="AGOS_ACL175W"
                     /old_locus_tag="ACL175W"
                     /product="ACL175Wp"
                     /transcript_id="NM_208582.2"
                     /db_xref="GeneID:4619349"
     CDS             53707..54591
                     /locus_tag="AGOS_ACL175W"
                     /old_locus_tag="ACL175W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR040W (FIG1)"
                     /codon_start=1
                     /product="ACL175Wp"
                     /protein_id="NP_983229.2"
                     /db_xref="GeneID:4619349"
                     /translation="MIFGPIVLFLVKRTPRLFALTFNAIAILLAVFVLLGCYNSQQQS
                     TFLSRLQFNAQSPLYTVIEKSLHERTNTTGFEQLRIKVGYLGVCLSNLPAAYPGGPVQ
                     CFGRKNITGTPLYDALDLRVFNIPAAANSSSHTDLNILGLAHAAAADIDHPYIFMISI
                     ILAILMFCILLYVTVPMLPYKRPLNLALLGLSPLVVVFLAFGSMWTHVACNAASAFIP
                     PASMGVIKVHRGRKATAMVWSCFVFVLLDCIIIWAIYFRDQARDKKSRGQADYERYAN
                     SDYAKYAQSDRSTLGNKY"
     gene            <54838..>56790
                     /locus_tag="AGOS_ACL174W"
                     /old_locus_tag="ACL174W"
                     /db_xref="GeneID:4619350"
     mRNA            <54838..>56790
                     /locus_tag="AGOS_ACL174W"
                     /old_locus_tag="ACL174W"
                     /product="ACL174Wp"
                     /transcript_id="NM_208583.2"
                     /db_xref="GeneID:4619350"
     CDS             54838..56790
                     /locus_tag="AGOS_ACL174W"
                     /old_locus_tag="ACL174W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR041W (FAT1)"
                     /codon_start=1
                     /product="ACL174Wp"
                     /protein_id="NP_983230.2"
                     /db_xref="GeneID:4619350"
                     /translation="MAQQLLKQVLRTLALPVIMPLLALNRRFRILDDIRTITYFVQAL
                     VAYGWCTLTQRFPTWYVFEAQVAKHGDSPCIRYCRPQARKGDFTVETYTYRETYEHVL
                     RLSYVLYHDYGVRAGEHVAVNYANKPMFLFLWLALWNIGAVPAFVNHNQKGTPLIHSV
                     KISNARLLFVDAGTTNLPKGSEAELLKELPELQIHHFDEEQMLAIIKSDKSPSLLIKR
                     GERTPRTLHDYDPAMLIYTSGTTGLPKSAIMSWRKATLGCSLFGFMMRISPESVVLTA
                     MPLYHSTAALLGVCAVFTQGGCIAISNKFSTTTFWKEAYLSKATHIQYVGEVCRYLMN
                     APKSEYEDMATVKVAYGNGLRQSIWMDFKKRFRIEAIGEFYASTEAPFATTAFQLGTF
                     GVGACRSYGSLVHWILSYQQTLVRVDPDDESVVYRNENGFCEVPASDEPGELLMRIFF
                     PRKPHTSFQGYLGNKKATESKVLRDVFRKGDAWYRSGDLLKSDKYGQWYFVDRMGDTY
                     RWKSENVSTTEVENQLLSFNKDLFDCLVVVGLKIPSYEGRAGFAVIQLNPARRGLDHA
                     SLLDDLVEYLKHALPRYALPLFIKFTNQLETTDNYKFAKKQYKNQQLPHGADGDETIY
                     WLKDYSQYKVLTDEDWEQISTGKAKL"
     gene            complement(<56905..>58140)
                     /locus_tag="AGOS_ACL173C"
                     /old_locus_tag="ACL173C"
                     /db_xref="GeneID:4619351"
     mRNA            complement(<56905..>58140)
                     /locus_tag="AGOS_ACL173C"
                     /old_locus_tag="ACL173C"
                     /product="ACL173Cp"
                     /transcript_id="NM_208584.1"
                     /db_xref="GeneID:4619351"
     CDS             complement(56905..58140)
                     /locus_tag="AGOS_ACL173C"
                     /old_locus_tag="ACL173C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR042C (CST26) and YDR018C"
                     /codon_start=1
                     /product="ACL173Cp"
                     /protein_id="NP_983231.1"
                     /db_xref="GeneID:4619351"
                     /translation="MITMSAVAQQAHRTVLAALVTFVFIQGCVSLVIFQFSMKCMYRS
                     NRIGLQSQLDRSKKSFILLLVTIMTIVAPSYVRVTTDNASVAKGTFWRDKGQGQLRSR
                     LERNSVVISNHQIYTDWVFLWWLAYTSGLAGRVYIMLKKSLAAIPVLGYGMKNYGFIF
                     MNRRWNLDRVHLGNSLQRLDRDGRGLGPLAGHAPSRVTAEGEEEYESQDGEASKQTWP
                     YTLILFPEGTNMSSNTRERSNVYARKINVQPFENVLLPRSTGLRFALEKLAPSCDCVY
                     DVTIGYSGVKKTTYAEQIYDLQSIFLRGQGPKLVDVHIRTFKLSEIPYKDEKAFEQWL
                     YKVWGEKDKLLERYYQKGSFDLDPDLTHTVSGLCEIDTAEVFLVMIVPMLILAAASFL
                     FTKYAVQYFGKYSMAAAIY"
     gene            complement(<58312..>60207)
                     /locus_tag="AGOS_ACL172C"
                     /old_locus_tag="ACL172C"
                     /db_xref="GeneID:4619352"
     mRNA            complement(<58312..>60207)
                     /locus_tag="AGOS_ACL172C"
                     /old_locus_tag="ACL172C"
                     /product="ACL172Cp"
                     /transcript_id="NM_208585.2"
                     /db_xref="GeneID:4619352"
     CDS             complement(58312..60207)
                     /locus_tag="AGOS_ACL172C"
                     /old_locus_tag="ACL172C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR043C (QDR3)"
                     /codon_start=1
                     /product="ACL172Cp"
                     /protein_id="NP_983232.1"
                     /db_xref="GeneID:4619352"
                     /translation="MSVSAQRAQEQNSMDIEQRSSQPSRSNSHAGSPGYEKVQPLYAA
                     ENGSTETAPTATGLFDSSHVVPVSQRRGLLSRLALVPEFRDARLYPPRVKKLILVIVA
                     FACILGPMGTSIIYPAIGTIMQDFGTSRFLVSVSVGTYLAALGIFPIWWSSLADKNGR
                     RTVYVLSFALLVVFSVGTAFSRNIETFIILRILCGAASASVQSVGAGTIADLYVPEER
                     GRNLGYYYLGPLMAPLLSPIVSSLLVNRWSWRSTQWFMVILAALTFLLLVFALPETLR
                     TQDNKELVARILRECRKQGSASAPATPADSALPPSLHSTHADLASLDSAAADLASQLT
                     DTVALYDAQRNFVDLGAPSLSRIHSSNPRVEGRILQQDRERLRTGLERAISQQAPRPH
                     QRLARELHFYLLRPLRSLYFLRYPPVLLAVLYNGACFAAVYVVNLTIEYCYSRDPYNM
                     RPLYLGLLYIPNAATYIFSAIYGGRWVDALLRRYTRRHGVGVPEARLSWNVALAAALL
                     PLSLLAIGWPLHCKAPWPVPLIGTAFFGLAAMLIIGAITAYLVDSLPARGATGVALNN
                     LIRMLLAAVCVFVLDAMLHRMGPGWTMTLFAALLVCSGLPLYILKRKSSYWREHYDLQ
                     HLYDRVG"
     gene            <60437..>61108
                     /locus_tag="AGOS_ACL171W"
                     /old_locus_tag="ACL171W"
                     /db_xref="GeneID:4619353"
     mRNA            <60437..>61108
                     /locus_tag="AGOS_ACL171W"
                     /old_locus_tag="ACL171W"
                     /product="ACL171Wp"
                     /transcript_id="NM_208586.1"
                     /db_xref="GeneID:4619353"
     CDS             60437..61108
                     /locus_tag="AGOS_ACL171W"
                     /old_locus_tag="ACL171W"
                     /note="NOHBY313; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACL171Wp"
                     /protein_id="NP_983233.1"
                     /db_xref="GeneID:4619353"
                     /translation="MRGIPGPISCCCPLPVELRGRSARLRKSACVRQFDPGGPAVLWH
                     IAREAKSAATRQPALRCHGRLTVLLGKQKMKLAQVASWLALLGRLQACVGGAPPAARL
                     PPDLAEAYQQYAPIFLAELRAMSASARAGAEGGAEFQLSDIAEFERNIPDGTPFYVGP
                     PVVNELTTRALDALGASVGSWVPGKADCARFLRSILEDEPLVTLKISETNLFEGLNVT
                     AGPTT"
     gene            <61181..>61753
                     /locus_tag="AGOS_ACL170W"
                     /old_locus_tag="ACL170W"
                     /db_xref="GeneID:4619354"
     mRNA            <61181..>61753
                     /locus_tag="AGOS_ACL170W"
                     /old_locus_tag="ACL170W"
                     /product="ACL170Wp"
                     /transcript_id="NM_208587.2"
                     /db_xref="GeneID:4619354"
     CDS             61181..61753
                     /locus_tag="AGOS_ACL170W"
                     /old_locus_tag="ACL170W"
                     /note="NOHBY312; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACL170Wp"
                     /protein_id="NP_983234.2"
                     /db_xref="GeneID:4619354"
                     /translation="MAPAEAPHVHAKRAAPHYCRWPPASRAGFCAQSSRLWCPDQLRR
                     PHNSEKNLTECKCITEITRTQKHATLQDFPVLLLAHVQPRGRLHRRQGSLVSGSTGSL
                     SHFAFSRSHMSQITKYIPKSTLFLCPFFLIASDFVLAMSGKGTRAGSSSTGIGSRPTR
                     LQRLRQLVAHRDPARGPSGALTSIEEFTRR"
     gene            <61957..>62268
                     /locus_tag="AGOS_ACL169W"
                     /old_locus_tag="ACL169W"
                     /db_xref="GeneID:4619355"
     mRNA            <61957..>62268
                     /locus_tag="AGOS_ACL169W"
                     /old_locus_tag="ACL169W"
                     /product="ACL169Wp"
                     /transcript_id="NM_208588.1"
                     /db_xref="GeneID:4619355"
     CDS             61957..62268
                     /locus_tag="AGOS_ACL169W"
                     /old_locus_tag="ACL169W"
                     /note="NOHBY311; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E02266g"
                     /codon_start=1
                     /product="ACL169Wp"
                     /protein_id="NP_983235.1"
                     /db_xref="GeneID:4619355"
                     /translation="MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYK
                     EVVDGRPSQFAGSQLTLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEK
                     Q"
     gene            complement(<62414..>62853)
                     /locus_tag="AGOS_ACL168C"
                     /old_locus_tag="ACL168C"
                     /db_xref="GeneID:4619356"
     mRNA            complement(join(<62414..62781,62841..>62853))
                     /locus_tag="AGOS_ACL168C"
                     /old_locus_tag="ACL168C"
                     /product="ACL168Cp"
                     /transcript_id="NM_208589.1"
                     /db_xref="GeneID:4619356"
     CDS             complement(join(62414..62781,62841..62853))
                     /locus_tag="AGOS_ACL168C"
                     /old_locus_tag="ACL168C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR122C (PFY1); 1-intron"
                     /codon_start=1
                     /product="ACL168Cp"
                     /protein_id="NP_983236.1"
                     /db_xref="GeneID:4619356"
                     /translation="MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIK
                     EISQGFDNAAGLQANGLHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYP
                     AGVQAGEATKIVEQLADYLISVQY"
     gene            complement(<63133..>64449)
                     /locus_tag="AGOS_ACL167C"
                     /old_locus_tag="ACL167C"
                     /db_xref="GeneID:4619357"
     mRNA            complement(<63133..>64449)
                     /locus_tag="AGOS_ACL167C"
                     /old_locus_tag="ACL167C"
                     /product="ACL167Cp"
                     /transcript_id="NM_208590.2"
                     /db_xref="GeneID:4619357"
     CDS             complement(63133..64449)
                     /locus_tag="AGOS_ACL167C"
                     /old_locus_tag="ACL167C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR123C (LEO1)"
                     /codon_start=1
                     /product="ACL167Cp"
                     /protein_id="NP_983237.2"
                     /db_xref="GeneID:4619357"
                     /translation="MAEEQRDALTESAELSEQKLEDGFTSDQGGSSANENDLFGEDSD
                     VSGSDDADEADDGASEDSGSRRSRGTGHGLGAEDNEEQEMYNRKFYGDDLQQASDLSD
                     EDEAREIKEADLELVKHVVPYYTTSHSKEETIYYTKVPQFLTIDPVPFDPPSFQGQIE
                     KRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVFKESNAQVIEWSDGTLSLKLGDE
                     YTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFIPTSTNSKIHKRLTKAIARR
                     EAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQLKEQLDRDNLEGGLAQGSF
                     EFKKAAGRAAPYSRSMEDEYDDEDGFIDDDDDLEALSDNDDAADSLPGSPTASQDEED
                     DLNAARLQQLKREGAAKYAAAPPAPRADEEVALKRRKVAVLDSDDE"
     gene            <64824..>66296
                     /locus_tag="AGOS_ACL166W"
                     /old_locus_tag="ACL166W"
                     /db_xref="GeneID:4619358"
     mRNA            <64824..>66296
                     /locus_tag="AGOS_ACL166W"
                     /old_locus_tag="ACL166W"
                     /product="ACL166Wp"
                     /transcript_id="NM_208591.1"
                     /db_xref="GeneID:4619358"
     CDS             64824..66296
                     /locus_tag="AGOS_ACL166W"
                     /old_locus_tag="ACL166W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR371W (CTS2)"
                     /codon_start=1
                     /product="ACL166Wp"
                     /protein_id="NP_983238.1"
                     /db_xref="GeneID:4619358"
                     /translation="MRRFPTPVYTIWILILVAAIVLEMTFLPKLIKEKLSRRIRPKPL
                     EVHEETRPVPDAPYPDGEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDE
                     KTGKIGSLDKWSDTKMPMNLTGMPRGLNGAIGELNYLKTRPGTDFKLMMAVGGWSNRE
                     PFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHK
                     MDELEDNIWGPGGTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAW
                     SERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKI
                     ALGMAAYGRGFTNVRGDGEQLIGQKYSGVGGGSEGEPGMWLYNQLPLAHGPEKFDNVW
                     VSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAF
                     TENMKGARKATAYKDSKLIQYYLRTRPEGFLVPMYRHTSG"
     gene            complement(<66495..>67490)
                     /locus_tag="AGOS_ACL165C"
                     /old_locus_tag="ACL165C"
                     /db_xref="GeneID:4619359"
     mRNA            complement(<66495..>67490)
                     /locus_tag="AGOS_ACL165C"
                     /old_locus_tag="ACL165C"
                     /product="ACL165Cp"
                     /transcript_id="NM_208592.1"
                     /db_xref="GeneID:4619359"
     CDS             complement(66495..67490)
                     /locus_tag="AGOS_ACL165C"
                     /old_locus_tag="ACL165C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR372C (VPS74)"
                     /codon_start=1
                     /product="ACL165Cp"
                     /protein_id="NP_983239.1"
                     /db_xref="GeneID:4619359"
                     /translation="MSLQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKL
                     RENTREPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDA
                     MRRRFDPSERLIEVVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKIN
                     YQLRQVRERLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRN
                     VELQYTELFPETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQ
                     FSQYPFALDKDIETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL"
     gene            complement(<67788..>71957)
                     /locus_tag="AGOS_ACL164C"
                     /old_locus_tag="ACL164C"
                     /db_xref="GeneID:4619360"
     mRNA            complement(<67788..>71957)
                     /locus_tag="AGOS_ACL164C"
                     /old_locus_tag="ACL164C"
                     /product="ACL164Cp"
                     /transcript_id="NM_208593.2"
                     /db_xref="GeneID:4619360"
     CDS             complement(67788..71957)
                     /locus_tag="AGOS_ACL164C"
                     /old_locus_tag="ACL164C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR124C (UBP2)"
                     /codon_start=1
                     /product="ACL164Cp"
                     /protein_id="NP_983240.2"
                     /db_xref="GeneID:4619360"
                     /translation="MNQESREQIETEQNCELEQGDDGRTVLYGNLARQGPVKTSDRLL
                     DDVRVTVSLSEEGREVLRAPMLEYARQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ
                     NRVHVFMGVLCDPGQRFASQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDE
                     LHPWDKPDFCLFEDGDPAVVDSATYVASGTNRLVRIEVLRPEFGPDELQEFTGERIRA
                     RYLEVCKRHPDLDPSDIPSQAECLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQL
                     EANWLVTKFGFELCEIEEDGQKIYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLG
                     KQSLRLVPKDVVVSNSKLRSFQLYQTHFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHF
                     VHLSSNYYYSDRDIIKNYEAQIALDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVV
                     GHEALMSALRLFHLDPSSTDPRQLSDEFLLESYKEVCKDSGPQKHADLRNALRLLARY
                     KESDKLKFYVEVEPFPNELQAYKLLEIDESVDIDIIETAYSIKVSDAPGLKMDCIRAL
                     YTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSYQSALQYLHVNVNATDDLILEIFQR
                     KWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFLETGLVDINYLPAGNWPTGINNI
                     GNTCYLNSLLQYYFTISPLREYILAYDHTASNLLNNAVSSSDMGRRRIGGRAISQAEV
                     ERSVQFVYQLRSLFHEMVHSRERYVTPTRELAYLSFSPSSTEVEFEPVPPAVGTASNA
                     LVANEVYNEDTEVIDISMEECDEDSAINELGASNISVKLDSDIGTDSNSNLATGAQTG
                     IPLDGHTDLNTGIRTCMPNDTAINMATGNATAPNKGIVNSEANFEHLMTPAPHEGTDK
                     PIGNDQSVVPNLGTSKDTLSAYPKSGYAKTAASALSTNNSAASPDDFSVRYQASSDTA
                     NTGSTRPNPSSTPESGLSDSAANAEYTSAGPLEDRQAVENDDSGKDITMVGSPEAEGP
                     ETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQ
                     LFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDED
                     DGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAE
                     LNAKKQQAIGLREELERLRERRRRLLAKNDHGVTLSAALADTRRFLDAAELTSGSRQL
                     QEQYHATTSHLDALRVALDEELAALDAHIASVQDAIAHRFDAFSSYGYSLGAVFIHRG
                     EASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHE
                     LDIEPLKRLLA"
     gene            <72510..>73082
                     /locus_tag="AGOS_ACL163W"
                     /old_locus_tag="ACL163W"
                     /db_xref="GeneID:4619361"
     mRNA            <72510..>73082
                     /locus_tag="AGOS_ACL163W"
                     /old_locus_tag="ACL163W"
                     /product="ACL163Wp"
                     /transcript_id="NM_208594.1"
                     /db_xref="GeneID:4619361"
     CDS             72510..73082
                     /locus_tag="AGOS_ACL163W"
                     /old_locus_tag="ACL163W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR373W (FRQ1)"
                     /codon_start=1
                     /product="ACL163Wp"
                     /protein_id="NP_983241.1"
                     /db_xref="GeneID:4619361"
                     /translation="MGAKASKLSKDDLQSLKQSTYFDRREILQWHKGFLRDCPNGQLT
                     QEEFVKIYKQFFPFGAPEKFAAHVFSVFDKDNNGTIDFKEFITALSTTSRGTLEEKLV
                     WAFQLYDLNHDGYITYNEMLTIVTSVYKMIGSMVKLSEDEATPELRVKKIFKLMDKNE
                     DGYITLDEFREGSKVDPSILSALNLYDGLV"
     gene            complement(<73189..>73869)
                     /locus_tag="AGOS_ACL162C"
                     /old_locus_tag="ACL162C"
                     /db_xref="GeneID:4619362"
     mRNA            complement(<73189..>73869)
                     /locus_tag="AGOS_ACL162C"
                     /old_locus_tag="ACL162C"
                     /product="ACL162Cp"
                     /transcript_id="NM_208595.1"
                     /db_xref="GeneID:4619362"
     CDS             complement(73189..73869)
                     /locus_tag="AGOS_ACL162C"
                     /old_locus_tag="ACL162C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR125C (CAT5)"
                     /codon_start=1
                     /product="ACL162Cp"
                     /protein_id="NP_983242.1"
                     /db_xref="GeneID:4619362"
                     /translation="MLPFATNQATKRSFSVLATLKTSAAAKAGEGQKFDAMSDPQLAY
                     LERVVRVDQAGELGANYIYAGQFFVLANKHPHLKPVLQHMWDQEIHHHDTFNDLQLRR
                     RVRPSLLTPLWKLGAFTMGSVTALLSPEAAMACTEAVETVIGGHYNDQLRCLNSQYEM
                     RRSDGTCGQSDELRNLISTIRQFRDDELEHLDTAVQYDSHKAVPYIALTEAIKAICRT
                     AIWTAERV"
     gene            complement(<74072..>74953)
                     /locus_tag="AGOS_ACL161C"
                     /old_locus_tag="ACL161C"
                     /db_xref="GeneID:4619363"
     mRNA            complement(<74072..>74953)
                     /locus_tag="AGOS_ACL161C"
                     /old_locus_tag="ACL161C"
                     /product="ACL161Cp"
                     /transcript_id="NM_208596.1"
                     /db_xref="GeneID:4619363"
     CDS             complement(74072..74953)
                     /locus_tag="AGOS_ACL161C"
                     /old_locus_tag="ACL161C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR374C"
                     /codon_start=1
                     /product="ACL161Cp"
                     /protein_id="NP_983243.1"
                     /db_xref="GeneID:4619363"
                     /translation="MDYSTGQYSDIWSYKYTSSVSKEWSRLAADGVNSRFYVEQFNEN
                     IRSIEDVLQGLTTVIQRSDYDTSSSEFSSDAEFAVSNTTQGNTSVGNAQDLLPGSAVE
                     AGTVSQARKYAEAYPMYRRMPAPAGVSGGAAAIVPEGSRFFVIKSFNLENIKASFKHG
                     VWTSTKRGNKRLSKAYVGLPAGARIFLFFSVNKSGKFCGVAEMKSNILQGDSRNKIWQ
                     CEAGHQFNDLFLVEWTCVCDVHNRLLKHFNIMDTEGSFKPVTHARDADEVDIEIGRTI
                     LKLFTNTKKNRSSFLED"
     gene            complement(<75267..>77321)
                     /locus_tag="AGOS_ACL160C"
                     /old_locus_tag="ACL160C"
                     /db_xref="GeneID:4619364"
     mRNA            complement(<75267..>77321)
                     /locus_tag="AGOS_ACL160C"
                     /old_locus_tag="ACL160C"
                     /product="ACL160Cp"
                     /transcript_id="NM_208597.1"
                     /db_xref="GeneID:4619364"
     CDS             complement(75267..77321)
                     /locus_tag="AGOS_ACL160C"
                     /old_locus_tag="ACL160C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR207W (HRD3)"
                     /codon_start=1
                     /product="ACL160Cp"
                     /protein_id="NP_983244.1"
                     /db_xref="GeneID:4619364"
                     /translation="MNLGSGANALGLLLATIAFLTTVGQGQVQDSLQQIAFIADRDPW
                     EAATALSLTLERITEPPLTSRLEKDPYLDSKGRLVVNPPTDYDEEEYKARYEVFWTES
                     VNDSQRLLYELLKECSDRLAHPEATYMLYRMHLYGEWGIPHNWLLGWKYLERFNVLSN
                     ETNTTSLYDAAVAHATGLFGVLPVSPEKTLIYLQKASRLGSLEAMQALAYRYLMGHNV
                     PQDASKALILYSKVAHELWYSYPARFWHYHDEYFDSYGNPGFLYRGAEVSEKFAPRSL
                     PNWGSPLLRFYYYFLKFIEITDEPGSPEYMDLGICDAVEEAFKLSMNTYTQYGDHEGV
                     LRRMFEIHEKFQGEIANADHVAKGCYGSGMALLGHLLLRGLGTEQPRIKEAEQILLHA
                     RDVLLQTNKVLSRFPLRDLGLLHHYEYRDYNRAAEFYKLAEDEASLYMLNFIQNDLSQ
                     EGLIAAMDRFRDGNLESHFTRIQILELQLGFQGPAAIAESYRYFLENANHLQSPDLRN
                     ALMQALMGNFENALWLYARSAELGTLSAMENAARILYKAPCLICASPQISPPRLDAAF
                     RYYDRARMMGSVFAAVTAGSMCYRNGSYETAALLHLSRCTEFSRLTLGYMYEHGLGVD
                     RDYRLAAEHYEAATREFVPWTSMAGKLLVWKVTVKAWFHSAIWLHKLIRSFRVLWNWL
                     TI"
     gene            <77493..>78734
                     /locus_tag="AGOS_ACL159W"
                     /old_locus_tag="ACL159W"
                     /db_xref="GeneID:4619365"
     mRNA            <77493..>78734
                     /locus_tag="AGOS_ACL159W"
                     /old_locus_tag="ACL159W"
                     /product="ACL159Wp"
                     /transcript_id="NM_208598.1"
                     /db_xref="GeneID:4619365"
     CDS             77493..78734
                     /locus_tag="AGOS_ACL159W"
                     /old_locus_tag="ACL159W"
                     /note="NOHBY310; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0C16687g"
                     /codon_start=1
                     /product="ACL159Wp"
                     /protein_id="NP_983245.1"
                     /db_xref="GeneID:4619365"
                     /translation="MEVRYQCVCQQLVKWSDLNSCKECHSISCFRCQEFEPVLKYCPK
                     CLEEPGKIDQIFCNRNCFQCPRCNISLVISSEKVTEDSKSYVFTCTGCKWSFTTPPTG
                     KIKSLTKYVLELYNSKNSRAYELMTHLHNKKQLLQWEGRAFKFDEIVNALEGNAPRSF
                     VQRLAAGEKLHHLINEELAQPLQQDMEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQT
                     PASSKLHKESFAMNVLPHIRIETEARALGVDTQDPTALAIIVMNPIPMRAVDFVLSAS
                     DTLFLPVRKFTIPSVAPDDSQLDRSQGKDVNLQILEHYVKFIPTCMLGNDHKLNRAER
                     TRRLGNRFQFQGSASPTPPNPVDYDIEEEARPLDQGDAWCILPLKLLRDGLHLLNVLV
                     TIGDWQVNLNLHFKQHIATIT"
     gene            <78848..>79135
                     /locus_tag="AGOS_ACL158W"
                     /old_locus_tag="ACL158W"
                     /db_xref="GeneID:4619366"
     mRNA            <78848..>79135
                     /locus_tag="AGOS_ACL158W"
                     /old_locus_tag="ACL158W"
                     /product="ACL158Wp"
                     /transcript_id="NM_208599.2"
                     /db_xref="GeneID:4619366"
     CDS             78848..79135
                     /locus_tag="AGOS_ACL158W"
                     /old_locus_tag="ACL158W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL160C-A"
                     /codon_start=1
                     /product="ACL158Wp"
                     /protein_id="NP_983246.1"
                     /db_xref="GeneID:4619366"
                     /translation="MSEKIELSQEPAIPTDTIARLFHTCSFTQDSTKITEDAVTLVER
                     YMKLFIREAVLRSLENKEKVKQETRADSFAEGPVLQHTDLEEISGVLILDF"
     gene            complement(<79321..>80868)
                     /locus_tag="AGOS_ACL157C"
                     /old_locus_tag="ACL157C"
                     /db_xref="GeneID:4619367"
     mRNA            complement(<79321..>80868)
                     /locus_tag="AGOS_ACL157C"
                     /old_locus_tag="ACL157C"
                     /product="ACL157Cp"
                     /transcript_id="NM_208600.2"
                     /db_xref="GeneID:4619367"
     CDS             complement(79321..80868)
                     /locus_tag="AGOS_ACL157C"
                     /old_locus_tag="ACL157C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR206W (ENT2) and YDL161W (ENT1)"
                     /codon_start=1
                     /product="ACL157Cp"
                     /protein_id="NP_983247.1"
                     /db_xref="GeneID:4619367"
                     /translation="MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAE
                     RSYSAVEFFEIVVMLDKRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLF
                     RRLTEFYHVDESTGVDHGQIIRVKARELVALLRDEERLREERNMRLGRNPRNRQASVP
                     PPAEDLDPDLQRALEESRITAEEEERRRREKTNQQQDNEELEVALQLSKEEEELRKLR
                     ELQQQREQQMALWQQQQQQQPQAMYYDIFGNPISLEEYLQYQQQQQQQQQQQQLAQQM
                     AEQYAAEQQYYAQQQYLAQQQQLAEQQYLAQQQFLAQQQQQPQFQSGPNNPFSLENMH
                     KLNSDGPQASGPYISTAGGFPDRASSSPSLPQQKQQPQVLQQPGQHSSPVPQLPRPQS
                     QPGPQLQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQ
                     GTGYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGNSNKPNEQ
                     NISLIDI"
     gene            <81015..>81470
                     /locus_tag="AGOS_ACL156W"
                     /old_locus_tag="ACL156W"
                     /db_xref="GeneID:4619368"
     mRNA            <81015..>81470
                     /locus_tag="AGOS_ACL156W"
                     /old_locus_tag="ACL156W"
                     /product="ACL156Wp"
                     /transcript_id="NM_208601.1"
                     /db_xref="GeneID:4619368"
     CDS             81015..81470
                     /locus_tag="AGOS_ACL156W"
                     /old_locus_tag="ACL156W"
                     /note="NOHBY309; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACL156Wp"
                     /protein_id="NP_983248.1"
                     /db_xref="GeneID:4619368"
                     /translation="MLAEPVYKPLFSYVIPEVPSTALHNANDSFLTTLHRPGNKRSCD
                     LIVIFNDDHAWLWQHAPQNKSRYRWSRDTYSVQGVENTKTTVLHLVLCARRFVSVMSS
                     FLHSRVASRVWRYTALKSSFVLLRAASLQPMAASEAAVARAKCSYLTGQ"
     gene            <81488..>83581
                     /locus_tag="AGOS_ACL155W"
                     /old_locus_tag="ACL155W"
                     /db_xref="GeneID:4619369"
     mRNA            <81488..>83581
                     /locus_tag="AGOS_ACL155W"
                     /old_locus_tag="ACL155W"
                     /product="ACL155Wp"
                     /transcript_id="NM_208602.1"
                     /db_xref="GeneID:4619369"
     CDS             81488..83581
                     /locus_tag="AGOS_ACL155W"
                     /old_locus_tag="ACL155W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL164C (CDC9)"
                     /codon_start=1
                     /product="ACL155Wp"
                     /protein_id="NP_983249.1"
                     /db_xref="GeneID:4619369"
                     /translation="MSAPKKQATLGRFFTALKRPQDGATAAATVKKSKVEAAECLAAP
                     AGHEQDAEVKNSLPELADKPAPGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCAVF
                     EAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGI
                     LIKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAI
                     AQAEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILT
                     HEHDGKEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLK
                     PMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYP
                     EIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCL
                     FAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSV
                     SASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRT
                     GTYGGFLLGCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSS
                     PPDVWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSS
                     DQIVEFYQRQANSSG"
     gene            <83958..>84917
                     /locus_tag="AGOS_ACL154W"
                     /old_locus_tag="ACL154W"
                     /db_xref="GeneID:4619370"
     mRNA            <83958..>84917
                     /locus_tag="AGOS_ACL154W"
                     /old_locus_tag="ACL154W"
                     /product="ACL154Wp"
                     /transcript_id="NM_208603.2"
                     /db_xref="GeneID:4619370"
     CDS             83958..84917
                     /locus_tag="AGOS_ACL154W"
                     /old_locus_tag="ACL154W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR205C (HMX1)"
                     /codon_start=1
                     /product="ACL154Wp"
                     /protein_id="NP_983250.1"
                     /db_xref="GeneID:4619370"
                     /translation="MATKSENTPIYTQASPVVPLPTDTGALANRINFHTRELHSKADA
                     FVSAKFAVALRHPSIYRQGLLAMYYIFRSVEQHIDRLLRAPATADEARIGEILRAFWR
                     PEFARAPALVQDFEVYYAAEYSTSAQLHQFLDSYELPPRLAAAVADIEAAALRQPWTI
                     LAHCHVLYLALFAGGRVMRSALSRQLGLLPRAAGLSARETQLRGTHFFTFGAGAGEEN
                     KARVAYKRAYELATRTALSEAEKADVIDAARADFDHIQAVMAELAVRNRQELLGSPSY
                     RLLTFLGEEWRYRTKNSPQLLALAAVLSALFLYAAARVLVARA"
     gene            complement(<84954..>85289)
                     /locus_tag="AGOS_ACL153C"
                     /old_locus_tag="ACL153C"
                     /db_xref="GeneID:4619371"
     mRNA            complement(<84954..>85289)
                     /locus_tag="AGOS_ACL153C"
                     /old_locus_tag="ACL153C"
                     /product="ACL153Cp"
                     /transcript_id="NM_208604.1"
                     /db_xref="GeneID:4619371"
     CDS             complement(84954..85289)
                     /locus_tag="AGOS_ACL153C"
                     /old_locus_tag="ACL153C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR204W (QRI5)"
                     /codon_start=1
                     /product="ACL153Cp"
                     /protein_id="NP_983251.1"
                     /db_xref="GeneID:4619371"
                     /translation="MLGLVRNMCRAVQLARVPFVRPLSLQAVAVNKSGGSAVWSELRS
                     MRAAASAPLAVACTQAVLVWGERSVGQAAPLEADSVMRKRRTKMKKHKWRKRRKAQRA
                     ERRKLSQGR"
     gene            <85697..>86983
                     /locus_tag="AGOS_ACL152W"
                     /old_locus_tag="ACL152W"
                     /db_xref="GeneID:4619372"
     mRNA            <85697..>86983
                     /locus_tag="AGOS_ACL152W"
                     /old_locus_tag="ACL152W"
                     /product="ACL152Wp"
                     /transcript_id="NM_208605.1"
                     /db_xref="GeneID:4619372"
     CDS             85697..86983
                     /locus_tag="AGOS_ACL152W"
                     /old_locus_tag="ACL152W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR203C (MSS51)"
                     /codon_start=1
                     /product="ACL152Wp"
                     /protein_id="NP_983252.1"
                     /db_xref="GeneID:4619372"
                     /translation="MLVSRLPQLAARPYAVGRGCAAGACGQRRPIMGFVRNALGLDPP
                     ASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTGKDIRYSCERSGIPTHHSR
                     EAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRMVNMLNWDLFL
                     YTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGLKSLAALRY
                     TLYPESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIHFIGPEALY
                     DRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFCFHPGFA
                     SAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHPTKNI
                     FGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV"
     gene            complement(<87033..>87659)
                     /locus_tag="AGOS_ACL151C"
                     /old_locus_tag="ACL151C"
                     /db_xref="GeneID:4619373"
     mRNA            complement(<87033..>87659)
                     /locus_tag="AGOS_ACL151C"
                     /old_locus_tag="ACL151C"
                     /product="ACL151Cp"
                     /transcript_id="NM_208606.1"
                     /db_xref="GeneID:4619373"
     CDS             complement(87033..87659)
                     /locus_tag="AGOS_ACL151C"
                     /old_locus_tag="ACL151C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL165W (CDC36)"
                     /codon_start=1
                     /product="ACL151Cp"
                     /protein_id="NP_983253.1"
                     /db_xref="GeneID:4619373"
                     /translation="MVPMPHVAPSKAVEQLNMDKYGLKGLLPVIKHEKQYDAFMTLGV
                     DVSSLLHSLQVSSKDGYNTALSNGHHALDTFPSPWVETSRSEVEPKFFIPESFCNIGG
                     VLGQASTDFTSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTL
                     KVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQRDFILNYSAIM"
     gene            <87741..>88400
                     /locus_tag="AGOS_ACL150W"
                     /old_locus_tag="ACL150W"
                     /db_xref="GeneID:4619374"
     mRNA            <87741..>88400
                     /locus_tag="AGOS_ACL150W"
                     /old_locus_tag="ACL150W"
                     /product="ACL150Wp"
                     /transcript_id="NM_208607.1"
                     /db_xref="GeneID:4619374"
     CDS             87741..88400
                     /locus_tag="AGOS_ACL150W"
                     /old_locus_tag="ACL150W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL166C (FAP7)"
                     /codon_start=1
                     /product="ACL150Wp"
                     /protein_id="NP_983254.1"
                     /db_xref="GeneID:4619374"
                     /translation="MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAR
                     EHNCYDGYDEARKSHIVDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRC
                     DNAILHDRLQKRGYHSSKIEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQN
                     VDRIAAWEANWVSEHPDGVSNALQQHAGSDASSSEADSDGVSDAGDSDGDGDGDSTQD
                     N"
     gene            <88711..>90597
                     /locus_tag="AGOS_ACL149W"
                     /old_locus_tag="ACL149W"
                     /db_xref="GeneID:4619375"
     mRNA            <88711..>90597
                     /locus_tag="AGOS_ACL149W"
                     /old_locus_tag="ACL149W"
                     /product="ACL149Wp"
                     /transcript_id="NM_208608.1"
                     /db_xref="GeneID:4619375"
     CDS             88711..90597
                     /locus_tag="AGOS_ACL149W"
                     /old_locus_tag="ACL149W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL167C (NRP1)"
                     /codon_start=1
                     /product="ACL149Wp"
                     /protein_id="NP_983255.1"
                     /db_xref="GeneID:4619375"
                     /translation="MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAR
                     EIEVGGGGVQMATGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMF
                     LAHAKVFDLWKECDRWCANHVSERACNAGAKGDVAELFRVLDLDEQLVSHAYIQQATR
                     VLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWF
                     TQFGARPVGFWTVKNVVEDTSNVNNNWSSNNSRYVEEHDSISGFVVFQSHEAASEALN
                     LNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCP
                     SCGFSNFQRRIACFRCSFPATSAVTVSKLYKPQQQRHYQNPHHVPSKQQVQHPQIHDQ
                     DTQQHSQHFNIQQMPQQLQMQQQAHGTVQGGSSMQQYKHRPQHGLQAYLGCYQQQQAK
                     SQQQYQMNQQQVQMIAGDAQRRYNRYNKMVQGNGQNGNSCNGNGSLGSSNVPFRAGDW
                     KCLNCSYHNFAKNIVCLRCGNPKTANEDETQASLQGLHSSSGPVGAQDSAISSVTVSI
                     DRRSKNELSNMRNGSNSSNSGNGNNDSSTNDHNGYPQQSHHNGAGGSNTHWNAGPLGG
                     TVNI"
     gene            complement(<90928..>92073)
                     /locus_tag="AGOS_ACL148C"
                     /old_locus_tag="ACL148C"
                     /db_xref="GeneID:4619376"
     mRNA            complement(<90928..>92073)
                     /locus_tag="AGOS_ACL148C"
                     /old_locus_tag="ACL148C"
                     /product="ACL148Cp"
                     /transcript_id="NM_208609.1"
                     /db_xref="GeneID:4619376"
     CDS             complement(90928..92073)
                     /locus_tag="AGOS_ACL148C"
                     /old_locus_tag="ACL148C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL168W (SFA1)"
                     /codon_start=1
                     /product="ACL148Cp"
                     /protein_id="NP_983256.1"
                     /db_xref="GeneID:4619376"
                     /translation="MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVN
                     SAICHTDAYTLSGSDPEGLFPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQ
                     CKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVS
                     VVAVDQQAPLETVCLLGCGVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKAR
                     NASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCT
                     GNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSE
                     MGGLVRDYLNGTLKVQEFVTHKRPFEEINSGFEDLHHGDCLRTVLSL"
     gene            <92473..>93213
                     /locus_tag="AGOS_ACL147W"
                     /old_locus_tag="ACL147W"
                     /db_xref="GeneID:4619377"
     mRNA            <92473..>93213
                     /locus_tag="AGOS_ACL147W"
                     /old_locus_tag="ACL147W"
                     /product="ACL147Wp"
                     /transcript_id="NM_208610.1"
                     /db_xref="GeneID:4619377"
     CDS             92473..93213
                     /locus_tag="AGOS_ACL147W"
                     /old_locus_tag="ACL147W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR201C (COQ9)"
                     /codon_start=1
                     /product="ACL147Wp"
                     /protein_id="NP_983257.1"
                     /db_xref="GeneID:4619377"
                     /translation="MFRVCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAH
                     VPVLGFNERAIVRAAGDLGYGSAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVAL
                     ADAAAQGNVSMEQLFLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDL
                     IYYSGEKDHPDLAWYSKRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLG
                     TAYNNVEEFAWYQLLMAMNLVKSQLTRG"
     gene            complement(<93265..>93588)
                     /locus_tag="AGOS_ACL146C"
                     /old_locus_tag="ACL146C"
                     /db_xref="GeneID:4619378"
     mRNA            complement(<93265..>93588)
                     /locus_tag="AGOS_ACL146C"
                     /old_locus_tag="ACL146C"
                     /product="ACL146Cp"
                     /transcript_id="NM_208611.1"
                     /db_xref="GeneID:4619378"
     CDS             complement(93265..93588)
                     /locus_tag="AGOS_ACL146C"
                     /old_locus_tag="ACL146C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR200W (YKE2)"
                     /codon_start=1
                     /product="ACL146Cp"
                     /protein_id="NP_983258.1"
                     /db_xref="GeneID:4619378"
                     /translation="MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQAL
                     QPETQVYKLTGGVLLPVEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAAL
                     VKLRG"
     gene            <93787..>94620
                     /locus_tag="AGOS_ACL145W"
                     /old_locus_tag="ACL145W"
                     /db_xref="GeneID:4619379"
     mRNA            join(<93787..93792,93859..>94620)
                     /locus_tag="AGOS_ACL145W"
                     /old_locus_tag="ACL145W"
                     /product="ACL145Wp"
                     /transcript_id="NM_208612.2"
                     /db_xref="GeneID:4619379"
     CDS             join(93787..93792,93859..94620)
                     /locus_tag="AGOS_ACL145W"
                     /old_locus_tag="ACL145W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR199C (PBA1); 1-intron"
                     /codon_start=1
                     /product="ACL145Wp"
                     /protein_id="NP_983259.2"
                     /db_xref="GeneID:4619379"
                     /translation="MIFKQWQSERLPRHQLDCLGPMDPHSLLAGAEPQVEFSGKLGER
                     YSAALVVPSTLSWLMPPEMVQLTPVAQLVGTLTQAGGGECATRLVAADQFYEADVPQA
                     ERHVRVAYQLYERGPGQLVVVVEENDLKYPPIVHNRLAQQLAEKLRAVGAETTVLVNS
                     DKSTGVKDLEELVPPEFITGALAALVCALAPSGAGRVLVVQSEGPHGFEKHNLTVVDA
                     LVERVRQILDQPPEYVAACTRHWKLQAGSQFQGGLYL"
     gene            complement(<94805..>96454)
                     /locus_tag="AGOS_ACL144C"
                     /old_locus_tag="ACL144C"
                     /db_xref="GeneID:4619380"
     mRNA            complement(<94805..>96454)
                     /locus_tag="AGOS_ACL144C"
                     /old_locus_tag="ACL144C"
                     /product="ACL144Cp"
                     /transcript_id="NM_208613.1"
                     /db_xref="GeneID:4619380"
     CDS             complement(94805..96454)
                     /locus_tag="AGOS_ACL144C"
                     /old_locus_tag="ACL144C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR197W (NOP56)"
                     /codon_start=1
                     /product="ACL144Cp"
                     /protein_id="NP_983260.1"
                     /db_xref="GeneID:4619380"
                     /translation="MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSF
                     TKLVELVSFAPFKGAAHALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDK
                     NLGPSIKEEFPYVDCISNELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRA
                     KVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKL
                     VLFIRDKASLNDESLHDLSAILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAER
                     VVNLVEYRRQLYEYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQI
                     LGAEKALFRALKTKGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYS
                     DDPTNVFGQVLKKQVEQRLEFYATGSPTLKNEIAIQEAIALFNKDKPQEASEAAEGAT
                     KSKSKKRKLDESEEEEKKDSKKEKKEKKEKKEKKEKAEKKDKAEKAEKAEKAEKAEKA
                     EKAEKAEKKEKKEKKEKTEKKEKKEKKEKKEKKEKKDKKKD"
     gene            97114..97184
                     /locus_tag="AGOS_t0046"
                     /db_xref="GeneID:4619381"
     tRNA            97114..97184
                     /locus_tag="AGOS_t0046"
                     /product="tRNA-Gly"
                     /codon_recognized="GGC"
                     /db_xref="GeneID:4619381"
     gene            complement(<97254..>103145)
                     /locus_tag="AGOS_ACL143C"
                     /old_locus_tag="ACL143C"
                     /db_xref="GeneID:4619319"
     mRNA            complement(<97254..>103145)
                     /locus_tag="AGOS_ACL143C"
                     /old_locus_tag="ACL143C"
                     /product="ACL143Cp"
                     /transcript_id="NM_208614.1"
                     /db_xref="GeneID:4619319"
     CDS             complement(97254..103145)
                     /locus_tag="AGOS_ACL143C"
                     /old_locus_tag="ACL143C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR217W (CCH1)"
                     /codon_start=1
                     /product="ACL143Cp"
                     /protein_id="NP_983261.1"
                     /db_xref="GeneID:4619319"
                     /translation="MADGREQDEQGAGGRAMPGLFRVETPTRGAAADGEERRAVRPQL
                     TVQTSGLGGQHKTASSLSVRSHLRELWERRSRRGSASPVPGTASGTRSFDVSPVRQSM
                     EPPRSARVISMIEDNEVDDFLNLQGEFIAAMEEEHDHTWLPKLSRVRTAEGGSRPVST
                     ASENDELAYSSGYLSPAVAHGEPHFEEIELVEMAGHAGKDGDAAKTDHLQVPGLAKGE
                     GRPRLSDGSRKSTGTAECEVTVEQEPLRLYGNSMGFISPDNRVRLRLARWLMHYRYSM
                     LSQALLILYTVCLSYRQYNKQASGTMGNYANWSDSAFILCNCLFTAEMFAKIIAFGFW
                     DDSQMFREHNQDYMTFWQYFGIGKYYRRLESKYGHEFMRKVVPFRAISQDAERARKKL
                     SSISYTSSFEKREITMPRAFARNSWNRMDLISTVCYWIGLVLSFNNFDLKNGIRIFKT
                     LATLRILRLTDTDTGLSSILKSIKYGLPQLINVGFMLLYFWVFFAILGVQSFQGSLRR
                     QCVWIDPNDPSNTYNYDMQFCGGHYDAESGRPMPYIFADGTPGPAAKGFICPRYSRCI
                     SDANPYHGRISFDNIISSMELIFIIMSANTFTDLMYYTMDTDAMAASLFFIISTLFLT
                     VWMMNLLVAVLYSSFEIANELLYQKQKESKSMQNLIVRKILQICNNIKQKAGQSSLPL
                     IFKKVIKVYEKLEFIFVLLIFVDLLIHGAVRAYDDNNMILAYKFERILSFVLMIETLI
                     RLFLYAPAFWKFLAKPTYVYDLIVAIISIIITQPLVHDKLGRTYYWLSIFQISRFYRV
                     VLAFKITRNLWKRVLGNALMIWNLSGFYFLFLFLASLIISVYFEGTVALDRMAEEPFA
                     MYSLPNTFLSLFIIGSTEDWTSILYLLQEESPNTIYAFFGAGFIMLWFVLANSVVLNI
                     FIAVISQSLRVEEADKRKLQIRHYLKHVYPERIKQYTNATLISRIKKKLLGRKVEETT
                     RDFRQFMFRGTAILAISQNYEELQRIPKETGNTAWIQQYLVNMSMYFMKKFRVIEYFQ
                     ANPFFKKPVVVFAETNELSETNKKYSLQLNEWEEEKLQFLRTHSTFNNSFFILPPNNA
                     LRKFCQTIVPPSVGKRTDGKQFYEDTTDIYRGNKYFYHIKRDTFVAITFVATILMVMF
                     SCYVTPLYRMRYETGSWSWLNVCECTFVALFTLEFLIKTIADGFLYSPNAYIMNPWNC
                     IDLVVLISMWIDLLSWLQSSSNLPRLFRGLDALRALRFLTISHTARSTFKQVFFDGIT
                     KIAGACLIALSLLFPFTVWGLSLFRGMLGVCNDGDAGMSQCYNEFSSTVGNWEVLMPR
                     VYHSPVLNMDNFPSAFRTLYEIVSLEGWVDLLVDLVSTQGVGMTRSPFASTENGIFLV
                     LFNFLSMVFILTLFVSFIISNHAKTTGSAFLTVEEKSWLEVKKLLSRVKPEATPDPFE
                     MSKARRFCHKLAVEMDYFWYAAFLQVMMFLHILTLMLRSYHESAALKGYASLMFILTG
                     SIFLCQEILYIYGKGFKLVRTNGWDVFRFLVLLLYFLLNITYNYYRGDNGLSNIHAAF
                     QLIVFTFVIPHNDILSELVNTAVASLPSILSLTYTWGILFLVYAIAMNQIFGLTRLGT
                     NTTGNLNFRTVAKSLIVLFRCSFGESWNYIMHDITVSQPFCFIDPQTGYTDCGSKPYA
                     YFLMMSWNVLSMYIFLNMFISLVIENFSYVYHRGDKKDVARRDELRKFKKAWNKFDQD
                     GTGELEFSLLPKLMHSFDGAVSFKIWEGRLSIKNLVANYMQVNPADPYDVDVDLVGLN
                     LELNTIDVAKIIQRRLNYRRFVREVHMTNAYYGCIKFSNILQQIPLYTEYNPRECLGI
                     DEYVKWLYTISKVDKFLENERNVDALEMVVTRWKYVMSKRKSPSRPRTPIPPPPRMHV
                     AIMRTPSESPAQRSIDNNVQLEDHFIWSPSEQHSNPFEDRESTPADNTQRDLIRPPKY
                     PELDQ"
     gene            <103238..>105223
                     /locus_tag="AGOS_ACL142W"
                     /old_locus_tag="ACL142W"
                     /db_xref="GeneID:4619382"
     mRNA            <103238..>105223
                     /locus_tag="AGOS_ACL142W"
                     /old_locus_tag="ACL142W"
                     /product="ACL142Wp"
                     /transcript_id="NM_208615.1"
                     /db_xref="GeneID:4619382"
     CDS             103238..105223
                     /locus_tag="AGOS_ACL142W"
                     /old_locus_tag="ACL142W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR216C (GPI1)"
                     /codon_start=1
                     /product="ACL142Wp"
                     /protein_id="NP_983262.1"
                     /db_xref="GeneID:4619382"
                     /translation="MSSASADGQRTYVDLKFITATTVKSTETKLRTHTHSYTTHPPMV
                     YIYWPRPLLLMHHRSQKLVVVAYADKGADPVVLHLIKEDIYRPVQAPYARIGTVDCSG
                     NFQYQREGGAAGAERAMVIEFTPPKLTLMQFFSMDPISLILPEKLQTDPFVDEPDGPN
                     NMLELLAGGGVSRTRLRGTLDVVNMYYRHVERFEKQYPEYADSRMSLRQRWGRAKRWL
                     GGTWAFQVMCTVVLYVVMMVRVVAGAITTMLNWRHLPLIAVSTTMQQIDLRAQQLCYM
                     PVQYLRIHGHMVAPAGEPRMKAPGGRGRRRSVSFQTLPCEFYPDYIRLYNTLWLIAND
                     VSLGVTFGALLVEKREPLAAALQHVLRAALYGLPMRITRFLNESPFGIKLNGELSKFL
                     SELFTWIMDFVFRLFIVRFTEVPALEHVVMVVAHVSSVVGVTFALALIIDGISVFSLH
                     ISLFYLISAKLYRWQLHVMTSFFYLFCGKKINVLRKRIDNDTFHLDQVLMGTLLFIVL
                     IFLLPTVFAYYLTYTLICVVLTIVPLLLEASMALLNHFPLFALLLRLKDPMRLPGGIY
                     FQLKHNRFSLNSNPLKVAMMFQPYLEILTIIRDKFMSLNTLSSIIAGEPIMVHRLYLY
                     QVLYSSLPIRPIDATLLWTELQRLMTWKDNPLYYTHI"
     gene            complement(<105276..>105647)
                     /locus_tag="AGOS_ACL141C"
                     /old_locus_tag="ACL141C"
                     /db_xref="GeneID:4619383"
     mRNA            complement(<105276..>105647)
                     /locus_tag="AGOS_ACL141C"
                     /old_locus_tag="ACL141C"
                     /product="mitochondrial 37S ribosomal protein RSM27"
                     /transcript_id="NM_208616.1"
                     /db_xref="GeneID:4619383"
     CDS             complement(105276..105647)
                     /locus_tag="AGOS_ACL141C"
                     /old_locus_tag="ACL141C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR215W (RSM27)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM27"
                     /protein_id="NP_983263.1"
                     /db_xref="GeneID:4619383"
                     /translation="MAQHHLETRQGYWVQDVMSIPKERLQQVAQISARIFDQCYNPSG
                     ARIGTKILTKRLRGPAMVQYYGNPDLLRFRQLKSLYPGFKFTDPEEQYRLQMVDSRKR
                     RGKGAPTKKKEASTDTKKKRK"
     gene            complement(<105867..>106728)
                     /locus_tag="AGOS_ACL140C"
                     /old_locus_tag="ACL140C"
                     /db_xref="GeneID:4619384"
     mRNA            complement(join(<105867..106538,106639..>106728))
                     /locus_tag="AGOS_ACL140C"
                     /old_locus_tag="ACL140C"
                     /product="40S ribosomal protein S0"
                     /transcript_id="NM_208617.1"
                     /db_xref="GeneID:4619384"
     CDS             complement(join(105867..106538,106639..106728))
                     /locus_tag="AGOS_ACL140C"
                     /old_locus_tag="ACL140C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR214W (RPS0A) and YLR048W (RPS0B); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S0"
                     /protein_id="NP_983264.1"
                     /db_xref="GeneID:4619384"
                     /translation="MSLPATFDLTPEDAQLLLAANVHLGSKNVQVHQEPYLYKTRPDG
                     VNIIHIGKTWEKIVLAARIIAAIPNAEDVVAISSRTYGQRAVLKFSAHTGATAIAGRF
                     TPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLESPSEYVDVAI
                     PCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYFYRDPEEIEQQAAEEA
                     AAGEEDDEAKEEVAAEEQTEAADWAEGQSEEVASW"
     gene            <107252..>109312
                     /locus_tag="AGOS_ACL139W"
                     /old_locus_tag="ACL139W"
                     /db_xref="GeneID:4619385"
     mRNA            <107252..>109312
                     /locus_tag="AGOS_ACL139W"
                     /old_locus_tag="ACL139W"
                     /product="ACL139Wp"
                     /transcript_id="NM_208618.1"
                     /db_xref="GeneID:4619385"
     CDS             107252..109312
                     /locus_tag="AGOS_ACL139W"
                     /old_locus_tag="ACL139W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR047C (FRE8)"
                     /codon_start=1
                     /product="ACL139Wp"
                     /protein_id="NP_983265.1"
                     /db_xref="GeneID:4619385"
                     /translation="MGGAWQEAVVRSIGAADERMVRLSGWASLALALGLVCVVVPVVN
                     YMRLNPWVFRVMHHWRHHVMRRHGAMCRKLVQQRTLWLALLWCMLGGACAVVGSADVV
                     VVTKRLGRVAAAFMPALFLLTLRPSPLPYTLYLSLLPMHKWLGRVVVLQATVHSALYT
                     WYFATSGKMAKMKKTANWMGAVALLAFVLIAATSLPAVRRRRFRTFYYVHYVGTWVSV
                     LAVHVHSRPPVTTYTVLNVALLLYQAWYRISRMSTTTVTVVPISTSLALLEFPLADLV
                     EKPQLPSGHVRINLRAPSILGRVFQHIMPMQHPFTVASLPTDTTVRLIVRKSRFPLVN
                     NGKYYVTGAFEPKVDFLSHRKRRMPGSWAPEPASPFQCQSPSLQSSPLHYNIKASRVL
                     MVVGGSAISFGLPFLRILNFNGVNVRLIWVCRDYHDLRILSQFRSNFNGLEIYVTGTN
                     CEEQDLNIDYVDYDERSSEGERDPERCALLSPKASEYNCLTPTTGGSTLSGRDAHNYS
                     TFQNRCHSCKHLDRGCRDLEDHAIADINDEIDFTDFFSTRHSTSKYHPKENSKLPVIT
                     KDSVFRKPNYVVPPVFDRYDLKTGFTTYTTREKLSIPTGVKLFFGRPVLSPRDYHWCL
                     QKECIGPSETNECCRADIANSTHVDDLARVWVLAAGPQALVEATRIWASDGGLHFHEE
                     SFKV"
     gene            complement(<109745..>111112)
                     /locus_tag="AGOS_ACL138C"
                     /old_locus_tag="ACL138C"
                     /db_xref="GeneID:4619386"
     mRNA            complement(<109745..>111112)
                     /locus_tag="AGOS_ACL138C"
                     /old_locus_tag="ACL138C"
                     /product="ACL138Cp"
                     /transcript_id="NM_208619.1"
                     /db_xref="GeneID:4619386"
     CDS             complement(109745..111112)
                     /locus_tag="AGOS_ACL138C"
                     /old_locus_tag="ACL138C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR212W (SLI1)"
                     /codon_start=1
                     /product="ACL138Cp"
                     /protein_id="NP_983266.1"
                     /db_xref="GeneID:4619386"
                     /translation="MRRVTPFEEFYYRKNTEGLYSCFFVGVTLNVPLDRAKLEIALRK
                     VVNNYPQLYSNVFYDDMSGDLCLRPLSEKIYIGDVLGLAESDKLDEDASNWIFKNINF
                     KYHCQCPLWKIVSMQAGQQLLFCFDHLILDGMSGALFWEDVLRELNSDDHSPAQADQD
                     GVLYFGDGIDAMPAHPYSMWPSSLAWKILRIVLFIWHIYLQPYIPTLGNSHSCFQFKR
                     YTFPECLYDNSRRIRNTNRHFSLRIAPDQLKQQVKWCREHNTSLTAWFAAIITLWLKN
                     FTKKSSTTGSVVKVEVPFNTRQQLSRAIPTYPKSALRLGLFVKGSTLQYNVDNGDEGV
                     WKIASEFSKDLGRNRDTEVGIQKCKLLELVDVKNFVISLSQLKYPPSTFEITNLGFQA
                     FGTSTSDTYYVTDAVFRGGQTLSNAFTCYIISTPLGGCHISLSLPPEVASDCEVDALQ
                     LVISK"
     gene            complement(<111649..>113082)
                     /locus_tag="AGOS_ACL137C"
                     /old_locus_tag="ACL137C"
                     /db_xref="GeneID:4619387"
     mRNA            complement(<111649..>113082)
                     /locus_tag="AGOS_ACL137C"
                     /old_locus_tag="ACL137C"
                     /product="ACL137Cp"
                     /transcript_id="NM_208620.1"
                     /db_xref="GeneID:4619387"
     CDS             complement(111649..113082)
                     /locus_tag="AGOS_ACL137C"
                     /old_locus_tag="ACL137C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR211W (ZPR1)"
                     /codon_start=1
                     /product="ACL137Cp"
                     /protein_id="NP_983267.1"
                     /db_xref="GeneID:4619387"
                     /translation="MTDQSAKEELFKPVGEAVEDTVNDETGLRDTGAADAMGHPVQEI
                     ESLCMNCHEDGITRLLLTSIPYFREIVIMSFECPHCGLKNSEIQPASEIQEKGARYQL
                     KVEEKADFDRQVIKAETAASRFVELDLEIPPKRGQLTTVEGLLTEMIEDLDADQAARK
                     EVDENLYDQIAQFIAKVRAALSCEPGTLPLTFTLDDPAGNSWIEYKPGEAAPKWSKTE
                     YLRSDEQNVQVGIITRDQLEQRRQEKRAELSQRERNKSQAAQAGLLSDATDIENFHNE
                     VQTFTATCPSCVHPCDTHMKPVNIPHFKEVIIMSTVCEHCGYKSNEVKTGGAIPDKGR
                     KITLICDDAEDLSRDILKSETCSVSIPELHLDIQQGTLGGKFTTLEGLLTQVYEELES
                     RVFTQTSDSMDEATRNRWTSFFSKLREAIDGKIKFTVIMEDPLAGSYIQNVYAPDADP
                     NMTIEDYERTAEQNEDLGLNDIDVGEH"
     gene            <113574..>114803
                     /locus_tag="AGOS_ACL136W"
                     /old_locus_tag="ACL136W"
                     /db_xref="GeneID:4619388"
     mRNA            <113574..>114803
                     /locus_tag="AGOS_ACL136W"
                     /old_locus_tag="ACL136W"
                     /product="ACL136Wp"
                     /transcript_id="NM_208621.2"
                     /db_xref="GeneID:4619388"
     CDS             113574..114803
                     /locus_tag="AGOS_ACL136W"
                     /old_locus_tag="ACL136W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR210C"
                     /codon_start=1
                     /product="ACL136Wp"
                     /protein_id="NP_983268.2"
                     /db_xref="GeneID:4619388"
                     /translation="MPRDPLIGIVGKPSSGKSTTLNSLTDASAAVGAFPFTTIEPNRA
                     TGYLQVDCACSRFGKQSLCKPNYGWCEDGKRHVPIMLLDVAGLVPGAHSGRGLGNKFL
                     DDLRQADALIHVVDVSGTTDAEGKTTRGYDPLQDIDWLQDEIRLWIEGNLLKRWGSIV
                     RKHTATRASAVETLQAQFGGYGANAKLVARALALVPDLPPLEHWDAACVTRVVRAFMA
                     VKFPTVLALNKIDHPDADKNVSKILLRHPDTPAVLTSAITEVFLRKLDRQGFVRYQRG
                     TEFVDTAEDDPALRPLDEKLSHRIENVRDLILYRFGSTGVMQVLQAAAATLDLVPVYT
                     VKNIHTFAGGSGPHVFRDCFLVKRGTSVRSVARLIMGDVTIAAIETVGGVRAAEDDPV
                     APGQNDILSFKLAPRSL"
     gene            <115355..>117121
                     /locus_tag="AGOS_ACL135W"
                     /old_locus_tag="ACL135W"
                     /db_xref="GeneID:4619389"
     mRNA            <115355..>117121
                     /locus_tag="AGOS_ACL135W"
                     /old_locus_tag="ACL135W"
                     /product="ACL135Wp"
                     /transcript_id="NM_208622.1"
                     /db_xref="GeneID:4619389"
     CDS             115355..117121
                     /locus_tag="AGOS_ACL135W"
                     /old_locus_tag="ACL135W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YPL265W (DIP5)"
                     /codon_start=1
                     /product="ACL135Wp"
                     /protein_id="NP_983269.1"
                     /db_xref="GeneID:4619389"
                     /translation="MAEEKFAQASEASTLDELKGPKLAAAGEGRGLRHTHSSTDQEAQ
                     SVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYS
                     IMGWVVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLT
                     AGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVM
                     ILLLVLALGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFA
                     YLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQAS
                     SAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGK
                     APKLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSI
                     LITYICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDV
                     PTFITGYIGLPIYIFCFIGYKIVHKTKWIPSKEVDLFTFKEAIDLEEEECIRERALMK
                     EQLAKGGLSWKKIYDNVLGWIF"
     gene            complement(<117340..>119100)
                     /locus_tag="AGOS_ACL134C"
                     /old_locus_tag="ACL134C"
                     /db_xref="GeneID:4619390"
     mRNA            complement(<117340..>119100)
                     /locus_tag="AGOS_ACL134C"
                     /old_locus_tag="ACL134C"
                     /product="ACL134Cp"
                     /transcript_id="NM_208623.1"
                     /db_xref="GeneID:4619390"
     CDS             complement(117340..119100)
                     /locus_tag="AGOS_ACL134C"
                     /old_locus_tag="ACL134C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR044C (PDC1) and Non-syntenic homolog of Saccharomyces
                     cerevisiae YLR134W (PDC5) and YGR087C (PDC6)"
                     /codon_start=1
                     /product="ACL134Cp"
                     /protein_id="NP_983270.1"
                     /db_xref="GeneID:4619390"
                     /translation="MVSGLSKKKTTAKQLSKLTINTMSEITLGRYLFERLRQIEVQTI
                     FGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARLKGMSCLITTFGVGELS
                     ALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVFHRMSANISGTTAM
                     ISDITSAPAEIDRCIRTCYITQRPVYLGLPANMVDLKVPASLLETPIDLNLKPNDPEA
                     EAEVVETVLEMIAAAKNPVILSDACASRHDVKAETMKLIDVTQFPAFVTPMGKGSIYE
                     QHPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYSYKTKNVVEFHSD
                     HIKIRNATFPGVQMKYVLRKLVDNVAEVIKSYVPVPVPSKPANNEEIDSATPLKQEWL
                     WNQVGKFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFA
                     AEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLIHGETAQ
                     YNDIQPWQHLNLLPTFGAKDYEAVRVSTTGEWDALTQDKAFNENSKIRMIEVMLPVMD
                     APSNLVKQAELTAATNAKQE"
     gene            <119499..>120614
                     /locus_tag="AGOS_ACL133W"
                     /old_locus_tag="ACL133W"
                     /db_xref="GeneID:4619391"
     mRNA            <119499..>120614
                     /locus_tag="AGOS_ACL133W"
                     /old_locus_tag="ACL133W"
                     /product="ACL133Wp"
                     /transcript_id="NM_208624.1"
                     /db_xref="GeneID:4619391"
     CDS             119499..120614
                     /locus_tag="AGOS_ACL133W"
                     /old_locus_tag="ACL133W"
                     /note="NOHBY308; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0G14872g"
                     /codon_start=1
                     /product="ACL133Wp"
                     /protein_id="NP_983271.1"
                     /db_xref="GeneID:4619391"
                     /translation="MTISSCFRQKQRTMGIELDDRRLRHLKKWLDRALDPPTTDESVT
                     ALVKDYVLQVLLECDIAAVKGRKNEFCEQMSQYLAGMVKDHSCLDGLFYQLVDLGEPP
                     AGNSCGRQLRVLKIPADRLRWETLRAEFAPFGAVTRARIDYVHREAFLEYADAASVVR
                     CCSVRKAFLGNRFVEVQPAREAWESLSGVDVWPPDHETTVPEHGSSGVPPRTGVVLDR
                     GRAPRLSSSEPSSQRISFALLRQKEALLEKYQVKLSQLVSTLKAGTSQEDATYARVRL
                     GDLRTEMQKLHITPSDLLEEKFRLLALHEPCKAISITLLPYSSNRKPPGIRPTLVSRR
                     RPAMVSSRARKGYCVTKGYKHRKSVIPSSNLLKRSRS"
     gene            complement(<120946..>123810)
                     /locus_tag="AGOS_ACL132C"
                     /old_locus_tag="ACL132C"
                     /db_xref="GeneID:4619392"
     mRNA            complement(<120946..>123810)
                     /locus_tag="AGOS_ACL132C"
                     /old_locus_tag="ACL132C"
                     /product="ACL132Cp"
                     /transcript_id="NM_208625.1"
                     /db_xref="GeneID:4619392"
     CDS             complement(120946..123810)
                     /locus_tag="AGOS_ACL132C"
                     /old_locus_tag="ACL132C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR045C (STU2)"
                     /codon_start=1
                     /product="ACL132Cp"
                     /protein_id="NP_983272.1"
                     /db_xref="GeneID:4619392"
                     /translation="MTEDEDFTKLGLKQRLGHKSWKARQHGYQELERMFERSSVLEVA
                     GEVSTWWEAPEHFGRFITDSNVVAQESAVGAMQRMLELMGQLERVPETGSLRAQWVPA
                     LVEKGVSSSRAGTKAKAMECILMLASFDSSVRQTMELMLPFSGNKLPRLVSSLMAAMG
                     QLVCSFGFVNMKNDFWSEVLAPLPRLAGHADRAVRAETMNFILEVYKWTGKPFLQDML
                     LEKLKPIQQKDLDKLFGNYDGTIPPTEQPRLFHWQVLQRQREAAAGVDDDGDTMMGEG
                     QGGNQPGGEAGAAPVVLADPFTLLKPSSIVKNFPADFEKNVKSAKWKERVEALQQVYD
                     DLLKPAKKLDQTDDYSFYARSLAQILSKDANLQAATLAANSAAHMTNALREGIAPYGH
                     MLLDGLLDRTKEKKPSVSEAVVEALDLLAQYYGVDNCLEPTIEHMKHKIPQVKMESTN
                     FLTRMLQKQWKPTAARLKDEVIMRMMPDIVPIIVKIVNDTQPSLRDAGFECFATVMKL
                     FGEREFTDELEKLGSLKKKKIYEHFEKIEVKVPPPVQKPQQTRAVQSQRQPQHSGNYT
                     QRSLQNHQSPQQHQLQHPQSPQAQRSNHHQNSSSNFSKTLPHIVKTPRAAASSLSPSV
                     DVRHFDSPPQTLRTPTASTIPTKRGPSSPLKDKNILNNGGLNTKPRLVNRSQTHSTVR
                     ASHFNPMSSLPPSSNNSLAPAVVPPAVLAELDELKGAKAKWNKERQELMTKLTSFQTQ
                     TSQLNSENQMLQDQLNDVQLALNEKTMLLRSKDLQITKLKNRLATLESELDTALNAKH
                     SPDTPVKSVLEGIQAISPSNGSAQSAGVYGGSNHSDPCISIQPHNPQQIRKTSGGSFR
                     SNAGLTSRFSPLTSSVRVATSSESSDDLPRRVHSLHIMDTTNAVAGSITTNGSSASLL
                     SEESWKRAAEVTNQLKARIERMRAKTRGLTMDAEDSYRQN"
     gene            <124302..>124613
                     /locus_tag="AGOS_ACL131W"
                     /old_locus_tag="ACL131W"
                     /db_xref="GeneID:4619393"
     mRNA            <124302..>124613
                     /locus_tag="AGOS_ACL131W"
                     /old_locus_tag="ACL131W"
                     /product="ACL131Wp"
                     /transcript_id="NM_208626.1"
                     /db_xref="GeneID:4619393"
     CDS             124302..124613
                     /locus_tag="AGOS_ACL131W"
                     /old_locus_tag="ACL131W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR043C (TRX1) and YGR209C (TRX2)"
                     /codon_start=1
                     /product="ACL131Wp"
                     /protein_id="NP_983273.1"
                     /db_xref="GeneID:4619393"
                     /translation="MVSEIKSLSEFESAVGSDKLVVVDFYATWCGPCKMIAPMIEKFA
                     TQFQEASFYKVDVDAAAEVAHKYQITSMPTILFFKNGQAVDKVVGADVQSIRTKIAQH
                     L"
     gene            complement(<124646..>125596)
                     /locus_tag="AGOS_ACL130C"
                     /old_locus_tag="ACL130C"
                     /db_xref="GeneID:4619394"
     mRNA            complement(<124646..>125596)
                     /locus_tag="AGOS_ACL130C"
                     /old_locus_tag="ACL130C"
                     /product="ACL130Cp"
                     /transcript_id="NM_208627.1"
                     /db_xref="GeneID:4619394"
     CDS             complement(124646..125596)
                     /locus_tag="AGOS_ACL130C"
                     /old_locus_tag="ACL130C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR208W (SER2)"
                     /codon_start=1
                     /product="ACL130Cp"
                     /protein_id="NP_983274.1"
                     /db_xref="GeneID:4619394"
                     /translation="MSSAAAYVVTAIAHGAQFPEGYLASLHEHLGQVGVAVRGTEQLA
                     PRAQDLFVDVPTTLTLEQLRTHVAAQPAAGVDVAVQPTAHRRKGLVVFDMDSTLIQQE
                     VIDLIAGYAGVEDRVAAITERAMNNELDFTQSLRERVSLLRGIPVARLYEEIKAKLQL
                     TPGVAELTSTLHAAGCRTAVLSGGFAPFANHIRDTLQLDFAKANNLETTVDAAGAEIL
                     SGRTLGDVVDGACKARTLRELAAGAGLPVAATAMVGDGANDLPAMHAAGLGIAWHAKP
                     RVQQQAPCRLNSPSLRDALYILGFSDREIAALHARVDPRS"
     gene            <125915..>126691
                     /locus_tag="AGOS_ACL129W"
                     /old_locus_tag="ACL129W"
                     /db_xref="GeneID:4619395"
     mRNA            <125915..>126691
                     /locus_tag="AGOS_ACL129W"
                     /old_locus_tag="ACL129W"
                     /product="ACL129Wp"
                     /transcript_id="NM_208628.1"
                     /db_xref="GeneID:4619395"
     CDS             125915..126691
                     /locus_tag="AGOS_ACL129W"
                     /old_locus_tag="ACL129W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR207C (CIR1)"
                     /codon_start=1
                     /product="ACL129Wp"
                     /protein_id="NP_983275.1"
                     /db_xref="GeneID:4619395"
                     /translation="MSKPLRILVPIKRVIDPQLRPRINAAGTAVQKTGVQFSVNPFDD
                     IAVEEAVRIREAKKVPVESIHAVSIGPAKAQEALLTAMAKGADSSTLVDAQDSELEPL
                     AVAKILRELVVQQKIDLVIMGKQATDSDNNNTGQMLAGLLNWPQATNAARVELDATGT
                     RATVTREVEGGEEVVSAALPLVVTTDLRLNTPRYVTLPNKMKAKKKPMAKLNLAAFPG
                     VDSAARLNLLRFEEPPARAPGTVVASVDELLAKLREAKAV"
     gene            complement(<126714..>126995)
                     /locus_tag="AGOS_ACL128C"
                     /old_locus_tag="ACL128C"
                     /db_xref="GeneID:4619396"
     mRNA            complement(<126714..>126995)
                     /locus_tag="AGOS_ACL128C"
                     /old_locus_tag="ACL128C"
                     /product="ACL128Cp"
                     /transcript_id="NM_208629.1"
                     /db_xref="GeneID:4619396"
     CDS             complement(126714..126995)
                     /locus_tag="AGOS_ACL128C"
                     /old_locus_tag="ACL128C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR206W (MVB12)"
                     /codon_start=1
                     /product="ACL128Cp"
                     /protein_id="NP_983276.1"
                     /db_xref="GeneID:4619396"
                     /translation="MENKLRKIPLYNAFEGDMPRRRAKLQLAALQIAPAAATGEHLAA
                     WDEECRRVLESVQQARAQGGEWEAWYEQTYLRKQPPGLLESGTLRPRRK"
     gene            <127224..>127766
                     /locus_tag="AGOS_ACL127W"
                     /old_locus_tag="ACL127W"
                     /db_xref="GeneID:4619397"
     mRNA            <127224..>127766
                     /locus_tag="AGOS_ACL127W"
                     /old_locus_tag="ACL127W"
                     /product="ACL127Wp"
                     /transcript_id="NM_208630.1"
                     /db_xref="GeneID:4619397"
     CDS             127224..127766
                     /locus_tag="AGOS_ACL127W"
                     /old_locus_tag="ACL127W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR025C (BNA1)"
                     /codon_start=1
                     /product="ACL127Wp"
                     /protein_id="NP_983277.1"
                     /db_xref="GeneID:4619397"
                     /translation="MLNTTPINIDAWLAENSHLLQPPVNNFCLHRGGFTVMLVGGPNE
                     RTDYHVNPTPEWFYQKTGAMTLRIVDEQLSGAARFRDVTIREGDSFLLPANVPHNPVR
                     YADTVGIVVEQDRPAGHFDQLRWYCRGCRELVCKYEFYMSDLSSQVREGIERFAASAE
                     DRVCKHCGTLNYPTPQASAT"
     gene            <127878..>128606
                     /locus_tag="AGOS_ACL126W"
                     /old_locus_tag="ACL126W"
                     /db_xref="GeneID:4619398"
     mRNA            <127878..>128606
                     /locus_tag="AGOS_ACL126W"
                     /old_locus_tag="ACL126W"
                     /product="ACL126Wp"
                     /transcript_id="NM_208631.1"
                     /db_xref="GeneID:4619398"
     CDS             127878..128606
                     /locus_tag="AGOS_ACL126W"
                     /old_locus_tag="ACL126W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR024C (MDE1)"
                     /codon_start=1
                     /product="ACL126Wp"
                     /protein_id="NP_983278.1"
                     /db_xref="GeneID:4619398"
                     /translation="MDAAAQTSLVVSEDRRHPANVICALCRLFYANNWVTGTGGGISI
                     KHPATGHIYIAPSGVQKEQIEPEDLFVLDGVDGAYLRAPAGHRPSACTPLFLACYRAR
                     GAGAVIHTHSQHAVLCTLLFDDVFRIANIEQIKALPSGRRDAAGKPLSLSFFDTLEIP
                     IIDNTAHEEDLAPGLEAALARHPACTAVLVRRHGIYVWGPTADRAKVYNEAIDYLLEL
                     AVHMHRLGVPPDCPIGEEKRFLRR"
     gene            complement(<128645..>128965)
                     /locus_tag="AGOS_ACL125C"
                     /old_locus_tag="ACL125C"
                     /db_xref="GeneID:4619399"
     mRNA            complement(<128645..>128965)
                     /locus_tag="AGOS_ACL125C"
                     /old_locus_tag="ACL125C"
                     /product="ACL125Cp"
                     /transcript_id="NM_208632.1"
                     /db_xref="GeneID:4619399"
     CDS             complement(128645..128965)
                     /locus_tag="AGOS_ACL125C"
                     /old_locus_tag="ACL125C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR022W (LSM8)"
                     /codon_start=1
                     /product="ACL125Cp"
                     /protein_id="NP_983279.1"
                     /db_xref="GeneID:4619399"
                     /translation="MSPLLKEYLGRRVVVVTTDGGCLVATLEGFDKTANLLLSDVRQR
                     ATGEGLAAAFLLQGSQIVCCGPLEGGGPEQEPQAAALRDTRNVVAREHDIWARAWQAR
                     QARE"
     gene            <129089..>129866
                     /locus_tag="AGOS_ACL124W"
                     /old_locus_tag="ACL124W"
                     /db_xref="GeneID:4619400"
     mRNA            join(<129089..129344,129400..>129866)
                     /locus_tag="AGOS_ACL124W"
                     /old_locus_tag="ACL124W"
                     /product="ACL124Wp"
                     /transcript_id="NM_208633.2"
                     /db_xref="GeneID:4619400"
     CDS             join(129089..129344,129400..129866)
                     /locus_tag="AGOS_ACL124W"
                     /old_locus_tag="ACL124W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR021C (REC107); 1-intron"
                     /codon_start=1
                     /product="ACL124Wp"
                     /protein_id="NP_983280.2"
                     /db_xref="GeneID:4619400"
                     /translation="MEASENAGSCERPTSATEPGSSPGRQLDETDRQILEWAGKLELE
                     SVDLREKADALLGLLQQRCSEVAASQQGLETWKQTVGAELSAFKADVVQALEEQRKAV
                     AGEVRRAAGARRTPPPDMERFAGRIIKSFETRQQRWFKEFQATQDVLYNVTVQLDRAT
                     DVLGSVSRDLQALSARQAQTEAFLARHVHELGGSVLPSTPPPSMAPRQRASPPGPAAR
                     TRDKAHQTRYLIPWEDISDQEL"
     gene            complement(<129875..>130708)
                     /locus_tag="AGOS_ACL123C"
                     /old_locus_tag="ACL123C"
                     /db_xref="GeneID:4619401"
     mRNA            complement(<129875..>130708)
                     /locus_tag="AGOS_ACL123C"
                     /old_locus_tag="ACL123C"
                     /product="ACL123Cp"
                     /transcript_id="NM_208634.1"
                     /db_xref="GeneID:4619401"
     CDS             complement(129875..130708)
                     /locus_tag="AGOS_ACL123C"
                     /old_locus_tag="ACL123C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR205W (TDA10)"
                     /codon_start=1
                     /product="ACL123Cp"
                     /protein_id="NP_983281.1"
                     /db_xref="GeneID:4619401"
                     /translation="MSEAFHFLAEFIDSVLPDALARRQGREPAFVLISGPQGSGKTFN
                     AAQLLAHVAQQHRAVGLSIDDFYLPAGAQAAVAAGGNPLLAGRGLPGTHDVPLLRDTL
                     ARLRKGEGEVELPQYDKAAHGGRGDRCAARVRVQLPVDVVILEGWFLGFEPAAEAELA
                     RAAGTYGAAALREVNAALEDYSACLWRAAGVPSVGIVFDAQVRECVARWRIQQEHELR
                     ERCGAGMTDAQVHAFLERYLVCYDVYYARLVREGLGNLHRLTVGLDGDRKVTYVSQKN
                     M"
     gene            <131078..>132052
                     /locus_tag="AGOS_ACL122W"
                     /old_locus_tag="ACL122W"
                     /db_xref="GeneID:4619402"
     mRNA            <131078..>132052
                     /locus_tag="AGOS_ACL122W"
                     /old_locus_tag="ACL122W"
                     /product="ACL122Wp"
                     /transcript_id="NM_208635.1"
                     /db_xref="GeneID:4619402"
     CDS             131078..132052
                     /locus_tag="AGOS_ACL122W"
                     /old_locus_tag="ACL122W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR019C (TES1)"
                     /codon_start=1
                     /product="ACL122Wp"
                     /protein_id="NP_983282.1"
                     /db_xref="GeneID:4619402"
                     /translation="MADLGALIDLTRISETRYESTNHHRMIHGGKALYGGLLVAQAIL
                     ASFYFVPRDFIPLSVHCLFMVGGDNAIKTQYEVERLRKGSNFAHLLVRAYQKDKELFT
                     MQIIYRRDLGKQPDTLHRKDNLGPVDRSHLEDAGTLCRRDLLSNRENLQAVSAFFETD
                     KGLNNILEGFDNTSSEYRLPGDFFLREGLRDVLRYAVRCQEEVVTDPSLRFPEGGRMT
                     PQNDSRYNYVMFGFFSDAYLLATVPYFVGLPVFSCRLSVSLDHDIRFHGMPKMNEWLD
                     VVVRNISIVNHSESMTGDWYDSTSGEIVCSVSQQGLAIYPTPERLSKL"
     gene            complement(<132104..>134923)
                     /locus_tag="AGOS_ACL121C"
                     /old_locus_tag="ACL121C"
                     /db_xref="GeneID:4619403"
     mRNA            complement(<132104..>134923)
                     /locus_tag="AGOS_ACL121C"
                     /old_locus_tag="ACL121C"
                     /product="ACL121Cp"
                     /transcript_id="NM_208636.2"
                     /db_xref="GeneID:4619403"
     CDS             complement(132104..134923)
                     /locus_tag="AGOS_ACL121C"
                     /old_locus_tag="ACL121C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR204W (ADE3)"
                     /codon_start=1
                     /product="ACL121Cp"
                     /protein_id="NP_983283.2"
                     /db_xref="GeneID:4619403"
                     /translation="MTLIDGKAIAAEIRGEIAEEIARLCADGLFQAKLTIFQVGERHD
                     SSTYVRMKRRAAAEAGIEVEFVQLGADVDEEEVLAAIDARNADETVHGILVQLPLPPG
                     MDEDRVTSRVAPEKDVDGFGSYNIGELNKRHGRPHFHPCTPKGIIELLRRMDVQIAGA
                     NVVVLGRSDIVGAPVACLLRALDATVTVLHSRSRDIPGYVGRADIVVVAIGQPEFVKG
                     AWFTNPDAVVIDVGTNFVEDSTRKTGYRCVGDVEFGVASEKVRLITPVPGGVGPMTVA
                     MLMQNTLDAAKKCHSAPRKLSPLPLQLQKPVPSDYEISRSQVPKNIAVVAREAGLLPS
                     EVELYGSVKAKVKLDTLDRLAHRENGKYVLVTGITPTPLGEGKSTTTVGLVQALAAHL
                     DKVAFATVRQPSMGPTFGIKGGAAGGGYSQVIPMDEFNLHVTGDIHAISMANNLLAAA
                     IDTRMFHEATQKDAALYKRLVPEKNGTRKFTSTMLRRLQKLGIHKTDPNSLTESEIAR
                     FARLDIDADTITWRRVVDCNDRFLRGITVGEAPTERGYKRQTGFDISVASECMAILAL
                     ADSLHDLRERLGRIVVAASRNGEPITCEDIGCAGAMAALLKDAIKPNIMQTLEGTPVF
                     VHAGPFANISIGANSVLADKIALKLAGVDPNWSEAEKKKRQGYVVTEAGFDFTMGGER
                     FLNIKCRASGISPDVVVIVATVRALKVHGGGPEVKAGAPLPSAYLNEDVDLLRKGCAN
                     LAKHIANARTYNLPVVVGINRMSSDTEREHEVIREEAIKAGAFDAIVSNHWEEGGQGA
                     VKLAEGVIRATEECRPEFHYLYDTEGPSIEDKISTIAKTMYGAAEVEFLPEARKKIEL
                     YTKQGFNHLPICIAKTQYSLSHDANLKGVPTGFKFPVRDIRASIGAGYLYALAAEIQT
                     IPGLPTHCGFMNIEINDKGEIDGMF"
     gene            <135415..>135906
                     /locus_tag="AGOS_ACL120W"
                     /old_locus_tag="ACL120W"
                     /db_xref="GeneID:4619404"
     mRNA            <135415..>135906
                     /locus_tag="AGOS_ACL120W"
                     /old_locus_tag="ACL120W"
                     /product="ACL120Wp"
                     /transcript_id="NM_208637.1"
                     /db_xref="GeneID:4619404"
     CDS             135415..135906
                     /locus_tag="AGOS_ACL120W"
                     /old_locus_tag="ACL120W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR017C (ESS1)"
                     /codon_start=1
                     /product="ACL120Wp"
                     /protein_id="NP_983284.1"
                     /db_xref="GeneID:4619404"
                     /translation="MTAENGLPGPWAVKFSKSRKREYYYNPETKESQWEVPADTDSEQ
                     LARHLAEHPVQVRCLHLLIKHAGSRRPASHRNEHITLDKAAAVAELEQYAERYRQGER
                     FEELARERSDCSSYKRGGDLGTFGRGEMQPSFEKVAFALPVGGVSDVVESDSGVHLIK
                     RVA"
     gene            complement(<135913..>136368)
                     /locus_tag="AGOS_ACL119C"
                     /old_locus_tag="ACL119C"
                     /db_xref="GeneID:4619405"
     mRNA            complement(<135913..>136368)
                     /locus_tag="AGOS_ACL119C"
                     /old_locus_tag="ACL119C"
                     /product="ACL119Cp"
                     /transcript_id="NM_208638.1"
                     /db_xref="GeneID:4619405"
     CDS             complement(135913..136368)
                     /locus_tag="AGOS_ACL119C"
                     /old_locus_tag="ACL119C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR203W (YCH1)"
                     /codon_start=1
                     /product="ACL119Cp"
                     /protein_id="NP_983285.1"
                     /db_xref="GeneID:4619405"
                     /translation="MHSRNISQIRYLEPAELFRWIKQACGADSQPFQVLDVRGSDYIG
                     GHIAGAWNYPYQRLKHESAALDELRAQLLETHAAAAGTGPIHCVFHCAQSQQRGPASA
                     MRFLRALSDGDLPQFEVWVLRGGFNLWQSMYGRDGSVTEDYVPDIWQWQ"
     gene            complement(<136528..>137733)
                     /locus_tag="AGOS_ACL118C"
                     /old_locus_tag="ACL118C"
                     /db_xref="GeneID:4619406"
     mRNA            complement(<136528..>137733)
                     /locus_tag="AGOS_ACL118C"
                     /old_locus_tag="ACL118C"
                     /product="ACL118Cp"
                     /transcript_id="NM_208639.1"
                     /db_xref="GeneID:4619406"
     CDS             complement(136528..137733)
                     /locus_tag="AGOS_ACL118C"
                     /old_locus_tag="ACL118C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR202C (PCT1)"
                     /codon_start=1
                     /product="ACL118Cp"
                     /protein_id="NP_983286.1"
                     /db_xref="GeneID:4619406"
                     /translation="MGPVTRQGSLKQRLANSSLTNLFNLNRKRRHGELEDGEDGVVGV
                     RRSRRASVRSCNGELAEGSESDEERRHSRKRRHTEREEQERRYDEAIPEEFRKFRPRG
                     FPFNLPPQDRAVRVYADGVFDLFHLGHMKQLEQCKKSFENVTLICGVPSDRITHKLKG
                     LTVLTDKQRCESLRHCRWVDEVVEDAPWCVTPEFLELHKIDYVAHDDIPYTSGDSDDI
                     YRPIKQMGKFLATQRTNGISTSDIITKIIRDYDKYLMRNFARGASRQELNVSWLKKNE
                     LEFKKHIQDFRSYFRKNQEKLNDASKDLYFEVREMLLKKTLGRNLYSKLVGPAGPPEK
                     RGKLQEASPATQFAHIYTGEAPAIAGQAMLPSSESDDENINRAGSVLSHLNRWLSQET
                     PHYTTEESE"
     gene            complement(137956..138028)
                     /locus_tag="AGOS_t0047"
                     /db_xref="GeneID:4619407"
     tRNA            complement(137956..138028)
                     /locus_tag="AGOS_t0047"
                     /product="tRNA-Val"
                     /codon_recognized="GUG"
                     /db_xref="GeneID:4619407"
     gene            <138626..>140371
                     /locus_tag="AGOS_ACL117W"
                     /old_locus_tag="ACL117W"
                     /db_xref="GeneID:4619314"
     mRNA            <138626..>140371
                     /locus_tag="AGOS_ACL117W"
                     /old_locus_tag="ACL117W"
                     /product="ACL117Wp"
                     /transcript_id="NM_208640.1"
                     /db_xref="GeneID:4619314"
     CDS             138626..140371
                     /locus_tag="AGOS_ACL117W"
                     /old_locus_tag="ACL117W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR016C (ILV3)"
                     /codon_start=1
                     /product="ACL117Wp"
                     /protein_id="NP_983287.1"
                     /db_xref="GeneID:4619314"
                     /translation="MMSHRRFSTAQRLREGLNRYSRVITEPRAQGASQAMLYATGFGD
                     GDFAKAQVGVGSCWWSGNPCNMHLMDLNNRVAASVDRAGLKAMQFNTIGVSDGISMGT
                     TGMRYSLQSREIIADSFETMMMGQHYDGNVAIPSCDKNMPGVIMAMARHNRPSIMVYG
                     GTIMAGSPCSGSTRLPKKIDVVSAFQAYGQYLSKQITEEESRDVVRHACPGPGSCGGM
                     YTANTMASAAEVLGLTLPNSSAFPAISEQKLAECDAVGDAMRKALELNIRPRDLLTRE
                     AFENAITYVIATGGSTNAVLHLVAIAHSAGVKLTPDDFQRISNKTPLLGDFKPSGKYV
                     MADLIEVGGTQAVIKFLYENGFMHGDALTVTGDTLKERAAKTAPLPEGQDIIRPVSQP
                     LNPRGHLQILYGSLAPGGAVGKITGKEGTFFQGRARVFDEENAFIRALEEGQIKKGEK
                     TVVVIRYEGPKGGPGMPEMLKPSSALMGYGLGNDVALLTDGRFSGGSHGFLIGHIVPE
                     AYEGGPIALVQDGDDIVIDAENNAINLLVPKEEIESRRARWTQPAPRYKRGTLATYSK
                     LVSNASKGCVLDSDD"
     gene            <140584..>142998
                     /locus_tag="AGOS_ACL116W"
                     /old_locus_tag="ACL116W"
                     /db_xref="GeneID:4619408"
     mRNA            <140584..>142998
                     /locus_tag="AGOS_ACL116W"
                     /old_locus_tag="ACL116W"
                     /product="ACL116Wp"
                     /transcript_id="NM_208641.1"
                     /db_xref="GeneID:4619408"
     CDS             140584..142998
                     /locus_tag="AGOS_ACL116W"
                     /old_locus_tag="ACL116W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR200C (ELP2)"
                     /codon_start=1
                     /product="ACL116Wp"
                     /protein_id="NP_983288.1"
                     /db_xref="GeneID:4619408"
                     /translation="MAVTTSTHLHRHYGYLKSLSIDNMATQEAVFIGANRQTKVADFY
                     LPTKTVAFGAGKCIALWNPLDEHNAGVYCTLKAHNAEVTSVKFIGAEKLLVSASADAT
                     INVWRGDERWELAQTLEGPKSSVTSLAVAAGLIVAGFADGTLSVWSEHDDAFVLSSQF
                     LIRKGFLPLALALQKLSDGCYMLAVSGTSTDLMVYSVCVAATVDVELSATVEGHEDWI
                     KDLAFRSNGPGDWMLASGAQDRYIRLWRIKANNNIEEEDPTKLKLLSNKIYKFQVTAD
                     LHLSINFEALIMGHDDWISSLQWHESKCQLLAATADTSVMLWEPDEISGIWVCASRLG
                     EFSSKGASTATGSAGGFWSCLWFATGDAEYILANGKTGSWRMWENRGDGGSWEQLPAI
                     TGPTRSVTDVAWSPSGSYLLASSLDQTTRLYTRWMYEGDGSRRKHTWHEFARPQIHGY
                     DMICLEPISDTQFISAGDEKVLRSFNEPRAIAKLLERLSGISADTSSTVADAAALPAL
                     GLSNKASVPEGNGGTVEDNDARETNETTNITAAMLSQLQTPPLEDHLQRHTLWPEIEK
                     LYGHGYEISCVDVSPDGKLLASACKSNNTSHAVVRIFSTHTWLQLPPCPEFHNLTITR
                     LRFSKDNRHLLSVSRDRMWAVWYRNDDDTFTLKYSDQKPHSRIIWDGDWLPASCGTAF
                     VTASRDKTVKIWRLDGQEGRFEVESNLKLKEAITAVAVTPRLIEGRLLLAFGLESGAV
                     HIYTYSERAFLQVLQLDSAIAPADRINRIRWNPAHHKENIMLSVASADSSVRIYSVKV
                     PAVLGN"
     gene            <143555..>144070
                     /locus_tag="AGOS_ACL115W"
                     /old_locus_tag="ACL115W"
                     /db_xref="GeneID:4619409"
     mRNA            <143555..>144070
                     /locus_tag="AGOS_ACL115W"
                     /old_locus_tag="ACL115W"
                     /product="ACL115Wp"
                     /transcript_id="NM_208642.1"
                     /db_xref="GeneID:4619409"
     CDS             143555..144070
                     /locus_tag="AGOS_ACL115W"
                     /old_locus_tag="ACL115W"
                     /note="NOHBY307; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACL115Wp"
                     /protein_id="NP_983289.1"
                     /db_xref="GeneID:4619409"
                     /translation="MAARGRPHGGTMTLPVDRAQKMKRSTANKLNFNVGKGLRAHPVT
                     WGRSHQCHVPARAAGVPEIWICVRNGPISRSTVRRPPQVGYYLTAARTHLPRTALNTQ
                     WLPPISPMHLKRLHYGTSLVLDHNCGCRSWKKVSHPYTTNPRAPVHLSRRPRRYAAAG
                     LAHRGPLYSRT"
     gene            <144795..>145754
                     /locus_tag="AGOS_ACL114W"
                     /old_locus_tag="ACL114W"
                     /db_xref="GeneID:4619410"
     mRNA            <144795..>145754
                     /locus_tag="AGOS_ACL114W"
                     /old_locus_tag="ACL114W"
                     /product="ACL114Wp"
                     /transcript_id="NM_208643.1"
                     /db_xref="GeneID:4619410"
     CDS             144795..145754
                     /locus_tag="AGOS_ACL114W"
                     /old_locus_tag="ACL114W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YJR107W"
                     /codon_start=1
                     /product="ACL114Wp"
                     /protein_id="NP_983290.1"
                     /db_xref="GeneID:4619410"
                     /translation="MKLSPFCLIFSLLASVNGYSVEVYNELKHYAYISNAAYCVSAPL
                     LPSMLQKGSVFMEKDGLRVLNVFQPKILDERVSCSGYIGLNDTAKKIVIAFRGSVTVP
                     DWLVDFSFLPTNYVPVKSDKRCEGTCLVHHGVYDQFKVAFPDIYAVFQKIAQQHPDYE
                     VTVTGHSLGGGYAYLMGLELQLLGHKPHVITYAGLRMGNADLNKWYDKVFDNVKKVED
                     LKNGGNPRNAYIRVVQSRDIVPMVPTGPIYTHAGILFTITDVDSEVPLQSGVRLDGCN
                     TKLKELVGDILFSGKLLSLVRLLDHNKFFRRMALPCTDNSLKL"
     gene            complement(<146081..>148387)
                     /locus_tag="AGOS_ACL113C"
                     /old_locus_tag="ACL113C"
                     /db_xref="GeneID:4619411"
     mRNA            complement(<146081..>148387)
                     /locus_tag="AGOS_ACL113C"
                     /old_locus_tag="ACL113C"
                     /product="ACL113Cp"
                     /transcript_id="NM_208644.1"
                     /db_xref="GeneID:4619411"
     CDS             complement(146081..148387)
                     /locus_tag="AGOS_ACL113C"
                     /old_locus_tag="ACL113C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR198W (YPP1)"
                     /codon_start=1
                     /product="ACL113Cp"
                     /protein_id="NP_983291.1"
                     /db_xref="GeneID:4619411"
                     /translation="MIAAISSVLPVQEDRCLACLHIAGVCVGTMSLEMDLIEWALNLR
                     AAGGGVFGSGSEELDRVLKLHYRVTYHAFDRGTKRSVWEVLLAEAEKIDSSKGMELEQ
                     AVMGNVFGILYRQLGDETECARWLAKLGALRALRGEYPEFWALLLLENVCYREAIGVE
                     DQQQVFRDVARLPKETHTLTWFYLERFLARVQCERWQAVKEFGGVPLAYLLEAVREEE
                     GVDQWLLEQGRAILSRTRFPAASEKNSTMLEEFHAVLNYYLRKNNKPRSTEWEGFITD
                     SLGVTFQSVNVSKAALTYYRRFGDTKLALLNLLNFFNYSERFRRMNNGFYDDIVSLLD
                     AYTFVLQLTSLPEAIGDIFNKAKAFEQLRNILQEFYRDYRLQQIPKEHSADWLSNSAK
                     VVVPPKLARLLSDSWFLLYRIERNSLKPTLDFSLTYYLANAMCINPLNIDVKFHYAYV
                     LASIRRIDMCIRFLKTNILNIKPADYRSWHLLALCESIQEDKDVSFKIVCSVLKAMAE
                     AHEESNLLKADKWQFIHIKLTQLVLVKEMFGVKDALEMLSEVYQLYASLFPASKVNKT
                     KDESRLGPAHNQTKEYLFQAIWFFSARLFLQDGDAQNAREAIDEAKRVTDTFTNLNVN
                     ITHGYLKLHCDPKGAMSEFQNALSFDPTNVDAVVGLAKLLYPEDQGSLERIARHRPII
                     GTATPKPESDPFANSKDRSAAVAQLKMLLENCIEKSIDGYHTPEVWWYLSRIYDEFHD
                     NERLESALWQCIKFHELEPIRDFKYCMF"
     gene            complement(<148432..>149031)
                     /locus_tag="AGOS_ACL112C"
                     /old_locus_tag="ACL112C"
                     /db_xref="GeneID:4619412"
     mRNA            complement(<148432..>149031)
                     /locus_tag="AGOS_ACL112C"
                     /old_locus_tag="ACL112C"
                     /product="ACL112Cp"
                     /transcript_id="NM_208645.1"
                     /db_xref="GeneID:4619412"
     CDS             complement(148432..149031)
                     /locus_tag="AGOS_ACL112C"
                     /old_locus_tag="ACL112C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR014W (TMA22)"
                     /codon_start=1
                     /product="ACL112Cp"
                     /protein_id="NP_983292.1"
                     /db_xref="GeneID:4619412"
                     /translation="MLKKVVYCGVCSLPPEYCEFTGKIRRCKVWLHEHDQELFAQLYG
                     DDKEDVDGVAARLGQSSIGEEREEQLEKKLQKLQAREESKEQRELARKLSSRVVIRRE
                     ARTKRKCMVVVAGLEVFEIDMKKLAKTFASKFATGCSVSKNVEKKEEVVVQGDIADEV
                     EAYIHALLEEKGMKGVKVEQIDAAKKKKKTPTTTTPPPS"
     gene            <149112..>149678
                     /locus_tag="AGOS_ACL111W"
                     /old_locus_tag="ACL111W"
                     /db_xref="GeneID:4619413"
     mRNA            <149112..>149678
                     /locus_tag="AGOS_ACL111W"
                     /old_locus_tag="ACL111W"
                     /product="ACL111Wp"
                     /transcript_id="NM_208646.2"
                     /db_xref="GeneID:4619413"
     CDS             149112..149678
                     /locus_tag="AGOS_ACL111W"
                     /old_locus_tag="ACL111W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL159C (RCN1)"
                     /codon_start=1
                     /product="ACL111Wp"
                     /protein_id="NP_983293.1"
                     /db_xref="GeneID:4619413"
                     /translation="METNTVIIASRAADVTADAFVESFEALLQEHVLRRAHVTAEEPL
                     QLCVLPNMRRLVVVAPTAAVARLVVDAFAAHGPPDREHMCAVGFSLLDTPRESAHLAV
                     PAARRLLLVSPPQSPPPEFDFSRLEDGPHRPAQVPGQDLPPGQPVTVLAPPTGAKIVL
                     HPCESLAGAASVEHVHTTLPPRSVFDDE"
     gene            <150096..>150545
                     /locus_tag="AGOS_ACL110W"
                     /old_locus_tag="ACL110W"
                     /db_xref="GeneID:4619414"
     mRNA            <150096..>150545
                     /locus_tag="AGOS_ACL110W"
                     /old_locus_tag="ACL110W"
                     /product="ACL110Wp"
                     /transcript_id="NM_208647.1"
                     /db_xref="GeneID:4619414"
     CDS             150096..150545
                     /locus_tag="AGOS_ACL110W"
                     /old_locus_tag="ACL110W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR051W (COX6)"
                     /codon_start=1
                     /product="ACL110Wp"
                     /protein_id="NP_983294.1"
                     /db_xref="GeneID:4619414"
                     /translation="MLSRTVFRSAVLNRALLLRSAGAAPVAGLRMCQPLVSLRKYSSH
                     HDEETFEEFTARYEKEFEEAYDLFEVQRVLNNCFSYDLVPAPVIIEKALRAARRVNDL
                     PTAIRVFEALKYKVENEEQYQAYLEELSEVRKELGVPLKEELFPESS"
     gene            complement(<150609..>151619)
                     /locus_tag="AGOS_ACL109C"
                     /old_locus_tag="ACL109C"
                     /db_xref="GeneID:4619415"
     mRNA            complement(<150609..>151619)
                     /locus_tag="AGOS_ACL109C"
                     /old_locus_tag="ACL109C"
                     /product="ACL109Cp"
                     /transcript_id="NM_208648.1"
                     /db_xref="GeneID:4619415"
     CDS             complement(150609..151619)
                     /locus_tag="AGOS_ACL109C"
                     /old_locus_tag="ACL109C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR353W (TRR1) and YHR106W (TRR2)"
                     /codon_start=1
                     /product="ACL109Cp"
                     /protein_id="NP_983295.1"
                     /db_xref="GeneID:4619415"
                     /translation="MLAAATRYRLGQALQTRMVHHKVTIIGSGPAAHTAAIYLARAEI
                     KPTLYEGMFANGVAAGGQLTTTTEIENFPGFPDGLTGSDLMERMKAQSVKFGTEVVTE
                     TVAKVDLSARPFKLWTEFNEDEEPTTTDAIILATGASAKRLGLPGEETYWQRGISACA
                     VCDGAVPIFRNKPLAVVGGGDSACEEASFLTKYGSKVFMLVRKDHMRASTIMQRRVER
                     NEKIEVLYNTAPVEAKGDGSLLDALRVRDTRTGEESDLPVNGLFYAIGHTPATQLVAG
                     QVDLDESGYVKTVPGSTLTNVPGLFAAGDVQDSRYRQAVTSAGSGCMAALDAEKFLSE
                     LE"
     gene            complement(<151945..>152460)
                     /locus_tag="AGOS_ACL108C"
                     /old_locus_tag="ACL108C"
                     /db_xref="GeneID:4619416"
     mRNA            complement(<151945..>152460)
                     /locus_tag="AGOS_ACL108C"
                     /old_locus_tag="ACL108C"
                     /product="ACL108Cp"
                     /transcript_id="NM_208649.2"
                     /db_xref="GeneID:4619416"
     CDS             complement(151945..152460)
                     /locus_tag="AGOS_ACL108C"
                     /old_locus_tag="ACL108C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR105W (YPT35)"
                     /codon_start=1
                     /product="ACL108Cp"
                     /protein_id="NP_983296.2"
                     /db_xref="GeneID:4619416"
                     /translation="MPHIQFLPPEPVVLVSRVADDPDPAGPGLHVAKVAVGDCTIVDA
                     RTPCAPLQGRFAVWTVALQLHSPDTPRSLTLRKRYSDFVRFRERLLLCLPPPLRRAVP
                     PLPPPVPWYDAWRYSDVNLDRAWLAARRAGLERFLQQVLLNRALVAAAPVVVRGFLEP
                     PAAHRWVPVRA"
     gene            complement(<152559..>153623)
                     /locus_tag="AGOS_ACL107C"
                     /old_locus_tag="ACL107C"
                     /db_xref="GeneID:4619417"
     mRNA            complement(<152559..>153623)
                     /locus_tag="AGOS_ACL107C"
                     /old_locus_tag="ACL107C"
                     /product="ACL107Cp"
                     /transcript_id="NM_208650.1"
                     /db_xref="GeneID:4619417"
     CDS             complement(152559..153623)
                     /locus_tag="AGOS_ACL107C"
                     /old_locus_tag="ACL107C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR104W (GRE3)"
                     /codon_start=1
                     /product="ACL107Cp"
                     /protein_id="NP_983297.1"
                     /db_xref="GeneID:4619417"
                     /translation="MVYKQLYMRGTPPDLSRCITGQDIAMVMNVRTIKLNNGADMPLV
                     GLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIRRAIDEGLVRREELF
                     VVSKLWNNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFVPLEERYPAGLYTG
                     AADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQDLLRGCRIRPAA
                     LQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNAAPLLQHEVVCR
                     IAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTLADDELRELSSLN
                     CGLRFNDPWDWSAQPLPTFI"
     gene            complement(<153770..>154591)
                     /locus_tag="AGOS_ACL106C"
                     /old_locus_tag="ACL106C"
                     /db_xref="GeneID:4619418"
     mRNA            complement(<153770..>154591)
                     /locus_tag="AGOS_ACL106C"
                     /old_locus_tag="ACL106C"
                     /product="ACL106Cp"
                     /transcript_id="NM_208651.1"
                     /db_xref="GeneID:4619418"
     CDS             complement(153770..154591)
                     /locus_tag="AGOS_ACL106C"
                     /old_locus_tag="ACL106C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR352W"
                     /codon_start=1
                     /product="ACL106Cp"
                     /protein_id="NP_983298.1"
                     /db_xref="GeneID:4619418"
                     /translation="MSRMTDCAATIWPVISIASGVVSFTTSLVASIPQVVETYKEKSV
                     DGLSPLCLLCWISGDITTLVGAILTHQLPFQIIQAFYYFSTDLILCYQYYYYGVRWRN
                     RLAAPGARHLAAPSPAKGLLASFLVVGRAAAAPLLRRDSVAAPPLPLPSSDPFGIVSS
                     WVGASFYFFSRIPQLIKNYRRKSTDGLSPLLFLAALTANLTYCVSVFTSCEFLASPDK
                     PAYVWNALPFIMGSGGTVVFDLIYVYQHYFLYRQKGQHKQLEYSPETEGSPLVSH"
     gene            complement(<154783..>157227)
                     /locus_tag="AGOS_ACL105C"
                     /old_locus_tag="ACL105C"
                     /db_xref="GeneID:4619419"
     mRNA            complement(<154783..>157227)
                     /locus_tag="AGOS_ACL105C"
                     /old_locus_tag="ACL105C"
                     /product="ACL105Cp"
                     /transcript_id="NM_208652.2"
                     /db_xref="GeneID:4619419"
     CDS             complement(154783..157227)
                     /locus_tag="AGOS_ACL105C"
                     /old_locus_tag="ACL105C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR103W (SBE22) and YDR351W (SBE2)"
                     /codon_start=1
                     /product="ACL105Cp"
                     /protein_id="NP_983299.2"
                     /db_xref="GeneID:4619419"
                     /translation="MEVPADSSSCLQVKRVHSLSVLKNKVSCFFLTIYWANALSRDSA
                     RVAGLDSEVRVRRDCELREGGMPSVLGTLDESMAEDAFGLGVDGYSEGASMFTADVTR
                     LGRPLRRRAAGGDAGRAGEGAGAAGGLGRGGEARGGAAEAAETAEALDFQPPPSKLFA
                     GRVERPISNDSIVTEAAETLSTHFDMSASTSSSSRGSSVVIEKSQAHEAAEESATGAP
                     CKKYLFASSRDRLQLSLGGMEASLSSLHIPAAGADAGGAVHSVASFSRTAPALVTTSK
                     ALTPSQRYRLRREQNKVALQNSIKQREVFYEEQERGSRGRSASLKGVLGLPHAVDELS
                     EDISDYLGWDVPVVSPTTGPFLAAAERSEKHTDRRPGVARSRSSTYVDHTMPPSPIPG
                     IQKTSDLEFFTETSKKLSCVYLDTSKETSKSKLYERSQSAELLPIEFKAASDEGMEDL
                     KLVSSGKMAVCSNSRPSWLPPKDTEERARHERQIRQTIDIASLSQIDRTKERAERDTR
                     DEKNRKRLAQLVERGLVRKSTLTELKKICWETSLPPDSRFQIYTTLLQSDTAKLIEEQ
                     YIDNFDQVDALFRSMQFPNAKLAEIQAMLACTPCTANVAPADDLIYLLQLKAISRQGL
                     LLGDPLLVHHLLQVGCYSTREIWVLVNILQLTCFNETTKDKYDRRIISSRGTVSTALS
                     ADKTFAQEFNSKCLNFTTWWHLMARLDHAVFMWCLDIIVAENSQPFKSNPIIRDKLNG
                     KDWDYYRDLHVVVNYRIICALTLTVLLSYHFGFNNLYDLSFVDPAFQIIGPEQGDLGD
                     VHATFIKKWHHNYKKF"
     gene            complement(<157350..>160193)
                     /locus_tag="AGOS_ACL104C"
                     /old_locus_tag="ACL104C"
                     /db_xref="GeneID:4619420"
     mRNA            complement(<157350..>160193)
                     /locus_tag="AGOS_ACL104C"
                     /old_locus_tag="ACL104C"
                     /product="ACL104Cp"
                     /transcript_id="NM_208653.1"
                     /db_xref="GeneID:4619420"
     CDS             complement(157350..160193)
                     /locus_tag="AGOS_ACL104C"
                     /old_locus_tag="ACL104C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR102W (KIC1)"
                     /codon_start=1
                     /product="ACL104Cp"
                     /protein_id="NP_983300.1"
                     /db_xref="GeneID:4619420"
                     /translation="MPNDSNGSKEQGVGQGSNSLTPQLFKRTEVIGRGKFGVVYKAYH
                     AKTKQVYAVKVLNLDCPEDEVEDVQKEIQFLASLKQVPNITRYYGSYLYDTKLWVIME
                     YCAGGSLRTLLRPGKIDEKYLGVIVRKLLIALVYIHKDNVIHRDIKAANVLITNEGHV
                     KLCDFGVAAQLTAANHKRQTMAGTPYWMAPEVIMEGVYYNTKADIWSLGITAYEIATG
                     NPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEERPTAEDLLSSK
                     FVKAHKGSSATILKELISRYLLFSEKHNRESVLIPLDEDDPHKSANNTTNGGDNQVEM
                     KWDFDSLNSNEYIMQNEISIDAIPQESDWGRTQHEVNYAYPYEDTYFHSNVRHYFQGT
                     TVSKSFADPAGNSSTIQAMNQLATGTPTTSNCQNKSTFTISQSMKTESKASKQLLQLF
                     EDSEMINEEKESGLPHLASSLSSMHLSESDTAASTPLGAPPMGAAIPRHDILANGPGY
                     HSQSTPILPMLQTNFKALSIPKSSTALHTPVEIEIPEELPLSTTTATAAPIGATAGVD
                     PMTLKNKPRSATVSSSASSGLQRRPTLGGNPAVAARSEASGLNKSLGAELTRTVTLNA
                     HIPPNGPSQGTAGAGLSSSRSNDRSPSPSRSGVASNLTPDRSTSSTASSEPPGAAAQG
                     MLPLSSAKTVHSAHSSAEGMLQQSLASTSLVPPMAPGAAGPLGTAAPGDKDVHLSDRV
                     SREFKRNHPNLKLQMPSPTTLIPNKLLNAGAADEHADSNSGGSASSANINQFGINTSS
                     TGLPVAMTPLNEKSSADFGAKLKRSTSTSSRAPPPQPADPSASLGAAAPAQPAQPAVA
                     PAPPPAAASNTIIVTVQAPLYMDLPPRMLPMDMFVDVDDLDDAHLVDKKPLVLRELDA
                     LLKMFEDGLPVIENALKAVLPTHIPNANDDEQR"
     gene            <160591..>162684
                     /locus_tag="AGOS_ACL103W"
                     /old_locus_tag="ACL103W"
                     /db_xref="GeneID:4619421"
     mRNA            <160591..>162684
                     /locus_tag="AGOS_ACL103W"
                     /old_locus_tag="ACL103W"
                     /product="ACL103Wp"
                     /transcript_id="NM_208654.1"
                     /db_xref="GeneID:4619421"
     CDS             160591..162684
                     /locus_tag="AGOS_ACL103W"
                     /old_locus_tag="ACL103W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR350C (ATP22)"
                     /codon_start=1
                     /product="ACL103Wp"
                     /protein_id="NP_983301.1"
                     /db_xref="GeneID:4619421"
                     /translation="MRRAGFQASSLLGRICSSGLNCKKLTVAFSSNEHMAMSSWAGDL
                     GRRIGTQLYRRENVAELRRLQAELQQQWTAAGDGRARAELEACARDEEERAFFRLLMP
                     ASGPEVTQRLEEAVKEVLGGRSSRAEKRERLYCAIALVARENAGRGIEVPEAAHRWFA
                     ADLGRNEYFGHMQFLIEHGVQLNAPAAFQLVRTMLRSGSELEVQLVSFKLFLYDTESR
                     RVFEEKFDRVYDFMRMHYVITQMVVRRDFRFMRDYLEVLARRLEQHELCDARMSAAVQ
                     RDHIARYTELLMLYARKSGDEKMLAELFASLVDSLPRGMGGATLRQPLHEVMTYLISE
                     NQPQQVLKLVAGMRKAEPNRRPGKSSVPGTLALVVSALRQFNNPNLVVSFIVQAYRKT
                     QTRVLLGQLGLWSLAFYGRAVALSPEAAKSPQELAQISPVDLPKELILKSVPDSCIMC
                     ELYQAILSEKRSQVPAEEYREILIQLFALYQDFMGKLVHKYDYYHLYDTSVLRLLLYK
                     IKNEVGDGELAFKLLMDFYGQPKMRPKCTAEGNPFGVVLYQNNAITQTQLNQALALMG
                     GLRIPMDFKTTSSMVLWYASAGDIDLAHTWYTKLVRGRFQMKNRRVLKLALAHGWTIP
                     AYADQQLVSELSRADNSSDGPEHTQEAVETAVLESEEASACTSIIIEKADELLHKIQQ
                     TRPLDPPSDTRSAAP"
     gene            <162886..>163956
                     /locus_tag="AGOS_ACL102W"
                     /old_locus_tag="ACL102W"
                     /db_xref="GeneID:4619422"
     mRNA            <162886..>163956
                     /locus_tag="AGOS_ACL102W"
                     /old_locus_tag="ACL102W"
                     /product="ACL102Wp"
                     /transcript_id="NM_208655.2"
                     /db_xref="GeneID:4619422"
     CDS             162886..163956
                     /locus_tag="AGOS_ACL102W"
                     /old_locus_tag="ACL102W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR026C (YVH1)"
                     /codon_start=1
                     /product="ACL102Wp"
                     /protein_id="NP_983302.2"
                     /db_xref="GeneID:4619422"
                     /translation="MVEEVPDVTRILGGIYVGSVKPIVNHTPLKGMFNITHILSVLKF
                     TVIPEYLVRKGYTLKNIAIDDDESTDILQYINESNRFIDQCLFPHEEEYDPRKVDFRK
                     KKQHGSVYIHCQAGVSRSVSFTIAYLMYRYGLDLKSALHAVKRRRPEAQPNDGFMEQL
                     RIFEEMGGQYVDTALPRYRHWVLQASLQADPTGSGILAREETYRGDGEEDLQSLSTED
                     RHKLTMLRCKKCRQRLALSTAFIQHEPPSAESSEGHFIRRAAGSRRIIDIQQSQDQCS
                     HFFVEPLNWMKAELQGKQELEGKFSCPNCTQKVGGYNWKGSRCSCGKWMIPAIHLQAA
                     KVDQVDAARLALPNLVNFETKQ"
     gene            complement(<163977..>164765)
                     /locus_tag="AGOS_ACL101C"
                     /old_locus_tag="ACL101C"
                     /db_xref="GeneID:4619423"
     mRNA            complement(<163977..>164765)
                     /locus_tag="AGOS_ACL101C"
                     /old_locus_tag="ACL101C"
                     /product="ACL101Cp"
                     /transcript_id="NM_208656.2"
                     /db_xref="GeneID:4619423"
     CDS             complement(163977..164765)
                     /locus_tag="AGOS_ACL101C"
                     /old_locus_tag="ACL101C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR025W (MND2)"
                     /codon_start=1
                     /product="ACL101Cp"
                     /protein_id="NP_983303.2"
                     /db_xref="GeneID:4619423"
                     /translation="MAIEALGIYLGCASEERERSVAELPVLGDLEQQAPAERGWEERR
                     GGRAGVAKLKRRRHAPLSAYSTYSQRPLSTSARFSEFDLEELIAQRTLAYIRTLGHGS
                     IRPIGIGKTVRELEREKQGRQENQPAAAGPEDCQPRPVENRDELAGALEHMAFDLDRG
                     LQSEQEESYNYDDEFDRVEEEATVEPRPTERVPAGTRLYGDSQLPEAAYLAAYAHELE
                     PPEAAELTSLSVPGSAGLGGPVQGSRVSSLNAGRAEGARERYLE"
     gene            complement(<164882..>165259)
                     /locus_tag="AGOS_ACL100C"
                     /old_locus_tag="ACL100C"
                     /db_xref="GeneID:4619424"
     mRNA            complement(join(<164882..165202,165251..>165259))
                     /locus_tag="AGOS_ACL100C"
                     /old_locus_tag="ACL100C"
                     /product="ACL100Cp"
                     /transcript_id="NM_208657.2"
                     /db_xref="GeneID:4619424"
     CDS             complement(join(164882..165202,165251..165259))
                     /locus_tag="AGOS_ACL100C"
                     /old_locus_tag="ACL100C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL018C-A; 1-intron"
                     /codon_start=1
                     /product="ACL100Cp"
                     /protein_id="NP_983304.2"
                     /db_xref="GeneID:4619424"
                     /translation="MPSLKQMVHFSADLALVAMVLAGLRRSTGYVLAYEASDLRNYIR
                     RYLGWGEYLFDQLAALAARSAYFRRETALDGFLGGAFRRLEEVAGAEGEGRAHERAAA
                     PRPAHLD"
     gene            <165399..>166382
                     /locus_tag="AGOS_ACL099W"
                     /old_locus_tag="ACL099W"
                     /db_xref="GeneID:4619425"
     mRNA            <165399..>166382
                     /locus_tag="AGOS_ACL099W"
                     /old_locus_tag="ACL099W"
                     /product="ACL099Wp"
                     /transcript_id="NM_208658.2"
                     /db_xref="GeneID:4619425"
     CDS             165399..166382
                     /locus_tag="AGOS_ACL099W"
                     /old_locus_tag="ACL099W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL018W (SWD2)"
                     /codon_start=1
                     /product="ACL099Wp"
                     /protein_id="NP_983305.2"
                     /db_xref="GeneID:4619425"
                     /translation="MSIGINKDTLAGFRAVKSFKVAQKEQGPITSLSFDDHGQYLLSA
                     TACDNMHLYDAAGCRFLNTVASKKYGCHAAKFTHAQSECVYSSTMISFDIRHLNLETN
                     QYLRYFQGHEALVSDLAMSPLDDTFLSASYDESVRLWDLRTSKAQAIVPSVVPNSVAY
                     DPSGLVFALGNPESQEIGLYNVRQLKAGPFMVVKVDPRFSQWTKMEFSNDGRYLLLAS
                     SAGRQLILDAFDGAQLFELTGTKPFPLREFMDAGSACFTPDGRYTLGTDYDGRIAFWN
                     HSESVSQRTLKPQGFVAAAPGTCPRTIAFNPKYSMFVTADESVEFYVYDEH"
     gene            complement(<166415..>168388)
                     /locus_tag="AGOS_ACL098C"
                     /old_locus_tag="ACL098C"
                     /db_xref="GeneID:4619426"
     mRNA            complement(<166415..>168388)
                     /locus_tag="AGOS_ACL098C"
                     /old_locus_tag="ACL098C"
                     /product="ACL098Cp"
                     /transcript_id="NM_208659.2"
                     /db_xref="GeneID:4619426"
     CDS             complement(166415..168388)
                     /locus_tag="AGOS_ACL098C"
                     /old_locus_tag="ACL098C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL017C (HCS1)"
                     /codon_start=1
                     /product="ACL098Cp"
                     /protein_id="NP_983306.2"
                     /db_xref="GeneID:4619426"
                     /translation="MSVELAEKLLACVAHEQQQDVEVTARQLRELPLAQLVAAGLAVS
                     RLQLENVRTGYGGKVYAELGPARGLADELVLGSTGVGDIVRVFAPKSRDEALEGVVFR
                     CSAQQVVVALDEGGEAAALQLQSASSVVMVKTVNTVTYKRMESTLRKLAEHGDEISNP
                     IAQYLLCQRPFHAQPPEQGVEFHNPDLNASQRDAVAFALRNEISIIHGPPGTGKTHTL
                     VELIRQLYDRGHRVLVCGPSNIAVDTVLERLSRPIPGAELLRVGHPARLLPGNLAHSL
                     DILAKEGDGGSIVRDIGREINQRIADVRKIKSSRDRKKAWQEVRDLRKELKQRERNVV
                     SELILAARVVVCTLHGSSAYSLCHMYDKCARLFDTVIIDEVSQSLEPQCWIPLISHYQ
                     SNISKLVIAGDNKQLPPTVKTEDDAHVRQVLSTTIFDKLERHYGDQFKKLLDVQYRMN
                     ERIMAFASESLYAGKLKAWQGVASQTLADLPGVDESDDTSAPLVWYDTQGDDFPEAEE
                     AAGGPALMASKFNENEAYLVLHHISQLRACNVPQEAIGVISPYNAQVALLKKIIHGQH
                     PLVEISSVDGFQGREKECIVLSLVRSNDSFDVGFLRDERRLNVAMTRARRQLCVIGNM
                     ETLERSQSQFLRSWVRWSEEHSEIRYPDLSEIL"
     gene            complement(<168541..>169065)
                     /locus_tag="AGOS_ACL097C"
                     /old_locus_tag="ACL097C"
                     /db_xref="GeneID:4619427"
     mRNA            complement(<168541..>169065)
                     /locus_tag="AGOS_ACL097C"
                     /old_locus_tag="ACL097C"
                     /product="ACL097Cp"
                     /transcript_id="NM_208660.1"
                     /db_xref="GeneID:4619427"
     CDS             complement(168541..169065)
                     /locus_tag="AGOS_ACL097C"
                     /old_locus_tag="ACL097C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL016C (ATP7)"
                     /codon_start=1
                     /product="ACL097Cp"
                     /protein_id="NP_983307.1"
                     /db_xref="GeneID:4619427"
                     /translation="MSLARSAANKLDWAKVIASLKLTGKTAAQLTQFKKRNDEARRRL
                     FELESQPAEVDFAHYRAVLKNTAVVDQIEASCRAYRPVTVDVSKQISSLEAFEAQAVR
                     DAQETEAVVGRELKALKETLANIEAARPFDELTVDELAAARPEIDTKVAEMVKRGKWE
                     VPGYKEKFGDLTVM"
     gene            <169501..>172005
                     /locus_tag="AGOS_ACL096W"
                     /old_locus_tag="ACL096W"
                     /db_xref="GeneID:4619428"
     mRNA            <169501..>172005
                     /locus_tag="AGOS_ACL096W"
                     /old_locus_tag="ACL096W"
                     /product="ACL096Wp"
                     /transcript_id="NM_208661.2"
                     /db_xref="GeneID:4619428"
     CDS             169501..172005
                     /locus_tag="AGOS_ACL096W"
                     /old_locus_tag="ACL096W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL015W (PUT3)"
                     /codon_start=1
                     /product="ACL096Wp"
                     /protein_id="NP_983308.2"
                     /db_xref="GeneID:4619428"
                     /translation="MAADGQTGPMESYQAVVQSGEVQELEYGQAAGYPEVMEVCGTLA
                     GREERNKRPAKRAPLACLRCRRRHVRCPGGTPCAKCAVANIACEYLEPSKKLIVSMKY
                     LQRLQEDLARARKENAALNAALREERGEVEMQARTLAAEAEEGIQFHRNTVDEEDEVV
                     PDFAERRGRLVESRKGQRYFVGSSSMTLFGMEVQSLVPEALQRDRGELESPILGAARL
                     AAPSAVDQQAERVTLVHQDDNSTYKLVLNGSYGGTEELELHLRLPPFAYAMLLVDTFV
                     TYNDGCFYFFNEGIVKHSLRRSYAGHVAYQDYTLQAMWLCKVFLIFAIGEMYLGTANC
                     DLNEHPSSRRRSTLPGSGFFAHAAQLFSILFSSEGIENATAEGGIEIMLLYAFYLQVA
                     DRTVPSYFYFGEALRACLILGWHVDAQRDVLTRFELEHHRRLWWTVYMFERMLSSKAG
                     LPLSLSDNTIATELPDDFDMSNPPPGCEHYIFAEAEYITHCVRITQVNAQILIKLYQK
                     QPDSNILPIIKDIVMQLLEWRANMSAFLQVDFTQKELKISRLCTNMFTEYFQGLNLAI
                     RPLLFHFVSKQLASFQETNTYINLSKYSKTISSLLNCSLQASINSIRSLWVLMGENMV
                     ALFGYMDREYLFTSACTLIFFNAAFGIHEQTYHHLDHALRIFTKMRDLGNHPAGLRMA
                     QLLRLMIDLDFHDVMKDLIAKHSDSSRCASSSFDQPQAEIDTLMQPRPQSPTASTTSS
                     SALSTDSVAPDMTELSKHETLTIEKNVSRLDLQTLDMHEDLQELLDNLDEVGKSDDQL
                     WKEVTDQAMWLGSSMDPTSALGNEADFYRSNSTQFK"
     gene            complement(<172123..>177228)
                     /locus_tag="AGOS_ACL095C"
                     /old_locus_tag="ACL095C"
                     /db_xref="GeneID:4619429"
     mRNA            complement(<172123..>177228)
                     /locus_tag="AGOS_ACL095C"
                     /old_locus_tag="ACL095C"
                     /product="ACL095Cp"
                     /transcript_id="NM_208662.1"
                     /db_xref="GeneID:4619429"
     CDS             complement(172123..177228)
                     /locus_tag="AGOS_ACL095C"
                     /old_locus_tag="ACL095C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL014C (URB1)"
                     /codon_start=1
                     /product="ACL095Cp"
                     /protein_id="NP_983309.1"
                     /db_xref="GeneID:4619429"
                     /translation="MSVSDAAPPREEKRHFAPKQSGNPNFDTGLLQQLQRILSSIDLI
                     NEGVANDYQPLLQFIQKGFLSQIVQGWSYFAQVNNQNMFGDCTVKLLKTVTVLASDVS
                     VQEQGSVLIRDLLSGHCKVLYRGLSCQRSTVTNPTLKLMRQMVVYNEGEHAELFLNYF
                     DLSVPCIQRILTPNKVEMKDLVAARKSAHTAMRANFIKFWVALIKHTPPLLRVDLLTD
                     NYKTMSNWVKYMSKLDTYEVLEMTVECLKEYVLKEKSFKKASKCKIINESVLKTMVEL
                     YRSPHKALVQSVNELFQLYATDPQFGVVFHDDKLWFDEPVYHAHGSSGAVVTVNQKEF
                     RLYNKLVYTMLTFFKPWEDDLQCGTVLKILRNLPELVPPYCNYLALQGYHEPKMTSYW
                     VGLTLLLGRIINLPMPAMLDHLHTDRLPNTSIVLENVMPASISKLSLTKCLQHDVMLV
                     KHFGCQLLVFSLKKFEKVLQLYTEKGWETAIAILANSYWAMLPDISVIVTALNDVYAK
                     DRENKIVPLSLTMALRYYSSLFPNYFNVSLPGQNIYEDIMMQESFKGVDLVILDNFMR
                     YQELNSSQIKWWHSDGRKHSLFSSLIRVASSKNSTNVITVKVIRLLDRLLQFTIFINM
                     DKLLGSSILALVNSLSIISKIEGVDDELEKIWKLLDETVTRCVKFPYKYVDMSSNYGH
                     VSPFVVVISEQWKYVDKKTPYDAIAKWMMLFFRNMIILGEPQQGILDLAMKLDGIEQS
                     LIKRYLATDRYEESVSNLSAAEYLLSSNTDFSFADYISTLPVTAIVTTTRYPVNDLDA
                     ASLLFRAGTILRADSLPLGKYNTAGVFDKLLSLVGNYALSNKSFLDKFKRQRVFKDLV
                     VPKHFIENTVAFEKYLYLTSRLAQIYEQLETDISEFQEYAYDLIANKHHEYTKLQSGD
                     LILSLCGVLSVVQLKELLDTETVTDTATLAFIISKLFESRQAISGQQLLMLLKLKDNK
                     ITNLLEHFISSKLIDDIDVEATLSETVHEPASVSLVQKVLLYPNAVNILVKHLPGVQE
                     RQNIIGLASVITDFDNELILKFLSVALTLAFENLNVLAGDELANAMRLFCNNHHLLSS
                     SDRNSILTFGISKAELKYTAEICRFVRMCLPVDNALVKEWLAKSVLFITKNFAEREHL
                     SEHFVEFLLQFKEILLISDIWNIVNKASLNSQLEVILNKKWVTDTRVLEYANLLLLGG
                     SKHTVESTRLLQIFINNEGQALNGADFDCYRKYLSAMIIYNLFNKDISKNSTAAIELQ
                     IINFYSGMATPQDRILLHILEVIESKLCLSWVRNVCSWDFVESTSYETDLGGPVKLLQ
                     KEKEGYVITLSKQMIEATLKHYPRLDYMIPEFNGKSTGTAWQLLQNFYDSYKLSSPNP
                     EVSVYDPFFILLLITNNDELLREQVLDDSASNYTLDVKKLLDCKLLQLAVMSLSDCRE
                     VVFNIATVMLNQMLLTLENKPTFKESNIFKILLTKILYLFVKETNGRKLSRSDVPPVV
                     YYALARIADLLMQPKAPLYEKAYRWVLSSPFIRTREIPFLHEIIPNNSTSPNDGYYTC
                     LQWILETLQHGINSERDVWLLKTTNLIEYIFNLQNSPYLNPKLQMLLSGFVFKLQRVE
                     SGGSTLISRFGGISQLEVRSSDIHHRTLELEGSLSVNAKNKKHLKEHMYLRQQNLNCQ
                     ELGFGYSVIVNAQKRLLEWTEHDHHNIQKRLRK"
     gene            <177502..>178134
                     /locus_tag="AGOS_ACL094W"
                     /old_locus_tag="ACL094W"
                     /db_xref="GeneID:4619430"
     mRNA            <177502..>178134
                     /locus_tag="AGOS_ACL094W"
                     /old_locus_tag="ACL094W"
                     /product="ACL094Wp"
                     /transcript_id="NM_208663.1"
                     /db_xref="GeneID:4619430"
     CDS             177502..178134
                     /locus_tag="AGOS_ACL094W"
                     /old_locus_tag="ACL094W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR024C"
                     /codon_start=1
                     /product="ACL094Wp"
                     /protein_id="NP_983310.1"
                     /db_xref="GeneID:4619430"
                     /translation="MYRRVCIPKLGLRWASTGMRNIAAPSKRPLYDSRYVLPMVLLVL
                     VGSIAANRMDTERRISDMQQPYYAKIRILELLLARARAGDTAFDMSSELEIVDRVLER
                     HKERSGRSNKCARRAVDEKPVVQEEESLDVLLNSIMRDLDSPVADAPAASEPAAYDGT
                     IVTDREVLAREALREKESADFRADSGPRVIVQTPGEYVAAAEDTDVPRFL"
     gene            complement(<178229..>181261)
                     /locus_tag="AGOS_ACL093C"
                     /old_locus_tag="ACL093C"
                     /db_xref="GeneID:4619431"
     mRNA            complement(<178229..>181261)
                     /locus_tag="AGOS_ACL093C"
                     /old_locus_tag="ACL093C"
                     /product="ACL093Cp"
                     /transcript_id="NM_208664.2"
                     /db_xref="GeneID:4619431"
     CDS             complement(178229..181261)
                     /locus_tag="AGOS_ACL093C"
                     /old_locus_tag="ACL093C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR023W (DAL81)"
                     /codon_start=1
                     /product="ACL093Cp"
                     /protein_id="NP_983311.2"
                     /db_xref="GeneID:4619431"
                     /translation="MRQPDGSVQQWDGAEGGDTPTMHTNNSMLSFNDDYTSLLNNLTN
                     AGVAAERATQPSERNAHRGGDGRQSLDQLLQQYHAVEEKVGNGGSEGRLQFASGEQPD
                     TRKAAAGGDGAVPGNQCDHCRRRQVKCVTVAEHSNCLQCETKGIKCVFSEMPSARMKK
                     TLQQGMQNKRSRSEENGAWIQELLKRTKGSVPSSSESISQFYADLLQNLNSTLANTPP
                     PPIFSKKNHEAGIPIHSASSPSGPGHYSYASNPPTADAVGRNDSHLNSALAKYPRSSF
                     YVGPTSMFDVNLVNHMKLDKIDQVQLSNTLALRKVAPGVQFVLRADFNHQLYLKNERD
                     VDLVEKLVHPHGKILVDIFFKLIHPYFPILHERVFLEKYSKSYRELTAPILASIYSLA
                     LQWWDFHPQAVGFQRPDVIDQLNEIALRTFFDVLERPKLSIVQTGLLILQCRSECPNN
                     WILCSEVVALAEDLGLGIDCKDWRLPSWERGLRRRLAWAVWYQDKWISMLEARYSHLI
                     LGRNWLVKMLSDQDFPANSPVISNSQEKSNANIGTGKTAPSNISVLDLSPTDEDFNNG
                     KLLFRQMVSLSIILGEILDTFYTLGAISTTTKIEQVLKLAKPLQLKLREWYHSLPSKL
                     SMNNFQPRKFNSNASLTLAYFAAEITLHRKIITTLQPDSPGDLVQVCRTAAKTRLIAA
                     IEFVRDLKTEHISAFWYSCTTGNLTLISTFAGLLYVTAPTKEDAQVFRDCLRNYVWIL
                     RMASKSYEKAANALDRIQMLLSQIPGLLTDEVAPQQFAPPRSQSPYSQQYSTAGSHSG
                     FEAQSGQNTAGMLDGDPNLSTGTFQQLRSLPQDVLLTLKSIQHNLPGVPHDIRGHRPT
                     AAKSDDELELSPGYTGASAQVQGTGPYKGGQQEHTNSKPSATSSSSATMPSATNGKSG
                     SESSASFGGDTDSSGKRNSSNSNAGAAFKPNSALESGQDTQVGSTSPTPSSSVDNPQS
                     KRVEDNTSLVKSPRNSPNMPGSTGGSSSVESASVEHSE"
     gene            complement(<181562..>182077)
                     /locus_tag="AGOS_ACL092C"
                     /old_locus_tag="ACL092C"
                     /db_xref="GeneID:4619432"
     mRNA            complement(<181562..>182077)
                     /locus_tag="AGOS_ACL092C"
                     /old_locus_tag="ACL092C"
                     /product="ACL092Cp"
                     /transcript_id="NM_208665.2"
                     /db_xref="GeneID:4619432"
     CDS             complement(181562..182077)
                     /locus_tag="AGOS_ACL092C"
                     /old_locus_tag="ACL092C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL013C (ARC19)"
                     /codon_start=1
                     /product="ACL092Cp"
                     /protein_id="NP_983312.2"
                     /db_xref="GeneID:4619432"
                     /translation="MSQSLRPYLNAVRLSLQAALTLSNFSSQDVERHNRPEIEAHTTS
                     AELLLQPMHIARNEHEHVLIEPSVNSVRMSICVKQADEIEQILVHKFTRFLEQRAESF
                     YVLRRVPLPGYSISFLVTNKHTETMITDRLVDFVIEFMEEVDKEISEMKLFLNARARF
                     VAEAYLGEFVY"
     gene            complement(<182416..>184365)
                     /locus_tag="AGOS_ACL091C"
                     /old_locus_tag="ACL091C"
                     /db_xref="GeneID:4619433"
     mRNA            complement(<182416..>184365)
                     /locus_tag="AGOS_ACL091C"
                     /old_locus_tag="ACL091C"
                     /product="ACL091Cp"
                     /transcript_id="NM_208666.1"
                     /db_xref="GeneID:4619433"
     CDS             complement(182416..184365)
                     /locus_tag="AGOS_ACL091C"
                     /old_locus_tag="ACL091C"
                     /note="NOHBY306; No homolog in Saccharomyces cerevisiae;
                     Non-syntenic homolog of Kluyveromyces thermotolerans
                     KLTH0E00638g"
                     /codon_start=1
                     /product="ACL091Cp"
                     /protein_id="NP_983313.1"
                     /db_xref="GeneID:4619433"
                     /translation="MRSSIIAAAALCAGLVVGSGSGNDGLQRVYDADTVFTEEKIVAD
                     LVEQLVSLSADKNSTSCEKCVGSLALGKVLALSRPHLVPKVFEEWCLLTTGFKIGCEK
                     SFRRNTLEGGFSGSNFVDMLALMDPHGYDGHLYCHYYENGCPKPETPNVTLSHLWPEK
                     QAKHFHAPEPSGEELINVLHVSDFHIQLDYKVGSEAQCNNDFMCCTPFATSSSQIKGG
                     SKKSHYNSLYESYYKDDNSFVKGRLVDGFNNLTAEIPATTFGHYYCDAPEVLVNSSLI
                     SIVEYSQRNNITFDFALFTGDLVDHRERGLISYEMTVQSEEVVFRDIKAKLKDIPLYA
                     VLGNHDSFPYGQLAQENSGFKNKFTWNAELMADLWEDYGWIDREAARQARSHYTGFAI
                     NAKPGLKVISLNSNVWFDNNRYAYINASQPDTFGQFEFLINELLESEAKDQRVWIIAH
                     IPPNSDALPVPTALFSEIVERFSPYTIGGIFFGHTHFDQFELLYAGNGTDTSIEALVN
                     FAWVAPSVTPWYGVNPSWRYYAVDAKTFSVMNSYTFYVDLKETFDSNGLEPTWELEYD
                     PREAYKIDWPESAPLNATYWHKVSQKMKNDTATLQLYSDLMNRHSPLRFNCTKPGSCD
                     NTHCLVSSFNIDQRDNCKSLHQMRF"
     gene            complement(<184871..>186292)
                     /locus_tag="AGOS_ACL090C"
                     /old_locus_tag="ACL090C"
                     /db_xref="GeneID:4619434"
     mRNA            complement(<184871..>186292)
                     /locus_tag="AGOS_ACL090C"
                     /old_locus_tag="ACL090C"
                     /product="ACL090Cp"
                     /transcript_id="NM_208667.1"
                     /db_xref="GeneID:4619434"
     CDS             complement(184871..186292)
                     /locus_tag="AGOS_ACL090C"
                     /old_locus_tag="ACL090C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR053W (BFA1)"
                     /codon_start=1
                     /product="ACL090Cp"
                     /protein_id="NP_983314.1"
                     /db_xref="GeneID:4619434"
                     /translation="MMAMERTGSGAEAPQRIEMPGGGSETSFEEVDTSCGVTERKAQA
                     GAAAPSTVSSGASTTLSGKERRGSAPTESDGHEFLRDFEEFGSSAKVDAWLQSGRGVL
                     GLEGFRELEGEDELLELQEELEQRLGGVGGLGPPPDLGPPGGRRAGCGTSRSVTNLRA
                     RSGGVRAKKSMPSLRPAAELDVGVGPMQPQFLVPYEEPWNLSPTQYTVTRDDKILTPQ
                     LNKLPRRAKNLDEFKEDDCRRQTRTKKVSASHRLRTIKQEIDHNTPVRAGKMSYNPSL
                     KKWEGNEEALERFRTLDEMDGKRVLLITNNRRTRGSPARTATAGAARGARDAKVVGKM
                     VFDEENLRWLQIGGGEVDPFADIQETIKSKPLPQSGAACPSKFVKSHRSDDALDGFRE
                     NGQRFSSTRHYSLPRQQTHPTFRVSSQLLEKFYHEENRWVRHVGGWFSAESVENSRKE
                     DVGHYDQSFMYEIRKMVMNSARN"
     gene            <186582..>188414
                     /locus_tag="AGOS_ACL089W"
                     /old_locus_tag="ACL089W"
                     /db_xref="GeneID:4619435"
     mRNA            <186582..>188414
                     /locus_tag="AGOS_ACL089W"
                     /old_locus_tag="ACL089W"
                     /product="ACL089Wp"
                     /transcript_id="NM_208668.3"
                     /db_xref="GeneID:4619435"
     CDS             186582..188414
                     /locus_tag="AGOS_ACL089W"
                     /old_locus_tag="ACL089W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML046W (PRP39)"
                     /codon_start=1
                     /product="ACL089Wp"
                     /protein_id="NP_983315.3"
                     /db_xref="GeneID:4619435"
                     /translation="MESVISEVDSGFLKENGSWADALAAVSWEDIGTLERAVYETEQV
                     MQKYERPNERVRGALYGVFEEVLGRYPLLFGYWRKYAGMVERAEDAGRATETLLRGVG
                     AFPASLELWTDYLRGAGTGPEARGLYETAAAQVGRQFLAHEFWDQYLAFETGQGAWEQ
                     VAALYARVARVPLHQYARYYSGFQEFAAAHAEAVPEGCVAEVDAAFAQTQQLVYDIWR
                     YESRISQSFFNVTDVAEAELQNWREYLAFAVSDARMEPAQVRATFERALVPCYRYRYF
                     WDAYITWLEGQGAHDELAAVFQRGMRALPADVPFERRYLDYLRVRTLQDCAQFRDAYR
                     DALAAAVQRAPEDGALLNDYLNLVKTTEYPTTLDQPEAEVLEQQQAYAKFLEGTVATY
                     MEGEDSRGSSQLLSLLDDRNISVVVVQLIKTTWLVLRNNMQAIKYFNQFGKLPQLKSS
                     TAFWLLYYKFEKSHRNFTKLNKFVGQLGTEIFLPTEVINDILEDYQGFYLANSDVNEY
                     ERRLASGPLQFDPLVDCVFKVNDPQWSPRNLDYRDWYKSTEYRENGHPGIALDPPQIT
                     NSIITKSIASIRKQNAQPLPTFRNLEKINQPPKNADHAWEYIKS"
     gene            complement(<188434..>190080)
                     /locus_tag="AGOS_ACL088C"
                     /old_locus_tag="ACL088C"
                     /db_xref="GeneID:4619436"
     mRNA            complement(<188434..>190080)
                     /locus_tag="AGOS_ACL088C"
                     /old_locus_tag="ACL088C"
                     /product="ACL088Cp"
                     /transcript_id="NM_208669.1"
                     /db_xref="GeneID:4619436"
     CDS             complement(188434..190080)
                     /locus_tag="AGOS_ACL088C"
                     /old_locus_tag="ACL088C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR052W (RAD7)"
                     /codon_start=1
                     /product="ACL088Cp"
                     /protein_id="NP_983316.1"
                     /db_xref="GeneID:4619436"
                     /translation="MYRSRNKSKAGDNEVRGPNSALTQFLREQGISAESIKERWKSTR
                     QSESQDSADAAETDSDKGDSDYDGSSSDGAPESGLESSRASSRARSNPVDSDEEEYEE
                     GVAARQGIRPKREPEMVQEVLKRRKQALQRRQAKRKRAMELLDRKTKRIPTLQDVCVA
                     VIGESIMKHKEHSLSVNKHILDVLGGVSVHNMNKLADALSKSRALNDRTLQLFLNVNL
                     ETITFHDCSNISADGYKSLAAFTPHLRAVSLQMCGQLNNEALLLMAEKLTNLRELYLD
                     GPFLINDETWGIFFERMGDKLEAFHVSNTHRFTDDSLQKLLLHCGGSLRSLKLSRLDS
                     ISNYALLPRYLHQDVHTLILQYPSNEEDITDEIMINLLGVVGNSLKVLNLDGCTGITD
                     SFLVNGLASNVRSGSDSCSLERLSLEELDQVTSDGFITFFSSVQLPRLHYLNLRRCHQ
                     LDDASIAEIWLNPCSKFLKELNLNSARNLTAAGFQLMSCPNLQQLNVGFVRCVDDKLL
                     AHISECAPNLEIVEVYGDNLVTQNASARGVTIIGRQSDSI"
     gene            191333..191406
                     /locus_tag="AGOS_t0048"
                     /db_xref="GeneID:4619437"
     tRNA            191333..191406
                     /locus_tag="AGOS_t0048"
                     /product="tRNA-Asn"
                     /codon_recognized="AAC"
                     /db_xref="GeneID:4619437"
     gene            complement(<191562..>192125)
                     /locus_tag="AGOS_ACL087C"
                     /old_locus_tag="ACL087C"
                     /db_xref="GeneID:4619315"
     mRNA            complement(<191562..>192125)
                     /locus_tag="AGOS_ACL087C"
                     /old_locus_tag="ACL087C"
                     /product="ACL087Cp"
                     /transcript_id="NM_208670.1"
                     /db_xref="GeneID:4619315"
     CDS             complement(191562..192125)
                     /locus_tag="AGOS_ACL087C"
                     /old_locus_tag="ACL087C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL090W (RHO2)"
                     /codon_start=1
                     /product="ACL087Cp"
                     /protein_id="NP_983317.1"
                     /db_xref="GeneID:4619315"
                     /translation="MTVNVVRRKLVIIGDGACGKTSLLHVFTLGKFPEEYLPTVFENY
                     VTDCRVDGIKVQLALWDTAGQEEYERLRPMSYSKADIILIGFAIDDPGSLSNAREKWT
                     VEALRYCPNAPIILVGLKKDLRRPGTQCAMVAPSQAQEVVRAIGAKKYMECSALTGEG
                     VDDVFELATRTSLLVNKEPGQGCCIIS"
     gene            complement(<192725..>196348)
                     /locus_tag="AGOS_ACL086C"
                     /old_locus_tag="ACL086C"
                     /db_xref="GeneID:4619438"
     mRNA            complement(<192725..>196348)
                     /locus_tag="AGOS_ACL086C"
                     /old_locus_tag="ACL086C"
                     /product="ACL086Cp"
                     /transcript_id="NM_208671.2"
                     /db_xref="GeneID:4619438"
     CDS             complement(192725..196348)
                     /locus_tag="AGOS_ACL086C"
                     /old_locus_tag="ACL086C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL091W (NST1)"
                     /codon_start=1
                     /product="ACL086Cp"
                     /protein_id="NP_983318.2"
                     /db_xref="GeneID:4619438"
                     /translation="MGLDNPTVVTGQNVQFSYDMASSSKKSRNKKKKSKPSIKEPQSA
                     PLLAVETESVEETHPQAELYDSEADYPSSRVIRRAANGDVIVESLNEAGSGVQAQQAQ
                     QQKHSAISSKLVAHWESLSPEEKRKILSISKEEVFSVTKSYQTLHNCNCTVCGRRHVP
                     MEQELESIYNQLYEMARQDNPNSDFVLFHLNLIKELQRGTSSGAEQRTASLQSRGASF
                     LDNMRDEAVKYCISNEGVDRLKEEVLQFKHNKQRQYSEQQRKQQLPPVHTHNSPSDSP
                     SIDELPEREQESLLHTLPDELGPDSSEVNEQLREKYLKFAKTFVSSHPKIAQEYVNRM
                     MMYPDMRALTEDLIKNNGQDFVKAMEAFVSSQQDGPLPGSPEHTKLTAEQFQELQKQL
                     VEKAGLDMSQSPVPTNDDPPQDCTDTDEIDTDLRGRVLLKQFMAGESIINQAFKSLQG
                     SNKNQLKKSVSHSSQGLPEDSEYDEDLNYSDSYDDEDSPYDDDVYDDNDAESYDEDDD
                     SHHKHHHQQHLHHHHREQDAEADDYDSDIDQQERLEEGRGLIQIAITKLLQRKLIVSY
                     QEKQAERNRERLLLELEAEEQQKKEKEEKKLKKKEKEKEKKRQMQLAKEEEKRKQVEE
                     EARLKQEAEAREMQRRENQRKKVEEAKRKKDLEMRKRLEEQRRREEEQERQRRMKEEI
                     KRKRDQERKQREEEQRKRKQEKELKKLQSLEVKKKREEDDKPTEESSQEDNLHKENIS
                     HDLLNQLAHPAGGVPYGIVPVKQEMSEEKTVNDDIFNMINEATSKSISTSKSISTSPS
                     HFNALLQKGIPRKSIDTSSIGLNYASAQAALPQPLSFPVDLTEALGFAQKTQVQTSIS
                     GPPGLSKNTAASSWDNVPGYVQLSPKSVTQNHSNVQVQTTPHGSVPGQHRASYSTFGA
                     SVDPNDTFSGDLTNLTNFLVQTKLEDVSTSAPLHSVSSSTTALPRGETSIYGNNLWNN
                     EQPHIGSLISSHASGPSTQAPLHPRRSIWDNNASVNNYAADLWGNTSSNSTPIAPSTA
                     VASSMVSAHQASATDVIIQAYTLLSTSGGFVPIDVLYQNCLSYLTDKGSFTFGQFVGQ
                     LLALRNANECEVLSNDVGMMTHCRFTTPQLQSTLYAPAAAPGGSDLPPRQPSKGLFSD
                     PVSTSTVGLTTIPVLSTSTGSTSSATPTGSIALGQPSSGQSNFFDFNQQLAQPSRANN
                     IWG"
     gene            complement(<197607..>198797)
                     /locus_tag="AGOS_ACL085C"
                     /old_locus_tag="ACL085C"
                     /db_xref="GeneID:4619439"
     mRNA            complement(<197607..>198797)
                     /locus_tag="AGOS_ACL085C"
                     /old_locus_tag="ACL085C"
                     /product="ACL085Cp"
                     /transcript_id="NM_208672.1"
                     /db_xref="GeneID:4619439"
     CDS             complement(197607..198797)
                     /locus_tag="AGOS_ACL085C"
                     /old_locus_tag="ACL085C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL092W"
                     /codon_start=1
                     /product="ACL085Cp"
                     /protein_id="NP_983319.1"
                     /db_xref="GeneID:4619439"
                     /translation="MEEDDNHALLQTLNSFWNYREYALDEFWRPRMRRWRGLSEHQKR
                     MIPWYERYLQQVHDAILANSQFYHSLVAHSVDAWEVDKAPDEWPIPTIADMQKTVLIF
                     TQLVREWSVECNDERSVLLSRMAAFMDEAYPRERDQVSILVPGAGLGRVVVDLVRMGF
                     RTEGNELSYHMLLVSRYLLNGSISCFQHQLYPFVHSFSNQTSRQSQLRAVQVPDMTIY
                     MEVGNDCLMSMSAGSFVDLYGPNLNIRQSGYYSNDPRMRNIRAEAASSKHVVVTNFFI
                     DTGMNVLDYMETIQHVLKPGGHWVNFGPLLYHFETDHHCEETANFDPLTGVVSDVREE
                     PVKGLELSQEDILSTATSVFGFKLLRHEKNIKCGYGSNNAEMTMLKYTCNFWVLQKCT
                     TVGQ"
     gene            complement(<199009..>199632)
                     /locus_tag="AGOS_ACL084C"
                     /old_locus_tag="ACL084C"
                     /db_xref="GeneID:4619440"
     mRNA            complement(<199009..>199632)
                     /locus_tag="AGOS_ACL084C"
                     /old_locus_tag="ACL084C"
                     /product="ACL084Cp"
                     /transcript_id="NM_208673.1"
                     /db_xref="GeneID:4619440"
     CDS             complement(199009..199632)
                     /locus_tag="AGOS_ACL084C"
                     /old_locus_tag="ACL084C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR089C (VPS21) and YNL093W (YPT53)"
                     /codon_start=1
                     /product="ACL084Cp"
                     /protein_id="NP_983320.1"
                     /db_xref="GeneID:4619440"
                     /translation="MNSNVTSIKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAF
                     LTQRVNMDSKTIKFEIWDTAGQERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWV
                     KELHEQASKGIVIALVGNKLDLLENGEARKVSREEAEKLAEEEGLLFFETSAKTGDKI
                     NEVFLAIGEKIPLAKVGEQPASGPSVDNARLDLNAVSSNQHANSCNC"
     gene            complement(<199834..>201459)
                     /locus_tag="AGOS_ACL083C"
                     /old_locus_tag="ACL083C"
                     /db_xref="GeneID:4619441"
     mRNA            complement(<199834..>201459)
                     /locus_tag="AGOS_ACL083C"
                     /old_locus_tag="ACL083C"
                     /product="ACL083Cp"
                     /transcript_id="NM_208674.1"
                     /db_xref="GeneID:4619441"
     CDS             complement(199834..201459)
                     /locus_tag="AGOS_ACL083C"
                     /old_locus_tag="ACL083C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR090C (PTC5)"
                     /codon_start=1
                     /product="ACL083Cp"
                     /protein_id="NP_983321.1"
                     /db_xref="GeneID:4619441"
                     /translation="MAIPTPFSPWGKAARTLSRCLSKRNFSKLVIARRLNSTHHRGKP
                     MRLERELRYAIIGGTLLLTYSYMSSCLSSDTIKGIKQYGAPARSLSTSSDGKANGNPD
                     TISLLTDYEVNTKLRSLEESYYVNRGKGVLRYDVSQLPSNNPIEDSRVEQIITVPNEQ
                     TQAQEELYFFGIFDGHGGPYTSSKLSEALVPYVAHQLSKIYAQGNEALTSEAIDDAIE
                     QGFLQLDNDIVQKTLGQFFENPSKESLIEALPAVSGACSLLAMYDSNNCTLKVALTGD
                     SRALLGRVDENGKWTVQSLTIDQTGDNADEVARIRAEHPGEPNCVRNGRVLGSLQPSR
                     AFGDYRYKVKEINGKNVYDLPSHLKIFFRKEPREFLTPPYVTAQPEITTAQIDSSARF
                     MVIASDGLFELLTNEEIAGLVVKWMEKHPVKKGFETLKSSARDKIPPVHDTTVHAESQ
                     RPAFRYKDANKGSAGFLMEDNNVATHLIRNALSGGGDKRYVSTLISIPSPKSRSYRDD
                     LTVTVVFFGEEQNQPDNQLILNHEATRPLEPKL"
     gene            <201876..>202907
                     /locus_tag="AGOS_ACL082W"
                     /old_locus_tag="ACL082W"
                     /db_xref="GeneID:4619442"
     mRNA            <201876..>202907
                     /locus_tag="AGOS_ACL082W"
                     /old_locus_tag="ACL082W"
                     /product="ACL082Wp"
                     /transcript_id="NM_208675.1"
                     /db_xref="GeneID:4619442"
     CDS             201876..202907
                     /locus_tag="AGOS_ACL082W"
                     /old_locus_tag="ACL082W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR091W (TMA46)"
                     /codon_start=1
                     /product="ACL082Wp"
                     /protein_id="NP_983322.1"
                     /db_xref="GeneID:4619442"
                     /translation="MPPKKKQAEPKKKKDNVDKTFGMKNKNKSTKVQKFIKQVQSQAD
                     PQKEELKRKKLEEKKLKEAAEAERRALFNPVVEQKVRAGVDPKTVLCAMFKLGNCNKG
                     ARCKFSHDLSVGRKVEKRDLYQDARSEKEGDTMDKWDEAKLRDVILSKHGNPRTTTDK
                     VCKYFIEAVENGKYGWFWVCPNGGDKCMYRHALPEGFVLKTKEQKRLEREAIENQPKI
                     TLEEFIETEREKLDKTRLTPITVENFAEWKKRRISQKLNAEKENGAKRRPSGREVLLK
                     KYMEDKKFSDMDEDYEDKGSAWDLSEFTKALRDEDGSTGIKDYGDGSNPNFEIKKAVE
                     EGSGSLTAA"
     gene            complement(<203075..>204856)
                     /locus_tag="AGOS_ACL081C"
                     /old_locus_tag="ACL081C"
                     /db_xref="GeneID:4619443"
     mRNA            complement(<203075..>204856)
                     /locus_tag="AGOS_ACL081C"
                     /old_locus_tag="ACL081C"
                     /product="ACL081Cp"
                     /transcript_id="NM_208676.2"
                     /db_xref="GeneID:4619443"
     CDS             complement(203075..204856)
                     /locus_tag="AGOS_ACL081C"
                     /old_locus_tag="ACL081C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL094W (APP1)"
                     /codon_start=1
                     /product="ACL081Cp"
                     /protein_id="NP_983323.2"
                     /db_xref="GeneID:4619443"
                     /translation="MWANGDAAGGGRRQRLMNMVRVTKDTYLPAMQNSLTQAKSSLRN
                     YYYSLEEGEERAPTSAEERELQLICYPTYTRVGSDRQYVTQVRGMVYVQGQATRRNRL
                     ILSICRQLARPTATAETERELESVLGDDAAGSRGTVRSASTAASSASSVSTVLSAATA
                     GSQTSQDEVLRDRLAGFLNKAVPGVAVIVDLLDAAGRQETLFTATDNYGQFRVHTTTG
                     FQPTVIRATLDTAAPVSTMYDTNLIEDAGIGLISDIDDTIKHTGVVGDKRSIFCNVFV
                     SGFNTWLIPGMSLWYNTLKDSRGVDFFYVSNSPFQIYPTLRQYISNEYPIGPMFLKQY
                     SGNLLSSLMSSTAAIKLPSITQICADFPNKKFILVGDSGEEDLEAYIATARNFPNQII
                     GIYIRCCKSSMSDDPAKDWDVMDDLNSLIATKYFARLQQRSAEQKQKKPAPPVPAKNV
                     QLSEEMKEDILRSKQIDSATDSVTYNSTSGQSTTGGTGPCPPHHAGTPKSEPPPLPPR
                     APVYPARTSLSDDGIFTMPSTQNDYGIYSAFFDRKADEWKERVTRAIGILLENGVEAR
                     FMFFRDPEVCIEDSMTKINFTAKRKSA"
     gene            <205395..>207155
                     /locus_tag="AGOS_ACL080W"
                     /old_locus_tag="ACL080W"
                     /db_xref="GeneID:4619444"
     mRNA            <205395..>207155
                     /locus_tag="AGOS_ACL080W"
                     /old_locus_tag="ACL080W"
                     /product="ACL080Wp"
                     /transcript_id="NM_208677.2"
                     /db_xref="GeneID:4619444"
     CDS             205395..207155
                     /locus_tag="AGOS_ACL080W"
                     /old_locus_tag="ACL080W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL095C and YOR092W (ECM3)"
                     /codon_start=1
                     /product="ACL080Wp"
                     /protein_id="NP_983324.2"
                     /db_xref="GeneID:4619444"
                     /translation="MMLERLRLVSKFRQAYGIWRPRNGGLQKCCHGSERRDKQDTMTL
                     ALGQVVWIAVKPVIRIYFIVGTGFVLARFNILSVEATRAVSDIVITALMPMLAFSKIV
                     QNIGISDIKNVGIICLTSFLLFGAGLAAAMGVRRVLPVPRKWQGGILAGGLFPNINDL
                     PIVYLQSMDQGLVFTPEEVSKGVANVIIFVAMFLVCLFNLGGFRLIEGDFTYEDEESE
                     SGREEKSELAEAAARPASADELESIPTRDSANTLPTGGERSEGGVRPLVPVQLAGPPL
                     SMWNTRLSSVSSFRRRDSITSTMRSIDLRSMPPQGIADLIREYSNVDQFGKRLSMQEA
                     AHGAAPYGEVGSHMTPAATQRSLTRIITSEAAVHKEDIEASGSTLPPWLRRFPLTKHV
                     VFFLKNCLRPCSISVMLALVIAFIPWVKALFVKVPDGPHIPDAPDKLPPLSFLLEFTS
                     YIGAASVPFGLMLLGATLGRLRFGNLPPGFWKAALVLVLIRLIILPIIGILWSEALVR
                     FKWVNWGDDKMLLFVIVLSWSLPTMTSIIYFTATYTPINALDTTQMDCASFFLMLQYP
                     VLTVSLPFVVTYFLKVKLDV"
     gene            complement(<207337..>212217)
                     /locus_tag="AGOS_ACL079C"
                     /old_locus_tag="ACL079C"
                     /db_xref="GeneID:4619445"
     mRNA            complement(<207337..>212217)
                     /locus_tag="AGOS_ACL079C"
                     /old_locus_tag="ACL079C"
                     /product="ACL079Cp"
                     /transcript_id="NM_208678.2"
                     /db_xref="GeneID:4619445"
     CDS             complement(207337..212217)
                     /locus_tag="AGOS_ACL079C"
                     /old_locus_tag="ACL079C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR093C"
                     /codon_start=1
                     /product="ACL079Cp"
                     /protein_id="NP_983325.2"
                     /db_xref="GeneID:4619445"
                     /translation="MDFSIPAHLSAEAVGQLQELIQDYKDGNLTAKGYASKRAQVLER
                     GAGSPVRDGASMCSGAGVPTPQALASPLSCLSAGTGFHGREQSVSSTIRTSGQQDMQS
                     TGSFSLYRVTTSNSNTMAVRGYGDGRGAPRPERRTYQPLIPLLPRSAEGAPAHLDSLP
                     SVLRGRSQTYDRETAMVSISARGKENSITWEKLYLRAEKVAHELGKTKVYKMNKLLLW
                     YDPGEAIEFAVALLGCFIAGTIAVPVSFETYTLQEIVEIIKQTNAKSILISEECSKQL
                     DTLYVNSRSKLKLLKSNFFSQLTFIKTDDLGTYAKAKRSTPAFDIPNVAYIEFTRTPL
                     GKLSGVVMKHQVLTRQFENFTAILNSRSKKNWRKGDIRRPYTRGKERFMRYVILSSLD
                     STRSTGLVLGTLFNIFSGNLLVCVHPHLLRRPGSYESIINKYRADILLSDQLQLKQVV
                     INYLENPESTISKKNKMDFSCIKWCIASCTTIDTEVSNMIVHKWLKNLGCLDASQAYS
                     PILTLLDFGGIFISLRDQLGNLENFPLHDYKLRLQDDVFIDKEQLKNNIVQPSISAMI
                     NSSSSIKDFLRLTTFGYPIPDAMVCVVDPDTRMLVEDLTVGEIWISAPSVTDEFYHMD
                     KLTDFVFNAKLNFKKMLATLEETELHCSRELYASSIERLDTIFSLFPPDTTFLRTKLI
                     GFIHNGKIYTLSLIEDMFLQNKLVRLQNWSHTSDITRSIKDPPSADKEVAVKTDKALS
                     SKRVVQTFYLQHVSENLVRTVDKVSEVAAFELDHDKDEHFLVVVVESSLANTPVIGSA
                     VSSAIPQINMADKRTLERRMNDLTEQIYKILWIFHKIQPFCVMVVPPGSLQRRYCSLE
                     IANRTVEKHFLNCSLHSKFVKFQLDNVILDYVPHSSYYNESIFSEHLSKLRHRSLEDN
                     YFNSMGMIPESALQTSGLDYKEDTLDSRTSEKLGRFETIMAILEWRSQKHGNDFAFCN
                     GNSFSTAGASIDQNKKFSWNSFSSLVASYIKKIVESKSPLKHGDHVVVMADNSVDYTA
                     IVIACFYCRLVVIPLHIMHDSHSEKEVNYLLKVIEVYEVKRLFVDHKVENLLEQNTHI
                     SILLKSHKHELPKITVFTKVKRKNSLAPSQFKTVLHEKFGRLSKTDPCVVWINHDDDA
                     STDLNVLMSHSTLLKMSKVLKETLRMTNENHIFSVTNYTRDIGFLQSCILGIYVGATT
                     SLFSPSECMMNPRHLLIGLQNMNIKDLVLCPDMLYMLMDRGCAMIEKQTQMVVSSGSI
                     DKRRDTDAATVLYPNFLRNIQNIMVPFTGRPRFQVMQTLLMKYKLAGSSALQINYLYQ
                     HRFNPFIALRSYLGIPPVDVYLDPIALREGIIHEFDPSTASSSVLSSAIHLQDSGIVT
                     ACTEVTIVNPETLEQCYENELGEIWCCSEANVFDYSICRLGNNTASASEANRTPVQKP
                     MRDPFITQQFKAKIKNNSHTDLSYLRTGDLGFIKNITRPDADGRPMELSILYVLGSIN
                     ETVEILGLTHFVVDLESTVLRTHSSILNCMVVKTGGLLSCLIECNSKVKIPEYSNLTP
                     LVVSMLLKEHGVALDLCCFVKPNSLNYLVKDWQKNRMKILNDWLGKRLYIEAQYGVNV
                     GENNSIYLLSDFEKVH"
     gene            <212651..>213196
                     /locus_tag="AGOS_ACL078W"
                     /old_locus_tag="ACL078W"
                     /db_xref="GeneID:4619446"
     mRNA            <212651..>213196
                     /locus_tag="AGOS_ACL078W"
                     /old_locus_tag="ACL078W"
                     /product="ACL078Wp"
                     /transcript_id="NM_208679.1"
                     /db_xref="GeneID:4619446"
     CDS             212651..213196
                     /locus_tag="AGOS_ACL078W"
                     /old_locus_tag="ACL078W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR094W (ARF3)"
                     /codon_start=1
                     /product="ACL078Wp"
                     /protein_id="NP_983326.1"
                     /db_xref="GeneID:4619446"
                     /translation="MGNSFSRVLSKLFGSREMKILMLGLDNAGKTTILYKLKLNKIKT
                     SAPTVGFNVETVAFRNVKFNMWDVGGQERLRPLWRHYFPATTALIFVIDSHDQARLNE
                     AKEELYSIIGEKEMENVVLLVLANKQDLRGALKPQEVSDYLQLGDNLNNQLWCVVGSN
                     ALTGQGLVEGLSWIANNTKSR"
     gene            complement(<213318..>214085)
                     /locus_tag="AGOS_ACL077C"
                     /old_locus_tag="ACL077C"
                     /db_xref="GeneID:4619447"
     mRNA            complement(<213318..>214085)
                     /locus_tag="AGOS_ACL077C"
                     /old_locus_tag="ACL077C"
                     /product="ACL077Cp"
                     /transcript_id="NM_208680.2"
                     /db_xref="GeneID:4619447"
     CDS             complement(213318..214085)
                     /locus_tag="AGOS_ACL077C"
                     /old_locus_tag="ACL077C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR095C (RKI1)"
                     /codon_start=1
                     /product="ACL077Cp"
                     /protein_id="NP_983327.1"
                     /db_xref="GeneID:4619447"
                     /translation="MSVTPIEELPSLGDALEDAKRAASYRAVDENLDPAKHRVVGIGS
                     GSTVVYVAERIGKYQASPELKAKVEFICIPTGFQSRQLILDNGLRLGSIEQYPEVDIA
                     FDGADEVDPELNLIKGGGACLFQEKLVSTSSAQFIVVADSRKRSPQRLGTSWTRGVPV
                     EVVPSAYVRVLRDLHGIPGCRSAQLRLGEPGKAGPVVTDNNNLLIDADFGPLEDPAAL
                     HARIKALVGVVETGIFAGNAAKAYFGSADGSTQTLAR"
     gene            <214736..>215452
                     /locus_tag="AGOS_ACL076W"
                     /old_locus_tag="ACL076W"
                     /db_xref="GeneID:4619448"
     mRNA            join(<214736..214879,215024..>215452)
                     /locus_tag="AGOS_ACL076W"
                     /old_locus_tag="ACL076W"
                     /product="40S ribosomal protein S7"
                     /transcript_id="NM_208681.1"
                     /db_xref="GeneID:4619448"
     CDS             join(214736..214879,215024..215452)
                     /locus_tag="AGOS_ACL076W"
                     /old_locus_tag="ACL076W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR096W (RPS7A) and YNL096C (RPS7B); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S7"
                     /protein_id="NP_983328.1"
                     /db_xref="GeneID:4619448"
                     /translation="MSAPQAKILSQAPTELELQVAQAFIDLENSSPELKADLRPLQFK
                     SIREIDVAGGKKALAIFVPVPSLAGYHKVQTKLTRELEKKFQDRHVIFLAERRILPKP
                     SRRSRQTQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQKVLLDSKDVQ
                     QVDYKLESFQAVYNKLTGKQIVFEIPSETH"
     gene            complement(<215791..>218337)
                     /locus_tag="AGOS_ACL075C"
                     /old_locus_tag="ACL075C"
                     /db_xref="GeneID:4619449"
     mRNA            complement(<215791..>218337)
                     /locus_tag="AGOS_ACL075C"
                     /old_locus_tag="ACL075C"
                     /product="ACL075Cp"
                     /transcript_id="NM_208682.1"
                     /db_xref="GeneID:4619449"
     CDS             complement(215791..218337)
                     /locus_tag="AGOS_ACL075C"
                     /old_locus_tag="ACL075C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR098C (NUP1)"
                     /codon_start=1
                     /product="ACL075Cp"
                     /protein_id="NP_983329.1"
                     /db_xref="GeneID:4619449"
                     /translation="MSTSSPAKNKRSISSAIAGLFRRPADGASTAECADCSTELPIEY
                     ESNTSSDTVIKRPRAGVRGAEPLILYESDVAVRPPVLPILPLQRLRMLRHRQELRRRQ
                     YQLAPLVQSGHGGRIVSEASGEGWRRIAGGTRSASALGRAGTGKKGRLWSSNFEYDLS
                     EYDVLKKQKLNTRDAKDITMLDSPKLSEEVVLKNGAARRDAGEPPFSSNLSRAQLKLL
                     TGCESPALLRGEAAAGGKSIDGRTPYSKPHDGAAAGPKKMPSVGFDFLLKADADTPSK
                     TKLPALPAPAVSLTLDENRPAQPSRAEETVRPAETPSAPLLAFGNQGQDVSKPAAQPQ
                     LSFTFGAPKAAGGKDVAEPAIKATSPEESTKKPAFSFNISNGGANKAPFSFGASAQTQ
                     NSGTTSNTPNGGAQGSAKPTFSFGQNFGASQQAENKPNTTSSEDKSSPSKDAPAPPIF
                     GNGKPTVSGFSFSNGSREATVPSKKADSTSGNPTLMFGNGIQNKEPQTTPTFSDDKKD
                     TSSKPTFQFVIPAKSNTNASNTNTTFGTTMNGNSVSSATNLFSGSSSETAKSSNNQAV
                     PTLSDGSAVKGTSLDRQNTLSPVTFGAPSAQPTTSGSLGAAPFSFKTTTPDTSNPTNP
                     PSLLFGNNVNGNGSLSSTSAPVTSGAASNSGGFKFDMSGFKNNQGVTSPVPTFSMNNN
                     VSQRPGNNMALNGSSMSIANAPQPQQATAFGFPQDSVSNGTTAFGSGLTTANNSPAFG
                     ISTNNNNSNNNQPAAAFTFGSNAGSPAPSLFANSASSALQNNRPVAFTPSSSVNLNFG
                     GAPAASLDPSQVFGQAATGQPQNSGFGMPQQPMMHLPPGRRIARMRARRG"
     gene            <220792..>221820
                     /locus_tag="AGOS_ACL074W"
                     /old_locus_tag="ACL074W"
                     /db_xref="GeneID:4619450"
     mRNA            <220792..>221820
                     /locus_tag="AGOS_ACL074W"
                     /old_locus_tag="ACL074W"
                     /product="ACL074Wp"
                     /transcript_id="NM_208683.2"
                     /db_xref="GeneID:4619450"
     CDS             220792..221820
                     /locus_tag="AGOS_ACL074W"
                     /old_locus_tag="ACL074W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YKR092C (SRP40)"
                     /codon_start=1
                     /product="ACL074Wp"
                     /protein_id="NP_983330.2"
                     /db_xref="GeneID:4619450"
                     /translation="MMGSKSIKKAVVPKLSEKAKEEELSTSGSSDSTLESSSSSSSEG
                     SSSSSSSSSDSESSSSDSGSSSSSSSSSSSGESGSSDSDSSSDSDSSSSDSDSSSSDS
                     DSSSSGSSSSSGSSSSSDSDSSSDSDSSSDSDSSSSGSSSSSDSDSSSSGSSSSSDSD
                     SSSSGSSSSSDSDSSSDSDSSDSGSSSGSGSSSGSSSSSDSDSSSSDSDSSSDSESSS
                     DSQSSSAPKNGKRARDTSSDESSSRTATPEPPVKKAAIPAGEDEIREGQRKHFSRIER
                     AKISFEDRTLTDNTYKGAAGTWGEKANDKLSRVRGKDFTKNKNKMKRGSYRGGSITLA
                     SGSYKFVD"
     gene            <222050..>222211
                     /locus_tag="AGOS_ACL074WA"
                     /db_xref="GeneID:9487596"
     mRNA            <222050..>222211
                     /locus_tag="AGOS_ACL074WA"
                     /product="ACL074W-Ap"
                     /transcript_id="NM_001355304.1"
                     /db_xref="GeneID:9487596"
     CDS             222050..222211
                     /locus_tag="AGOS_ACL074WA"
                     /note="NOHBY335; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E13101g"
                     /codon_start=1
                     /product="ACL074W-Ap"
                     /protein_id="NP_001342246.1"
                     /db_xref="GeneID:9487596"
                     /translation="MDHIKDFASKQEKNGEDIISRAEDGVKHAKEKLGDDGYQKLENQ
                     AKKFTGNRP"
     gene            <222769..>224418
                     /locus_tag="AGOS_ACL073W"
                     /old_locus_tag="ACL073W"
                     /db_xref="GeneID:4619451"
     mRNA            <222769..>224418
                     /locus_tag="AGOS_ACL073W"
                     /old_locus_tag="ACL073W"
                     /product="ACL073Wp"
                     /transcript_id="NM_208684.2"
                     /db_xref="GeneID:4619451"
     CDS             222769..224418
                     /locus_tag="AGOS_ACL073W"
                     /old_locus_tag="ACL073W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL036W (MUP3)"
                     /codon_start=1
                     /product="ACL073Wp"
                     /protein_id="NP_983331.2"
                     /db_xref="GeneID:4619451"
                     /translation="MATDIKAPLLVHTEDLEGSGTSSDSARSYYGGVKIAEDVISPVL
                     ANEVPQGRHLGLFSTVVMFVSRIVGSGIFATPSTMFVNCGGNALLFVTVWIVAMLAAF
                     SGLYLYLEFGCLLPRSGGPKNFLEAVYDRPRMMMSVAFASFSVLTGFTVSGAIVFGKY
                     TLYALGFDRKYVNEDSAMCNYIGAAAVMLIVVIHGSSVKHGIIVQNILGGMKFLLIAV
                     MSVTGIYAVFFFDTRADDQNPAYYVKSHFWESRDSSLITASSLTASFMQAFFCFSGWD
                     GVHSVVSEVKDPVRTMRIAGPFSLLIAFGCYMLLNFAYLFVLSWEEIQGAGPLIGSIL
                     FSKLYGPTLGGKFVTLCVAVSTASNLFVVIYGTSRMNQEFFREGYLPFSKQMASNWPW
                     GSPLPSLLCCGLITVAWLCFLPPSGAAYDYLVNFEGYSKQFFLMLIAIGLFIYRHRHP
                     DIVAEIRASMIGVAFLAVISVYLMVGPFFGDQSGNVVGWLPPYQITTLLMFLVCFLYW
                     LLKFVLLPRLLGYRLQALIVTLSDGLEIKRWRRRYSKQASI"
     gene            complement(<224562..>229445)
                     /locus_tag="AGOS_ACL072C"
                     /old_locus_tag="ACL072C"
                     /db_xref="GeneID:4619452"
     mRNA            complement(<224562..>229445)
                     /locus_tag="AGOS_ACL072C"
                     /old_locus_tag="ACL072C"
                     /product="ACL072Cp"
                     /transcript_id="NM_208685.2"
                     /db_xref="GeneID:4619452"
     CDS             complement(224562..229445)
                     /locus_tag="AGOS_ACL072C"
                     /old_locus_tag="ACL072C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL048C (YBT1) and YHL035C (VMR1)"
                     /codon_start=1
                     /product="ACL072Cp"
                     /protein_id="NP_983332.2"
                     /db_xref="GeneID:4619452"
                     /translation="MIAPGCEPWDYDDLTECGRALYASGYVPLGVVSACAAYVVGSVL
                     AGGSDGAAAQAACVPDEERPLLDADLAARRYTDTGGRNLKAEHFAIEKLQLLGPDGRP
                     HGHAEEVRRSFAERSRVAVEFLGCALLLGLSGGVWANLSIIPGPQVPLPRVSAGSNLA
                     LWTGLFVSAALRLANAGEQLAWVRALPVNLWGMSFGAYTALAATSMLPFRSVLLGHVA
                     DPAAARYYTVNFAVLLVLFLVTVTAKVGFRLPVLYRRPGGEFPSPEPMTSVAAGMTWA
                     WLDPMIWQAHKRYLEITDVWGLRLEDYAIFVMRRFRHSARRVSGGRLYGNLFRFFFGY
                     LALQAVWAILDGLANFLPTILLQCTLNYVEDPQSVPSSMVPIYVAGLFLSRLALALFQ
                     AQALFIGRRICIRLKAVLVSEIYTKALRRRVSPYAGVAVDKSNSPEGSPVRSANAEES
                     KASNLGEIINLMAVDAFKVSEISSYLYFFIGSFVMVVVSMIFLYRLLGWSALVGVALL
                     VAMLPLNYKLAQKLGNLTVVTLGFTDKRIQKLNETLQSIRIIKFFAWETNFEKEVQAI
                     REDELATLLKRAIVWSAISFLWFMVSTIVVSASFACYIYIQGEVLTIPVAFTALSLFV
                     MLRNPLDVLADMLSYVVQSKVSLDRIQAFLDEDETTKYEQLTISGNRLAFENATIAWN
                     DDPSSFRLRNIDIEFMIGKLNVVIGPTGTGKSSLLLGLLGEMTLQEGKIYVPSLDPRE
                     DLVIQADGLTNSIAYCSQSAWLLNDTARSNILFNSPYNEQRYNDVLEACGLKKDFEIL
                     SGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTALWIYENCI
                     IGPLMEGRTCVLVSHNVALTMRNADWVVILENGRVKAQGEPLALANEGLLGEDKLIKS
                     SIASRTNSSLSLKTPQSALNLKELDNKIRTATAENLAGNASNDDERKKVGKLVAQETK
                     ADGVVSIDVYKWFYNLFGGWKMTLALATLYLSAQCLYMSSSWWIRYWIMHDAKSQIPM
                     ISVSSTPSFGNLIRHAQGLFSQPFLFVKSLMTEHAVNSDGSKGTFYYLAIYVLIGLTT
                     ASLSALKNIISVMAGLYASRKIFNLVLWKILHAKMRFFDATPTGRIMNRLSKDLEAVD
                     QELIPYFEGSFAAVVQCISTLVLIAYVTPQFLIMAIFIGFLYALIGYFYVTTSRELKR
                     FESITRSPIYQHFSETLVGITSIRAYGDERRFMLENLSRIDDNNRPFFYLWIANRWLA
                     FRVDLLGALVTFFSGLFIYLNIGKLDAGLAGISLTYAISFTEGALWFVRHYSNVEMTM
                     NSFERLKEYMEIEQEPYNENAQLPPDNWPQHGRIDVSDLSLRYAPNLPKVIKNVNFSV
                     EPKLKVGIVGRTGAGKSTIITAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQ
                     DPTLFTGTLKSNLDPYSQYSDKQIYEALQRVNLLSDTDINSLSSPSTQSSGENINKFL
                     DLNNEVTEGGANLSQGQRQLVCLARSLLRSPKIIMLDEATASIDYTSDEKIQQTIREE
                     FRDSTILTIAHRLKSIIDYDKVLVMDAGEVKEYDHPYSLLLNKNTIFYNMCERTGELD
                     DLIQASKEAFVRKLNSK"
     gene            complement(<229767..>230663)
                     /locus_tag="AGOS_ACL071C"
                     /old_locus_tag="ACL071C"
                     /db_xref="GeneID:4619453"
     mRNA            complement(<229767..>230663)
                     /locus_tag="AGOS_ACL071C"
                     /old_locus_tag="ACL071C"
                     /product="ACL071Cp"
                     /transcript_id="NM_208686.1"
                     /db_xref="GeneID:4619453"
     CDS             complement(229767..230663)
                     /locus_tag="AGOS_ACL071C"
                     /old_locus_tag="ACL071C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL034C (SBP1) and YLL046C (RNP1)"
                     /codon_start=1
                     /product="ACL071Cp"
                     /protein_id="NP_983333.1"
                     /db_xref="GeneID:4619453"
                     /translation="MASKTATAEQTGAAAVKPDVDPDTTIFIGNLAGDCSEEDLKQVF
                     GAHVEVEIPSNKTGKFYKQRYAFVKFPAKIDFEEVKEKYDKTVVRERSIYVRQALTKE
                     QRDLHKQAQRGSRVATRGSRRGKRFVRGQAVPAPPQREKVPLDQLERSSDTLYVNNIP
                     YYTTKEEIAEFFGTKPELIVLPMRRMRDTVSNRFFYSKSMNRGIVFVAFEGMEGDAIV
                     HKMEQFQGKVLKDREITVDVAAIKPESYDHEHEHEHEHEHEHESTPELESTPESVWKK
                     AKSPAAAAPAQVSIVPAQAEVA"
     gene            complement(<231334..>232251)
                     /locus_tag="AGOS_ACL070C"
                     /old_locus_tag="ACL070C"
                     /db_xref="GeneID:4619454"
     mRNA            complement(<231334..>232251)
                     /locus_tag="AGOS_ACL070C"
                     /old_locus_tag="ACL070C"
                     /product="60S ribosomal protein L8"
                     /transcript_id="NM_208687.2"
                     /db_xref="GeneID:4619454"
     CDS             complement(231334..232251)
                     /locus_tag="AGOS_ACL070C"
                     /old_locus_tag="ACL070C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL045C (RPL8B) and YHL033C (RPL8A)"
                     /codon_start=1
                     /product="60S ribosomal protein L8"
                     /protein_id="NP_983334.1"
                     /db_xref="GeneID:4619454"
                     /translation="MGAAHPPPIHSRRAPRPPPRATHPRARPSYKIHSARRFRHPPHL
                     STQDKMAPSKKVNPAPLAAKSGKAAKAKNPLTVSSPRNFGIGQAIQPKRNLSRYVKWP
                     EYVRLQRQKKILSMRLKVPPTIAQFQHTLDRNTAAETFKLFNKYRPETAAEKKDRLAT
                     EAAAIAEGKTRMEASPKPYAVKFGLNHVVSLVENKKAKLVLIANDVDPIELVIFLPAL
                     CKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSAVNANFIEKYD
                     ESRKHWGGGVMGPKAQAKLAKRSKASEAA"
     gene            complement(<232439..>234373)
                     /locus_tag="AGOS_ACL069C"
                     /old_locus_tag="ACL069C"
                     /db_xref="GeneID:4619455"
     mRNA            complement(<232439..>234373)
                     /locus_tag="AGOS_ACL069C"
                     /old_locus_tag="ACL069C"
                     /product="ACL069Cp"
                     /transcript_id="NM_208688.2"
                     /db_xref="GeneID:4619455"
     CDS             complement(232439..234373)
                     /locus_tag="AGOS_ACL069C"
                     /old_locus_tag="ACL069C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL032C (GUT1)"
                     /codon_start=1
                     /product="ACL069Cp"
                     /protein_id="NP_983335.2"
                     /db_xref="GeneID:4619455"
                     /translation="MTLNVVPKGEIPLIAAIDVGTTSTRAILFNKQGQEVSKYQIEYS
                     TTAAKDKEASSPGSAGSGKGIIFSAEGIAIEANEYVEIEELEHQDATLRFPHPGWVEC
                     KPMNILANVVQCFAATLISINKVNDERVENNLPPYVIKCIGVTNMRETTIVWSKKTGL
                     PVVDYGIVWNDTRTMDIVNTKKSETPPEEQERLRAKTGLPPYSTYFSCSKLRWFLDNV
                     PEVLEAYESGDLMFGTVDTWLIYHLTGNHAFVSDVTNASRTGFMNLDTLDYDDELLEY
                     WGIDRSKLNMPKIVPSAQYYGDFCVPAVTKKKLTEAAWDVLTSFSQSGIPIQGCLGDQ
                     SSSLVGQMAFKAGSAKCTYGTGCFLLYNTGTKKLLSQHGALTTFGFWFPELEGSEASK
                     PHFVLEGSVAVAGSVVQWLRDNLRLFPRAEDVGPLASRVPDCGGVVFVPAFSGLFAPY
                     WDAAARGTILGMSQFTTASHIARAAIEGVCFQARAILKAMSSDAFGEGAKDHDFLEEI
                     VDTGTYEHSPLSVLAVDGGMSKSDEVMQIQADILGPCVKVRRSPTAESTALGAAIAAC
                     MAYKDPNERVWKDLNDAKKWIFYGGLEKEEALRTPDNVSSKLKIFASQSVDTVRRKNW
                     KRWEAAIERTKGWLHDAEGN"
     gene            <235420..>236850
                     /locus_tag="AGOS_ACL068W"
                     /old_locus_tag="ACL068W"
                     /db_xref="GeneID:4619456"
     mRNA            <235420..>236850
                     /locus_tag="AGOS_ACL068W"
                     /old_locus_tag="ACL068W"
                     /product="ACL068Wp"
                     /transcript_id="NM_208689.2"
                     /db_xref="GeneID:4619456"
     CDS             235420..236850
                     /locus_tag="AGOS_ACL068W"
                     /old_locus_tag="ACL068W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL043W (FPS1)"
                     /codon_start=1
                     /product="ACL068Wp"
                     /protein_id="NP_983336.2"
                     /db_xref="GeneID:4619456"
                     /translation="MSGKHKTEQGFAQDLEQQGPPHHGHRSEYVTGEFVESGAPFVMQ
                     EVVANSGAVVSNLRQQELANARAKPHGEHVNERDYDDLMSASMVVKPKPLHQNPQTPT
                     VLPSNYQPINAWSQFKATYLREFFAEFLGTMVLVFFGDSVVVQTRMSSTARVTAFLGQ
                     LESNGLSGSPVEYMRHLVTPDVAGSSISVNLCWASGVVMGYYAAGGPAITGAHMNPAV
                     TLANYCFRGLPAVKVLIYWAAQMLGGYMGGLTVFWYYARVIKTTFPDWKTNESVIGCF
                     STVPLPYLDSNRQFISEFVIGALLIGLIFALTDPYTCLTTDFFPIMLFLLIFSLLACG
                     SYQTGAILNPARDIGPRLAMWTVGFSRKALWEDHHHYFWVALVGPCVGGLVGALIYDL
                     LIFQGHESPVNQPAAHVLKRLKTRFTSFGRKTASTGEYTFSDKELTDVSSNNASGKNI
                     NFRSVTRGESTNGVPTIYSQSNDPKK"
     gene            complement(<237012..>237671)
                     /locus_tag="AGOS_ACL067C"
                     /old_locus_tag="ACL067C"
                     /db_xref="GeneID:4619457"
     mRNA            complement(<237012..>237671)
                     /locus_tag="AGOS_ACL067C"
                     /old_locus_tag="ACL067C"
                     /product="ACL067Cp"
                     /transcript_id="NM_208690.2"
                     /db_xref="GeneID:4619457"
     CDS             complement(237012..237671)
                     /locus_tag="AGOS_ACL067C"
                     /old_locus_tag="ACL067C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL031C (GOS1)"
                     /codon_start=1
                     /product="ACL067Cp"
                     /protein_id="NP_983337.2"
                     /db_xref="GeneID:4619457"
                     /translation="MASFVTVRGKAISLESQCDSLLSRYSSYAQSTSSEADSKERGLA
                     EKLESVLKERQGVIEELQRICDDTTSIGSSKLSQLQRHREVLQQHWQTFQSIRSSIQQ
                     ERSRLNLLFSVKRTLEQSELEEQPQEEQYAAAETRRIEESHNVLDRLISQAFETRDRF
                     AEQRFSLQRANDRVYQTLQRIPGINHVLSQITIRRRKNAMILALTMTICIVLLYWNMV
                     G"
     gene            complement(<237760..>238272)
                     /locus_tag="AGOS_ACL066C"
                     /old_locus_tag="ACL066C"
                     /db_xref="GeneID:4619458"
     mRNA            complement(<237760..>238272)
                     /locus_tag="AGOS_ACL066C"
                     /old_locus_tag="ACL066C"
                     /product="ACL066Cp"
                     /transcript_id="NM_208691.2"
                     /db_xref="GeneID:4619458"
     CDS             complement(237760..238272)
                     /locus_tag="AGOS_ACL066C"
                     /old_locus_tag="ACL066C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL042C (ATG10)"
                     /codon_start=1
                     /product="ACL066Cp"
                     /protein_id="NP_983338.2"
                     /db_xref="GeneID:4619458"
                     /translation="MLSAEDFSDQVLRLLPLLRRWRRCEHALWDPRARRLQLSVATAR
                     NSARFDVRVDLHPLYAVPQLLLRYWEPDPAVSEYEVWKLHFVDPYQLPLWQPGRFSIA
                     LDQVPATSGSAYETWYVVNSCDTDANVGPETDNYMLRWFSLYGQLLDENLGFTLAAAL
                     VAPCTDQKKA"
     gene            complement(<238400..>239185)
                     /locus_tag="AGOS_ACL065C"
                     /old_locus_tag="ACL065C"
                     /db_xref="GeneID:4619459"
     mRNA            complement(<238400..>239185)
                     /locus_tag="AGOS_ACL065C"
                     /old_locus_tag="ACL065C"
                     /product="ACL065Cp"
                     /transcript_id="NM_208692.1"
                     /db_xref="GeneID:4619459"
     CDS             complement(238400..239185)
                     /locus_tag="AGOS_ACL065C"
                     /old_locus_tag="ACL065C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL041C (SDH2)"
                     /codon_start=1
                     /product="ACL065Cp"
                     /protein_id="NP_983339.1"
                     /db_xref="GeneID:4619459"
                     /translation="MVFRAGIGRIGLIRGLATQAAEVSATRYKSFKIYRWNPDTPAEK
                     PRMQEYKVDLNKCGPMVLDALIKIKNEQDPTLTFRRSCREGICGSCAMNIGGRNTLAC
                     LCKIDQAENKDVKIYPLPHMYVVKDLVPDLTNFYKQYKSIQPYLQKASKPADGREHLQ
                     SIADRKKLDGLYECILCACCSTACPSYWWNNEQYLGPAVLMQAYRWMVDSRDGAGAGR
                     REQLQNAMSVYRCHTIMNCTRTCPKGLNPGKAIAEIKKALAFA"
     gene            complement(<239883..>249233)
                     /locus_tag="AGOS_ACL064C"
                     /old_locus_tag="ACL064C"
                     /db_xref="GeneID:4619460"
     mRNA            complement(<239883..>249233)
                     /locus_tag="AGOS_ACL064C"
                     /old_locus_tag="ACL064C"
                     /product="ACL064Cp"
                     /transcript_id="NM_208693.2"
                     /db_xref="GeneID:4619460"
     CDS             complement(239883..249233)
                     /locus_tag="AGOS_ACL064C"
                     /old_locus_tag="ACL064C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL040C (VPS13)"
                     /codon_start=1
                     /product="ACL064Cp"
                     /protein_id="NP_983340.2"
                     /db_xref="GeneID:4619460"
                     /translation="MLESLAAGLLNRFLGSYVENFDPKQLNVGIWSGDVKLRNLKLRK
                     ESLDALNLPIDVEFGFLGDLTLSVPWSNLKNEPVKIIIEDVYVVCRPGDIWDVPPEDQ
                     AERELRAKLQKLERLEAINQSRMEAQGETSKDVSFTQSLLTKIVDNLQITILNIHVRY
                     EDTRCVFSEKPYTIGATLSELSAMSTDANWKPSFISITQAITHKLMNLDSICVYWNTD
                     NRSILDEDQDVVIANMKSCIASGDNVPEHQFILRPVSGTGKLTLNKQGSTEEQAHIVA
                     QLFFNEFGVELDDCQYQELLHTMSMFHWYQKTVKYKRHRPSFTPSEKPREFFRYIAEC
                     VLSEIHDRNYKCSWAYIKERRQKRNAYVELWKRKLKFGGPELPLPDAKDEEALSNLHR
                     ELSYDDIKFFRALARRECAKDKIKEESESPEPVLKESTPGSWFSSWWGSSNNQNNEPV
                     LSITEEQKKELYEAIEFDENKEILDAIDLPRDRVKMRITNLLKKGSLVIKHRSKKYKL
                     CEVVFEQCSAEFLQRSDSFLAKFDLHEMRVEDGSPDTLYKHILSVSDHYTDRSSRAAS
                     PSEPFFQLVFENNPLDESADTYVNIKLGSMLVFYHTAYLNELLKFFNPPKKHWDTITA
                     IMSAAEATVEGWTTQTRLGLQALLEEHKTLNLVFDASSTTFIIPLDPQEWSSPCAVLD
                     AGEMHIVSDLVPKERIREITNMSVEEYNKKSSNQLKRLMFDRFHLYLRDTQFLIGPDV
                     KSTISSLSVKRKDNHFCILDRMALEFIVDVSIFPKALNLPRVKTSGKLPKIHLYLNDY
                     QYKILMQLLDKCIPNLEVADEGEPEATHDQYVFLDEFRQHRFTGRDKEVSVLKQTESR
                     LAQMTIAELNQPVFELDLKVDSAQLSLQKCVDGTTMKSQKLVQFYGKDLLMEFKSMAK
                     EMHLDLHLNSLDLEDHIEGSNVPEFRKLATSYNIPDKATKDIFQMSYHKTQRIVSYEG
                     TLIEVFDRDVNITMAALKFVLTPTSVLTMINYALNTFTDPTAELPEDVLRHNEADTID
                     APGKINMKLSMDGITVLLNDDSILLATLELSAAELFVLLLPESMKATAKIGGLQLIDK
                     ISEGLPTDSIFRQLITVNGDELVELVYETFDPTNNPHEYTSKLDYRTGSMTINIVEHS
                     LHKIINYLAKFQKMKGLFDRARLAAYDQAGSLDAVNNMKLNVFVNAPVIRFPKSVDPK
                     TGTYDDVTFFLGQLFIENVFVKGSNGLVNKLKAGIRRGKFTSLFNLENSVTQKLYMMD
                     DLDIHFDIDNDPKAGSTDPVFKVRGYFEPFSTKITELQLKFMYLLSTRLAESFTIDEI
                     KETDDMEFAAINASSVIGPNAQYKASNDVFKVYKEAARPDPNGIFIDVAFDAPSVSLT
                     LFNQTADVQDVSEHGITEIKLHDFGIKMHMSHVGNLKSEVHIAAFTVEDIRTSKDNKH
                     TMLIPKIEGDNYQFMGFLNRTFMDSTELIDIAITVDSPKVILAMDYLFALKSLFDNAF
                     SVKAPSVVFENSDRKISVDGSTAVASVPDRDSLMKVQYSINVINSQVILLADPSKVDS
                     EAVVFAVGQLLLSDQNILSLSINNVGMFLCRMDTSNDDKIRLLDDCSSALIIDNRNST
                     KNRMLTEIQGSIGNLVMRLSLRDIRLAISIFNRAMALAKDNGLISEEDRDEQATLATR
                     YGRFSKDFKEKIKRYAPSIVSSVSALSRETGTFLPTPEVVLKAENMDINFSGMRLVLI
                     GDVHELPILDFNVKPFNIDAKDWSSNIDAVATVEAYTNVFNYSRSSWEPLIEAFPVTF
                     HATKGGDNDASFLFEIVSNKIAEVTLTSRTIALFSNISDSLFYPDDTNRVARGAEKPY
                     RILNDTGMDINVWIRDDNCAEGARQLTLLKNGEVIPWEFEDWRAVRESLDTDNSKNIL
                     QVELCDPKYKTIIEVDATEEGETLHKLYPPSNNIHNRLVTDLKLCDDNVKLITLRSSL
                     VFENSTYTPLQIKIGFNDEQVCVIEPGQKRSIPIDSVYHSRVLVRPLNDRQYKWSNSV
                     IYWEYLLRRGPQALFCEDEESDSTFHLEAEAKYDPNEPLLKAYPHMSVVISSPLIIEN
                     LLPFDMTFILFSRNTRAKNLKRLKKGEKVPIHDISLEDFLLFAVQPIDEGFKWSNEVI
                     INSPRNSEMKPETKVQLKHYSGQKVNLKLHYHQVEGMRAKLISVYAPYVILNKTERDL
                     YIEGDRQCGIMQAPAFIQDGKRVSKPKIFSFDRDDRNKNRARIRFKDTTASIPTSFEA
                     IGQAVDVTMDVPNKDKECNIGIYVTEGNGKYALSKVVEIQPRYIIRNKLDSDIVITET
                     EFVDGTCTLSPGSSMPLYKLRNVVNKQLRMKFLGNDSEWSQPFMIKDVGTTYVKVMRQ
                     VSGQILLKVDIYLDNATLFIEVDDANDKWPFSVRNFSDYEFIFWQRDPRIVDDDDDDV
                     DYHREFDSRGYAPLYYRVPPRSVMPYAWDYPSARQKKLVIHGKNRRREIDLNELGNLK
                     PMRLPGANKTDPPLIVDFNIVMDNGVQALVITNYNEELSLYKLRNHQSTSSSLSGSTN
                     NEGFEINENDNEIKMRVSVAFQGVGISLVNTERLQELLYISMKGLELRYNNSEIYQTL
                     TWKLKWIQVDNQLFGGIYQNVLYPTRIPNTTKEMNVHPALSGSISKVKDSTHSSLNFK
                     FATVLLQEMTLQLDEDFLFAVLDFFKIPGASWQRTIPDQLCQEVCELSEPRKTQSDLD
                     VYFEMLHIQPTLLHLSFVRTERINANSEDKKARGTSTIMFFLNVLTMALGNVNNAPIK
                     LSSLMMENVRVSMPTLLEVIQAHYGQQFFYQLHKILGSADFLGNPVGLFNTISSGVKD
                     LFYEPYQGYIMNDRPQELGISLAKGGLSFMKKSVFGLSDSFSRLTGSMAKGLSVATRD
                     SDFQDRRRLQQRQRGAVGFAASASSFMNTIGSGISGVALDPYKGASKEGTTGFLKGLG
                     KGIIGLPTKTAIGVLDLASNVSEGIRNTTTMMDGGHIDRVRLPRHVGLDKVIKPYNAH
                     EAQGQFWLKTANGGQFQSDQYVGHVVLRTEGNVALVSLSRILRISLSTREVLEQADFT
                     DVGGVRLSRNGLHVVLRKPMDHQLFFACTDAEERRYLYKTVAVAVTEFNQRYDSEL"
     gene            <249546..>255098
                     /locus_tag="AGOS_ACL063W"
                     /old_locus_tag="ACL063W"
                     /db_xref="GeneID:4619461"
     mRNA            <249546..>255098
                     /locus_tag="AGOS_ACL063W"
                     /old_locus_tag="ACL063W"
                     /product="ACL063Wp"
                     /transcript_id="NM_208694.2"
                     /db_xref="GeneID:4619461"
     CDS             249546..255098
                     /locus_tag="AGOS_ACL063W"
                     /old_locus_tag="ACL063W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL030W (ECM29)"
                     /codon_start=1
                     /product="ACL063Wp"
                     /protein_id="NP_983341.2"
                     /db_xref="GeneID:4619461"
                     /translation="MVYYAQLSEQQELDLVDKVELRFALAEEDSFERNLDTFLAPLVL
                     KLGSPHGAVRQAVLKTLGYVTGRLGTFKTMKLPVEKLLTQAEQPKLNPDADSTSVRLY
                     SLMFVSKGVERLDTEERWQLVPRVLRGYGTTPAAARPRVFVLLWKLLSDWQAPEPGTR
                     AADEARAAVQVDASVRELWMERFTQLFLLLPVRPTNGKIPRGYSCPGLAAEDVAFFTY
                     NAGVSFDADQLHRVREAIYRFVVDLFAPEDDRMLAQFLVVASVDATALSERAATNLRR
                     IRVPYEDRSFVAYLVGLFMGSKTGGAPPANHKLQEAILSVLNNSILATTLATEVPVLC
                     SIGLNSDFHKLRSLTLTFIQHIAKYNHSSLIQADAHSSGAYSTNIAALIRNNLHNEGW
                     PKLLLNRSTPNFNLSIQQRRSQYETLGEILKKDFSLVKDLSYIEFLIDSLKGDLPDFR
                     PSIQSALSSMAVHLPQLPSASKEKLKKILLQVMMEHPDQCDSPSDQEASMACKYIAIK
                     YCNAAFTFNDADARLINILGTARCNRFDVIEEAHKGLHPYWFRVSQSYAKGLGERRTN
                     APASDLKEIVFLPFEQLLDTVLKAIKGDNLQAIEECLNTAVRFSIQTIVSNATQGANT
                     VIVQDADWSLRIEKAIDMDKIVLKRVGEAIKGVTSSNYTNFLVLLSNELIKRNSNGQK
                     VSLYKYDDSIFGKALLFFLRNSSPDVIRQLNPIAGSLFSLLDNHRVTNENDLELTANL
                     YAILGAYDYSNLFQEKIADLTASASKQDMQLLLACSYLLPRLVLVDPQSASVLVMATS
                     RLLGLLLEQLQLPSYRKLTYRCLSQVLKFGLLNILPEEERRTHLDRVISNLKLKLTND
                     EDATALWGYLSLYISSEQDFHTMFRAIEDTHVSKHTEFLFTAGEALTVIVGGWANGWI
                     QQQLDVDISVRELETAFPPRYLSIGLTRLQELCNSSKPAHRRAGCMWLLSVVQYLGSS
                     EEVLSQCREIHMTFMKLLGDRDELVQDSASRGLSIIYELGGSDLQETMVKSLIRSFTD
                     SAATMNMTSGTMTEDTALFEPGLLDTGDGTISTYKDILNLANEVGDPALVYKFMDLAK
                     SSTLWSSRKGIAFGLGAIISKNTLNDMLSKNSQLSQKLVPKLFRYRFDPNENVSRIMQ
                     GIWDTLILETASTIKDFYPDIMNELLASMGNKEWRVREAGVNAIVDLIQSSSFEQYGS
                     QIQELWTMTFRVMDDIKDSVREAGLKLAKVLSKSLVATITSEVKQNLVDPDHILEILL
                     PFLLGPKGFNSSAEAVQKFALKTILELIEKAGPVMRKHGPKLVYELALSLSFMEPQVI
                     NYLSLNADKYSISAEEIDRQRAQALASSPIMTAIEKIVDMCDDSSVGPLVKTSSKVVR
                     KSVGLPSKVGSARILSLITQKYSLSMNSYSEKLLELCFGCFQDRNHASATAFTLPFAH
                     LFRVTSLDVRVKYATKLSELYFDTILAQLKSVIGVAIGALIKHAPTQFEQCASIFMPL
                     IFLAKHDPDESLSTLYANNWTEASKSSTGTMKLYLEEISNLASASMRSTSFSVRLMCA
                     RSICDVVGSVDSSIPNNQVQNLFDVLLESSKGRSWDGKNVVIEALVTLTEKAESFYVG
                     DNFLNNLVKKTLVTEISRNNVSYIRKIIGPYSLYLSHYYNSELAHKLQEAASTVLDSL
                     EDPDNHDLSETESNSGSTWQNRQEVNIKSSKANIEREEKRATVLRQLARAVTTDTQDT
                     DNTLAPFVLDTCLRTLNPTNYIVPTWRTSIATCEVACTMLENFHGTLSDTLINHFILF
                     WKTVYASSSTPETIESVKIQLIRFGAKLRDQDPSFANQIECELRELVLKDKSPVLLAA
                     LQATGIQP"
     gene            complement(<255355..>256503)
                     /locus_tag="AGOS_ACL062C"
                     /old_locus_tag="ACL062C"
                     /db_xref="GeneID:4619462"
     mRNA            complement(<255355..>256503)
                     /locus_tag="AGOS_ACL062C"
                     /old_locus_tag="ACL062C"
                     /product="ACL062Cp"
                     /transcript_id="NM_208695.1"
                     /db_xref="GeneID:4619462"
     CDS             complement(255355..256503)
                     /locus_tag="AGOS_ACL062C"
                     /old_locus_tag="ACL062C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL039C (UBI4)"
                     /codon_start=1
                     /product="ACL062Cp"
                     /protein_id="NP_983342.1"
                     /db_xref="GeneID:4619462"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
                     KSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST
                     LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK
                     QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKI
                     QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAL"
     gene            complement(<256805..>257509)
                     /locus_tag="AGOS_ACL061C"
                     /old_locus_tag="ACL061C"
                     /db_xref="GeneID:4619463"
     mRNA            complement(<256805..>257509)
                     /locus_tag="AGOS_ACL061C"
                     /old_locus_tag="ACL061C"
                     /product="ACL061Cp"
                     /transcript_id="NM_208696.1"
                     /db_xref="GeneID:4619463"
     CDS             complement(256805..257509)
                     /locus_tag="AGOS_ACL061C"
                     /old_locus_tag="ACL061C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL038C (ENT4)"
                     /codon_start=1
                     /product="ACL061Cp"
                     /protein_id="NP_983343.1"
                     /db_xref="GeneID:4619463"
                     /translation="MLLPDSVKYLGSSPTAAKVRKATDDNEFVGASSALISEITILTY
                     SCKTLLDVTRVLKKRLSGNANKSSHKNAVHILKALTLTNYLIANGSEDFVQWLQGCAV
                     LLRRLKDFTTGNERDSHMASQIRSFSLSLLELMQNPALLEDHRRSVVRFRSSISTPGY
                     KSDQRSQSLPGLPAPMRPQSPAAEFPCMVRHSIEHNYRSPSLGCLVEEDVSQMGTPTQ
                     APPYSGATLPTKDSYI"
     gene            complement(<257815..>259397)
                     /locus_tag="AGOS_ACL060C"
                     /old_locus_tag="ACL060C"
                     /db_xref="GeneID:4619464"
     mRNA            complement(join(<257815..259316,259385..>259397))
                     /locus_tag="AGOS_ACL060C"
                     /old_locus_tag="ACL060C"
                     /product="ACL060Cp"
                     /transcript_id="NM_208697.1"
                     /db_xref="GeneID:4619464"
     CDS             complement(join(257815..259316,259385..259397))
                     /locus_tag="AGOS_ACL060C"
                     /old_locus_tag="ACL060C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL036C (PRP19); 1-intron"
                     /codon_start=1
                     /product="ACL060Cp"
                     /protein_id="NP_983344.1"
                     /db_xref="GeneID:4619464"
                     /translation="MFCAISGKPPITPVVSPESKCVFEKRLIEQYIDEHGVDPISKTS
                     LTKDALIVIAQTPQQYALANAVNSATLNANYSIPNLLSTLQNEWDAVMLETFELRSQL
                     DMCKKELSSALYKCDAAIRVAARAKQESDELRHTLTELTEAVGGQAADAPPLPAELIT
                     AMAEDAQEYVQQTKERRKMKSQVVTAFALEQPVETACEVDRVFVNRLLDPEDRVTCIL
                     ARGKARLLNREGVLLLDDLPAELKIVFPVDRSGVVFSTDSQMGIYETSTKEFKIFGSP
                     TSSRIVDIQYSPFVAAEFLVTLNENHEIHYRNRDGSQIYRFVNGKVHFPDAGEPAQLQ
                     LHKDGLLIAYQPTFSTIAIFSVTAPKDPPIVIMPSSSTEESTGELVTFRFSPNGYWLY
                     VLTELAFLVYDLRKQPGTLAMNPLMLNSPAVAFDTDQTGKTLFLLSADGSLESYSYVK
                     SQNGWSRGICHSSDRLAPLDLVYLADKAGVFLQGFHALTDDQTDRYIPAWLRIE"
     gene            complement(<259734..>261095)
                     /locus_tag="AGOS_ACL059C"
                     /old_locus_tag="ACL059C"
                     /db_xref="GeneID:4619465"
     mRNA            complement(<259734..>261095)
                     /locus_tag="AGOS_ACL059C"
                     /old_locus_tag="ACL059C"
                     /product="ACL059Cp"
                     /transcript_id="NM_208698.1"
                     /db_xref="GeneID:4619465"
     CDS             complement(259734..261095)
                     /locus_tag="AGOS_ACL059C"
                     /old_locus_tag="ACL059C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL184C (STR3)"
                     /codon_start=1
                     /product="ACL059Cp"
                     /protein_id="NP_983345.1"
                     /db_xref="GeneID:4619465"
                     /translation="MRGGSQESRLVCVGEHGDQHGASVPALYQSTTFKQRTLDGQAYD
                     YTRSGNPTRTVAEGQVGRLYGVGPEQVMAVASGMTALDVVLRAVLRRGGRGTVIAGDD
                     LYGGTQRLLGLLAETGQARVVHVDTADTAAFCAAVAAAGEVACVLLESPTNPLMKVAD
                     VPALVAHVKAHAPGCRVVVDNTMMSGLNCNPLRLGADYVYESATKYLNGHHDIMAGVI
                     VAATRALAEEAYFVVNSVGAGLAPMDAWLLIRGLKTLSLRLYKQQHNAMVLAHWLREV
                     CGFRAVGGNHALQTRFVGLRSHPQHKLHRSFNRGPGAVLSIQTGDTALSERIVCSKKL
                     QFWGVTVSFGCVNSLISMPCRMSHASIDPELRKARQFPEDLIRLSCGVEDVEDLQQDL
                     LAALEDAGAVVVRDGGRTIVNRLNGHIGTHVSSSEQRCIYRDFFGDSSNPSLEVGSLV
                     AKL"
     gene            <261725..>264178
                     /locus_tag="AGOS_ACL058W"
                     /old_locus_tag="ACL058W"
                     /db_xref="GeneID:4619466"
     mRNA            <261725..>264178
                     /locus_tag="AGOS_ACL058W"
                     /old_locus_tag="ACL058W"
                     /product="ACL058Wp"
                     /transcript_id="NM_208699.2"
                     /db_xref="GeneID:4619466"
     CDS             261725..264178
                     /locus_tag="AGOS_ACL058W"
                     /old_locus_tag="ACL058W"
                     /note="NOHBY305; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0C17050g"
                     /codon_start=1
                     /product="ACL058Wp"
                     /protein_id="NP_983346.2"
                     /db_xref="GeneID:4619466"
                     /translation="MADKGLKVITIKDQSAVVLEDGTVYKVQHKRQRRVLNCMPCHKR
                     KVKCNRARPVCDHCEKNRYACAYFVNDRVSRGGQNKVPRESKLRLMRVIEQARRAVEQ
                     GAADEAGGGAAAGAGGAAEVVGGAAEGAALEQALEQALEQALEQALEQALERERHAEL
                     LEYYRVAVAPVLPLVDMEGYTRDAEAFWATWDGELDSERLDFLLLHMPLMYVSLKAQY
                     HETNGAQLVEEVCMYHGLIRQLYALYDFPNKFTMRSLTGNVLLNSAVENPNISSVAQL
                     ARLAQRLQLTADPEYVPGSREMADVQFRRIIFWQIFQLDTLTSLQNRLPPLLRYNECE
                     TSLPSEFDEGGKLNPNLCFLNAKYQFVILVNDVCRMDAALSRSVLSDKDLLEFRERVA
                     QLHALCANKASLLTDYSRRCAIQAPVASFTCWAIFMLNTFADRAVLLHQDMLLRTMAK
                     WKKQKDLESQLEQVPSSKFSDEFRIFHSIITDGGTSIAAYMKNISTSNACNTMSMLFP
                     ATLHCLQEFVNYYKGKHISSFNWLLLIGTLPMAAVTFALRTLMVDLIHARDSSGTISL
                     KTDLRFKLLYQVVTMIESRLQTSAAVYKSSLTLARLFLRLVLLKFGTPDDMERIQLNP
                     SVTNNISSQLPSPLPFSQQTAWPANVLKLTQNHSMPHTTALTVEQPLYGFSHNPRATQ
                     GQQEHFRSLQRHGTSELSVCNTDPQRALQGMPCTPLPTVQHTPPISGYSLDNNSDQRS
                     IWHDFPTPLSADDALSQAESMDHATELSHIRSEVERYVRLISASGKARDGESVSLDGT
                     YFQEFECTLLEVIQTTLSM"
     gene            <264936..>266498
                     /locus_tag="AGOS_ACL057W"
                     /old_locus_tag="ACL057W"
                     /db_xref="GeneID:4619467"
     mRNA            <264936..>266498
                     /locus_tag="AGOS_ACL057W"
                     /old_locus_tag="ACL057W"
                     /product="ACL057Wp"
                     /transcript_id="NM_208700.1"
                     /db_xref="GeneID:4619467"
     CDS             264936..266498
                     /locus_tag="AGOS_ACL057W"
                     /old_locus_tag="ACL057W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER130C"
                     /codon_start=1
                     /product="ACL057Wp"
                     /protein_id="NP_983347.1"
                     /db_xref="GeneID:4619467"
                     /translation="MTIYQQKSGVNLSYETLLSVGNSTANGSSSQLHQDLRLNFQLHQ
                     KDIEQEAMTNDLTGSTLNIPENHSITSCVVGAETPRDSDELPLTMDLLDEFLNLGAQQ
                     HTAPQQGKLPATQPRSYKQEPLANPLAPGTSSGQFNAHFHRQFQEQFQQHAALPPNQR
                     TCHYSYQQPQTSQSRLRNYSFAPPGRRLSITGYQSDKPIYYEYEFFGKQSAEEEDEAT
                     ANEDDTLTTDEEDLYNLSHLMASPGGKARKDSIFSDYGNEMVMPLPQAQQINMQVEDY
                     TPMVGMESMPQWRKMKDIFKWNLFGGGKVDSQPSPAEYIEMNEEEHHQPFRKRYFWSR
                     RPNTPAIQAESQEEASVNPSELVRSSSFDLPLTLECITPSSTDVTSSFTTNTSVTGNE
                     LTEPFSHPLKMEQAGIYFKEPLLKMAEQMSSFSSAPDPLDPGITKKRAGMPKTRGRKP
                     SPALDATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHI
                     KTHSNGATERKL"
     gene            complement(<266633..>267371)
                     /locus_tag="AGOS_ACL056C"
                     /old_locus_tag="ACL056C"
                     /db_xref="GeneID:4619468"
     mRNA            complement(join(<266633..267307,267369..>267371))
                     /locus_tag="AGOS_ACL056C"
                     /old_locus_tag="ACL056C"
                     /product="ACL056Cp"
                     /transcript_id="NM_208701.2"
                     /db_xref="GeneID:4619468"
     CDS             complement(join(266633..267307,267369..267371))
                     /locus_tag="AGOS_ACL056C"
                     /old_locus_tag="ACL056C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL183C (MND1); 1-intron"
                     /codon_start=1
                     /product="ACL056Cp"
                     /protein_id="NP_983348.2"
                     /db_xref="GeneID:4619468"
                     /translation="MPPKRAVVTLAEKKARVLKFFQEEHSIYSIKDLEKLIPKKCAGV
                     SSMLVKDIVQQLIDEDGLISVEKCGNVNVYWCFKNQLVGKMCTEMQAMKARSEESQVR
                     LQELQAAINSEKKHARAAAFRSEGVSYTRAALLTEHDELGRQLAALQSAYRKLEDTKW
                     DETKIDSYCRGVRSKLEQLDKITDNIEVIVSFLMRRHAVSRAELAAALDMPEEFEEFE
                     DLRKSLP"
     gene            <267927..>269342
                     /locus_tag="AGOS_ACL055W"
                     /old_locus_tag="ACL055W"
                     /db_xref="GeneID:4619474"
     mRNA            <267927..>269342
                     /locus_tag="AGOS_ACL055W"
                     /old_locus_tag="ACL055W"
                     /product="ACL055Wp"
                     /transcript_id="NM_208702.1"
                     /db_xref="GeneID:4619474"
     CDS             267927..269342
                     /locus_tag="AGOS_ACL055W"
                     /old_locus_tag="ACL055W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL181W (GTS1)"
                     /codon_start=1
                     /product="ACL055Wp"
                     /protein_id="NP_983349.1"
                     /db_xref="GeneID:4619474"
                     /translation="MRFKSSRTVERELKALVSSPENANRCGECGATYPTWCSVNLGAF
                     LCGRCAAVHRKVLTGEQGGPESHVKSLTLDRWTVDELEEITNSGGNRRNHHTWNVRNV
                     AFPYDGDDDRSRVEDFIRNKYIVGKFGQGGGRGSGYRPDSSSRRGHDEFADRRSRSAS
                     FSRSSNRSYSSLNSASPPRSGGIPLLTHRTVHDHEIGRYGSQLATMKSLGYSDTDAIV
                     EALVLSRGDINVALDILDKDAKLRKESPAPPPPPPRPTSPAASGTRSSPPKPQPAVFD
                     GFNGIQPQTTQAQTFDGGVQQYLDPVTGQIYVDQSQYLQAMQQQQLQQQQLQQQQLQQ
                     QQLQQQQLQQQQLQQQQLQQQLQFQQLQQQPTAVDKNALMALYSRPDLYSSPVEIRPD
                     NPQYAALQQQQQQQQQQLRLQQTMNQQQPMLFAQQMPQQMPQFPQQYPQQFPQQYQQS
                     NQGTQPPTASQGAYPGYNYQM"
     gene            <269705..>272623
                     /locus_tag="AGOS_ACL054W"
                     /old_locus_tag="ACL054W"
                     /db_xref="GeneID:4619475"
     mRNA            <269705..>272623
                     /locus_tag="AGOS_ACL054W"
                     /old_locus_tag="ACL054W"
                     /product="ACL054Wp"
                     /transcript_id="NM_208703.1"
                     /db_xref="GeneID:4619475"
     CDS             269705..272623
                     /locus_tag="AGOS_ACL054W"
                     /old_locus_tag="ACL054W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL180W (ATG1)"
                     /codon_start=1
                     /product="ACL054Wp"
                     /protein_id="NP_983350.1"
                     /db_xref="GeneID:4619475"
                     /translation="MNNVKSGGRPVAIVAERYVVEKEIGRGSFAVVYKGHLADSSAGN
                     VAIKAVSRSKLRNKKLLENLEIEIAILKKIKHPHIVGLLECERTGTDFYLMMEYCALG
                     DLTFFIKKRRSLMDKHPLVRTLFEKYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSK
                     NLVHRDIKPQNLLLSTPLVDYNDPAEFHARGFVGIYNLPILKIADFGFARFLPNTSLA
                     ETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEMCCGKPPFKASNHLELFQKIKKA
                     NDVIQFPKHAALESAMVDLICGLLTFEPAKRMGFTEFFSNGLVNEDLSPYEVESEPDL
                     ETKSKNVAESNMFISEYLPTAERNKRASPIRLGDSCTLRGPCESPQGADPYPQDNTQS
                     DQHEHLHADYSFQVEMGQDGQQADGEEKRKLYNNQEERSNEERQFGQVSNGRNQEDQL
                     LLHQGRGQIPCEQNRQALQSHSHVAAKQIPDKDSKSSVSCQKHAASAPTKNDHRTTRL
                     KEKTKCSYSDLLLEKEYVVVEKKSVEVNALADEFAQAGSGAPAIRLPDQHHNDASQAL
                     QMARHSSTSVSAANTAKQTLLRRNSRTLSSSGASTSRRPSLVDRRLSITSLGATNALS
                     KALGMASLRLFGNSHQQSSNGSSTFKQNPNVTSLLSPQTFQDMTENAVLSADHQWDNS
                     RQADVLHDDSIMKALENLTAKVYAIYSFAEVKFSQIIPLPPSSTQDPYTHKRMSNGSC
                     AIDDEEDDIEHSPGAETYRKNSSGANANTGNYNFSLDTIHEMNLNDLPPNDLYILCTE
                     AIVLYMKSLSLLAYAMHLTSKWWHESADKICPLKLNLLVQWIRERFNECLEKAEFLRM
                     KTQSIQLHNGNQLSASTMVSEPVFVEKLIYDRALDISKTAAKMEMQGEYLEGCEVAYS
                     TSLWMLEALLDDVSDEDNYNDDNLGHTGVLDKSDKEVIKRYIDSIANRLKALRRKLSR
                     "
     gene            complement(<273165..>276710)
                     /locus_tag="AGOS_ACL053C"
                     /old_locus_tag="ACL053C"
                     /db_xref="GeneID:4619476"
     mRNA            complement(<273165..>276710)
                     /locus_tag="AGOS_ACL053C"
                     /old_locus_tag="ACL053C"
                     /product="ACL053Cp"
                     /transcript_id="NM_208704.2"
                     /db_xref="GeneID:4619476"
     CDS             complement(273165..276710)
                     /locus_tag="AGOS_ACL053C"
                     /old_locus_tag="ACL053C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER129W (SAK1) and YGL179C (TOS3)"
                     /codon_start=1
                     /product="ACL053Cp"
                     /protein_id="NP_983351.2"
                     /db_xref="GeneID:4619476"
                     /translation="MNNNQEPTESEGVAAAGGPNLEISRGEHGEPTCMPGKVEGYEAD
                     ELSSSDSLNLLLERQRERQLNHPLHQNHIKAAHVQPGGRKVKETHKISLEYDPISKRK
                     VLNTYEIIRELGSGQHGKVKLALDLVTKQHVAIKIVDRHGKKKSSWKLKKTPVREESE
                     KIRREIAIMKKCDHEHVVKLIEVLDDMKSRKIYLVLEYCSKGEVKWCPGDQLEAAARG
                     PPLLTFQRTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSEHDIVKISDFGVSLASS
                     NSGTPSSRSSSSSSVKGVLGAEGPDDLELAKTAGTPAFFAPEICLGSDAYEKLNIDRQ
                     SNPCSGSLISYMIDIWALGVTLYCLLFGKLPFIAEYEMELFEKIVNDPLEFPRLEFMQ
                     SNGVSMISCKEEYLSAQDLLNKLLEKNPMQRINIVDIKAHPFVCWDFDHVDGLSGQRI
                     SMRQAEKQKFLRHQDEEYKQISVSHDEVDNAVNGIGKGLKKSQIDTLFDSGVVKNKPL
                     LNPTSVIDACALLKKPKTKDLKDRHSPTVFDSIRRETFSPTDIDSLNFILSEGSIANS
                     KDFLPGQPSTPSPLHQPPIQAELSARELFQRELQKFDNDRDPNSIVSLPVNSSFASLD
                     SFYIDNYAVNDTNVEAEFTPSFPTNDQRISSSYQQFTSSNLPHKGASALLSPFSNMNV
                     SGTPKAQDKILASPPPLSINTLQLDSKRNGRIPRVSSILSPQSTTTRSSSSAELSPAA
                     FASRFRMTPTAAIASSESAIRLDNRSQKSELATPRLSIGTNGTSQTILAKRYDSSRSL
                     ASQVTKSTPLKQGNPPLTKKIIFQELHGSDEEKDSITTDSAAYMSTESAGEYSYDGTK
                     SDTESLPFEFGIDSEHGSEISLRNVPAVGGIDSFCQPETLSASSASTASDADDDELVF
                     PPRHVGRSRRFSSSADNSSSRALGVSQPAISEEATDIAPASISGQLKASDSLSTLTQI
                     NSARTVNTPSGDGVNSVRLNTDPSYVLPVSQDVEDSIDVPAEVLHMIPELHKQDRGNM
                     DPVTQTGGVLTNSWLLPHTAAQATTQEAHVDQVLITSSQDHSHHLSSRDLLQSVLSSS
                     DTSRRSSLHGGTSVHSPTSTSAAQDESRLINAAKKLARIRKTDDSSGLTMSFRRQSLA
                     PEFRHKEAHSKSRSCSISLGQLDKRNNDTLGSPYN"
     gene            complement(<277079..>277693)
                     /locus_tag="AGOS_ACL052C"
                     /old_locus_tag="ACL052C"
                     /db_xref="GeneID:4619477"
     mRNA            complement(<277079..>277693)
                     /locus_tag="AGOS_ACL052C"
                     /old_locus_tag="ACL052C"
                     /product="ACL052Cp"
                     /transcript_id="NM_208705.1"
                     /db_xref="GeneID:4619477"
     CDS             complement(277079..277693)
                     /locus_tag="AGOS_ACL052C"
                     /old_locus_tag="ACL052C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER128W (VFA1)"
                     /codon_start=1
                     /product="ACL052Cp"
                     /protein_id="NP_983352.1"
                     /db_xref="GeneID:4619477"
                     /translation="MDKYAKRKVAARDAGGCLICDSRTVTVLHCAASGDWFFCCDLHL
                     QDNPQFAQPNYTPAYHAACRRVADLASRLAASEKAAAAGWDSWLGRFAASKKKPAVPA
                     KDGNVSAQGQDKTEDKEEKPAEVSAADLRREYERELATVATLRNKPATYTLSAVMLTS
                     RLERRTRVAARAERAREEEQAYSNTDPQQLLQTYHFPELPKPKR"
     gene            complement(<277785..>278801)
                     /locus_tag="AGOS_ACL051C"
                     /old_locus_tag="ACL051C"
                     /db_xref="GeneID:4619478"
     mRNA            complement(<277785..>278801)
                     /locus_tag="AGOS_ACL051C"
                     /old_locus_tag="ACL051C"
                     /product="ACL051Cp"
                     /transcript_id="NM_208706.1"
                     /db_xref="GeneID:4619478"
     CDS             complement(277785..278801)
                     /locus_tag="AGOS_ACL051C"
                     /old_locus_tag="ACL051C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER127W (LCP5)"
                     /codon_start=1
                     /product="ACL051Cp"
                     /protein_id="NP_983353.1"
                     /db_xref="GeneID:4619478"
                     /translation="MGELRQVLRQINESLSQTDAALDRLQQTYEAGPAADEAVTALAA
                     KSGTEAGSDKVSLLSLKNGSMLAYVSSLLLLVGEKLSPEGSTGERGRAGAIEQRVCLE
                     RGIKPLEKKLGYQLDKLTRAYVRLQKEHAAAAERARARSEADANADADSSDEEDEEAL
                     SYRPNAGALAAAAAPGGGRGDERGGTYKPPKIAAALPPQRGQHFEDRFNAQDHKDRSS
                     RSRMQAMDEFIREQADRPEWEASVGANIVDHGKGGIKSARDHDRDSEMTRFEEENFTR
                     LNSVGNKAEKRKAKQRERFAKVSMIGGEDFSIFSSKRRLEDSTARKAHKKPRSSWDRA
                     KKKL"
     gene            <279017..>279802
                     /locus_tag="AGOS_ACL050W"
                     /old_locus_tag="ACL050W"
                     /db_xref="GeneID:4619479"
     mRNA            <279017..>279802
                     /locus_tag="AGOS_ACL050W"
                     /old_locus_tag="ACL050W"
                     /product="ribosome biogenesis protein NSA2"
                     /transcript_id="NM_208707.1"
                     /db_xref="GeneID:4619479"
     CDS             279017..279802
                     /locus_tag="AGOS_ACL050W"
                     /old_locus_tag="ACL050W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER126C (NSA2)"
                     /codon_start=1
                     /product="ribosome biogenesis protein NSA2"
                     /protein_id="NP_983354.1"
                     /db_xref="GeneID:4619479"
                     /translation="MPQNEYIEQHIKKHGRRLDHEERKRKREAREAHKISEKAQKLTG
                     WKGKQFAKKRYAEKVAMRKKIKAHEQSKLKGAAKPLEDSGEALPAYLLDREQANSAKA
                     ISSSIKQKRLEKADKFSVPLPKVRGISEEEMFKVVKTGKSKTKSWKRMITKHTFVGEG
                     FTRRPVKMERIIRPSALRQKKANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKG
                     TIIEVNVSELGMVTSGGKVVWGKYAQITNEPDRDGCVNAVLLV"
     gene            <279887..>280492
                     /locus_tag="AGOS_ACL049W"
                     /old_locus_tag="ACL049W"
                     /db_xref="GeneID:4619480"
     mRNA            <279887..>280492
                     /locus_tag="AGOS_ACL049W"
                     /old_locus_tag="ACL049W"
                     /product="ACL049Wp"
                     /transcript_id="NM_208708.1"
                     /db_xref="GeneID:4619480"
     CDS             279887..280492
                     /locus_tag="AGOS_ACL049W"
                     /old_locus_tag="ACL049W"
                     /note="NOHBY304; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACL049Wp"
                     /protein_id="NP_983355.1"
                     /db_xref="GeneID:4619480"
                     /translation="MASARSGYAVIITASKTGLGLSRAQKTARTHAPLVAQLPPDVCS
                     AETAPHLPPSFVDSGIHRAAGRHARAGPSFNSDSHCARYTSHAPAAPAISRRPRPLRS
                     GRPPLRDARGPRPGCSASGPSCLATRLPATKTTYREELAYIAHQTASQTNPAGRLRFR
                     SMQGRRASSTRPPGRSVPEASRLRKLSNAKLLVVFGTVSLV"
     gene            <280762..>282663
                     /locus_tag="AGOS_ACL048W"
                     /old_locus_tag="ACL048W"
                     /db_xref="GeneID:4619481"
     mRNA            <280762..>282663
                     /locus_tag="AGOS_ACL048W"
                     /old_locus_tag="ACL048W"
                     /product="ACL048Wp"
                     /transcript_id="NM_208709.2"
                     /db_xref="GeneID:4619481"
     CDS             280762..282663
                     /locus_tag="AGOS_ACL048W"
                     /old_locus_tag="ACL048W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL067C"
                     /codon_start=1
                     /product="ACL048Wp"
                     /protein_id="NP_983356.2"
                     /db_xref="GeneID:4619481"
                     /translation="MRRNMSRRSSYNAELRHRMSVEEPKPPKQKYGRLMRWLHKVWDG
                     PAHPSDEVPTRYSRLGFIQSIDGVPRRLWRGVNKTGVKAIILVLYGCLWLAVGLGILY
                     PSLVALPYHKGSEGKTPVVALSCTSKLHWLGKNNDCDLNARRCRPSPNEEHIVRCPAL
                     CDHDGLLFSAIPVGDKLLKYTMHVVGGGSRADDARAITYPYRGDSTVCSSAMHAGLIS
                     PAYGGCVRVAMRGQQNSYPSRRGRTGWSANFDSFFPTSFEFLKLDGSQYGCRDPRVPF
                     TVCNMIFSLPVLYFYNMLVGFWVLMLAGYWTLVLAMDPPVFIDPNNRYSIYSLWSIGC
                     ERLLPLGFILYVMWRVAVRKLEGGPPLMRILLFYPLFWLGTLNNITFDRLPVDRLTPK
                     DLQERAGTAAAVFILGILIAVCVAVQAHAVWKAGRLRKYVVLYLGLVAGLVFLGLLPG
                     LNLRIHHYILGLLFLPGCATRGPSAYLFQGVLLGLVISGVGKWGFASIVETNLALARG
                     EAGFTDKPPTLNFDPAVPHAVSWTPRTEAGINGSKYDAFSLLVNDIEVYVGSNTTVDL
                     EVLSEENKEFGYMLRNATQGARAGPPLYIRVASRSQYDLHVRSDYTSAGVLDWSSGSW
                     TPPDNAVVT"
     gene            <282894..>285284
                     /locus_tag="AGOS_ACL047W"
                     /old_locus_tag="ACL047W"
                     /db_xref="GeneID:4619482"
     mRNA            <282894..>285284
                     /locus_tag="AGOS_ACL047W"
                     /old_locus_tag="ACL047W"
                     /product="ACL047Wp"
                     /transcript_id="NM_208710.2"
                     /db_xref="GeneID:4619482"
     CDS             282894..285284
                     /locus_tag="AGOS_ACL047W"
                     /old_locus_tag="ACL047W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL068C (SEC6)"
                     /codon_start=1
                     /product="ACL047Wp"
                     /protein_id="NP_983357.2"
                     /db_xref="GeneID:4619482"
                     /translation="MEATAAQKVLELVKDESSLADIARIKEQLVKEKSTVEYQLHKIS
                     KVRYEDVYNCLELVSSTTGSVQSLREKLRNVDRLSQENRSSSERYQIINDVTRIHELL
                     GRTSDIYNRIVKFTDFCGQIESYLDAEIGQDALESGCPRLLQIHYMLTCARDFQEQMT
                     VMANVSTEDVQRTMKKVFAKLPAQIEKFDKMLARIIFDLLEAVRTENKSLIIRVCKII
                     DYEDREDKRISKTREIIKTKELEMESNKIRKLPTKMSRIAEDSKSQENKYPTEQALFE
                     EIMNGTIQTRTLPRGYREFFFSTIRKSIAELFVDVRKEYAAEKQFDVLENLDWIFNEL
                     VIAKDHLCRLCPSEWDIFRVYYTAYYEELNGLITELINSEPESLYILSILDFDKNFTK
                     TLKKDFGFGKDEIVSIIGEEQKAQLLQDYLQLIVNKMREWLDNLEKAELQIFLERTTP
                     PHTDSENLLFLEGTKTCFQMFTQQVEVAAGSGQAKILVGVVERFCKLLFERQSHWMQA
                     ISSEVKKCLQYNHKYEKDPDNIAQEEECAGGLVEYLVAVANDQMKAADYAVAISQKYG
                     SMVSKVHERTITNRIEETLDGFAEVAKCSNSGLVALIFDDLRRPYAEIFSKAWYSGNQ
                     AQQIADTLYEYLADIRSQMNPFVYSTLVESVIEETILQFLAALHHGHAFRNKQNKFLD
                     CMKRDFEIFYKLFVQFVSDEDKLLIDDKFKLMEFFMDFACSPLDVVPDTWAQCLHVYW
                     DTPAALLQAVLACRKDVDSPTAKRLLADAQAAAADPKRLATLKNQDLQPTFISRFT"
     gene            complement(<285294..>285635)
                     /locus_tag="AGOS_ACL046C"
                     /old_locus_tag="ACL046C"
                     /db_xref="GeneID:4619483"
     mRNA            complement(<285294..>285635)
                     /locus_tag="AGOS_ACL046C"
                     /old_locus_tag="ACL046C"
                     /product="ACL046Cp"
                     /transcript_id="NM_208711.2"
                     /db_xref="GeneID:4619483"
     CDS             complement(285294..285635)
                     /locus_tag="AGOS_ACL046C"
                     /old_locus_tag="ACL046C"
                     /experiment="RACE determination of 5' region of mRNA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER071C (TDA2); Newly annotated start codon"
                     /codon_start=1
                     /product="ACL046Cp"
                     /protein_id="NP_983358.2"
                     /db_xref="GeneID:4619483"
                     /translation="MAHVDGEYSVQRGAFGAEAPLTEERLVSLVEQAFEGNGQLGECV
                     EDAVTRLAAASSQHKFVVTATEIRGAGAAGQTLQSHAGAAWDGKRDGAHSVRVQRAGS
                     EVLVTVVWLAR"
     gene            <285773..>286141
                     /locus_tag="AGOS_ACL045W"
                     /old_locus_tag="ACL045W"
                     /db_xref="GeneID:4619484"
     mRNA            <285773..>286141
                     /locus_tag="AGOS_ACL045W"
                     /old_locus_tag="ACL045W"
                     /product="ACL045Wp"
                     /transcript_id="NM_208712.1"
                     /db_xref="GeneID:4619484"
     CDS             285773..286141
                     /locus_tag="AGOS_ACL045W"
                     /old_locus_tag="ACL045W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER072W (VTC1)"
                     /codon_start=1
                     /product="ACL045Wp"
                     /protein_id="NP_983359.1"
                     /db_xref="GeneID:4619484"
                     /translation="MSSTPLLQKAPGKRIALPARVEPKVFFANERTFLSWLSFTVMLG
                     GLGVGLLNFGDRVGRISAGLFTLVSMGTMLYALVTYHWRAAAIRRRGAGPYDDRLGPT
                     VLCFFLLAAVVVNFVLRLSQ"
     gene            <286310..>287851
                     /locus_tag="AGOS_ACL044W"
                     /old_locus_tag="ACL044W"
                     /db_xref="GeneID:4619485"
     mRNA            <286310..>287851
                     /locus_tag="AGOS_ACL044W"
                     /old_locus_tag="ACL044W"
                     /product="ACL044Wp"
                     /transcript_id="NM_208713.1"
                     /db_xref="GeneID:4619485"
     CDS             286310..287851
                     /locus_tag="AGOS_ACL044W"
                     /old_locus_tag="ACL044W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER073W (ALD5)"
                     /codon_start=1
                     /product="ACL044Wp"
                     /protein_id="NP_983360.1"
                     /db_xref="GeneID:4619485"
                     /translation="MLATAQVRTLRALVRCYSSLPLTVQVRLPNGNSYEQPTGLFIDG
                     KFVPSHQAKTFEVIDPGTEEEITHVYEAREEDVDAAVAAAKRAFLPWSRADPEVRAQC
                     LFKLADLIEKHQETLANIESLDNGKSLLCSRGDVALVARYLRTCGGWADKIYGNVMET
                     GPDHFSYTRREPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAESTPLSALYV
                     CNLANEAGIPKGVMNIVPGFGKIVGEHLCTHPDVKKVAFTGSTATGRHIMRTCAETVK
                     KVTLELGGKSPNIVFADADIDKAVKNIGFGIFYNAGEVCCAGSRVYVQDSVYDEVLEK
                     FKQFSENLKVGNPFEEGVFQGAQTSQMQVDKILSYVDIGVKEGARIVAGGERLGRKGF
                     FIKPTIFADVNENMRVVKDEIFGPVVTVSKFSTVDEVIAMANNSQYGLAAGIHTTDIN
                     KAIDVSNQIKAGTVWVNTYNDFHPNVPFGGFGQSGIGSEMGVQALDNYTQTKAVRMAI
                     DHVKV"
     gene            <288221..>288904
                     /locus_tag="AGOS_ACL043W"
                     /old_locus_tag="ACL043W"
                     /db_xref="GeneID:4619486"
     mRNA            join(<288221..288223,288500..>288904)
                     /locus_tag="AGOS_ACL043W"
                     /old_locus_tag="ACL043W"
                     /product="40S ribosomal protein S24"
                     /transcript_id="NM_208714.1"
                     /db_xref="GeneID:4619486"
     CDS             join(288221..288223,288500..288904)
                     /locus_tag="AGOS_ACL043W"
                     /old_locus_tag="ACL043W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL069C (RPS24B) and YER074W (RPS24A); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S24"
                     /protein_id="NP_983361.1"
                     /db_xref="GeneID:4619486"
                     /translation="MSDAITIRTRKVLTNPLLARKQFVVDVLHPNRANVSKDELREKL
                     AEAYKADKDAVSVFGFRTQFGGGKSTGFGLIYNSVADAKKFEPTYRLVRYGMAEKAEK
                     ASRQQRKQRKNRGKKVFGTGKRLAKKAARRNAD"
     gene            <289168..>289481
                     /locus_tag="AGOS_ACL042W"
                     /old_locus_tag="ACL042W"
                     /db_xref="GeneID:4619487"
     mRNA            join(<289168..289258,289321..>289481)
                     /locus_tag="AGOS_ACL042W"
                     /old_locus_tag="ACL042W"
                     /product="ACL042Wp"
                     /transcript_id="NM_208715.1"
                     /db_xref="GeneID:4619487"
     CDS             join(289168..289258,289321..289481)
                     /locus_tag="AGOS_ACL042W"
                     /old_locus_tag="ACL042W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER074W-A (YOS1); 1-intron"
                     /codon_start=1
                     /product="ACL042Wp"
                     /protein_id="NP_983362.1"
                     /db_xref="GeneID:4619487"
                     /translation="MIFGLGKLFYVILLLVNAVAVLSEERFLRRIGLGSKSNQPVFGQ
                     AENSTKSKLVHLISAVQTLLRIPLIGINILVILYELVLG"
     gene            complement(<289647..>291944)
                     /locus_tag="AGOS_ACL041C"
                     /old_locus_tag="ACL041C"
                     /db_xref="GeneID:4619488"
     mRNA            complement(<289647..>291944)
                     /locus_tag="AGOS_ACL041C"
                     /old_locus_tag="ACL041C"
                     /product="ACL041Cp"
                     /transcript_id="NM_208716.2"
                     /db_xref="GeneID:4619488"
     CDS             complement(289647..291944)
                     /locus_tag="AGOS_ACL041C"
                     /old_locus_tag="ACL041C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER075C (PTP3)"
                     /codon_start=1
                     /product="ACL041Cp"
                     /protein_id="NP_983363.2"
                     /db_xref="GeneID:4619488"
                     /translation="MVLKGGEYYRVGYGPGHKSTLSDSVSILSNSSTTAEEGGPGGPA
                     HAKTRSAGMVEGPAVPHGSSAYKVGVSAGGGLRFPLHAGCRTMDSRALGNMLNEDANT
                     VVVDTRPFVEYSKSHVRGALHVCLPSTLLRRKTFSLARLLENLPPGDRESVRERLREH
                     TQGERSLSIVIYDNLPMKGDGWSSLACAGLSAKFLENNWEAEGQNVPDVYILSDGYQQ
                     FQLQFAELSEALPASADDDLLCQPPGLCASASSLSTPSSFRGSPLEPLPSPLTTSPMS
                     QLFKFQLPTQRPLQNGSSHAFPRVFKMRHFEENSNLESYLGAVDINENRKLSEFDETS
                     DSNGTRFQQSFFKFPLKLSFQLEYAKITELYKQEEIDCVIPKWFQDLMLKPSKMQYVE
                     QFQRLDILERTRLDRILNTPFGDKINSVSTIPCDINDAELANYFDYDKEYDPEITISS
                     GVELGAKNRYKDVFPYEHTRVVLRRDSELRSTTVPFEKDSVIDTYINANYLTSPFDSG
                     KKSGSAGRYIATQAPLPETIHDFYTCIINNNVPVVLSLTDEFEHGIEKCCKFWADGEY
                     NGIVVSMLEEHKGEVLFIRRIKITYNDGKSSYELLQIQIKDWPDLGILDSPKDIIDMI
                     FLKDYVIQQLMSDGIFAEDEMPTVLVHCSAGCGRTGTLCTVDSVISNLTEIAHQSEQW
                     ASSKSTASGVFDPIVTIIDRFRKQRISMVQTITQYLFIYDCMLRYFKIRLETINEGSD
                     SNRVRSLIGEQDILGNFIRSKITAR"
     gene            complement(292553..292625)
                     /locus_tag="AGOS_t0049"
                     /db_xref="GeneID:4619489"
     tRNA            complement(292553..292625)
                     /locus_tag="AGOS_t0049"
                     /product="tRNA-Ala"
                     /codon_recognized="GCA"
                     /db_xref="GeneID:4619489"
     gene            293221..293294
                     /locus_tag="AGOS_t0050"
                     /db_xref="GeneID:4619469"
     tRNA            293221..293294
                     /locus_tag="AGOS_t0050"
                     /product="tRNA-Ile"
                     /codon_recognized="AUU"
                     /db_xref="GeneID:4619469"
     gene            complement(<293393..>294421)
                     /locus_tag="AGOS_ACL040C"
                     /old_locus_tag="ACL040C"
                     /db_xref="GeneID:4619470"
     mRNA            complement(<293393..>294421)
                     /locus_tag="AGOS_ACL040C"
                     /old_locus_tag="ACL040C"
                     /product="ACL040Cp"
                     /transcript_id="NM_208717.1"
                     /db_xref="GeneID:4619470"
     CDS             complement(293393..294421)
                     /locus_tag="AGOS_ACL040C"
                     /old_locus_tag="ACL040C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL175C (AIR2) and YIL079C (AIR1)"
                     /codon_start=1
                     /product="ACL040Cp"
                     /protein_id="NP_983364.1"
                     /db_xref="GeneID:4619470"
                     /translation="MSALSEVETHDGLTFMQGRLLSRQDDKQVAPSIDDVDNDPELLR
                     NLRGQGRYFGVEDDADAIHEAEAKCKNCSQRGHIKKNCPHVICSYCGLMDDHYSQHCP
                     RTMRCSHCNDSGHYRQNCPQKWKRIYCTLCNSKKHSRDRCPSVWRSYCLRGAKEKRVL
                     ASHKIFCYNCAGKGHFGDDCPQARSSRVPNDDGSAFSGDNLAGELRADYFTNLTKWHQ
                     EAREALDEQVDDYNINYDDYEIDEAQYSNSAGRKSKKRKRNPRNSQASAAPQRASLPA
                     PVSKGRTLNPPEGRRHPLDFPRNGPRGEKRIAGSRYGSPAPYHSDAVHKPYNPYQPFR
                     SGTLSRRR"
     gene            <294922..>297096
                     /locus_tag="AGOS_ACL039W"
                     /old_locus_tag="ACL039W"
                     /db_xref="GeneID:4619490"
     mRNA            <294922..>297096
                     /locus_tag="AGOS_ACL039W"
                     /old_locus_tag="ACL039W"
                     /product="ACL039Wp"
                     /transcript_id="NM_208718.1"
                     /db_xref="GeneID:4619490"
     CDS             294922..297096
                     /locus_tag="AGOS_ACL039W"
                     /old_locus_tag="ACL039W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL078W (THS1)"
                     /codon_start=1
                     /product="ACL039Wp"
                     /protein_id="NP_983365.1"
                     /db_xref="GeneID:4619490"
                     /translation="MCTAEAAQKVQNLSLDEKNAKKNKKQGNKNSAYLDPEPAFIDER
                     IQLFEKLQAEYNAKVASMPRAAISVVLKDGSEKPAVAWETSPMDIAQQISKSFADRQC
                     ISKVNGELWDLERPLEGSEGDHLKLEFFDFESNEGRRVFWHSAAHVLGEACECNLGAH
                     ICLGPPTDDGFFYEFACKDSMDPDAPERTVSQADFPNLETVAKQAIKEKQRFERLVMT
                     KEDLLKMFHYSKYKTYLVQTKIPDGGSTTVYRSGKLIDLCVGPHIPHTGRIKAFKLLK
                     NSSCYFLGDSENDTLQRVYGIAFPDKKLMDAHLKFLEEAAKRDHRKIGREQELFMFNE
                     MSPGSCFWLPHGTRIYNNLVELLRNEYRKRGYEEVITPNMYNSKLWETSGHWANYKEN
                     MFTFEVEKESFGLKPMNCPGHCVMFKSRERSYRELPWRVADFGVIHRNEFSGALSGLT
                     RVRRFQQDDAHIFCAQDQIETEIEGLFDFLKYVYGVFGFEFKLELSTRPENYVGDLET
                     WNNAEARLESALNKWGGDWEINEGDGAFYGPKIDIMISDALKRWHQCATIQLDFQLPN
                     RFELEYKGKGNDENAYERPVMIHRALLGSVERMTAILTEHYAGKWPFWLSPRQVLVVP
                     VGVKYQDYAQQIRDKLVGAGFYADADLGSNTLQKKVRTGQMLKYNFIFVVGEQEMNEN
                     SVNIRNRDVTDLQGKNETVDFDLVLKQLLKLKEEKRADNVLQ"
     gene            complement(<297187..>298167)
                     /locus_tag="AGOS_ACL038C"
                     /old_locus_tag="ACL038C"
                     /db_xref="GeneID:4619491"
     mRNA            complement(<297187..>298167)
                     /locus_tag="AGOS_ACL038C"
                     /old_locus_tag="ACL038C"
                     /product="ACL038Cp"
                     /transcript_id="NM_208719.1"
                     /db_xref="GeneID:4619491"
     CDS             complement(297187..298167)
                     /locus_tag="AGOS_ACL038C"
                     /old_locus_tag="ACL038C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL077C"
                     /codon_start=1
                     /product="ACL038Cp"
                     /protein_id="NP_983366.1"
                     /db_xref="GeneID:4619491"
                     /translation="MAPGDGIDGGGGGDEYIPRQGSPNDKALGSFTGYGTQQQAWYKS
                     AKRFYEKDSVLEPADREWLGQTYQSVARAHLWGRLVGFAAGFGADFAYQAMRLRSRQG
                     VNLSRSFLFGVAGTVVGTYQCGLYAYWRALESVAPVERYDDLEEDGGAAARRRRHEVL
                     QLLRDSMPAVWADYFNKTARDPSLRMPDPHVLWQGILRGERPNMPMYRHESLAQSPMA
                     RLTSPPDLRPVQHPAGPAPVEASARPANEDPFSAEITEPSNSLSAWDRVRQQNSIPQT
                     SGDSWDQVRRRSMGGFSGPAPPNTDREQNEFDELLNAERRGIWDEIDGPK"
     gene            <298389..>299252
                     /locus_tag="AGOS_ACL037W"
                     /old_locus_tag="ACL037W"
                     /db_xref="GeneID:4619492"
     mRNA            <298389..>299252
                     /locus_tag="AGOS_ACL037W"
                     /old_locus_tag="ACL037W"
                     /product="ACL037Wp"
                     /transcript_id="NM_208720.1"
                     /db_xref="GeneID:4619492"
     CDS             298389..299252
                     /locus_tag="AGOS_ACL037W"
                     /old_locus_tag="ACL037W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL076W (SEC28)"
                     /codon_start=1
                     /product="ACL037Wp"
                     /protein_id="NP_983367.1"
                     /db_xref="GeneID:4619492"
                     /translation="MDYFSVKQQFYTGNYRQALQEAEKHKTDDDTVVYYKSMAQLALK
                     EYSKGSGNAGLQAVFDAYVDCRESGALDKLKQAAEAHPGPYSANLVACAQAAGGDYEG
                     ALATCKDGDAAELVLTAVQAALLAGQQAAAAALFEAYVAAHEQAGEDEIVLNTAEAYL
                     NFARSREAMGSNFYFFEELCQTFPSWRSQLGLLNLHLQQAHLPEARAIIDLLEDEYYG
                     AMAGAAAFRADLLACKITYAAMNGDETAALRAELQELDAAHPLIQKHLENDASFDAIV
                     EKYSSSIQDAK"
     gene            <299410..>300279
                     /locus_tag="AGOS_ACL036W"
                     /old_locus_tag="ACL036W"
                     /db_xref="GeneID:4619493"
     mRNA            <299410..>300279
                     /locus_tag="AGOS_ACL036W"
                     /old_locus_tag="ACL036W"
                     /product="ACL036Wp"
                     /transcript_id="NM_208721.1"
                     /db_xref="GeneID:4619493"
     CDS             299410..300279
                     /locus_tag="AGOS_ACL036W"
                     /old_locus_tag="ACL036W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER083C (GET2)"
                     /codon_start=1
                     /product="ACL036Wp"
                     /protein_id="NP_983368.1"
                     /db_xref="GeneID:4619493"
                     /translation="MSEVSEAEKRRILREKRKQKFSKGAGSARLHKITTQQPGGASGD
                     STVTSAEISDNEGSLQRGSNSGQSTREIDDLLAAMDPPIEPAEPLESAAPEVAFIQQL
                     MKMQQGSATPPADEKAGGLFSPLLERLAEQEAGGAPVVSGEVGVHQFQVRQLKAYMLL
                     LRWAILLPFIYYVMHPGTAHWLHTSRFLHFVMEPRNFFMVFTTFEVASISIYYQVLLT
                     LERTNKVNSLSYSSKLVTWAGLVPDGMLPIDNLQGKVVVALHYWDILSMYLTDLSLCL
                     VAAGLMKYYHAAP"
     gene            complement(<300382..>301716)
                     /locus_tag="AGOS_ACL035C"
                     /old_locus_tag="ACL035C"
                     /db_xref="GeneID:4619494"
     mRNA            complement(<300382..>301716)
                     /locus_tag="AGOS_ACL035C"
                     /old_locus_tag="ACL035C"
                     /product="ACL035Cp"
                     /transcript_id="NM_208722.1"
                     /db_xref="GeneID:4619494"
     CDS             complement(300382..301716)
                     /locus_tag="AGOS_ACL035C"
                     /old_locus_tag="ACL035C"
                     /note="NOHBY303; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0C09240g"
                     /codon_start=1
                     /product="ACL035Cp"
                     /protein_id="NP_983369.1"
                     /db_xref="GeneID:4619494"
                     /translation="MSYKMFGRCRTACFRSPNLFAANKGMPLQASVAGGASRYIIGTA
                     SVLVGAMAGFYIMNSRSAIHEYVSCPLVRLVTPDAEDGHKLGIWFLKYGLAPKLMFDK
                     DDPVLKVEVFGKTMSNPIGCAAGLDKDGEAIDGIAQSGFGYVEIGTVTPLAQPGNPKP
                     RFFRLPMDEAVINRYGFNSSGHKKVYDNVLSRVRQFLGAYFRDDTVNSLALYKDKLLG
                     INLGKNKNGDEVEDYLRGVEKFQSLADVLVINVSSPNTPGLRDLQQEGRLTELLSMIV
                     AKRNSLINEGNVLGASTHKPPVLVKIAPDLTEPELQSIAEAAKKSSIDGIIVSNTTIQ
                     RPDSLYTVDEELKNQAGGLSGKPVKPFALKALRTIHQYTKDTNLVLVGCGGISSGQDA
                     IEFAKAGAHFVQLYTAYAYRGPGLIARIKDEVTEELRNEGKTWMEIIGQDAK"
     gene            <302398..>304050
                     /locus_tag="AGOS_ACL034W"
                     /old_locus_tag="ACL034W"
                     /db_xref="GeneID:4619495"
     mRNA            <302398..>304050
                     /locus_tag="AGOS_ACL034W"
                     /old_locus_tag="ACL034W"
                     /product="ACL034Wp"
                     /transcript_id="NM_208723.1"
                     /db_xref="GeneID:4619495"
     CDS             302398..304050
                     /locus_tag="AGOS_ACL034W"
                     /old_locus_tag="ACL034W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER082C (UTP7)"
                     /codon_start=1
                     /product="ACL034Wp"
                     /protein_id="NP_983370.1"
                     /db_xref="GeneID:4619495"
                     /translation="MAAKVDSKGDPVGRIAKTNAEKFQRGGGKINHKKIKDKKLRAGL
                     KRIDEQYKDAVAAAAATEYLLPESQGYLEAEDEMEKTFKVQQTEIKDSVDIGTANKAL
                     DLNLKEFGPYQAGYSRNGTHLLIAGRKGHVASMDWRKGELRAELHLNETVQAATYLQN
                     EQFFAVAQKKYTFIYDHEGVEMHRLKQHIEVKHMEFLPYHYLLATAGQTGFLKYQDVS
                     TGQLVAELRTKLGPTSSMAQNPWNAVMHLGHNNGTVTLWAPNMPTPLARILTARGPVT
                     GVAVDRQGYYMATTGADKSMRLWDIRNFKELHSVENLPIPASNVKISDMGLLAVSRGP
                     HVTLWKDAFKTSSDFKPVFTSSRLPNKNTPYMSHLFAGNKINSLAFVPFEDLLGVGHQ
                     TGVTNLIIPGAGEANYDALEVNPYETTKQRKEQEVRSLLNKLPADSIALDPNVIGTVD
                     KRSAQIRLTAKDLTQIATDEDMKSKENRDIPKANPAVKSKNSGLRTFLRKKTQNVVDE
                     RKLRVQKQLENEKEARLRKQQAARGELTEDKNLVDEALGRFS"
     gene            complement(<304168..>306960)
                     /locus_tag="AGOS_ACL033C"
                     /old_locus_tag="ACL033C"
                     /db_xref="GeneID:4619496"
     mRNA            complement(<304168..>306960)
                     /locus_tag="AGOS_ACL033C"
                     /old_locus_tag="ACL033C"
                     /product="ACL033Cp"
                     /transcript_id="NM_208724.1"
                     /db_xref="GeneID:4619496"
     CDS             complement(304168..306960)
                     /locus_tag="AGOS_ACL033C"
                     /old_locus_tag="ACL033C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL075C (RPN2)"
                     /codon_start=1
                     /product="ACL033Cp"
                     /protein_id="NP_983371.1"
                     /db_xref="GeneID:4619496"
                     /translation="MSVITAAPLLALLREDDHTVKSYALHSINEVVDQLWSEVSNDIT
                     DIEALYEDSKFEDRKLAALVVSKIYYNLGEYESAVRYALAAEEYFDINEKSRYVETIV
                     SQSIEMYIKLATENYGKEKSEIDLQLVSIFERMLNKCITAGEYKLALGIALESYRLDV
                     VTNILTQQTSEPNMLKLITYVLIAATTTVSNTHFKINILYALFDILIRLKAPDYFAVS
                     KIIVNLNDSKLAARLFDKLVSEKNTEIAYQIAFDLVTSASQGLLNELVATLSTGEGND
                     RLVEILSGLPTCDFYNTFLHANKRIDRSLLNKSKSSMDGKFSLFHTAVSVSNAFMHAG
                     TTDDTFVRANLQWLGKAQNWAKFTATASLGIIHQGNLTGGKKIMEPYLPGSRASSRYI
                     KGGSLYGLGLIYAGYGKEIIGYLKDQIVENSSNATDDDVDVLLHGASLGIGLAGMSSN
                     STEIFEALKEVLYADSANSGAAAALGIGLTMLGSGDETVAENLYTYAQETSHGEITKG
                     LAIALALLNYGREELADETIKKMLEHENDSMRYGAVYTIALAYAGTSSNEAVKKLLHV
                     AVSDSNDDVRRASVTALGFVLIRDYTTVPRIVELLSESHNPHVRCGTAFALGVACAGR
                     GLQAAIDVLEPLTNDPVDFVRQAAMIALSMILIQQTEKTNVKVRDVNEQLRNVIANKH
                     QEGLAKFGACVAQGIINAGGRNVTIQLENSEMGTLNTKSVIGLAMFTQFWYWFPLAHF
                     LSLSFTPTTTIGVRSHDLKIPKFSFHCHTKEGIFDYPPMFEEDIDKSIEKVATAVLST
                     TAKAKARAKKSKKDKAVEPDKSKEEIKVENEQRDKKEHDADVPEEEFKIKYTSTYYKV
                     ENMTRVVPQQLKYIAFPKDERFTPVRKFKGSNGVIVLSDKTPDEPVEVIKTVRQEKET
                     DAPLPAPFKVQDDLEF"
     gene            complement(<307190..>308602)
                     /locus_tag="AGOS_ACL032C"
                     /old_locus_tag="ACL032C"
                     /db_xref="GeneID:4619497"
     mRNA            complement(<307190..>308602)
                     /locus_tag="AGOS_ACL032C"
                     /old_locus_tag="ACL032C"
                     /product="ACL032Cp"
                     /transcript_id="NM_208725.1"
                     /db_xref="GeneID:4619497"
     CDS             complement(307190..308602)
                     /locus_tag="AGOS_ACL032C"
                     /old_locus_tag="ACL032C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL074C (SER33) and YER081W (SER3)"
                     /codon_start=1
                     /product="ACL032Cp"
                     /protein_id="NP_983372.1"
                     /db_xref="GeneID:4619497"
                     /translation="MTSPQQINNLQAAFQDALNMSGSPGVVSTSPTTSFMNTLPPRTS
                     VAKQAKALKPFSTGDIKILLLENVNQTAIDIFDKQGYQVEFHKSSLGPEELIEKIRDV
                     HAIGIRSKTKLTPEILKHAKNLVCIGCFCIGTNQVDLDYAAKMGVSVFNSPFSNSRSV
                     AELVIGEIISLARQLGDRSIEMHTGTWNKVSHHCWEVRGKTLGIIGYGHIGSQLSVLA
                     EAFGMHVLYYDVVTIMALGTAKQVATLDELLNNSDFVSLHVPATDETKNMISAPQLAA
                     MRNGAYLINASRGTVVDIPSLIQAMKAGKIAGAALDVFPHEPAKNGSGAFGNQLSPWI
                     SDLVSLPNIILTPHIGGSTEEAQSAIGVEVATSLSKYINDGTSVGSVNFPEVSLRSLD
                     LDQENTVRVLYIHQNVPGVLKTVNNILSDHNIEKQFSDSSGDIAYLMADISNVNYSDI
                     KDIYDKLNATEYKISIRLLY"
     gene            complement(<309371..>311215)
                     /locus_tag="AGOS_ACL031C"
                     /old_locus_tag="ACL031C"
                     /db_xref="GeneID:4619498"
     mRNA            complement(<309371..>311215)
                     /locus_tag="AGOS_ACL031C"
                     /old_locus_tag="ACL031C"
                     /product="ACL031Cp"
                     /transcript_id="NM_208726.2"
                     /db_xref="GeneID:4619498"
     CDS             complement(309371..311215)
                     /locus_tag="AGOS_ACL031C"
                     /old_locus_tag="ACL031C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER080W (AIM9)"
                     /codon_start=1
                     /product="ACL031Cp"
                     /protein_id="NP_983373.2"
                     /db_xref="GeneID:4619498"
                     /translation="MLRHSLRSASKLQSKNVRLLRAAPLLLKRSLSNDPKEVFTKLTD
                     ENDPQRDAFFKYGWGSWLKNDKQEKEKRVTRFSIEGLNKVLSDLHEQSAQADKTAKTD
                     AVPPPSYNPNLTVSLPHNVTSKHLGTPKRGESVRVVSMASFHEGKHHRIYKIDTNAGK
                     SFVLRIPYGIDEENTLAYRVKSEVATMDFADLKLGMNVPKVFCFGVNALNPIRQPFIL
                     EEYVPGRLLMKDWMPLASDSADGSHKEKLNSVIQPISEFQAKLAETEFTAFGSLYFAK
                     DYRESNEPAYKSDTDGDLADRWRIGPSVERCFWRKKSALPFEQRKQYLGPWTISQPLD
                     IVKSLGSLEAENARARLAIKQADASPEAEIDEQVLRDQITAFENLAKLAPVMYNLKTK
                     SIPNMDAIVKPRLCHPDLDPMNVILHEENGKPYLLDFEGTTVKPFILHNNPQFVAYDG
                     PKIYDLERDVENYSKLNAQEKDQYEFMYKRTRNQYLWESQLNQNAKHLISSIAPLVKL
                     LRSPYVYAVQRKYDQEYLLIDEALVQLKEVWELFAKNELTNSEQFPVEFTEEWLRQHA
                     EKLNAYHEKLIAEPFSATQGWMPQDLFDNLVKSGVLVKDANGDHSLKQ"
     gene            complement(<311596..>312195)
                     /locus_tag="AGOS_ACL030C"
                     /old_locus_tag="ACL030C"
                     /db_xref="GeneID:4619499"
     mRNA            complement(<311596..>312195)
                     /locus_tag="AGOS_ACL030C"
                     /old_locus_tag="ACL030C"
                     /product="ACL030Cp"
                     /transcript_id="NM_208727.2"
                     /db_xref="GeneID:4619499"
     CDS             complement(311596..312195)
                     /locus_tag="AGOS_ACL030C"
                     /old_locus_tag="ACL030C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER079W"
                     /codon_start=1
                     /product="ACL030Cp"
                     /protein_id="NP_983374.2"
                     /db_xref="GeneID:4619499"
                     /translation="MSPHPPSRDISTLSLFDCNNSETPTDNISTRALYEVNLDDELQY
                     PPVSRPLSRSSVTSGLSMVATKDGVEGRRVPRHGITQYSVNLANSMNAAAHWKKAHPE
                     EPCKDFPNGPSLTLKEKMRLFNEDRPSQSNCDSLDSFADTNFSGSARYQLNIHRLNSE
                     LESNTSTLGDDTSYLYDMRSIPAAVSITDSEKDSTSSRH"
     gene            <312952..>314694
                     /locus_tag="AGOS_ACL029W"
                     /old_locus_tag="ACL029W"
                     /db_xref="GeneID:4619500"
     mRNA            <312952..>314694
                     /locus_tag="AGOS_ACL029W"
                     /old_locus_tag="ACL029W"
                     /product="ACL029Wp"
                     /transcript_id="NM_208728.1"
                     /db_xref="GeneID:4619500"
     CDS             312952..314694
                     /locus_tag="AGOS_ACL029W"
                     /old_locus_tag="ACL029W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL072W (HOP1)"
                     /codon_start=1
                     /product="ACL029Wp"
                     /protein_id="NP_983375.1"
                     /db_xref="GeneID:4619500"
                     /translation="MSTIQQVKQLTKTKTAITTEQSQKLIQTMLTMSFGCLAFLRGLF
                     PDDSFIDQKFVPEKCNKSYDKENTPSIRIKTLVRGRSEEADMFLDWVEKGVFTAIRLR
                     YLKAILLGIFTDKNNPHDLLESYVFSLEYPTSNTVTLRINGQEEAISLLDSRKMMQQL
                     MRRFIIITQSLDPLPKERYLSMRLLFNENAPPDYQPQFFRDASMEPKTTIKVPDHMDM
                     DAVSVGCLDTHHHTMAIKVLSLVDVDAQAREEPNARAIDPFELVNQPVELKVDSIGQS
                     KYNSQTTNMLQDYLRSSPDNVCPTQALDKEDESQQLSPEGQESCECGMSCSVSFKIEC
                     DTCKRQLHGLCYGNSRSNVVQQCITCIVAEELNLDPTTKEFQMMMVLRKAYRYLKDNL
                     NSCTSTSFLQETLFDGNNSDTTTNMLAEALSIFIQDKVIVLDQERKRNAKGQFTKDSV
                     FVDVDHQSVFTPDGLLHPGRYAMTFIPNSKNAQKCYTELCPASAAQVTAWTSAVRRSL
                     AHLNRTKRHVNSSSSSINLSSLAIDEETLNPIPRGKRKNIRLEDESVENYPDSLPNKV
                     RKISVSKKTLKSAW"
     gene            <314891..>316420
                     /locus_tag="AGOS_ACL028W"
                     /old_locus_tag="ACL028W"
                     /db_xref="GeneID:4619501"
     mRNA            <314891..>316420
                     /locus_tag="AGOS_ACL028W"
                     /old_locus_tag="ACL028W"
                     /product="ACL028Wp"
                     /transcript_id="NM_208729.2"
                     /db_xref="GeneID:4619501"
     CDS             314891..316420
                     /locus_tag="AGOS_ACL028W"
                     /old_locus_tag="ACL028W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER078C (ICP55)"
                     /codon_start=1
                     /product="ACL028Wp"
                     /protein_id="NP_983376.2"
                     /db_xref="GeneID:4619501"
                     /translation="MLSARRILRLSTVGIRAFSYGRSQFASGKWLDRPPTLLQAGQAI
                     HESRPHMLKAGELTPGITATEYFGRRMKLAERMQPKSCAIIVGAELKYASGPVFYPFQ
                     QDNNLFYLTGWLEPDTIMVLEKPTADPSDVILHMFVPRRDALVEAWDGPRSGPDGARE
                     IFNADESMEINKAREGLTHILKRCDSVYYDYPTTKSSMSSGFNDVFGVSVPRAHEAVR
                     SMIGSFAVSVNRLSPLTTALRCIKSPAEIDVMRKAGRISGRAYNQAYAQRFRTERTLQ
                     AHLEYNFIAGGCDKRAYVPVVGAGKNALYIHYTKNDDVMYDDELVLVDAAGSLGGYCA
                     DISRTWPVSGKFSGPQKDLYEVVLAVQRKCISLCSANLGYSIHDIHEKSVAFMREELS
                     NLGLSGAHFWDVNKIYPHYIGHNLGLDVHDVPGACKSSPLQEGQVITIEPGIYIPDEP
                     EFPAYFRNIGIRIEDNIAVEKDTYRNLTVEAAKEIVDIESIAQNGVSTKMGETLSPLE
                     D"
     gene            complement(<316466..>317728)
                     /locus_tag="AGOS_ACL027C"
                     /old_locus_tag="ACL027C"
                     /db_xref="GeneID:4619502"
     mRNA            complement(<316466..>317728)
                     /locus_tag="AGOS_ACL027C"
                     /old_locus_tag="ACL027C"
                     /product="ACL027Cp"
                     /transcript_id="NM_208730.1"
                     /db_xref="GeneID:4619502"
     CDS             complement(316466..317728)
                     /locus_tag="AGOS_ACL027C"
                     /old_locus_tag="ACL027C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL071C (PCI8)"
                     /codon_start=1
                     /product="ACL027Cp"
                     /protein_id="NP_983377.1"
                     /db_xref="GeneID:4619502"
                     /translation="MDQFEVLVAVERLFFAWEQISDKETLVERLEGRLADMNLSLSTS
                     PHRSLFLPYLGTRKDHNVADPDTISSEYGLQLLVLENALAHNYSKAISLLESSTVGDV
                     GYIEWCRCMMRLNILGKSYGNNSELDIGLRSYLRNGAQGSSLLLTDEVSDCRMLGFAS
                     LFLQEEYFIAVHHMVRSIHEHPSLVDYLLREEDGRDIFILKEEYKLMLTIAVLVAIPL
                     ENYQDFLLLEDLNPLLQGLPELHVCLNLLVSTSFGSFFARWLGPIQELANRSCFLAPV
                     WHSVNSHMRSKILVFYIKISERVTVSYLARTLDIPYDTVMADVSSLIQKFDINIGIEG
                     DLVYYKEDLPVGNLVSKVSQIQREIDSKLLVMKQKNDALRSFIENMLKEQSVEPLNRS
                     QDMDAFELHEQSEDEEYEEEHLEEGENV"
     gene            <317891..>319783
                     /locus_tag="AGOS_ACL026W"
                     /old_locus_tag="ACL026W"
                     /db_xref="GeneID:4619503"
     mRNA            <317891..>319783
                     /locus_tag="AGOS_ACL026W"
                     /old_locus_tag="ACL026W"
                     /product="ACL026Wp"
                     /transcript_id="NM_208731.1"
                     /db_xref="GeneID:4619503"
     CDS             317891..319783
                     /locus_tag="AGOS_ACL026W"
                     /old_locus_tag="ACL026W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER077C"
                     /codon_start=1
                     /product="ACL026Wp"
                     /protein_id="NP_983378.1"
                     /db_xref="GeneID:4619503"
                     /translation="MFLRIQLRTFMSMPVLRKTGLKSKLSAIQAGKTTVPMTKKELRE
                     RQAKYQLMVKRLQKTPYTKQQAIHILEKQYGFRDAAKTLEIGPLSEKDTELLQRTTDK
                     RLIYAILGVSGEQLRDSKLVADDVLKFCKRGMLNKALLLIRLAKKNGVVGMNILMRHY
                     CEVEQSASSAILLYQYRLKWGIPPNEHTPTILFSGIAHIKKPLSKHHAAKIVTIVQAL
                     IDERQLNAIHFNAALACLARCPETEYLFQCFELMPSYMERSKVAYTELLEGISKIKDD
                     IEAMQKLDYIMKKLPVRAVNAKALFYYLNVWNMRGSPDLSKCTLVLCDRFFDLGVQVE
                     LPVPKGVQLPSLDTWGLLKKLTLNEHVLGIFLENCAKHGLFTLAMKVYERVRTETPEI
                     LNEKSYHHIMQIFREKYPTSCLDKNLEVFEHLRLGLGKVSVASLREIHHSMTRVLAKR
                     YIHDDLTKLEDTMEKIHTFFQKYDSTSLHGKRILNLTQSTVYWSILKGTASSDKLTLT
                     RKRIISEQFIHSYNGDIFRLKHANDADRSRLRAVYLNAIRFYSGYQDNFTLPVADVTE
                     LPHDSLEYQKYQFRKLLSRFKKRILEELQLLERKQPIPANLIEGTKQLGDRILTTPVP
                     GILQKE"
     gene            complement(<319938..>320678)
                     /locus_tag="AGOS_ACL025C"
                     /old_locus_tag="ACL025C"
                     /db_xref="GeneID:4619504"
     mRNA            complement(<319938..>320678)
                     /locus_tag="AGOS_ACL025C"
                     /old_locus_tag="ACL025C"
                     /product="ACL025Cp"
                     /transcript_id="NM_208732.2"
                     /db_xref="GeneID:4619504"
     CDS             complement(319938..320678)
                     /locus_tag="AGOS_ACL025C"
                     /old_locus_tag="ACL025C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL070C (MAM33)"
                     /codon_start=1
                     /product="ACL025Cp"
                     /protein_id="NP_983379.2"
                     /db_xref="GeneID:4619504"
                     /translation="MFRIAARNALRLTARRAIPCATFRTQVPRLFSSNAVSFNMHSKN
                     VAQILKSEQMLELEEHSNELPEDAQEFLTKHGFKEVAKKNQNLAEIVREDKDEVVRVF
                     FDVAEIMNMPYETAPEEDAEGSEELENTFTNARVVVVRKADDTAVAFDLLLSVSEERY
                     YINSVTPFDSSEAALSETAEAEVKRELTYQGPPFPNLDDSLQQSLEQYLVSRGINDEF
                     MSFITSYSGHKENAEYVNWLEKMKKFFE"
     gene            <321051..>321434
                     /locus_tag="AGOS_ACL024W"
                     /old_locus_tag="ACL024W"
                     /db_xref="GeneID:4619505"
     mRNA            <321051..>321434
                     /locus_tag="AGOS_ACL024W"
                     /old_locus_tag="ACL024W"
                     /product="ACL024Wp"
                     /transcript_id="NM_208733.1"
                     /db_xref="GeneID:4619505"
     CDS             321051..321434
                     /locus_tag="AGOS_ACL024W"
                     /old_locus_tag="ACL024W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL123W (SNA4)"
                     /codon_start=1
                     /product="ACL024Wp"
                     /protein_id="NP_983380.1"
                     /db_xref="GeneID:4619505"
                     /translation="MCCGCTCSDCILYFLGFLIPPVAVLLRSGCFSLDLLLNTILTCL
                     GVLPGIVHAFYYIHITSPLRHQYGDPVPVGTLDRFLYDRQRLDQAVAAQRLGGSGPMP
                     EEQRPLTYSSNSKAQMAPPPYNEHA"
     gene            complement(<321528..>323528)
                     /locus_tag="AGOS_ACL023C"
                     /old_locus_tag="ACL023C"
                     /db_xref="GeneID:4619506"
     mRNA            complement(<321528..>323528)
                     /locus_tag="AGOS_ACL023C"
                     /old_locus_tag="ACL023C"
                     /product="ACL023Cp"
                     /transcript_id="NM_208734.2"
                     /db_xref="GeneID:4619506"
     CDS             complement(321528..323528)
                     /locus_tag="AGOS_ACL023C"
                     /old_locus_tag="ACL023C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL176W"
                     /codon_start=1
                     /product="ACL023Cp"
                     /protein_id="NP_983381.2"
                     /db_xref="GeneID:4619506"
                     /translation="MITFGVSVPGNGKDVVSGYRLFRYQDDALTPMPITSDNATDHNE
                     MIQKFCYLRPRDRLTIPECQNGGLMDSSDYLLVAKSNGIIEIFRDYQYRVSQRLQLKP
                     NFVLTCLPVAHERNTLDLTIAGLEFKDGLLYCCTKDGDLYIFILNLPNDYIQEENIYN
                     PMGMPDLFEIAAPNIRDTSRLEEGILFVYSKFTGRTKLQHICYYCHPMGQQISIYPQL
                     KVLYPSIPYFKPCIYVNLKKEVSNFRINPLDRFSFIAMAPRVPLTIYKIHLPKLFTDF
                     FIKFVKLKRAVLKRSSQEIHDIDEASTSVYRCKFLDFLRFDFRGIQTDMDPRTWNSLM
                     ANDYVAELNCSCVWRQRQGNVKDDLYKLFHRQVDVYDEERERPASRGSLTGSIDSSAR
                     SSSLRRSILERTIDAVPCYSNSATDRFIRCIRQNTCPVDIRIVNTKLGDDPMSSTNED
                     DHDSNRTSFLTDDYKDMDIITLDKFLCLTAFRPKYIDEPLMKLDSFHSVTKDATNAEA
                     RWALMNLSSFKKLFMITNSICMIFDTFGVVLIDRFKVVNSHDLLENDPEAFKIIDFEI
                     GLINDIAVVITHIDKCHDCGGSYNIEFIAIVTTVAGTLSALKGEFYCHERLGKMRCRD
                     KLKINKKHKFLDQIVLLDYEPSRKRAREHNAEDRTKRSKVQY"
     gene            <323727..>324218
                     /locus_tag="AGOS_ACL022W"
                     /old_locus_tag="ACL022W"
                     /db_xref="GeneID:4619507"
     mRNA            <323727..>324218
                     /locus_tag="AGOS_ACL022W"
                     /old_locus_tag="ACL022W"
                     /product="ACL022Wp"
                     /transcript_id="NM_208735.1"
                     /db_xref="GeneID:4619507"
     CDS             323727..324218
                     /locus_tag="AGOS_ACL022W"
                     /old_locus_tag="ACL022W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL177C"
                     /codon_start=1
                     /product="ACL022Wp"
                     /protein_id="NP_983382.1"
                     /db_xref="GeneID:4619507"
                     /translation="MRLVAMFATKRTYSSTVWHESEVLIDRRSKFQGRCCILQSASDV
                     PELLEGLVDGNKRIAKASHPLIYAWRTGEVIEEPFEKNGKKRSAAQQHPRARVRNVSQ
                     GSADGGEAGAGNVLLSLLERNQLVNVLIVVTRWYGGTPLGPARFRHISTVGVQSLRNG
                     GLT"
     gene            complement(<324259..>325863)
                     /locus_tag="AGOS_ACL021C"
                     /old_locus_tag="ACL021C"
                     /db_xref="GeneID:4619508"
     mRNA            complement(<324259..>325863)
                     /locus_tag="AGOS_ACL021C"
                     /old_locus_tag="ACL021C"
                     /product="ACL021Cp"
                     /transcript_id="NM_208736.1"
                     /db_xref="GeneID:4619508"
     CDS             complement(324259..325863)
                     /locus_tag="AGOS_ACL021C"
                     /old_locus_tag="ACL021C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL178W (DLD2)"
                     /codon_start=1
                     /product="ACL021Cp"
                     /protein_id="NP_983383.1"
                     /db_xref="GeneID:4619508"
                     /translation="MLARTLLKTTAVRGIALRCRSAVWARSVLRPSVGRTCGYATHAA
                     HLTADTYPTLVRDARYKKLGEEDIAFFRGILSEQEILQAGEGEDLALYNEDWMRKYRG
                     QSKLVLRPKSTQQVAAIIRYCNEQRLAVVPQGGNTGLVGGSVPVFDEIVLSLAQLNKV
                     RDFDPVSGILKCDAGVILENADSYLMERGYLFPLDLGAKGSCHVGGLVATNAGGLRLL
                     RYGSLHGSVLGLEVVLPNGEVLNSMDALRKDNTGFDLKQLFIGSEGTIGVITGVSILC
                     PPRPTAFNVCFLALENYARVQEVFIKAKKELGEILSAFEFMDFNSQYIAGQHLKGVAH
                     PFSEKYPFYVLIETAGSNKEHDDLKLEQFLEGAMEEGLVSDGALAQGETEVRNLWQWR
                     EMIPEASASEGGVYKYDVSLPLKDMHSLVDAVNERLTAQNLSDTEDASKPVVCALGYG
                     HFGDGNLHLNVAVREYTKQVEAALEPFVYEFVASKHGSISAEHGLGFQKKNYISYSKS
                     PQEIKMIKDIKHHYDPNAILNPYKYV"
     gene            <326404..>327888
                     /locus_tag="AGOS_ACL020W"
                     /old_locus_tag="ACL020W"
                     /db_xref="GeneID:4619509"
     mRNA            <326404..>327888
                     /locus_tag="AGOS_ACL020W"
                     /old_locus_tag="ACL020W"
                     /product="ACL020Wp"
                     /transcript_id="NM_208737.2"
                     /db_xref="GeneID:4619509"
     CDS             326404..327888
                     /locus_tag="AGOS_ACL020W"
                     /old_locus_tag="ACL020W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YML043C (RRN11)"
                     /codon_start=1
                     /product="ACL020Wp"
                     /protein_id="NP_983384.2"
                     /db_xref="GeneID:4619509"
                     /translation="MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQA
                     HIDSACFPTPDNSAAEASDGDALEGDVDTAARRLKRKRLRLQSILGHATLDAEEGDLG
                     SEEEDDLNGGSTAKDYEKQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIE
                     NYSNQRMKATLSLSTKKAAAYHEVMRLGYETCPKEEVTNYQKLHLNHLVGLLYSNIIS
                     ENWGTAYRCFALLIRMKSVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFS
                     QNKVNLIDPVFRSGSRAHTPNFMLAWLWLVLRGATADEVLDSTRSMAWLLEKVSELVL
                     RPPYMDDAEIWFLYAMCYFIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKN
                     CLESCREKGNFTYPERIIQEQLLEFERRLYAGTHKEQTDGNSFDTYESDTGEQNDNPT
                     MVSETDFHDPNFRNFKPDVAEDDDTAFGELPTRFEVDSDYDSSE"
     gene            complement(<328045..>329772)
                     /locus_tag="AGOS_ACL019C"
                     /old_locus_tag="ACL019C"
                     /db_xref="GeneID:4619510"
     mRNA            complement(<328045..>329772)
                     /locus_tag="AGOS_ACL019C"
                     /old_locus_tag="ACL019C"
                     /product="ACL019Cp"
                     /transcript_id="NM_208738.2"
                     /db_xref="GeneID:4619510"
     CDS             complement(328045..329772)
                     /locus_tag="AGOS_ACL019C"
                     /old_locus_tag="ACL019C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL013C (HRD1)"
                     /codon_start=1
                     /product="ACL019Cp"
                     /protein_id="NP_983385.2"
                     /db_xref="GeneID:4619510"
                     /translation="MPREVSWPMWAMFITATYALAGWSAYSCATSFDDPLSALFMASS
                     GVHFVIWGNFLIVHYCLFVWAIIRVLFGQLTAIEYDHIFERLHVVLVTLASIVITMRK
                     TYMAGHMTILFYTLCLVAHWVLRDRMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVD
                     YKMLKFCVQNTNVDGKRHDLYLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSA
                     NLVYEGGTTDDDADDEVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYS
                     IFVRSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETT
                     KMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDSNSHATTQAREQTPPDL
                     LQERGIDEHIDVIGMQDMSVQSISLHEGTAVRRGTTGNCMNQAYDGGLLSHEERDQAG
                     WVAFPIEFRADNKVFFNLNDSQGDRQWMASYTSYPRQNMVNSDDPDNASESHSRIPSP
                     SLPGSLEGTSSQVDVTVSAKDAPANACFVIATSKLEQTKEVEHLKRKVEELESRVEEL
                     SKRIKTDQV"
     gene            <329991..>330395
                     /locus_tag="AGOS_ACL018W"
                     /old_locus_tag="ACL018W"
                     /db_xref="GeneID:4619511"
     mRNA            <329991..>330395
                     /locus_tag="AGOS_ACL018W"
                     /old_locus_tag="ACL018W"
                     /product="ACL018Wp"
                     /transcript_id="NM_208739.1"
                     /db_xref="GeneID:4619511"
     CDS             329991..330395
                     /locus_tag="AGOS_ACL018W"
                     /old_locus_tag="ACL018W"
                     /note="NOHBY302; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0C05896g"
                     /codon_start=1
                     /product="ACL018Wp"
                     /protein_id="NP_983386.1"
                     /db_xref="GeneID:4619511"
                     /translation="MSALAFKLGALLIRQVTRPVANVLKQQAKQHSAFKQVCIRLAQQ
                     MHRADVKLRSRLTPVAQPKKIRPLNDERAVENGATLLSELFVFGVTGTVVVWETVRQR
                     NKELDRREQVLQDIKELQEEIDELKRALADRA"
     gene            complement(<330556..>330957)
                     /locus_tag="AGOS_ACL017C"
                     /old_locus_tag="ACL017C"
                     /db_xref="GeneID:4619512"
     mRNA            complement(<330556..>330957)
                     /locus_tag="AGOS_ACL017C"
                     /old_locus_tag="ACL017C"
                     /product="ACL017Cp"
                     /transcript_id="NM_208740.1"
                     /db_xref="GeneID:4619512"
     CDS             complement(330556..330957)
                     /locus_tag="AGOS_ACL017C"
                     /old_locus_tag="ACL017C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL012C (HTZ1)"
                     /codon_start=1
                     /product="ACL017Cp"
                     /protein_id="NP_983387.1"
                     /db_xref="GeneID:4619512"
                     /translation="MSGKVHGGKGKSGAKDGGPLGSQSHSARAGLQFPVGRIKRYLKK
                     NAAGKTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDEL
                     DSLIRATIASGGVLPHINKALLLKVEKKTHK"
     gene            complement(<331299..>332384)
                     /locus_tag="AGOS_ACL016C"
                     /old_locus_tag="ACL016C"
                     /db_xref="GeneID:4619513"
     mRNA            complement(<331299..>332384)
                     /locus_tag="AGOS_ACL016C"
                     /old_locus_tag="ACL016C"
                     /product="ACL016Cp"
                     /transcript_id="NM_208741.1"
                     /db_xref="GeneID:4619513"
     CDS             complement(331299..332384)
                     /locus_tag="AGOS_ACL016C"
                     /old_locus_tag="ACL016C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR005W (TAF4)"
                     /codon_start=1
                     /product="ACL016Cp"
                     /protein_id="NP_983388.1"
                     /db_xref="GeneID:4619513"
                     /translation="MGKSPKAADQGDTGAGGKKTKGEDGFSFGIDAEEVEPTGSDFSN
                     DMPTPFDNFVGQDEQSNRAELPESGQPATTLALPAGGAGSGAGRKSPQKMQRAGMRRA
                     AGAGAPKQQSDPDKLSDALLSAGVDIKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFL
                     HPSHVASMMKKVAAEQNFNQDFSKSSELLSLMSTACELYIRDIITNSIIISRHRRKAV
                     KLNSGRRSETTRVLRDLALKQREQEERRVKRRIALGLEKEITDTKLDSGETLHRASNA
                     TANMMIAGGKKKYSWLTSGSKVNATDLKNPGKVSSAVAARGDLGIKFREAREEPGIVM
                     RDLLHALENRRVGVNNTIAKGYARIRD"
     gene            <332684..>333772
                     /locus_tag="AGOS_ACL015W"
                     /old_locus_tag="ACL015W"
                     /db_xref="GeneID:4619514"
     mRNA            <332684..>333772
                     /locus_tag="AGOS_ACL015W"
                     /old_locus_tag="ACL015W"
                     /product="ACL015Wp"
                     /transcript_id="NM_208742.1"
                     /db_xref="GeneID:4619514"
     CDS             332684..333772
                     /locus_tag="AGOS_ACL015W"
                     /old_locus_tag="ACL015W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL010W (RCL1)"
                     /codon_start=1
                     /product="ACL015Wp"
                     /protein_id="NP_983389.1"
                     /db_xref="GeneID:4619514"
                     /translation="MSSKYVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRD
                     HEVSFLRLIEAVTNGSVIEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLY
                     LAPFSKKKFSIILRGVTSTHQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGG
                     GEVHLVVDSLIAQPITMHALERPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPC
                     EANITADVWRGANSGKSPGWGITLVAETKKGWRYFTEAIGDAGEVPEDIGNKAAYNLL
                     EEISRSAVVCRSQLPLAIVYMVIGKEDIGRLRIARAQVDESLVLLLRDIKELFGTEAL
                     LKPADDDTDDLIVTIKGIGFTNTSKKIA"
     gene            complement(<333901..>335472)
                     /locus_tag="AGOS_ACL014C"
                     /old_locus_tag="ACL014C"
                     /db_xref="GeneID:4619515"
     mRNA            complement(<333901..>335472)
                     /locus_tag="AGOS_ACL014C"
                     /old_locus_tag="ACL014C"
                     /product="ACL014Cp"
                     /transcript_id="NM_208743.2"
                     /db_xref="GeneID:4619515"
     CDS             complement(333901..335472)
                     /locus_tag="AGOS_ACL014C"
                     /old_locus_tag="ACL014C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR004W (MVP1)"
                     /codon_start=1
                     /product="ACL014Cp"
                     /protein_id="NP_983390.2"
                     /db_xref="GeneID:4619515"
                     /translation="MMDLDSQELWGRGPSMESPNNAWASVQRTPADSARTQQIVSPVV
                     RQAESLGSLTLTDSSLSAEVKETMRNNYNERKMYEPGTPALEQTVWGAPPSQLDASIS
                     GLDTSMAPVASQSSMCDELHSEDLENWMNSRRKTYNPLAKNIVVVEEIPEREGILFKH
                     TNYLVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNA
                     DPIFLARRRKGLCRFINLVIMHPVLKQDDLVLTFLTVPTDLGSWRKQANYDTTEEFTD
                     QKIDKAFISLWHKELSNQWNKADAKIDELLESWIKTSVLVERYERRMRQVSEERRLLG
                     RVIEEFADNSVTLYPLEEGTIHDINSHISTISKHLNSLADTSKKERQEVEEHLSVKFK
                     TFIDIIIALKGVFDRYKIMAGNNIAHLQRRVEINMDKLQSMESNPDVKGAEYDKLRQT
                     IQRDKRTIAEQLNRSWLIRKCILEEFVIFQETQFCITHVFQEWAKMHVKYANETTESW
                     EKVYANLQDMPLSRS"
     gene            complement(<335715..>336509)
                     /locus_tag="AGOS_ACL013C"
                     /old_locus_tag="ACL013C"
                     /db_xref="GeneID:4619516"
     mRNA            complement(<335715..>336509)
                     /locus_tag="AGOS_ACL013C"
                     /old_locus_tag="ACL013C"
                     /product="ACL013Cp"
                     /transcript_id="NM_208744.2"
                     /db_xref="GeneID:4619516"
     CDS             complement(335715..336509)
                     /locus_tag="AGOS_ACL013C"
                     /old_locus_tag="ACL013C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL009C (MDM12)"
                     /codon_start=1
                     /product="ACL013Cp"
                     /protein_id="NP_983391.2"
                     /db_xref="GeneID:4619516"
                     /translation="MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTD
                     FKLGTIPPRITLKQIDNPLDDFYEALRLEGASIGGRDTDVQFLMEVDYKGDMLIELSA
                     ELVLNYPSPNFMQLPVKLTISDIGIHSLCLVAYLQRQLFISFLCDVSDPALDNVESPL
                     DSNGPAFLGSKAVERISLIRSIKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNLLR
                     KEAAWPSWINLDFNEDVSADVESSSSAEESLPHRDDAQDFSADARA"
     gene            <336672..>337286
                     /locus_tag="AGOS_ACL012W"
                     /old_locus_tag="ACL012W"
                     /db_xref="GeneID:4619517"
     mRNA            <336672..>337286
                     /locus_tag="AGOS_ACL012W"
                     /old_locus_tag="ACL012W"
                     /product="ACL012Wp"
                     /transcript_id="NM_208745.1"
                     /db_xref="GeneID:4619517"
     CDS             336672..337286
                     /locus_tag="AGOS_ACL012W"
                     /old_locus_tag="ACL012W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL008W (COQ10)"
                     /codon_start=1
                     /product="ACL012Wp"
                     /protein_id="NP_983392.1"
                     /db_xref="GeneID:4619517"
                     /translation="MLRCLISRPQLLPTRLPLATPSCVSRRTFLGFTGGDTKEQRYIL
                     KRVFNAPLHYVYPAVSEVSLYKLFIPYCTDSFVNKRRPGDNMPTEAGLRVGFQQYDET
                     FVCRVDCTTLPGNQRSVVAESLAHHLFETLHTQWLLSPHPTRPDASVVELILRFKFKS
                     QLYNSVSSIFGTRVTQVVMKAFEKRVFQLRKEAMDRPPTGDAGH"
     gene            complement(<337455..>338300)
                     /locus_tag="AGOS_ACL011C"
                     /old_locus_tag="ACL011C"
                     /db_xref="GeneID:4619518"
     mRNA            complement(<337455..>338300)
                     /locus_tag="AGOS_ACL011C"
                     /old_locus_tag="ACL011C"
                     /product="ACL011Cp"
                     /transcript_id="NM_208746.1"
                     /db_xref="GeneID:4619518"
     CDS             complement(337455..338300)
                     /locus_tag="AGOS_ACL011C"
                     /old_locus_tag="ACL011C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR003W (AIM34)"
                     /codon_start=1
                     /product="ACL011Cp"
                     /protein_id="NP_983393.1"
                     /db_xref="GeneID:4619518"
                     /translation="MSLRRAKSLPSLKNIAEVAKPITKAPPLPLLAFEGPGLSTCRWY
                     PTTVRTVHNTPSKAQTTLLSTAKKESAFSAMNLKALRNECRSRGLQVSGRKSDLIERI
                     VDFELKGPLGRRGTRRAFHSPGTSSASVCRPVDKVTMPDIALTERAVQQPEKNYILRI
                     PSLSREAASHPVTKSEKDLAQGADEDADPTSEEGRVLTPDSDLHIESPVVINKIEIIN
                     EDDYLQDDSRQSSDSQGGSQQDSDGTGQQNFSPRDRRFFAGLTAAVGLWWYFGNKSAK
                     RRMRK"
     gene            complement(<338687..>339136)
                     /locus_tag="AGOS_ACL010C"
                     /old_locus_tag="ACL010C"
                     /db_xref="GeneID:4619519"
     mRNA            complement(<338687..>339136)
                     /locus_tag="AGOS_ACL010C"
                     /old_locus_tag="ACL010C"
                     /product="ACL010Cp"
                     /transcript_id="NM_208747.2"
                     /db_xref="GeneID:4619519"
     CDS             complement(338687..339136)
                     /locus_tag="AGOS_ACL010C"
                     /old_locus_tag="ACL010C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR002W (MIC17)"
                     /codon_start=1
                     /product="ACL010Cp"
                     /protein_id="NP_983394.2"
                     /db_xref="GeneID:4619519"
                     /translation="MARSRGPARRPAPVQSRSASSMAAPAAHAPPAPAPAAHAPAQAA
                     PQQPGLFAQMASTAAGVAVGSAVGHTIGAGLTGLFSGSGSAPAEAQPQQLAAAPVQQD
                     TFQTQARHCDTDARNFTRCLEDNNGNFQICDYYLQQLKACQEASRQY"
     gene            complement(<339551..>340516)
                     /locus_tag="AGOS_ACL009C"
                     /old_locus_tag="ACL009C"
                     /db_xref="GeneID:4619520"
     mRNA            complement(<339551..>340516)
                     /locus_tag="AGOS_ACL009C"
                     /old_locus_tag="ACL009C"
                     /product="ACL009Cp"
                     /transcript_id="NM_208748.1"
                     /db_xref="GeneID:4619520"
     CDS             complement(339551..340516)
                     /locus_tag="AGOS_ACL009C"
                     /old_locus_tag="ACL009C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL007C (CSI2)"
                     /codon_start=1
                     /product="ACL009Cp"
                     /protein_id="NP_983395.1"
                     /db_xref="GeneID:4619520"
                     /translation="MKLHISRQSINNSWLLLLLLLPCTFCQVLAISTVRGRRFNSTTP
                     GIITNPRHPIRYHRSITSIPIPKRPTERPTDTRRRVTTIAPQQNRAAHANITKIPASY
                     TNQQIASQTTHIMEYTPGIPSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWG
                     IVFLRSWYFARKEHRFQAMASRYQNAALYNLSSDSADSAPYDSDLVLKVRKMDQLNRL
                     SLYSLGSMSSLGGGEHSKDANRRSLENRASMYISPTNLIQHQKLFMLSTRTPSTLSLT
                     PTAALKDLPFPAPASTRAASGLPLRHSMASTKYIPKSSAPLPPTA"
     gene            complement(<341154..>343352)
                     /locus_tag="AGOS_ACL008C"
                     /old_locus_tag="ACL008C"
                     /db_xref="GeneID:4619521"
     mRNA            complement(<341154..>343352)
                     /locus_tag="AGOS_ACL008C"
                     /old_locus_tag="ACL008C"
                     /product="ACL008Cp"
                     /transcript_id="NM_208749.2"
                     /db_xref="GeneID:4619521"
     CDS             complement(341154..343352)
                     /locus_tag="AGOS_ACL008C"
                     /old_locus_tag="ACL008C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL006C (TOP1)"
                     /codon_start=1
                     /product="ACL008Cp"
                     /protein_id="NP_983396.2"
                     /db_xref="GeneID:4619521"
                     /translation="MTVKLKNDSSSEDEPLGNGGRKAARPARGSKRRAVKEEESSSGE
                     QEEVLSQEVKKRKTVSKRRAPARKVKEEEGDRDAKKESSVDGEEDSEEFKWWEREEEK
                     DDSVKWVTLRHNGVMFPPEYTPLPSHVRLYYGGKAVELPAEAEEVAGFFAALLQSDHA
                     QNPVFQKNFFEDFLSVLNKHGGARNGIDIQEFSKCDFSKMHAYIQQQKDQKKQLSSHE
                     KKLLKQEKDKQEEPYKFCYLDGRKEQVGNFKIEPPDLFRGRGAHPKTGKLKRRVQPED
                     VVLNLDKDAPIPEPPAGHKWGEIRHDNTVQWLCMWRENISNSFKYVRLAANSSLKGMS
                     DFKKFEKSRELKNYIDIIRADYRKNLKSKVMLDRQIAVATYLIDVFALRAGGEKSEDE
                     ADTVGCCSLRYEHISLKPPNTVVFDFLGKDSIRYYQEVEVDKQVFKNLSIFKRPPKEP
                     GHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGSVTEKMVRY
                     NAANRAVAILCNHQRTVGRSHAQSMQKATEKIEEYQWQKIRYKKAILQLDESELKANP
                     KFFKEINDLTKEEQMSIHKRVLEREREKYQKKFARENEKRKFEGEELLPESQLESWLA
                     DVEEMGKEYVEELETGLVTVKPTLQSVEKLKAQIDKLEQRIRTTSIQMKDKEDNSTVA
                     LSTSKISYIDPRLSVAFCKKYDVPLEKVFTKTLREKFKWAIESADENWRF"
     gene            complement(<343662..>344261)
                     /locus_tag="AGOS_ACL007C"
                     /old_locus_tag="ACL007C"
                     /db_xref="GeneID:4619522"
     mRNA            complement(<343662..>344261)
                     /locus_tag="AGOS_ACL007C"
                     /old_locus_tag="ACL007C"
                     /product="ACL007Cp"
                     /transcript_id="NM_208750.2"
                     /db_xref="GeneID:4619522"
     CDS             complement(343662..344261)
                     /locus_tag="AGOS_ACL007C"
                     /old_locus_tag="ACL007C"
                     /note="NOHBY301; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACL007Cp"
                     /protein_id="NP_983397.2"
                     /db_xref="GeneID:4619522"
                     /translation="MAAQTRPIPLRVRTWAFVSIVTIWSARRYSDAVPSACNRLLACL
                     FLRAEKKVSSSTGVCLRLWCSCRLAVSNCPTLPSVRPSPHRPLPAQREHRLARRKRCS
                     GDRCPGPTLPQSSLVTAAPRRYLFRAGPTSSAGGDDWQRQSLQYILDCVLIQFARSAA
                     QLAAATAAKSQNGRRTGFRYMDRLSNSYYCFPLEKTYTW"
     gene            <344392..>346521
                     /locus_tag="AGOS_ACL006W"
                     /old_locus_tag="ACL006W"
                     /db_xref="GeneID:4619523"
     mRNA            <344392..>346521
                     /locus_tag="AGOS_ACL006W"
                     /old_locus_tag="ACL006W"
                     /product="ACL006Wp"
                     /transcript_id="NM_208751.2"
                     /db_xref="GeneID:4619523"
     CDS             344392..346521
                     /locus_tag="AGOS_ACL006W"
                     /old_locus_tag="ACL006W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR001C (CDC5)"
                     /codon_start=1
                     /product="ACL006Wp"
                     /protein_id="NP_983398.2"
                     /db_xref="GeneID:4619523"
                     /translation="MSAPLQIVNEKQLNTRSNANVHTPVKQHHAKRADLERGHHDNNR
                     QPPQKKKKEKLSALCKTPPSLIKTKGRDYHRGMFLGEGGFARCFQMKDDSGKVFAAKT
                     VAKISIKSEKTRKKLLSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDL
                     LKQRKQLTEPEVRFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAA
                     VLANDRERKYTICGTPNYIAPEVLTGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKE
                     VNTIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYVWFRNVFPA
                     RINGDILNFVPEFHDLDLQESLINFKNCMAKCGLMNPSAAAAAVAAKEYDQRLPSYSK
                     NSNNNNNQINQNNEQLSEAKKSVLPQSLSPGGTRYKYKEIVDVETQRKLNDLAREARI
                     RRAQQSMLKQSLVASSTNFIKSEISLRILASECHMTLNGLLEAEAQKRMGGLPRSRLP
                     EIQHPIVVTKWVDYSNKHGFAYQLSTDDIGVLFNNGTTVLNLADAEEFWYISYDDREG
                     WVANHYSLAEKPKELNRHLEVVDFFSNYMNSNLSRISTFVRESYHKDDVFLRRFTRYK
                     QFVMFELSDGTFQFNFKDHHKFAISQSGKLTTYISPDRQSFTFPTVEILKAEKIPGHP
                     ELGFMEKFAMIKEGLKQKSAIVSVAQQ"
     gene            complement(<346569..>346937)
                     /locus_tag="AGOS_ACL005C"
                     /old_locus_tag="ACL005C"
                     /db_xref="GeneID:4619524"
     mRNA            complement(<346569..>346937)
                     /locus_tag="AGOS_ACL005C"
                     /old_locus_tag="ACL005C"
                     /product="ACL005Cp"
                     /transcript_id="NM_208752.1"
                     /db_xref="GeneID:4619524"
     CDS             complement(346569..346937)
                     /locus_tag="AGOS_ACL005C"
                     /old_locus_tag="ACL005C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL005C (RPB11)"
                     /codon_start=1
                     /product="ACL005Cp"
                     /protein_id="NP_983399.1"
                     /db_xref="GeneID:4619524"
                     /translation="MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGN
                     IIRAELLEDERVLFAAYKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLK
                     SNFETEWNLQTLASEDQFRL"
     gene            <347726..>351859
                     /locus_tag="AGOS_ACL004W"
                     /old_locus_tag="ACL004W"
                     /db_xref="GeneID:4619525"
     mRNA            <347726..>351859
                     /locus_tag="AGOS_ACL004W"
                     /old_locus_tag="ACL004W"
                     /product="ACL004Wp"
                     /transcript_id="NM_208753.1"
                     /db_xref="GeneID:4619525"
     CDS             347726..351859
                     /locus_tag="AGOS_ACL004W"
                     /old_locus_tag="ACL004W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL004W (SIN3)"
                     /codon_start=1
                     /product="ACL004Wp"
                     /protein_id="NP_983400.1"
                     /db_xref="GeneID:4619525"
                     /translation="MSQSWSQHHQVDHAGSGRPVGQAGPGPAGGTPQMGGGAGLLPGR
                     RGSEGLKTHYTLPSISAAGLPGAGEPHGGSRLPPMQNALGVGGGGPGSIANGFAVGRL
                     EGAVPVSGTGGPGSPGPQVPAQDGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLD
                     IMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTP
                     FGTIGEIPITGAGGNHAHGANTEPRLQSTQNVPTVYRSAEGSPAAIATPATTQEQYGT
                     GPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVL
                     FQNAPDLLDDFKKFLPDSSAPQLQSHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQ
                     QNLPPLGNFSTPGDHHPMSLPSVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPD
                     ASFRASEYNQVQDVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKA
                     KKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERP
                     KHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVW
                     ASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEK
                     AAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEE
                     WRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNK
                     RIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISL
                     FFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDI
                     LYRNKQQKVNKGPQNDQSSEEFEKESDIEEKEIVRQEAKKPWLLGSIVDEADNHGHVS
                     DRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLIST
                     QLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFKLYTIDKVIQ
                     ALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEY
                     NTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKI
                     IERDEGYIDDGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRV
                     DVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEEIST
                     DTKAALSTTTDTAGNVSTASFSSQTAANAAISASSPESALQSNNGNSEVTSPIANDI"
     gene            complement(<352023..>353150)
                     /locus_tag="AGOS_ACL003C"
                     /old_locus_tag="ACL003C"
                     /db_xref="GeneID:4619526"
     mRNA            complement(<352023..>353150)
                     /locus_tag="AGOS_ACL003C"
                     /old_locus_tag="ACL003C"
                     /product="ACL003Cp"
                     /transcript_id="NM_208754.2"
                     /db_xref="GeneID:4619526"
     CDS             complement(352023..353150)
                     /locus_tag="AGOS_ACL003C"
                     /old_locus_tag="ACL003C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL003C (PFA4)"
                     /codon_start=1
                     /product="ACL003Cp"
                     /protein_id="NP_983401.2"
                     /db_xref="GeneID:4619526"
                     /translation="MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQ
                     VSLSMIWISYWKAIYKNPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVL
                     VMDHHCPWTMNCVGYKNFPHFIRFLFWIIATTGILLHYFVKRIKFTWVNRYATANLVS
                     KQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLL
                     PQLLTNLKEIYPGSLEGQEKEVEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLN
                     WLNPFGGPKADGMVFQKNEISDYDEATSIQDKLLALPWPPDDTRHGIAFPSVSHVEKD
                     TQGGEQVVRRRHVPIAVPPRNEWYNDWGESLEHFGVDVEVE"
     gene            complement(<353448..>354437)
                     /locus_tag="AGOS_ACL002C"
                     /old_locus_tag="ACL002C"
                     /db_xref="GeneID:4619527"
     mRNA            complement(<353448..>354437)
                     /locus_tag="AGOS_ACL002C"
                     /old_locus_tag="ACL002C"
                     /product="ACL002Cp"
                     /transcript_id="NM_208755.2"
                     /db_xref="GeneID:4619527"
     CDS             complement(353448..354437)
                     /locus_tag="AGOS_ACL002C"
                     /old_locus_tag="ACL002C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL002C (IZH2)"
                     /codon_start=1
                     /product="ACL002Cp"
                     /protein_id="NP_983402.2"
                     /db_xref="GeneID:4619527"
                     /translation="MNDSDLKQRVKFVAPENDTASSYSTKETTFLQDGTVAAAITATR
                     AIREVSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIP
                     GICFLFIALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSV
                     FGNKLDYIGIVALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRS
                     REWRKYRAAIFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYG
                     VRFPERLAPGSFDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTNALFVSL"
     gene            complement(<354803..>357040)
                     /locus_tag="AGOS_ACL001C"
                     /old_locus_tag="ACL001C"
                     /db_xref="GeneID:4619528"
     mRNA            complement(<354803..>357040)
                     /locus_tag="AGOS_ACL001C"
                     /old_locus_tag="ACL001C"
                     /product="ACL001Cp"
                     /transcript_id="NM_208756.2"
                     /db_xref="GeneID:4619528"
     CDS             complement(354803..357040)
                     /locus_tag="AGOS_ACL001C"
                     /old_locus_tag="ACL001C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR001W (RRP6)"
                     /codon_start=1
                     /product="ACL001Cp"
                     /protein_id="NP_983403.2"
                     /db_xref="GeneID:4619528"
                     /translation="MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDD
                     TSATVVSLINELLLSVDENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHG
                     SSSRNEGVNMQYLADSSHDDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALK
                     PLEESLMLAPEEENVPAHYPHPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDN
                     VESLSQMLDELKEVKELAVDLEHHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHV
                     LNVIFTDPTVVKVFHGAFMDMIWLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLET
                     FAKFKTSKKYQLADWRVRPLPKPLRDYARSDTHFLLSIYDDLRNALVKAGKLAEVLNA
                     SRNVAKRRFEYTSFRPRIPDSNVYSPIESTEPWRKLMYQYNLPPSKEPLLKKLYEWRD
                     TVARRDDESVRYVMPNQLLVSLVSLSPSETAGVLSVSTYVTDYVRSNARTLANLIKRT
                     LETIKAGTASVAEFSSSERALSNPAATLSLHMIQNLDDHFRSLLMEAQKQSGSICSQH
                     SSSLLFNSDLATGPSAVEYTNGQKHVIGDNVLQTRKHALLQKFTSQPVEPVTDIEAPS
                     HQSSSENPQVSEDISPSEPQESQNEVQKDEPDFEKSEIVVLRKKKKAHAQKPKGTSSS
                     PTETVDYSNAKEVLGKGTSSTAKRGDKDRPRKRKFDPYGQDNNAPSGVKKKNKPSKGK
                     SISFK"
     centromere      357359..357549
                     /note="Chromosome III centromere"
     centromere      357359..357366
                     /note="Chromosome III centromere CDE I element"
     centromere      357367..357532
                     /note="Chromosome III centromere CDE II element"
     centromere      357533..357549
                     /note="Chromosome III centromere CDE III element"
     gene            complement(<357961..>359001)
                     /locus_tag="AGOS_ACR001C"
                     /old_locus_tag="ACR001C"
                     /db_xref="GeneID:4619529"
     mRNA            complement(<357961..>359001)
                     /locus_tag="AGOS_ACR001C"
                     /old_locus_tag="ACR001C"
                     /product="ACR001Cp"
                     /transcript_id="NM_208757.1"
                     /db_xref="GeneID:4619529"
     CDS             complement(357961..359001)
                     /locus_tag="AGOS_ACR001C"
                     /old_locus_tag="ACR001C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL001W (PHO80)"
                     /codon_start=1
                     /product="ACR001Cp"
                     /protein_id="NP_983404.1"
                     /db_xref="GeneID:4619529"
                     /translation="MSVQTSHETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGM
                     NDAQGDKSKPIKLTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVY
                     PEFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVN
                     YRILPRDDNIRRCSLERQERIFSYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGD
                     FNMSPDKSCNLSFTLAESPTNSIQKTLPGGNDFQTAYPGNIDDGSKSCPNITSNNGSE
                     CQLASKEESRSLRSAHMDNNSSVNNSSPQSFSRKRNYSDSSINHLGMCTQLILSKKHS
                     NSQNSHSPREIV"
     gene            complement(<359133..>359633)
                     /locus_tag="AGOS_ACR002C"
                     /old_locus_tag="ACR002C"
                     /db_xref="GeneID:4619530"
     mRNA            complement(<359133..>359633)
                     /locus_tag="AGOS_ACR002C"
                     /old_locus_tag="ACR002C"
                     /product="ACR002Cp"
                     /transcript_id="NM_208758.1"
                     /db_xref="GeneID:4619530"
     CDS             complement(359133..359633)
                     /locus_tag="AGOS_ACR002C"
                     /old_locus_tag="ACR002C"
                     /note="NOHBY316; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACR002Cp"
                     /protein_id="NP_983405.1"
                     /db_xref="GeneID:4619530"
                     /translation="MLITILAPHPESCRPPHIEDFRLPLYTYLFRTGRAQTSYHFAEL
                     RNLSRKSVGTRYRQPEPYGLAYWCHSTFTSSATEHVAATRLYAGINFRPAVNPPLRYV
                     YKYNDWRRHTEEAVKKGGQKILFFVNWGYIIIIIRLLVCVTVRFVKAEEGFFVGRLRF
                     ACFTVP"
     gene            complement(<359761..>360387)
                     /locus_tag="AGOS_ACR003C"
                     /old_locus_tag="ACR003C"
                     /db_xref="GeneID:4619531"
     mRNA            complement(<359761..>360387)
                     /locus_tag="AGOS_ACR003C"
                     /old_locus_tag="ACR003C"
                     /product="ACR003Cp"
                     /transcript_id="NM_208759.1"
                     /db_xref="GeneID:4619531"
     CDS             complement(359761..360387)
                     /locus_tag="AGOS_ACR003C"
                     /old_locus_tag="ACR003C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML001W (YPT7)"
                     /codon_start=1
                     /product="ACR003Cp"
                     /protein_id="NP_983406.1"
                     /db_xref="GeneID:4619531"
                     /translation="MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGAD
                     FLTKEVTVDGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKS
                     WRDEFLVHANVPSPESFPFVILGNKIDVEESKKVVTTRTSQELAKSLGNIPFFLTSAK
                     NAINVDDAFEEIARSALQQSQADAGAYEDDFNDAINIQLDGEPSSCNC"
     gene            <360903..>362594
                     /locus_tag="AGOS_ACR004W"
                     /old_locus_tag="ACR004W"
                     /db_xref="GeneID:4619532"
     mRNA            <360903..>362594
                     /locus_tag="AGOS_ACR004W"
                     /old_locus_tag="ACR004W"
                     /product="ACR004Wp"
                     /transcript_id="NM_208760.1"
                     /db_xref="GeneID:4619532"
     CDS             360903..362594
                     /locus_tag="AGOS_ACR004W"
                     /old_locus_tag="ACR004W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR002W (ALG6)"
                     /codon_start=1
                     /product="ACR004Wp"
                     /protein_id="NP_983407.1"
                     /db_xref="GeneID:4619532"
                     /translation="MNQGRLRDKPRMEGAPPSKEPGQKGIATDAKKPGLKEAFFASPL
                     YDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEAQRHWMEVT
                     QHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYESEDLKS
                     YMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALILIDHGHFQ
                     YNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYYPR
                     LNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRVFPFERGLFEDKVANFWCV
                     TNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFFLF
                     GFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIM
                     FLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYIC
                     VGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL"
     gene            363106..363195
                     /locus_tag="AGOS_t0051"
                     /db_xref="GeneID:4619533"
     tRNA            join(363106..363142,363160..363195)
                     /locus_tag="AGOS_t0051"
                     /product="tRNA-Arg"
                     /codon_recognized="CGU"
                     /db_xref="GeneID:4619533"
     gene            <363354..>364337
                     /locus_tag="AGOS_ACR005W"
                     /old_locus_tag="ACR005W"
                     /db_xref="GeneID:4619471"
     mRNA            <363354..>364337
                     /locus_tag="AGOS_ACR005W"
                     /old_locus_tag="ACR005W"
                     /product="ACR005Wp"
                     /transcript_id="NM_208761.1"
                     /db_xref="GeneID:4619471"
     CDS             363354..364337
                     /locus_tag="AGOS_ACR005W"
                     /old_locus_tag="ACR005W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR007C (SGT2)"
                     /codon_start=1
                     /product="ACR005Wp"
                     /protein_id="NP_983408.1"
                     /db_xref="GeneID:4619471"
                     /translation="MSPSNKDIAALIVDFLTTSAKTVGEDYEDSLKVAIDCITEAFEL
                     GPGEADTLVSEKCGGRSLSQLLTTGMAHTSDAGEPKVAAEELKKEAEALKLEGNRAMA
                     AKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKG
                     FSRLGYAKYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAE
                     VTESGDSAAGSAGGSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMM
                     QNPSAIQEMMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFGPK"
     gene            complement(<364435..>367650)
                     /locus_tag="AGOS_ACR006C"
                     /old_locus_tag="ACR006C"
                     /db_xref="GeneID:4619534"
     mRNA            complement(<364435..>367650)
                     /locus_tag="AGOS_ACR006C"
                     /old_locus_tag="ACR006C"
                     /product="ACR006Cp"
                     /transcript_id="NM_208762.1"
                     /db_xref="GeneID:4619534"
     CDS             complement(364435..367650)
                     /locus_tag="AGOS_ACR006C"
                     /old_locus_tag="ACR006C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML002W and YML003W; YML002W and YML003W represent one ORF
                     in this genome"
                     /codon_start=1
                     /product="ACR006Cp"
                     /protein_id="NP_983409.1"
                     /db_xref="GeneID:4619534"
                     /translation="MPYHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVP
                     RTEVLLQYQDATTYVPLTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIRPQ
                     SGIITAQPSAKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGP
                     QEQPLQYQRITQTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRL
                     FHELVEKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPG
                     YYITRSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARI
                     LISTFQKLTTKTSQATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDD
                     VKFGLLGYSLSTLEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIEQGIPINLKEHE
                     EVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQAL
                     QAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDW
                     KRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTL
                     LHIIKDGIQLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQD
                     PQSLKAIDYVKNPIILNLIGTAMAKNSLYGCLSVHNIKYEENAWYLWITSSLSPESYK
                     TSSYALKDIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALT
                     FSLSIIQQREDYKNVFSYTESELSTWLRASMVKQKPNKRDKIEPEEIHSIQNFLKFSL
                     TEFNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRLRTSPFDNE
                     FNDGIDPFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEK
                     GKPNSASSEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEE
                     ISFFISSKNFAYMNFMVKAYVNRRIKQHKNMLLAIEEFIST"
     gene            <367874..>368815
                     /locus_tag="AGOS_ACR007W"
                     /old_locus_tag="ACR007W"
                     /db_xref="GeneID:4619535"
     mRNA            <367874..>368815
                     /locus_tag="AGOS_ACR007W"
                     /old_locus_tag="ACR007W"
                     /product="ACR007Wp"
                     /transcript_id="NM_208763.1"
                     /db_xref="GeneID:4619535"
     CDS             367874..368815
                     /locus_tag="AGOS_ACR007W"
                     /old_locus_tag="ACR007W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR006C (TSR3)"
                     /codon_start=1
                     /product="ACR007Wp"
                     /protein_id="NP_983410.1"
                     /db_xref="GeneID:4619535"
                     /translation="MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFP
                     AKLAMWDFDHCDPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVE
                     QHGVSVVECSWARLDEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFA
                     IVGRTDLAEELLSHFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQ
                     RRKQTHEEDIWMMGNVNRKAPNMRSSMLDSDDNSDSEYASDVDHDLVSDTEEGEDIAI
                     GSKRDVTYDSLGNVIENGRREFVPETKILESDEEDQQ"
     gene            <368912..>371857
                     /locus_tag="AGOS_ACR008W"
                     /old_locus_tag="ACR008W"
                     /db_xref="GeneID:4619536"
     mRNA            <368912..>371857
                     /locus_tag="AGOS_ACR008W"
                     /old_locus_tag="ACR008W"
                     /product="ACR008Wp"
                     /transcript_id="NM_208764.2"
                     /db_xref="GeneID:4619536"
     CDS             368912..371857
                     /locus_tag="AGOS_ACR008W"
                     /old_locus_tag="ACR008W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR005C (DNL4)"
                     /codon_start=1
                     /product="ACR008Wp"
                     /protein_id="NP_983411.1"
                     /db_xref="GeneID:4619536"
                     /translation="MVIYPWLKNTTELTIALPKKPIIHANMDVLGSPRGGTPTGEHEI
                     NAQDGSPINFSPSPDFCWLCDELFIKLEEVALKKKDLGKPRKVRNLEITSNFVSLWRK
                     TVGNDIYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPR
                     GVKLSTFCVEELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFN
                     YCLEHMSYVELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYD
                     PNERLEKNDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMD
                     YGNSIAYFSRNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCIL
                     PFGLTKSGASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKIL
                     IPSKNVVHLLSGPRCSDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIK
                     PEYLENFGENMDLVVIGRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPII
                     VQPKIEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWI
                     DPKNSVVLEVKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAR
                     EARSYFNVSQNAKFGKDRSSPRKRRTFHLVGDIDVTKPSKADFLKGYYFYVTSGYFDL
                     QSKKNIDASEIGEAVVSCGGTYIHNLRIRASLDKLYILGCKDTRELKMLIERGYDIIH
                     PEWLMDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALANK
                     QVEEGYASEMGTDAVSEYERLLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTN
                     DLELATIVVAVKDCFSQLSLQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYL
                     VDEDEYAAI"
     gene            <371963..>374005
                     /locus_tag="AGOS_ACR009W"
                     /old_locus_tag="ACR009W"
                     /db_xref="GeneID:4619537"
     mRNA            <371963..>374005
                     /locus_tag="AGOS_ACR009W"
                     /old_locus_tag="ACR009W"
                     /product="ACR009Wp"
                     /transcript_id="NM_208765.1"
                     /db_xref="GeneID:4619537"
     CDS             371963..374005
                     /locus_tag="AGOS_ACR009W"
                     /old_locus_tag="ACR009W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL062W (NPR2)"
                     /codon_start=1
                     /product="ACR009Wp"
                     /protein_id="NP_983412.1"
                     /db_xref="GeneID:4619537"
                     /translation="MPPALEKMPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLE
                     KSGIRFDTIKNYVIPKSQLCNKLVTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVF
                     PYDSATSPYEPAIARLAKMLRVLEEQSQMLSKVERDPVYYQLKTGETKAAEQKTEESD
                     SKAKTHNLDKKSRAQHNATTKYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIP
                     MDSGNAIDIKLFPLLTPPNSCLSFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINS
                     IAKISKCSDSAVELVMECIKHLVYYDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRE
                     CQVYVVSSEDCEIHRLPFESRPNGGHSRNQTASTNTVYTLRRTTSTNRADSFSSNAEF
                     SQKSSGISSLAQSFTQSNKDYYYNRSRNLESNCKRTLPTRRVLFDLYRSLTQGQTLKE
                     WYKANYSAIRENQIDVRRLIIFGVFHRLIYRCYSYPVAKSIGTLELLKRFDYVSTTDN
                     FIPTGTSAGNNVFSTSDIRVDFDGSSRSRNIPPFLNSSDVAEEVLRETYQKLSIKDIL
                     NDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNTTRITFDIRNRHVSKDNEHREQQN
                     EDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVNS"
     gene            complement(<374084..>376921)
                     /locus_tag="AGOS_ACR010C"
                     /old_locus_tag="ACR010C"
                     /db_xref="GeneID:4619538"
     mRNA            complement(<374084..>376921)
                     /locus_tag="AGOS_ACR010C"
                     /old_locus_tag="ACR010C"
                     /product="ACR010Cp"
                     /transcript_id="NM_208766.1"
                     /db_xref="GeneID:4619538"
     CDS             complement(374084..376921)
                     /locus_tag="AGOS_ACR010C"
                     /old_locus_tag="ACR010C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL061C (CIN8)"
                     /codon_start=1
                     /product="ACR010Cp"
                     /protein_id="NP_983413.1"
                     /db_xref="GeneID:4619538"
                     /translation="MPDHEVQTRKSRMLDDAQEELNITVAVRCRGRNEREIKAKSSVV
                     VTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDF
                     MKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSAGIIPRIMFKLFDALEATDSDF
                     LVKCSYIELYNEELKDLLDESHDSSKRLRIFDSSSMNHSSRASSQSNSPREPEVAHNG
                     FSRRRQRPPPVKANRMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQ
                     VASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKE
                     AGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN
                     ADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYM
                     SHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQ
                     STIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQ
                     GITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEANGSDMCDTLVK
                     LIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLTEISEENNHLREYLDQHLFKNST
                     QEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERS
                     LFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHR
                     TDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKK
                     IIHEMSPEVGDIKSVETLMERINARTFSPVRPTGKTPSRQVLKNAITSKASSRSMSPI
                     KTLDTNVRIISPVKRGTIEFGAEGPPTKKVR"
     gene            complement(<377333..>378094)
                     /locus_tag="AGOS_ACR011C"
                     /old_locus_tag="ACR011C"
                     /db_xref="GeneID:4619539"
     mRNA            complement(<377333..>378094)
                     /locus_tag="AGOS_ACR011C"
                     /old_locus_tag="ACR011C"
                     /product="ACR011Cp"
                     /transcript_id="NM_208767.1"
                     /db_xref="GeneID:4619539"
     CDS             complement(377333..378094)
                     /locus_tag="AGOS_ACR011C"
                     /old_locus_tag="ACR011C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR004W (UTP23)"
                     /codon_start=1
                     /product="ACR011Cp"
                     /protein_id="NP_983414.1"
                     /db_xref="GeneID:4619539"
                     /translation="MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFD
                     LLKGLKRTLQAEVKPMITQCCMQKLYDTKNQDAIAQGKLYERRRCNHVKEPKEPIECL
                     QSVVAVNGQNRHRYIVASQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSRE
                     AEKQKLFKGLNDPKYTGIAENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQ
                     PTSDASEQKADASKKRRRKHKKATSAETPAESTSD"
     gene            complement(<378749..>380374)
                     /locus_tag="AGOS_ACR012C"
                     /old_locus_tag="ACR012C"
                     /db_xref="GeneID:4619540"
     mRNA            complement(<378749..>380374)
                     /locus_tag="AGOS_ACR012C"
                     /old_locus_tag="ACR012C"
                     /product="ACR012Cp"
                     /transcript_id="NM_208768.1"
                     /db_xref="GeneID:4619540"
     CDS             complement(378749..380374)
                     /locus_tag="AGOS_ACR012C"
                     /old_locus_tag="ACR012C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL060C (PRB1) and YOR003W (YSP3)"
                     /codon_start=1
                     /product="ACR012Cp"
                     /protein_id="NP_983415.1"
                     /db_xref="GeneID:4619540"
                     /translation="MKLQRAVWPAVALTTAQALLILPQAEDELVVAEAHRGQLVQWMA
                     RENQERKAQGAEQQSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAES
                     VARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLR
                     SNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTS
                     YVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVV
                     AVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQALDLA
                     VDAAVDAGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLF
                     APGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEV
                     LKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEA
                     MGSDLDRLIHELESSTDAMFSGFRTILDRMNII"
     gene            complement(<381118..>382584)
                     /locus_tag="AGOS_ACR013C"
                     /old_locus_tag="ACR013C"
                     /db_xref="GeneID:4619541"
     mRNA            complement(<381118..>382584)
                     /locus_tag="AGOS_ACR013C"
                     /old_locus_tag="ACR013C"
                     /product="ACR013Cp"
                     /transcript_id="NM_208769.2"
                     /db_xref="GeneID:4619541"
     CDS             complement(381118..382584)
                     /locus_tag="AGOS_ACR013C"
                     /old_locus_tag="ACR013C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL262W (FUM1)"
                     /codon_start=1
                     /product="ACR013Cp"
                     /protein_id="NP_983416.2"
                     /db_xref="GeneID:4619541"
                     /translation="MLRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKY
                     WGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAA
                     DEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQ
                     AQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATP
                     LTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSR
                     ETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELS
                     LPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFKPVMIAN
                     LLSSVRLLADAARSFRVHCVDGIQANEDRIAKLLHESLMLVTALNPKIGYDAASAVAK
                     NAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPRD"
     gene            complement(<382775..>382987)
                     /locus_tag="AGOS_ACR014C"
                     /old_locus_tag="ACR014C"
                     /db_xref="GeneID:4619542"
     mRNA            complement(<382775..>382987)
                     /locus_tag="AGOS_ACR014C"
                     /old_locus_tag="ACR014C"
                     /product="ACR014Cp"
                     /transcript_id="NM_208770.1"
                     /db_xref="GeneID:4619542"
     CDS             complement(382775..382987)
                     /locus_tag="AGOS_ACR014C"
                     /old_locus_tag="ACR014C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL059C-A (SOM1)"
                     /codon_start=1
                     /product="ACR014Cp"
                     /protein_id="NP_983417.1"
                     /db_xref="GeneID:4619542"
                     /translation="MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRGYVCVP
                     FQRLFRECTLNKRRVRIEITERNTNM"
     gene            <383129..>384787
                     /locus_tag="AGOS_ACR015W"
                     /old_locus_tag="ACR015W"
                     /db_xref="GeneID:4619543"
     mRNA            <383129..>384787
                     /locus_tag="AGOS_ACR015W"
                     /old_locus_tag="ACR015W"
                     /product="ACR015Wp"
                     /transcript_id="NM_208771.1"
                     /db_xref="GeneID:4619543"
     CDS             383129..384787
                     /locus_tag="AGOS_ACR015W"
                     /old_locus_tag="ACR015W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL058W (PCM1)"
                     /codon_start=1
                     /product="ACR015Wp"
                     /protein_id="NP_983418.1"
                     /db_xref="GeneID:4619543"
                     /translation="MRTVQEMVKLYDRHRGCGRVYAYGTAGFRSRAEVLAPVVFATGL
                     LACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQG
                     QQELLDALHMLVDRLGLDLALRARVVVARDSRASGPQLLDALLDGTRMLEDVEVVDCG
                     MLTTPQLHFLTCACNERGSAAGVREDLYYAHFVAALEELAALHGLETLPFPLVVDTAN
                     GVGALKARELFRRSPLFKNRVSIINDNWSQHELLNSGCGADYVKTKQCLPQGISADLL
                     RESLFCSYDGDADRVIFYYIDGQERFHLLDGDKISTLIAKFLQSALLTAGINDDVCLG
                     VVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFS
                     EHFTLTVERALENPALSAKARLSLQTLKTFANLINQTIGDAIADMLAVIAILSILHWS
                     PEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSF
                     VRASGTEDAVRIYAEAASQQQADELATKVSTLVVESTNDPGICN"
     gene            <384966..>386888
                     /locus_tag="AGOS_ACR016W"
                     /old_locus_tag="ACR016W"
                     /db_xref="GeneID:4619544"
     mRNA            <384966..>386888
                     /locus_tag="AGOS_ACR016W"
                     /old_locus_tag="ACR016W"
                     /product="ACR016Wp"
                     /transcript_id="NM_208772.1"
                     /db_xref="GeneID:4619544"
     CDS             384966..386888
                     /locus_tag="AGOS_ACR016W"
                     /old_locus_tag="ACR016W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL263C (KEL3)"
                     /codon_start=1
                     /product="ACR016Wp"
                     /protein_id="NP_983419.1"
                     /db_xref="GeneID:4619544"
                     /translation="MAKKGKKDKDAKKARAEAKSKKSLLKAEQKDKKKAKKLGADDDD
                     DMDIEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQ
                     STGMTHFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQ
                     NTFYHYSDTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTY
                     LNDCWLFDITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQK
                     GKILTDCWYLKMKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEET
                     EEGLDSLFYNDLFTYHIETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILK
                     KANLDDDDGDEDGKTIEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDD
                     TLFIFGGVWEQGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAED
                     DEDDDSEDDDEEEHSDRKLVAEEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFY
                     VRTGASFLEWAITNKHNTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGG
                     VGEVIEKDFTKPTKRR"
     gene            <387121..>388392
                     /locus_tag="AGOS_ACR017W"
                     /old_locus_tag="ACR017W"
                     /db_xref="GeneID:4619545"
     mRNA            <387121..>388392
                     /locus_tag="AGOS_ACR017W"
                     /old_locus_tag="ACR017W"
                     /product="ACR017Wp"
                     /transcript_id="NM_208773.1"
                     /db_xref="GeneID:4619545"
     CDS             387121..388392
                     /locus_tag="AGOS_ACR017W"
                     /old_locus_tag="ACR017W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL056W (HAT2)"
                     /codon_start=1
                     /product="ACR017Wp"
                     /protein_id="NP_983420.1"
                     /db_xref="GeneID:4619545"
                     /translation="MTTKLKGLKELGNTSDPLRTVSYQVRTKMSDYEDDNTDVQSLTV
                     EEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNYL
                     KVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATIN
                     GKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEA
                     AKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPF
                     NTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIIC
                     SSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLAS
                     TEEDNVIQAWKVSMKLVNASPPAISDPSLLV"
     gene            complement(<388481..>389968)
                     /locus_tag="AGOS_ACR018C"
                     /old_locus_tag="ACR018C"
                     /db_xref="GeneID:4619546"
     mRNA            complement(<388481..>389968)
                     /locus_tag="AGOS_ACR018C"
                     /old_locus_tag="ACR018C"
                     /product="ACR018Cp"
                     /transcript_id="NM_208774.2"
                     /db_xref="GeneID:4619546"
     CDS             complement(388481..389968)
                     /locus_tag="AGOS_ACR018C"
                     /old_locus_tag="ACR018C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL272C"
                     /codon_start=1
                     /product="ACR018Cp"
                     /protein_id="NP_983421.2"
                     /db_xref="GeneID:4619546"
                     /translation="MPATSAIRSLTSAEKARYAEVRAGLRNGSLFAVTYGFDRREQET
                     WSDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRV
                     IEFQTYKDEAIACHDGIPPYVARHILNKSKFEAGKPLWEVYIADGSMVIFHCHNVLFD
                     LFAAGNFHVRFQQALQRCEKNEPHNETLFVYEGGPLQLPIDPDACSLPGVDVPYPASS
                     PFVSFVKNVCRYALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGYL
                     NSKKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTT
                     PFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVT
                     THVMKSLTAQTSGDWTGKRKYSKCQLRKKKIIEINVVDMGTSPSARFQIKNMNFTDSL
                     GSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLDELS"
     gene            <390550..>391416
                     /locus_tag="AGOS_ACR019W"
                     /old_locus_tag="ACR019W"
                     /db_xref="GeneID:4619547"
     mRNA            <390550..>391416
                     /locus_tag="AGOS_ACR019W"
                     /old_locus_tag="ACR019W"
                     /product="ACR019Wp"
                     /transcript_id="NM_208775.1"
                     /db_xref="GeneID:4619547"
     CDS             390550..391416
                     /locus_tag="AGOS_ACR019W"
                     /old_locus_tag="ACR019W"
                     /note="NOHBY317; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACR019Wp"
                     /protein_id="NP_983422.1"
                     /db_xref="GeneID:4619547"
                     /translation="MQEHMRSSGTERMTEVERAGQAIQLSGSRAHESPEVGDKTLDVA
                     AVAAVVAGEKVRGLPLMAGDLLGEDGSLGHDMHALGKRQRILKDQLQSMSPQERLERQ
                     RAMRRKRDNAYRARKRATELTVDPELRQLFMALDKNKKFHSISAKYDAAALTPEFFPR
                     VLLTKAETDDAALYKAPFDSFIECLRNKIRSFSGTKLSKERTSVHVTSVSCVLYCSQD
                     KSHQRLLQTKETKKNSNLDNLKQYHCQSYMRVNYSFKTQVLSIKFRHIQHGDSPLLIG
                     SDSNHPSCFDEK"
     gene            complement(<391571..>394579)
                     /locus_tag="AGOS_ACR020C"
                     /old_locus_tag="ACR020C"
                     /db_xref="GeneID:4619548"
     mRNA            complement(<391571..>394579)
                     /locus_tag="AGOS_ACR020C"
                     /old_locus_tag="ACR020C"
                     /product="ACR020Cp"
                     /transcript_id="NM_208776.1"
                     /db_xref="GeneID:4619548"
     CDS             complement(391571..394579)
                     /locus_tag="AGOS_ACR020C"
                     /old_locus_tag="ACR020C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL055C (POL5)"
                     /codon_start=1
                     /product="ACR020Cp"
                     /protein_id="NP_983423.1"
                     /db_xref="GeneID:4619548"
                     /translation="MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEW
                     EYVLGRLVRGLASSNKSARLGFSLCLTEVAAAALENGHIGSAEEYLERLEAALPVDKV
                     KNGKEERGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAW
                     LRQPCLFTLYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEI
                     KRILDETKIFDALPLVKRWKADNPLAKGNAKALASVLKDDALIEGDGPKQKGVWTPRL
                     HFVWDLLLPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFS
                     EKASSERKYLGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFL
                     KTIVSACETDASKVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSLTATELAQLV
                     TLLLQQLEHENTDISKIKFILDTLLHVIRAHKWKAHLSWTNPLLLALVRYAFFSAPSH
                     LSEQSEEIITLSRERLFSVLGELIPLSKHDMGAPSWAYATLELLLQEKEKHPLALQLD
                     AELETVTSNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEE
                     LASFYESATQGADNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLL
                     NTLSARENKAGFAQLFEGADEYEELGSDEAGTDNEDQSSESNEDSSDEVSDQEDYSDE
                     DVAKIDKEATSALAHALRLPDNILDEDGNVGFEEMDDEEEEEESMDDEAMMELDGQLS
                     EIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNKKL
                     SATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEES
                     ILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTSEQVIGIYST
                     TMKHWNVSGKFGPNFFIDFINWLASKKSKN"
     gene            <394892..>395080
                     /locus_tag="AGOS_ACR021W"
                     /old_locus_tag="ACR021W"
                     /db_xref="GeneID:4619549"
     mRNA            <394892..>395080
                     /locus_tag="AGOS_ACR021W"
                     /old_locus_tag="ACR021W"
                     /product="ACR021Wp"
                     /transcript_id="NM_208777.1"
                     /db_xref="GeneID:4619549"
     CDS             394892..395080
                     /locus_tag="AGOS_ACR021W"
                     /old_locus_tag="ACR021W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL271W (ATP15)"
                     /codon_start=1
                     /product="ACR021Wp"
                     /protein_id="NP_983424.1"
                     /db_xref="GeneID:4619549"
                     /translation="MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAK
                     VIDYASKGSAAEAVPLRK"
     gene            <395425..>397689
                     /locus_tag="AGOS_ACR022W"
                     /old_locus_tag="ACR022W"
                     /db_xref="GeneID:4619550"
     mRNA            <395425..>397689
                     /locus_tag="AGOS_ACR022W"
                     /old_locus_tag="ACR022W"
                     /product="ACR022Wp"
                     /transcript_id="NM_208778.2"
                     /db_xref="GeneID:4619550"
     CDS             395425..397689
                     /locus_tag="AGOS_ACR022W"
                     /old_locus_tag="ACR022W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL270W (MDL2)"
                     /codon_start=1
                     /product="ACR022Wp"
                     /protein_id="NP_983425.2"
                     /db_xref="GeneID:4619550"
                     /translation="MWRAIRPFGGLGPVAVLQRLPGPRHNVAVRLQVMSRARCGWQCV
                     RATSRLTVPVCRQSRAYSAARVGGEGTPSPRDKEHEQERKVEKRPAEPSRAQPAKPAG
                     WHEVFRLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDATKDAVAQAEKNET
                     GAPMSLLDMPPIIGNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLVARLRAQV
                     IKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTQNISDGVKAALCGGVGVGMMFH
                     ISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSF
                     VAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGE
                     LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKNSVPSTVGQTF
                     VPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRF
                     YDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEI
                     RAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEAT
                     SALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFA
                     DLYRDEDSELFKLLNEHASEPAKPEASPAPAQEEASAPQAADIPRDIEGGNLRLNEEV
                     IKHVLEDTARAPMP"
     gene            <397968..>400277
                     /locus_tag="AGOS_ACR023W"
                     /old_locus_tag="ACR023W"
                     /db_xref="GeneID:4619551"
     mRNA            <397968..>400277
                     /locus_tag="AGOS_ACR023W"
                     /old_locus_tag="ACR023W"
                     /product="ACR023Wp"
                     /transcript_id="NM_208779.1"
                     /db_xref="GeneID:4619551"
     CDS             397968..400277
                     /locus_tag="AGOS_ACR023W"
                     /old_locus_tag="ACR023W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL269W (KAR9)"
                     /codon_start=1
                     /product="ACR023Wp"
                     /protein_id="NP_983426.1"
                     /db_xref="GeneID:4619551"
                     /translation="MIQVPNAFISPPLATTLGPGADSLEDVMLRIGNKNLSTEEIKQD
                     LLRLVNLLQDLKVSLKGTFSRDVVVSHMPQYFDWIQDGRGLFYPLYKCFSQIEPAMLK
                     FLDPLEAQQTSGALNRDQVAIFNLIDQVSELVLSLKPLFQSVKNLFDTALEFNEIFKD
                     HMNSLLEEIEGNMKKCLALHQDCFASPVRHPPSFTLDQLVELISSSSNNQRLQMPTFN
                     PLEKRIYQDYCELENAIVPIQTSLRDVLKTRIQMFRDRDIINLNYLMRLLNHKYANIV
                     EKYDHFHSELMALKAGIIDKRWNVLFTNLNMELASILTSVTRMYESLQDNPTISGDTR
                     DTLIQQIQQKSDTIFKTFEVIYKALDASILNPNVAEVTNTLADKWLVLREKVDPILPK
                     ETESDPIDVLTKRMSDMTISEPVDSKPFHFDRSKRCSVGALLLRKMNIKPILTSDPDE
                     AEKPKFNRSYRSPSSADANGSPISSDYPPVPFSLEPVHSKNPPVFKLQIGSPDQPPVV
                     KLQNENVCTEDKKTLAPSNTATAEPIGATQMQLNPEYPCSPPPPGDPQPTSPAQNATR
                     RPSDASLGYPGSHKDPQSPSAPFLSAGSSAPVSPREAPATKSPSLSPKDCRPEFDHME
                     PPDFFRSGEDSYTWRRDRSRNSSVSSASAGELSGKLLLSASPQSSQPGDFTACTTAPN
                     EDDVSPTSLVSDDYIKQADHIKYIERIEEERFRYYANMHSRIPVMFSDLIPQPIHLSH
                     FPRSPGTRHNYWSSRLKEPTPLADLLNLS"
     gene            <400379..>403012
                     /locus_tag="AGOS_ACR024W"
                     /old_locus_tag="ACR024W"
                     /db_xref="GeneID:4619552"
     mRNA            <400379..>403012
                     /locus_tag="AGOS_ACR024W"
                     /old_locus_tag="ACR024W"
                     /product="ACR024Wp"
                     /transcript_id="NM_208780.1"
                     /db_xref="GeneID:4619552"
     CDS             400379..403012
                     /locus_tag="AGOS_ACR024W"
                     /old_locus_tag="ACR024W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL268W (PLC1)"
                     /codon_start=1
                     /product="ACR024Wp"
                     /protein_id="NP_983427.1"
                     /db_xref="GeneID:4619552"
                     /translation="MDLNHAYKASNGESNNSLDSSLDVKPMEKPATDDAVRTEKRKYH
                     GAAVMSHHQISVMSQPLTKGVRELIKKTTAFMSCSKSKPQKLMELGPMTYAHSVLTAS
                     EKPLCHMELESSSVNGFADTLQDNGVSDATLVEMWLIRVTRRKRVRYCFRISNGVLTW
                     KDNRMLELDTIKDIRMAEMAKNYREQYDIMDAFASRWITIIYQVSPTKLKALHLIAPT
                     QLECAKFYNAVLTVARQRRELMESISVPSSEAFANIHWKVNVSSKKADESRDTLSFED
                     VQRLCTKFHIYCSSNYLKRVFKIADVNRNGLLNFSEFCTFVRMLKKRHEVTEIWQKIA
                     AETRAIDFEKFYSFLTDVQCEDMDAQLARDLFNEYSHEGYMDEDLLLKFLTAQPYARE
                     IEEDYSRPLSEYFISSSHNTYLLGNQVGSMASVEGYIQALQQGCRSVEIDIWDSDDGP
                     VVCHGKLTSSLPLRNVVDVINKYAFITSPYPLILSLEIHCRSEGQIIVKQLFDDILGP
                     LIYVADHSVGWPSLRDLKHKIIIKSKKLRVNVDMAADIYHSTSSKGSSYDSEYDVQSQ
                     PSSPMPRRGMRGIHISKRKHRVIEQLLQISAIHGITFRNFSLPESKTPTHCFSLSERS
                     FDNLANDDLQRLAIDKHNRRHLMRVYPHAFRYKSSNYDPIKCWRLGVQMVATNWQTYD
                     LGQQLNQAMFRVTARDDWPWPSGYVRKPEYLLHTVPKTSFIRDIYEAVHSSVVALSLE
                     LLSAQLLPKPKLSSRDGEAHFAPYVVIEVLGDGLCGPIHVQNGLVTAPNQVTSCRCPE
                     NGFNPVWKTSLTATLNNTGFNFIRYIVKNADITLATCCIRLDYMKRGYRHIPLYSLES
                     SRFIFSTLFVKTDYRIVRSLF"
     gene            <403211..>403834
                     /locus_tag="AGOS_ACR025W"
                     /old_locus_tag="ACR025W"
                     /db_xref="GeneID:4619553"
     mRNA            <403211..>403834
                     /locus_tag="AGOS_ACR025W"
                     /old_locus_tag="ACR025W"
                     /product="ACR025Wp"
                     /transcript_id="NM_208781.1"
                     /db_xref="GeneID:4619553"
     CDS             403211..403834
                     /locus_tag="AGOS_ACR025W"
                     /old_locus_tag="ACR025W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL267W (ACM1)"
                     /codon_start=1
                     /product="ACR025Wp"
                     /protein_id="NP_983428.1"
                     /db_xref="GeneID:4619553"
                     /translation="MSDVSPVKRNVLARKSVNVKAGARKDKNNSNQSSPKRAKIESSE
                     SSVTTGRVASPLRPSGQFTFYKETPEERAQVIQQQTTVAQQRVRDENDFESCKENLDC
                     EETAKTGAAAGKPSRTALRDLSIEEYCGYIEYKGGSSRNQLTLHLAHPTVLPSFVTPP
                     RSAKLRAFFTAKQVVKSKRRCKRAKTTDDICKDRTVRKLDFTIHQDA"
     gene            <404009..>404968
                     /locus_tag="AGOS_ACR026W"
                     /old_locus_tag="ACR026W"
                     /db_xref="GeneID:4619554"
     mRNA            <404009..>404968
                     /locus_tag="AGOS_ACR026W"
                     /old_locus_tag="ACR026W"
                     /product="ACR026Wp"
                     /transcript_id="NM_208782.1"
                     /db_xref="GeneID:4619554"
     CDS             404009..404968
                     /locus_tag="AGOS_ACR026W"
                     /old_locus_tag="ACR026W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL266W (DIM1)"
                     /codon_start=1
                     /product="ACR026Wp"
                     /protein_id="NP_983429.1"
                     /db_xref="GeneID:4619554"
                     /translation="MGKAAKKKYSGISTGKEVPSEQHMNTVFKFNTDLGQHILKNPLV
                     AQGIVDKAQIKPSDIVLEVGPGTGNLTVRILEQARKVVAVEFDPRMAAELTKRVHGTP
                     AEKKLEIMLGDFMKTELPYFDICISNTPYQISSPLVFKLINQPRPPRVSILMFQREFA
                     MRLLARPGDSLYCRLSANVQMWANVTHVMKVGRNNFRPPPQVESSVVRIEIKTPRPPV
                     DFNEWDGLLRIVFVRKNRTISAGFKSTAVLEIMEKNYKAYLATTNDAMVDDAKGSLAE
                     QVKQKIETVLAETGLSDKRAGKCDQTDFLKLLYAFHQVGLHFS"
     gene            complement(<405109..>408081)
                     /locus_tag="AGOS_ACR027C"
                     /old_locus_tag="ACR027C"
                     /db_xref="GeneID:4619555"
     mRNA            complement(<405109..>408081)
                     /locus_tag="AGOS_ACR027C"
                     /old_locus_tag="ACR027C"
                     /product="ACR027Cp"
                     /transcript_id="NM_208783.2"
                     /db_xref="GeneID:4619555"
     CDS             complement(405109..408081)
                     /locus_tag="AGOS_ACR027C"
                     /old_locus_tag="ACR027C"
                     /note="NOHBY318; No homolog in Saccharomyces cerevisiae;
                     Non-syntenic homolog of Kluyveromyces lactis KLLA0D00528g"
                     /codon_start=1
                     /product="ACR027Cp"
                     /protein_id="NP_983430.2"
                     /db_xref="GeneID:4619555"
                     /translation="MADGRRLLIGVDVGGTNSDLVVLDPARISEPNRGVLAWYKAVTT
                     PDVSEGIEQAIRTVLDDPSNDIKKEEIVSVSIGTTHFINAVIERDANRLERVAVLRLC
                     AGFGESLPPFGDFPEDLGSILQCYTASMDGGSQVNGSDIKPLDESALRRHCKEIKKRG
                     ITCVAVIATFANINNAHELRAAEIIKEEIPSAEVVLSHTVSTIGFVERENATILNAAI
                     KRFGRRLITSFVRATKRIGLDCTILISQNDGTVLSTKDALAAPIRTFSSGATNSMRGA
                     AILCSADPEVTGKNVIVCDVGGTTTDIGLLLASGFPRQSSTYSYVGGVKMNFSMPHVL
                     SIGLGGGSIVRTEEGLTVGPDSTGADIVKQSLLCGGPVTTASDVAVAKLADSGSLEAL
                     SEFKMGNVSRVKGRFDEAYKDAFTATLKEKLERTIDRMKTSPDPIPVIMVGGGSFIAP
                     DSLDGASKVIRPPYYQVANAIGAALGKISSSKQEFRTMLKGTDEEKEEVIKELVQKAQ
                     DEACSKGALRSSLSVVNIVCDAVPYVDKVYNVEVKVIGDIDYGKALDVTHKVAEENGD
                     ESDEETNYVTTKNATVLATEAKTVDYTTYRPSIKDGEWILSVTDIDFISIGAYILGCG
                     GGGDPTSETIELKRIIKNGGVIKVLTLDEFERKTNGKGRAINVAYCGSPTLSSERLHA
                     NELLEAIDLIERWEGQKADGIFMFEIGGSNGLAGLWTAYKKNLPCIDIDLMGRAYPTQ
                     WQSLPSVYNDLKGYPYAALSDGNGMSILFTSVANDVQMEDLVRDAMNNHGVQCAVVDP
                     TMNISRMKRETVLSTLSLSWRIGRAVRLARAKGDTGRLPDYIINAVGGPDAAKYLFKG
                     KIISVEKRLERGYGYGVVVIEGLDDKSAILKVPFKNENIVAYKVQADGTEVPICSVPD
                     LITLLDEDGGAVGTQDYRYGLIVLVMAFAPSDKWTSAPRGIEIGGPKGFGKAFEHIEY
                     KPIGRYVEPVPVPDEYSQ"
     gene            complement(<408699..>410504)
                     /locus_tag="AGOS_ACR028C"
                     /old_locus_tag="ACR028C"
                     /db_xref="GeneID:4619556"
     mRNA            complement(<408699..>410504)
                     /locus_tag="AGOS_ACR028C"
                     /old_locus_tag="ACR028C"
                     /product="ACR028Cp"
                     /transcript_id="NM_208784.1"
                     /db_xref="GeneID:4619556"
     CDS             complement(408699..410504)
                     /locus_tag="AGOS_ACR028C"
                     /old_locus_tag="ACR028C"
                     /note="NOHBY319; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0D00484g"
                     /codon_start=1
                     /product="ACR028Cp"
                     /protein_id="NP_983431.1"
                     /db_xref="GeneID:4619556"
                     /translation="MLQNTGVVMKKRKSPYSRKGCLQCKKSHTKCDETKPACLKCVKR
                     NVECTYKVSFVFQKVETGKDRESAGAADGAGAGTSSDGGYENVVPKGDSGAEPNLDLR
                     DYIYVSPTDLTFLNLLTFDTQAAKVAAPFVPSAPLTNVFQLSWRNASWVELYDTLKAY
                     DPIQAICNSGAAVDTGIISLDSPELLNFVWTMMRSTLGCGNFIMYPQERFDVFVGLLL
                     DVAEKYQIVEQAVMYDVALLMKDIYFKNAFKDYSHIWDRYVRMPSLKPCLDTLQHRIN
                     KTTDFSEVVSLALAVFLLFAANSTYRNAEWRTHLKGSWHMMQSAIDFLPREPLTFISG
                     RCMELYQLLKDWFCHAEILACITSDNGGSIRTLTELNGLLSNAPYSHHNILGGRYDLI
                     RGYVTDLFPIFTKITLKLLDLKSRGVSLHGTNILRFLLVEHEEAVTLELRGFGLTLLR
                     ELQVCKVTDLELCEIVRDVSDLRLQYTMKNSAKVYHMTLELYVKVFFVCVPLDSAELV
                     STLEQILETLYAMPYYTTSSVACHWGIYLSALVSALIGQKNIHLHFVDILSKLASNGM
                     IVAANSITRLAYISRTLENKNYEALVNPSHDYIVY"
     gene            complement(<410921..>413233)
                     /locus_tag="AGOS_ACR029C"
                     /old_locus_tag="ACR029C"
                     /db_xref="GeneID:4619557"
     mRNA            complement(<410921..>413233)
                     /locus_tag="AGOS_ACR029C"
                     /old_locus_tag="ACR029C"
                     /product="ACR029Cp"
                     /transcript_id="NM_208785.2"
                     /db_xref="GeneID:4619557"
     CDS             complement(410921..413233)
                     /locus_tag="AGOS_ACR029C"
                     /old_locus_tag="ACR029C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR001C"
                     /codon_start=1
                     /product="ACR029Cp"
                     /protein_id="NP_983432.2"
                     /db_xref="GeneID:4619557"
                     /translation="MISAMRWGGLTWACMALLWARGVPGAVAREQAGGAAALDDDGGF
                     PFTTVVDILSQNAEFAGFLRAAQRGGWVPYLNELDDFSLLAPFGGVGGGRLDMQRYVI
                     QGGVIDLAQYEAGVYVVDSRAGPRVVEVRGDGGASVNGVRVVADSLFASVQNAVVVPI
                     AGPMPALAERDGLLQALREAGRPVRCAAQLLRLTEGRGANETLLLPEDGAFESQFDAA
                     ELNYLLQAHRLEVDGWYDDQRRLAARLRLRGVHGGAAVARNATAVSGELVELQPADHG
                     ATLYVNGTRTSSSNLVYRGGIAHLLDLQGLRSGIEFTADKYLVGLNASAFVEGMYYQK
                     LAHMLRAHTSTYTIFVSADSWDQYRDFSRSSLLYHFTADHLWLEELLSDEGAHRLHDS
                     MFCPGDGLGGRCQRLKLSRAGADIYVNGGLRVLNPHPYRVRNTLIYLLERSLEPPSAL
                     LSSVNPFLHCTLSLSLLRELGLLDLPSDHHGYTVLLPCFDAWRDLELNLDYLRQNTSA
                     LDMLLGNLIFKGLVYTDDSQERNVSTLHGEPVSVRPLAAHANGSASFAFSNLAAGVAL
                     ELGADIPFDRGVVHPLREVPGPRAFHVPLRALVDAAGAAPFADLLRRAPAFADALGPD
                     APYSILAPAGLLQRHVADPAKFLAAHLVPRAATDALRLCNGLVPTAHGPPLHCRAPAP
                     GVRLLSVAGHSQEVRVLKVGCTDGACVFLLDRALDAPQARARLRLAAAGFLAGVCAGL
                     YMGYVLFCKRTVWFRRSPESAPLLQESPPA"
     gene            <413857..>415656
                     /locus_tag="AGOS_ACR030W"
                     /old_locus_tag="ACR030W"
                     /db_xref="GeneID:4619558"
     mRNA            <413857..>415656
                     /locus_tag="AGOS_ACR030W"
                     /old_locus_tag="ACR030W"
                     /product="ACR030Wp"
                     /transcript_id="NM_208786.2"
                     /db_xref="GeneID:4619558"
     CDS             413857..415656
                     /locus_tag="AGOS_ACR030W"
                     /old_locus_tag="ACR030W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR001W (AVT1)"
                     /codon_start=1
                     /product="ACR030Wp"
                     /protein_id="NP_983433.1"
                     /db_xref="GeneID:4619558"
                     /translation="MPSAGELEQQPLRGSPSSNVQYISIPIERQSSVTAEAGGHAAAG
                     TPGAHRGSFLDQPLGSFRGVNSLGRFASSFHRSNSFKAIELNAGKERAFLKDGYDELY
                     DPDTLGPSLDGRRLSIAINAPGTVSVRPPASDFYGSVGGGGWRDSTAVVDEDEQSTRL
                     MRVLSNQSLTFVDVNNAAGPDADSIMLKRVETKTGKVVTVLAGQSTAPQTIFNSVNVL
                     IGIGLLALPLGLRYAGWALGIPMLLVFAAGTFCSAELLSRCIDADPSMISYGDLGYAA
                     FGSKGRALISVLFTLDLLGCGVSLIILFGDSLNALFPQYSVTQFKILSFFAVTPQVFL
                     PLSVLSNFSLLGITATLGTVLTILYCGLTKTQSPGSLLDPAPTRVWPASFLEFCLSIG
                     ILSACWGGHAVFPNLKSDMRHPSKFKDCLRTTYAITSLTDIGTATVGFLMFGVAVKDE
                     VTRSVMLSDGYPPFVYVLISALMAIIPLAKTPLNARPIISILDVMMGIRNAETELEGH
                     KLFVARALKLTNRLLINVMFVIIAILFPEFDKLIAFLGAGLCFMICLILPCLFYLRIC
                     KDRVTPRERMACYATIAVSAVLSVLGVGAAILS"
     gene            <415993..>417810
                     /locus_tag="AGOS_ACR031W"
                     /old_locus_tag="ACR031W"
                     /db_xref="GeneID:4619559"
     mRNA            <415993..>417810
                     /locus_tag="AGOS_ACR031W"
                     /old_locus_tag="ACR031W"
                     /product="ACR031Wp"
                     /transcript_id="NM_208787.1"
                     /db_xref="GeneID:4619559"
     CDS             415993..417810
                     /locus_tag="AGOS_ACR031W"
                     /old_locus_tag="ACR031W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR002W (MPP10)"
                     /codon_start=1
                     /product="ACR031Wp"
                     /protein_id="NP_983434.1"
                     /db_xref="GeneID:4619559"
                     /translation="MAHFLEVIKQSPASLLSNEVLESKEALEVVKTYFDDVIQLHRDA
                     EGKAAGSMLDEIVVDGLDANQVWWQAKMVLDKVGVDLMTQIAELRGAVGAADDEDMGE
                     DASGEELSGSELDDVEDDAAESDEEVEGSDADGASEEADSEEADSEEEQSLHAGLEED
                     GSDGAQDEAGDDSEERGAAAAEATQGRSSAKEDKYGLNDEFFDIEEFNKQTLAAENPE
                     TEEAQEEEQDIDYFDDIPSEEDEEALYYNDFFDQPNAGKGSAAAADREGEESGADSAY
                     EDAMDSAKLDLFESEGEDDEDDVRDAQTTKKLSTFERQQLEIRKQIEELEKEAVAEKK
                     WALKGEVKAKDRPDDALLTEDLEFDRTAKPVPVITNEATETLEAMIRRRIKNAEFDDL
                     PRRVINDISLHSKKPEIELSDVKSSKSLAEIYENEYKGISEDTAVSEELQKAHDEISE
                     LYKDLVYKLDALSSASFIPKPPQKSLEVRVQGATISMEDAQPLTMSSASTLAPQEIYA
                     AGKAENSDEIALKNGVVMARAELTREDKQRLRRANKRKRAHQLANKSQQLQKKSKKAD
                     VIDTLSRAKNVTIIDKKGEQRDVKGNVKSTHPKNINLKL"
     gene            complement(<417953..>419995)
                     /locus_tag="AGOS_ACR032C"
                     /old_locus_tag="ACR032C"
                     /db_xref="GeneID:4619560"
     mRNA            complement(<417953..>419995)
                     /locus_tag="AGOS_ACR032C"
                     /old_locus_tag="ACR032C"
                     /product="ACR032Cp"
                     /transcript_id="NM_208788.1"
                     /db_xref="GeneID:4619560"
     CDS             complement(417953..419995)
                     /locus_tag="AGOS_ACR032C"
                     /old_locus_tag="ACR032C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR002C (NOC3)"
                     /codon_start=1
                     /product="ACR032Cp"
                     /protein_id="NP_983435.1"
                     /db_xref="GeneID:4619560"
                     /translation="MSYNHSECILRLDSSRYDSKMANKKRSQKAIQERTDKKRKLQDA
                     QLENGLFGADVNSIDIGEEMPAKIASGKWEDNEQDYELKPRRMQDSEHELVEGLPIKI
                     NGKLERKMRVVQRAPENNEVSEDDSEKSEDESKQEESADEEDEEPDTEERILEMKELI
                     AELVEKIIEEPEENTSALTRLRKMAESKNPNTSKFSMLALIPVWKSIIPGYRIRPLTE
                     MEKKEKVSKDVARLRNFEEKLVHNYKLYIDHLASLARTANNEPALKVRLGNIAATAAV
                     ELAGSFSHFNFMSEVLTIVVRRVCKPNPSADPVFSKAIKVLETLMNEDDEGRVSAEIV
                     RLLSRTLKVRNYNVDESVLNSLLSVDVLHDYDPNTKTDEPTKVKLKKKDRVHLSKKQR
                     KVRKEMKEIEEEMRKAEQAVSAEEREKNQAELLKLILALYLNVLKANQQKLIGSVLEG
                     LAKFGHMANLELLGDFLTVMKELISDADLNALSSAEVRKVLLCIVTAFSLVSNHRHMK
                     LSVDLSSFVDALYSVLPYLSLDADVEFSHKTLRLADPLNNELVKPSVNVSTKAELLLK
                     ALDHVFFRSKSGTQQRAAAFTKRLYICMEHTPEKTTVALLKFLDKLMTKYPQIAGLYS
                     TNDRIGNGTFYMEASTPARSNPDAATIWENALLTKHYCPLVVKGTKALFNRSKEST"
     gene            complement(<420392..>420679)
                     /locus_tag="AGOS_ACR033C"
                     /old_locus_tag="ACR033C"
                     /db_xref="GeneID:4619561"
     mRNA            complement(<420392..>420679)
                     /locus_tag="AGOS_ACR033C"
                     /old_locus_tag="ACR033C"
                     /product="ACR033Cp"
                     /transcript_id="NM_208789.1"
                     /db_xref="GeneID:4619561"
     CDS             complement(420392..420679)
                     /locus_tag="AGOS_ACR033C"
                     /old_locus_tag="ACR033C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR012C"
                     /codon_start=1
                     /product="ACR033Cp"
                     /protein_id="NP_983436.1"
                     /db_xref="GeneID:4619561"
                     /translation="MSASDGSNEQPDEPQELSYDQLVDIIVNGKPVPNLVEVADQVHD
                     ESQCSESKLCPRKKPWESTDVRAPITEQPVPFTTRPAREPLPADREFYYSN"
     gene            <420792..>421985
                     /locus_tag="AGOS_ACR034W"
                     /old_locus_tag="ACR034W"
                     /db_xref="GeneID:4619562"
     mRNA            <420792..>421985
                     /locus_tag="AGOS_ACR034W"
                     /old_locus_tag="ACR034W"
                     /product="ACR034Wp"
                     /transcript_id="NM_208790.1"
                     /db_xref="GeneID:4619562"
     CDS             420792..421985
                     /locus_tag="AGOS_ACR034W"
                     /old_locus_tag="ACR034W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR013W (GPI14)"
                     /codon_start=1
                     /product="ACR034Wp"
                     /protein_id="NP_983437.1"
                     /db_xref="GeneID:4619562"
                     /translation="MKREECLLVLAGLLARVGFFSYGIYQDAHFAVKYTDIDYHVFHD
                     AARYVAQGNSPYLRDTYRYTPLLSWMLVPNHWLQWVHFGKFIFVLFDLLAGVMVMNLL
                     GKCGRRRKLILASLWLLNPVVITVSTRGNAESVMAFLIMWFLVHLRNRQFALSGFVYG
                     VAIHFKIYPIIYALPISIYIRSSEGSRWFLRLLTMGIATLATLVGCGIGMYYIYGWEF
                     LEHAYIYHFTRTDHRHNFSLWNMLLYLDSSGVVPTTINWAEFAFLPQLFICAAVTYVL
                     WEAPTFQNMQCVLFLQTFAFVTYNKVCTSQYFIWYLLFLPSFLLDTTLSGAKGIFLIF
                     LWVGTQAWWLYNGYLLEFEGKNMFYPRLFSACVTFFLANVYLLAQFILDCRRRNYQTN
                     IKKTN"
     gene            <422234..>422974
                     /locus_tag="AGOS_ACR035W"
                     /old_locus_tag="ACR035W"
                     /db_xref="GeneID:4619563"
     mRNA            <422234..>422974
                     /locus_tag="AGOS_ACR035W"
                     /old_locus_tag="ACR035W"
                     /product="ACR035Wp"
                     /transcript_id="NM_208791.1"
                     /db_xref="GeneID:4619563"
     CDS             422234..422974
                     /locus_tag="AGOS_ACR035W"
                     /old_locus_tag="ACR035W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR195W (SKI6)"
                     /codon_start=1
                     /product="ACR035Wp"
                     /protein_id="NP_983438.1"
                     /db_xref="GeneID:4619563"
                     /translation="MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQ
                     GNNKLITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQT
                     ALVRTFEKNVMLQLYPRTAIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISG
                     ISVGLYDTTPLLDLNRLEEQAMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGI
                     AGTHRVRDMMDKVLRQHGKIRLENSVAN"
     gene            complement(<423040..>425295)
                     /locus_tag="AGOS_ACR036C"
                     /old_locus_tag="ACR036C"
                     /db_xref="GeneID:4619564"
     mRNA            complement(<423040..>425295)
                     /locus_tag="AGOS_ACR036C"
                     /old_locus_tag="ACR036C"
                     /product="ACR036Cp"
                     /transcript_id="NM_208792.2"
                     /db_xref="GeneID:4619564"
     CDS             complement(423040..425295)
                     /locus_tag="AGOS_ACR036C"
                     /old_locus_tag="ACR036C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR196C (FYV8)"
                     /codon_start=1
                     /product="ACR036Cp"
                     /protein_id="NP_983439.2"
                     /db_xref="GeneID:4619564"
                     /translation="MPDKVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTRQHE
                     TICKLPELPKLNLGGSTEERGRPGSGDGLAPRGAAEEEAASSGRGAATPAHEVQTPRS
                     GAAAQKFSLTSSSRSVSSMNKELDTLMDEISKEMTAGGSEPPLVETRQSPVDFNRVGV
                     PALKPEGHLADDSSDSDGEDAAGGSSLSQSFEHLNMSLKTDTASGQAMPLSSPRGSSA
                     LPAGRDSLALKKGASPDRASEGSLSSRSEDLLAVDRTAGENTRLKTTNSSDDDTDSLP
                     ELITSDAKFRADGASGPARVVSSGVETVIHRAIAPEVAPRLRITSKTDLSYRYDTSSE
                     DDSEAYSGIEDDYLSYQPSPNISDAATFHGHRSRTGSPARAPHPLVEQEEHIELPVIS
                     DDDSTSKSSVRDNYYSEESDNTTSQALVTQDNSSHDTIHDTIRERSFDKSTSGSVTHS
                     IPVIKDDNEDWQNQLRQQSVHLGAWNPDTEGKRGAFLTQASPMSTNKGMCGSQDEETT
                     GDDQQLAEPCNDDSDSVWEGFPSVGEYEDLQSVADIKTIYDNQTLYNVPGIITSSTSV
                     PPLPSSMSELTSRQDTSILSESTSGSGLDSDSLMRVVEGQRHAPKPSMFKENFGQTPE
                     VQVEHLVNSPVPSLDICALIEGPQSHSFKRDKLNSHIEDLNAYSSGAQTWIKYALKST
                     QSSSNITFDEYVISKHVQDAYAQAEEVSKKHSVTNAVNQNVSQLRKKVFSHSMKEGAK
                     GLLSSIGKKKL"
     gene            complement(<425613..>427283)
                     /locus_tag="AGOS_ACR037C"
                     /old_locus_tag="ACR037C"
                     /db_xref="GeneID:4619565"
     mRNA            complement(<425613..>427283)
                     /locus_tag="AGOS_ACR037C"
                     /old_locus_tag="ACR037C"
                     /product="ACR037Cp"
                     /transcript_id="NM_208793.1"
                     /db_xref="GeneID:4619565"
     CDS             complement(425613..427283)
                     /locus_tag="AGOS_ACR037C"
                     /old_locus_tag="ACR037C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR050W (SMF2)"
                     /codon_start=1
                     /product="ACR037Cp"
                     /protein_id="NP_983440.1"
                     /db_xref="GeneID:4619565"
                     /translation="MRISRSSSSRVPPSKTQRTHREEQTMYQVEAERLVSAAEERGTA
                     ALAHGGSSDRMWQRARGVARVLGKYVRFVGPGLLVSVAYMDPGNFSTAVAAGSAHRYQ
                     LLFSVLVSTVLAAFWQCLCAKLGAVTGLDLAQNCRAHFPHNVNVVLYALAEMAIIATD
                     LAEVVGTAISLNILFGIPLPLGVVLTVVDVLVVLMAYKPNGSLRVVRWFEMFVSLLVI
                     LTVVCFTVEVFSVDVGSPQEVLRGFLPSRTVFEGDGLYLSLAILGATVMPHSLYLGSG
                     VVQPRLRDFDIRKGYYVPSDHDRENNHPNYKPSLEAIDDAMHYTVAELLVSLFTVALF
                     VNCSILVVAGATLHGRLSDEDTGDLFSIYNLLCSTLSKAAGTIFVLALLFSGQSAGIV
                     CTLSGQMVSEGFLSWTIAPSVRRTLTRAVAITPCLILVLVAGRTGLSAALNASQVVLS
                     LLLPFVSAPLLYFTGNKQIMRVPLDNTCYHVLPDDEIPLTTLRPNSAESDRSALPPLA
                     SSASPAPGFRDMSNSTLTNVLAWLLWVFVSALNFYLLISFTSGKDIHI"
     gene            <428007..>430031
                     /locus_tag="AGOS_ACR038W"
                     /old_locus_tag="ACR038W"
                     /db_xref="GeneID:4619566"
     mRNA            <428007..>430031
                     /locus_tag="AGOS_ACR038W"
                     /old_locus_tag="ACR038W"
                     /product="ACR038Wp"
                     /transcript_id="NM_208794.1"
                     /db_xref="GeneID:4619566"
     CDS             428007..430031
                     /locus_tag="AGOS_ACR038W"
                     /old_locus_tag="ACR038W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL034W (KAR2)"
                     /codon_start=1
                     /product="ACR038Wp"
                     /protein_id="NP_983441.1"
                     /db_xref="GeneID:4619566"
                     /translation="MAFGKVSNWAVPLTALMYAMALVCLPMFAGGSRGLVYAADTDAE
                     NYGTVIGIDLGTTYSCVALMRNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKNQV
                     ANNPKNTIFDIKRLIGLKYNDKTVQREIKHLPFEVVDKNGMPAVAVTVKGERKLFTPE
                     EISGMVLGKMKQIAEEYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLNILRIVNE
                     PTAAAIAYGLDKTEDEHRIVVYDLGGGTFDVSLLSIENGVFEVQATAGDTHLGGEDFD
                     YKLVRHFLKVFKKKHGVDVSSNAKAMAKLKREAEKAKRALSSQMSTRVEIDSFVDGID
                     FSETLTRAKFEEMNLDLFKRTLKPVEKVLQDAGLKKEDIDDIVLVGGSTRIPKVQELL
                     ENFFNKKASKGINPDEAVAYGAAVQAGVLSGEEGVEDIVLLDVNPLTLGIEVTGGIMT
                     PLIKRNTPIPTKKSQIFSTAVDNQKTVMIQVYEGERAMAKDNNHLGKFELSGIPPAPR
                     GIPQIEVTFALDANGILKVSATDKGTGKSESVTITNEKGRLSKDDIERMVAEAENYQK
                     EDEEIRAKVEARHKLENYAHSLKNQVNGDLGDKLEEDDKETLLEAANDVLEWLEDNSD
                     SATKEEFNEKFESLSQTAYPITSKLYGAGASDATDDEDDESDDYFDHDEL"
     gene            complement(<430488..>431231)
                     /locus_tag="AGOS_ACR039C"
                     /old_locus_tag="ACR039C"
                     /db_xref="GeneID:4619567"
     mRNA            complement(<430488..>431231)
                     /locus_tag="AGOS_ACR039C"
                     /old_locus_tag="ACR039C"
                     /product="ACR039Cp"
                     /transcript_id="NM_208795.1"
                     /db_xref="GeneID:4619567"
     CDS             complement(430488..431231)
                     /locus_tag="AGOS_ACR039C"
                     /old_locus_tag="ACR039C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR016C (PML1)"
                     /codon_start=1
                     /product="ACR039Cp"
                     /protein_id="NP_983442.1"
                     /db_xref="GeneID:4619567"
                     /translation="MVVSFYRQHEFMWTSKTMESAFLLMSVDGGIRGPQTMSKRRFGR
                     QQYHTQDQYPREYHDRAIKRPRNVYSRPILPIFEPSGLLALESNNEQGLALKHVEPPD
                     AVSPEAYFNQWKVARPQRTLFELFLYRKGAGDQAFKSWVLESKSAYIIGRDMGRVAED
                     PDEEKEVVVADIGIPEESTSKQHCVFQFRLKQGYLVPYILDLSSANGTLLNGAILPSA
                     RYVQLHSGDVLELANKSDATEYELVFVAE"
     gene            <431344..>433635
                     /locus_tag="AGOS_ACR040W"
                     /old_locus_tag="ACR040W"
                     /db_xref="GeneID:4619568"
     mRNA            <431344..>433635
                     /locus_tag="AGOS_ACR040W"
                     /old_locus_tag="ACR040W"
                     /product="ACR040Wp"
                     /transcript_id="NM_208796.2"
                     /db_xref="GeneID:4619568"
     CDS             431344..433635
                     /locus_tag="AGOS_ACR040W"
                     /old_locus_tag="ACR040W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL033W (HCA4)"
                     /codon_start=1
                     /product="ACR040Wp"
                     /protein_id="NP_983443.2"
                     /db_xref="GeneID:4619568"
                     /translation="MAKKHRLTTVKRKELRQKESEALKQLQERIKDYDAKTCRAVTFQ
                     DLPISSGTVKGLKEAAYIKMTDIQRAAIPVALKGHDVLGAAKTGSGKTLAFLVPVLEK
                     LYHERWTELDGLGALVISPTRELAMQIYEVLVKIGKYMSFSAGLVIGGKDVKFEMERV
                     SKINILIGTPGRLLQHMDQSVGLNTSNLQILVLDEADRCLDMGFKKALDAIVSNLPPS
                     RQTLLFSATQSQSLADLARLSLADYKTVGTMDGPSSKNKPATPENLEQFYIQVALPDK
                     LDILFSFIKSHLKSKMIVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQTARTETL
                     DKFSRAQHVCLFSTDVVARGIDFPSVDWVIQTDCPEDVDTYIHRAGRSARYGKTGKSL
                     LMLTPQEEDAFLARLKGKLIEPSKLNIKQSKRKSIKPQLQSLLFKDPELKYLAQKAFI
                     SYVRSIYIQKDTEVFKFNELPLEEFAASLGLPGAPQVKIKGKKSIEKAKELKNTSRQL
                     LLLAKANDDGEVDSKEKTVRTKYDKMFGRKNQTVLSEHYMNITKTGAADDDAGDFMTI
                     KRTDHELNENDLPQLTLPTSKRGQKKALSKKASLSSKGNPTKFKFDADGVPHPIYELE
                     GEEEFHKKGDVDTQVKEFLSKETEYMARADTEDKQLVKEKRQEKKRKRLEAMRREMEA
                     LQDDDDEYDAPTVAYVGTGNLSDDMASGDEPDFAPASPPPRKKLKGRYSESAESPDTG
                     VMEVEEPDTLEDLESLTARLISG"
     gene            <433910..>434890
                     /locus_tag="AGOS_ACR041W"
                     /old_locus_tag="ACR041W"
                     /db_xref="GeneID:4619569"
     mRNA            <433910..>434890
                     /locus_tag="AGOS_ACR041W"
                     /old_locus_tag="ACR041W"
                     /product="ACR041Wp"
                     /transcript_id="NM_208797.2"
                     /db_xref="GeneID:4619569"
     CDS             433910..434890
                     /locus_tag="AGOS_ACR041W"
                     /old_locus_tag="ACR041W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL006C (CTK2)"
                     /codon_start=1
                     /product="ACR041Wp"
                     /protein_id="NP_983444.2"
                     /db_xref="GeneID:4619569"
                     /translation="MSSTVYQSQLTLSRPYLTKEQIRQAQKKTITDRRTYNQKRISVF
                     KFLCDLCVQLKFPRKTLEVAMYYYQRYYVFNKFETEMCYDVATSCLFISCKQVETVKK
                     VADVCSASLKLRNSLKLSMEKLESYKTRIIQMELRILETCAFDHRINNTVHVDEYIVK
                     IGRELSLDHTVCHLAWLIAFDVIKLEIILIVPQHTIALAVLKIACELLQTDQWPNIRY
                     NLFESDEDSVNEAYNYVLNFFINVFDICDLKNSLPQGLPTISIEEFMKLKAKSGEGKG
                     LKESLPSIEKDKYLSEERDYKIRERRYVLNRKRVAEEAMPAGPSGAKRTK"
     gene            complement(<434955..>435991)
                     /locus_tag="AGOS_ACR042C"
                     /old_locus_tag="ACR042C"
                     /db_xref="GeneID:4619570"
     mRNA            complement(join(<434955..435929,435989..>435991))
                     /locus_tag="AGOS_ACR042C"
                     /old_locus_tag="ACR042C"
                     /product="ACR042Cp"
                     /transcript_id="NM_208798.1"
                     /db_xref="GeneID:4619570"
     CDS             complement(join(434955..435929,435989..435991))
                     /locus_tag="AGOS_ACR042C"
                     /old_locus_tag="ACR042C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL031C (BET4); 1-intron"
                     /codon_start=1
                     /product="ACR042Cp"
                     /protein_id="NP_983445.1"
                     /db_xref="GeneID:4619570"
                     /translation="MHGVKRRLWTQEALKQKRAQDKQRIKAYRDQTARVLRLRDAGAY
                     SMEALAETTSLLQMNGEFNAVWNYRRDIIAALREQLDGGFWEAELKLTMAHLRESPKV
                     YWIWNHRQWCLQHHAEQGAAVWKRELALVGKMLELDPRNFHGWHYRRVVVRELERRSG
                     ASLDSAELSFTTEKINENISNFSAWYQRAQLIPRMIASGKIADTSRFAEEEASYIINA
                     MYTDAEDQSVWMYLKWFAEASCIRDDMPLQDYDCMLTKFRENIMAINQDELEFSGREN
                     IWCLKMLVFLGSIAPTQQESPAQRRHHLERLIELDSMRRNRYIHMLENA"
     gene            <436152..>436751
                     /locus_tag="AGOS_ACR043W"
                     /old_locus_tag="ACR043W"
                     /db_xref="GeneID:4619571"
     mRNA            <436152..>436751
                     /locus_tag="AGOS_ACR043W"
                     /old_locus_tag="ACR043W"
                     /product="ACR043Wp"
                     /transcript_id="NM_208799.1"
                     /db_xref="GeneID:4619571"
     CDS             436152..436751
                     /locus_tag="AGOS_ACR043W"
                     /old_locus_tag="ACR043W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL030W (MAD2)"
                     /codon_start=1
                     /product="ACR043Wp"
                     /protein_id="NP_983446.1"
                     /db_xref="GeneID:4619571"
                     /translation="MSRPISLKGSTRMVTEFFEYSINSILYQRAVYPPEDFTTVKKYD
                     LNLLKTHDEELKEYIRKILLQVHRWLLGGKCNKLVLVILDKDEGEVLERWEFNVQRSE
                     RAPQEAALESADLEETQKQIRALIRQITASVTFLPELANEGNYTFNVLAYTDANANVP
                     MEWVDSDARDIDNAEVVQFRNFNTGDHSVNAQVSYRFNG"
     gene            complement(<436805..>439201)
                     /locus_tag="AGOS_ACR044C"
                     /old_locus_tag="ACR044C"
                     /db_xref="GeneID:4619572"
     mRNA            complement(<436805..>439201)
                     /locus_tag="AGOS_ACR044C"
                     /old_locus_tag="ACR044C"
                     /product="ACR044Cp"
                     /transcript_id="NM_208800.2"
                     /db_xref="GeneID:4619572"
     CDS             complement(436805..439201)
                     /locus_tag="AGOS_ACR044C"
                     /old_locus_tag="ACR044C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL029C (VPS53)"
                     /codon_start=1
                     /product="ACR044Cp"
                     /protein_id="NP_983447.2"
                     /db_xref="GeneID:4619572"
                     /translation="MSCDKPDYDPLEDLVTILSGIDSLDHLDKLLVATREHKLRLHEE
                     VKAERELADSPLGSADDELDQLIHKVERTQQLSKSTESTISDLTKDIAYLDTVKKNLT
                     HSMAWFQNLNDLSESYCQCKHYLEQQSFKEMSAPYAVMTSLSDMFQGYKSVTEINRLL
                     ELIRALEDDTIHSIKQLYRKLFESKETLNVTEATFKEGACVLLESNPTDKFEVINWSL
                     DKILGEIREIFQVDDEAGSLENISRRYLFFKRVLNNFQANFASYFPASWEMPLRLTSM
                     FFIFTKHDIQILLDREMKKTPSLELFMEALQATVDFEKYIGIKFSNKLSNITHEKIST
                     CFEPHLSLWLSHHDQVMNSKMLAYMSETKLPNSSDSHVVPSSAALFRTYRQILSQTLE
                     LTDGEGRSAVLSDLAGFFSKWLIEYSNKILQPLLLPENARMEEKDEVIQYTILMINTA
                     DYCSITAGQLEEKLQEYVDSGDTISKQFDKAKSRFGLLVSQGLQFLLTHILSPELHFA
                     WREFSNSDWRHPLGEGYSRYIVTLEHILTPDDVQGDSLVHKLLSQFNRDVFVWNMLDR
                     ITELVTTEFLRCITKLLVPKEPFGNMKSRRQFTVAQVIGIGKQLLLDCQSLERILKKL
                     PEGLPDGKATQNNRINRHIDTNIAQLSALCKVLAVPLDSPASYHDEYFGIINNKNHAV
                     WALVFALKGMQWEISEWKTYWEEFKTRETSATESSIDLFIFYRDESTVRHFVAAMLKV
                     VDPGWKAFASEELRLVSSRSSSRPSTPPPSNIGPARNKSINENLKNLVSNTRFFNRGG
                     "
     gene            complement(439327..439399)
                     /locus_tag="AGOS_t0052"
                     /db_xref="GeneID:4619573"
     tRNA            complement(439327..439399)
                     /locus_tag="AGOS_t0052"
                     /product="tRNA-Met"
                     /codon_recognized="AUG"
                     /db_xref="GeneID:4619573"
     gene            <439721..>441412
                     /locus_tag="AGOS_ACR045W"
                     /old_locus_tag="ACR045W"
                     /db_xref="GeneID:4619472"
     mRNA            <439721..>441412
                     /locus_tag="AGOS_ACR045W"
                     /old_locus_tag="ACR045W"
                     /product="ACR045Wp"
                     /transcript_id="NM_208801.2"
                     /db_xref="GeneID:4619472"
     CDS             439721..441412
                     /locus_tag="AGOS_ACR045W"
                     /old_locus_tag="ACR045W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL008C (CCT8)"
                     /codon_start=1
                     /product="ACR045Wp"
                     /protein_id="NP_983448.2"
                     /db_xref="GeneID:4619472"
                     /translation="MSLKLPQNPNAGLFKQGYNSYSNADGQIQKSIAAIREIHQMCLT
                     SMGPCGRNKIIVNHLGKYLITNDAATMLRELEIVHPAVKVLVMATEQQKIDVGDGTNM
                     VMVLAGELLNLSEKLISLGLSPVEVIQGYTMAKNFTIEELDKMVVQEVIDKHDKDELI
                     KVIKPVISSKQFGSEELLSELIAEAVSYVLPSKSNFFNVDSIRVVKIMGSSLSNSTVI
                     KGMVFNREPEGHLKSLPKGGKHKVAVFTCPIDIASTETKGTVLLHNAQEMLDFTKGEE
                     KQLDAMIKEIADTGVRCVIAGSGVGELALHYLNRYEVLVLKIPSKFELRRVCRVCGAT
                     PMPRLGAPTPEEIGVVETVKSMEIGGDRVTVFKQESEETTRTATIILRGATQNNLDDI
                     ERAIDGGVAAIKGLLKLDGGKLLPGAGATEIELVSRITKYGEKTPGLLQLAIKQFAMA
                     FEVIPRTLAETAGLNVNEVLPNLHAAHAPAGDSASTDDKIYQGIDIDGTTPEGIVDIR
                     NEGVYDMLAAKKFAINVATDAANTVLSVDQIIMAKRAGGPAAPKGPKPGNWDQED"
     gene            <441675..>443711
                     /locus_tag="AGOS_ACR046W"
                     /old_locus_tag="ACR046W"
                     /db_xref="GeneID:4619574"
     mRNA            <441675..>443711
                     /locus_tag="AGOS_ACR046W"
                     /old_locus_tag="ACR046W"
                     /product="ACR046Wp"
                     /transcript_id="NM_208802.2"
                     /db_xref="GeneID:4619574"
     CDS             441675..443711
                     /locus_tag="AGOS_ACR046W"
                     /old_locus_tag="ACR046W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL010C (NOP9)"
                     /codon_start=1
                     /product="ACR046Wp"
                     /protein_id="NP_983449.2"
                     /db_xref="GeneID:4619574"
                     /translation="MAKQRGRKLLQKQNKDDFKHSLDQERHEEEVIQVPVDKAPAPIS
                     ADGPNTFFGTLDTQELEYFKRAESTMAVDTFESADEKYQFINSVIEESKGKELKLATS
                     QICSKLMERIILAADDQQLKAIFQGINGFFVNLSYNKYASHVVETLLVRSAALIEKEL
                     LTPVFEAELDGDEQVYASMENMFLFMLNELKPHMKMMINHQYASHVFRLLILVLSAKK
                     LPKSTQSNSALRSKKSKIARKMVDLKDNADFDRTYRTPDSFKLELKGILVMLYKQFTN
                     GIEPGTKHSEVNIACVTKFREYCVDKVASPVIQLIIQVEGIFDRDRSFWNLVFSNTEQ
                     NDPKEESFMEYLLSDSVGSHFLQAVIGFARTKQVERLYKLYMQDRIVKLAKRDTTGAF
                     VIMSLLQNLGSKEVKSILDDLVPELSILLNSNLDFGSEIIEASIRQGDYKKTEIVEQL
                     GKKYYPADSESKNILESCLQLASSTLGNTKDDWPTADERRRALFLEKLINFDDYFLEI
                     AVESLLNLPEERIMQMCYHGVFSHVVEHVLQAKRVETVKRKLLLNILYKDAVNLACNA
                     YGSHIMDKLWEFTAKLTLYKERIANLLLEEADKVKNSIYGRQVWKNWHLELYVRKRFD
                     WRKKVKEQELEVFPDSKPLQPKQKESIPAKRSAPSNNQRPGSLNKKRNAEKHHT"
     gene            complement(<443875..>444513)
                     /locus_tag="AGOS_ACR047C"
                     /old_locus_tag="ACR047C"
                     /db_xref="GeneID:4619575"
     mRNA            complement(<443875..>444513)
                     /locus_tag="AGOS_ACR047C"
                     /old_locus_tag="ACR047C"
                     /product="ACR047Cp"
                     /transcript_id="NM_208803.1"
                     /db_xref="GeneID:4619575"
     CDS             complement(443875..444513)
                     /locus_tag="AGOS_ACR047C"
                     /old_locus_tag="ACR047C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL142W (MRP8)"
                     /codon_start=1
                     /product="ACR047Cp"
                     /protein_id="NP_983450.1"
                     /db_xref="GeneID:4619575"
                     /translation="MSDEALKKQVEELQALVKRQSVLITKTGQSVLELQVSKQKHDMA
                     NLDEKFLPKGGAGKFDTTDFATNEDLVQLVGELQGQLDTMEERSVRRLVNSTKSEEKD
                     FLAPLPNADGEIPDVKDGVFPLTLGDFESLDNVKLYKLAKFYELLPPTLREQEKFEEF
                     LEGKVENFHISETPDADIEAEVKRLTEEQLNDIFNDIARYLGLRSRRGTSVW"
     gene            complement(<444777..>446099)
                     /locus_tag="AGOS_ACR048C"
                     /old_locus_tag="ACR048C"
                     /db_xref="GeneID:4619576"
     mRNA            complement(<444777..>446099)
                     /locus_tag="AGOS_ACR048C"
                     /old_locus_tag="ACR048C"
                     /product="ACR048Cp"
                     /transcript_id="NM_208804.1"
                     /db_xref="GeneID:4619576"
     CDS             complement(444777..446099)
                     /locus_tag="AGOS_ACR048C"
                     /old_locus_tag="ACR048C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL143W (LTV1)"
                     /codon_start=1
                     /product="ACR048Cp"
                     /protein_id="NP_983451.1"
                     /db_xref="GeneID:4619576"
                     /translation="MSKSVFNKKTAQKFAVVHRPHDDPNYYDDEASQHVLVPVGAATS
                     QRASKKGHRKARDVNERAGEAKLYGIEFDDSQYDYTQHLKPIGLDPENSVFIPSKNVR
                     EGDNRRKKAVDLFVEPEYRDDRQKRSEPLFSRGVAKPEYLEKMQDIPDEIRGFQPDMN
                     PALREVLEALEDDAYVVNEDVEVKSDPPASAVEDEEDLFAELLEGGEVPGGKDAELDE
                     WDIDGLDDFEEQNYRDEMAQFANVDNLETLQSLDVSADVRRFKQQMARDNANDWDSDD
                     GLSDQGSAAEEQDDLGELPSFGTRTGAKKRRERQRKGAKSDVSGFSMSSSAIARTEVM
                     TILDDKYDQVIGSYENYEEEQDEEEYQPFDMSRERADLSDMLDDFLDNYELERGGRRL
                     AKKDKEIDNLKKAADEVSKGKLSARRNKARKEKNSLDSITSGVQSLKF"
     gene            <446476..>447108
                     /locus_tag="AGOS_ACR049W"
                     /old_locus_tag="ACR049W"
                     /db_xref="GeneID:4619577"
     mRNA            <446476..>447108
                     /locus_tag="AGOS_ACR049W"
                     /old_locus_tag="ACR049W"
                     /product="ACR049Wp"
                     /transcript_id="NM_208805.1"
                     /db_xref="GeneID:4619577"
     CDS             446476..447108
                     /locus_tag="AGOS_ACR049W"
                     /old_locus_tag="ACR049W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL144C (RPC25)"
                     /codon_start=1
                     /product="ACR049Wp"
                     /protein_id="NP_983452.1"
                     /db_xref="GeneID:4619577"
                     /translation="MFILTKISDLVRIPPDQFHRDTASAINHQLNNKYANKIIPHVGL
                     CITIYDLLTVDEGQLKPGDGASFINVTFRALVFKPFVGEIITGWITQCTNEGIKVSLL
                     GMFDDIFIPAKMLFEGSYYSVDDSAWVWQMDEETKLYFDVNEKIRFRVEQEVFVDVKP
                     KSPREQELEEQLKEKDTLTEEEKRLVEKPPAYALLGSCQTDGMGLVSWWE"
     gene            complement(<447220..>448647)
                     /locus_tag="AGOS_ACR050C"
                     /old_locus_tag="ACR050C"
                     /db_xref="GeneID:4619578"
     mRNA            complement(<447220..>448647)
                     /locus_tag="AGOS_ACR050C"
                     /old_locus_tag="ACR050C"
                     /product="ACR050Cp"
                     /transcript_id="NM_208806.1"
                     /db_xref="GeneID:4619578"
     CDS             complement(447220..448647)
                     /locus_tag="AGOS_ACR050C"
                     /old_locus_tag="ACR050C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL145W (RPT1)"
                     /codon_start=1
                     /product="ACR050Cp"
                     /protein_id="NP_983453.1"
                     /db_xref="GeneID:4619578"
                     /translation="MFRFALSYTTLLHRQTITRDYAMPPKEDWEKYKAPVETEEEQKQ
                     ADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDIEQRIKEKAGVKESDTGLAPS
                     HLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRSGANTGEDDEDAKYVINLKQI
                     AKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSD
                     VGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTD
                     ATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVDAIGGARFDDGAGGD
                     NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG
                     RANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD
                     FLKAVDKVINGYKKFSSTSRYMQYN"
     gene            complement(<448843..>450495)
                     /locus_tag="AGOS_ACR051C"
                     /old_locus_tag="ACR051C"
                     /db_xref="GeneID:4619579"
     mRNA            complement(<448843..>450495)
                     /locus_tag="AGOS_ACR051C"
                     /old_locus_tag="ACR051C"
                     /product="ACR051Cp"
                     /transcript_id="NM_208807.2"
                     /db_xref="GeneID:4619579"
     CDS             complement(448843..450495)
                     /locus_tag="AGOS_ACR051C"
                     /old_locus_tag="ACR051C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL146W (AVT3)"
                     /codon_start=1
                     /product="ACR051Cp"
                     /protein_id="NP_983454.2"
                     /db_xref="GeneID:4619579"
                     /translation="MSRRASTLGGSVPTSRGTEAAMVDIVSRHLAAEPASSLQLQGGD
                     ITRELYRWTAERPGRRRSHSYGGSRAPSVHSMGARDMRAPNGFRRSYMMERGGVLTGS
                     FMEFLSLYGHFAGEDLSEDEDDALADAAVLFEEEETLLQGRRRSYGTDSGEAGGASVF
                     RTVLLLLKSFVGTGVLFLPKGFHNGGWLFSTGALVFCGAASCVCFMLLIAAKEQEGVG
                     GYGDLGRRVCGVAMQRTVLASIVLSQLGFAAVYAVFTATNLQVVCSTLFGWHASTGVY
                     VAAQAAVYLPLALTRRITKLSATALLADLFILLGLVYVYYFSASQVVQHGAATDSMLA
                     FNPSSWTVFLGTAIFTYEGVGLLIPIQESMRSPEKFRRCLLWVMVAVTAVFISFGMLC
                     YAAFGAKVETVILLNFPQDSALGTGVQLLYAAAIMLSTPLQLFPAIRILENVVVTTSR
                     SGKYSTKVKWIKNWFRALVVVLMLVLASLGSNDLDKFVSLIGSFACIPLIYVYPPLLH
                     YVVFRGTGTVSQVALALDLAVMAFGLGIMGYTTVQTVVQWYG"
     gene            <450772..>452673
                     /locus_tag="AGOS_ACR052W"
                     /old_locus_tag="ACR052W"
                     /db_xref="GeneID:4619580"
     mRNA            <450772..>452673
                     /locus_tag="AGOS_ACR052W"
                     /old_locus_tag="ACR052W"
                     /product="ACR052Wp"
                     /transcript_id="NM_208808.2"
                     /db_xref="GeneID:4619580"
     CDS             450772..452673
                     /locus_tag="AGOS_ACR052W"
                     /old_locus_tag="ACR052W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL148C (SDH1) and YJL045W"
                     /codon_start=1
                     /product="ACR052Wp"
                     /protein_id="NP_983455.2"
                     /db_xref="GeneID:4619580"
                     /translation="MLSVTRTAPGVRTRALRLFSSGRAASLAAVGAGAPQAKYHIVDH
                     EYDCVVVGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNMHGDD
                     WKWHMYDTVKGSDWLGDQDSIHYMTREAPASIIELENFGMPFSRNDEGRIYQRAFGGQ
                     SKEYGKGGQAYRTCAVADRTGHAMLHTLYGQALSHNTHFFVEYFAMDLLTHNGEVVGV
                     IAYNQEDGTVHRFRAHRTVMATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEF
                     VQFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPTAKDLACRDVVSRAITME
                     IREGRGVGPEKDHIHLQLSHLPPSVLKERLPGISETAHIFAGVDVTKEPIPVLPTVHY
                     NMGGIPTRWTGEALTIDEETGEDKVIPGLLACGEAACVSVHGANRLGANSLLDLVVFG
                     RAVAHTVADSLQPGLPHKPLPADLGKESIANLERMRTASGPLTTSQIRLNMQKAMQKD
                     VSVFRTQQTLDEGVHNVSAIDETLKDVGTSDRSMIWNSDLVETLELQNLLTCAVQTAK
                     SAAERKESRGAHAREDFPERNDEEWMKHTLSWQHASGAPVEIKYRNVITTTLDETECP
                     PVPPTVRAY"
     gene            <452806..>453978
                     /locus_tag="AGOS_ACR053W"
                     /old_locus_tag="ACR053W"
                     /db_xref="GeneID:4619581"
     mRNA            <452806..>453978
                     /locus_tag="AGOS_ACR053W"
                     /old_locus_tag="ACR053W"
                     /product="ACR053Wp"
                     /transcript_id="NM_208809.1"
                     /db_xref="GeneID:4619581"
     CDS             452806..453978
                     /locus_tag="AGOS_ACR053W"
                     /old_locus_tag="ACR053W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL149C (DBR1)"
                     /codon_start=1
                     /product="ACR053Wp"
                     /protein_id="NP_983456.1"
                     /db_xref="GeneID:4619581"
                     /translation="MTQETLRIAVQGCAHGQLDRIYDAVANMPEQPDLLLVLGDFQSL
                     RTTADYPSISVPRKYASLGDFPSYFSGERTAPVLTVFIGGNHENFAQLLDLPHGGWVA
                     RNIYYMGYSNVFWFRGVRIGGLSGIYKHWDLVAARPPTAAAAAASWGSVVRSLYHVRM
                     ADALPLLLLDPARRLDVMMSHDWPRGIEQYGNCAQLLRWKPHFRSDVSAGRLGSPLSW
                     EMLRRLRPRRWLSAHLHVKFEAAVDHDKLDQKDSDEIALDLDDAPAPPPVKTEFLALD
                     KCKAGRNTHLAMLCVTADPGHPSAADPEHLFWDPEFISNVRFVQCDPQGLAATRRHFS
                     PTDVQHLFAERAPLRQEPDTDWSGYRIPPFEPEMLTETKIQTEHFRAAFLGPPSVT"
     gene            complement(<454022..>454942)
                     /locus_tag="AGOS_ACR054C"
                     /old_locus_tag="ACR054C"
                     /db_xref="GeneID:4619582"
     mRNA            complement(<454022..>454942)
                     /locus_tag="AGOS_ACR054C"
                     /old_locus_tag="ACR054C"
                     /product="ACR054Cp"
                     /transcript_id="NM_208810.1"
                     /db_xref="GeneID:4619582"
     CDS             complement(454022..454942)
                     /locus_tag="AGOS_ACR054C"
                     /old_locus_tag="ACR054C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL150W (MCR1)"
                     /codon_start=1
                     /product="ACR054Cp"
                     /protein_id="NP_983457.1"
                     /db_xref="GeneID:4619582"
                     /translation="MLSRITRSSKALNFALGTTAVAAAGYLYAQSRGNLSTSLNKGDV
                     TGQAAAQTFTGDGQWHALKIAKIEQVSHDTRRFTFALPSQDHVTGLTTASALLAKYVT
                     PKGSNVIRPYTPVSDNMARGMFQLVIKHYDGGKFTTHLFGLKENDTVEFKGPIQKWRW
                     DPNMFDSIVLMGAGTGITPLFQMMHHIAENPTDNTKVHLLYGNKTPQDILLRKELEEL
                     ASKYPDQVKVTYFVDKPEGDYKGEKGFITKDFLKQNLPTPGSNSHIFVCGPPPFMDAF
                     SGNKVSPSDQGQVTGVLSELGYTKDHVYKF"
     gene            <455219..>456295
                     /locus_tag="AGOS_ACR055W"
                     /old_locus_tag="ACR055W"
                     /db_xref="GeneID:4619583"
     mRNA            <455219..>456295
                     /locus_tag="AGOS_ACR055W"
                     /old_locus_tag="ACR055W"
                     /product="ACR055Wp"
                     /transcript_id="NM_208811.2"
                     /db_xref="GeneID:4619583"
     CDS             455219..456295
                     /locus_tag="AGOS_ACR055W"
                     /old_locus_tag="ACR055W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL151C"
                     /codon_start=1
                     /product="ACR055Wp"
                     /protein_id="NP_983458.2"
                     /db_xref="GeneID:4619583"
                     /translation="MAWPRRAAEVARSTMASRLDKLPEAVSRLQSLSHRQLLRLAQGV
                     CIPALSPSLHKGQSGRVCVVGGSLEYTGAPYFSAHAAALMGSDLVHVLCEWNAATPIK
                     AYSPDLMVHPHLRDSSSLARGLEPATEAVRALVDRVHVLVLGPGLGRDPAMLRSVAGI
                     LEYVADKHEGGIPVVLDADALLLLSEQATAAAARAALRRFPPDRVILTPNAVEAKRLA
                     GAFELDDPARLAEHLNCTVVLKGGPDRIYAPGGSSPLSCSHEGSLKRVGGQGDTLTGC
                     LAAMLAYNRAIHDFGIAEPDYTGLEGGTLSASERTALCCYVACAVARGASHRAYEAQG
                     RAMQTSDLNGHVGAIFRDFFPERQ"
     gene            <456517..>457260
                     /locus_tag="AGOS_ACR056W"
                     /old_locus_tag="ACR056W"
                     /db_xref="GeneID:4619584"
     mRNA            <456517..>457260
                     /locus_tag="AGOS_ACR056W"
                     /old_locus_tag="ACR056W"
                     /product="ACR056Wp"
                     /transcript_id="NM_208812.2"
                     /db_xref="GeneID:4619584"
     CDS             456517..457260
                     /locus_tag="AGOS_ACR056W"
                     /old_locus_tag="ACR056W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL152C (GPM1)"
                     /codon_start=1
                     /product="ACR056Wp"
                     /protein_id="NP_983459.2"
                     /db_xref="GeneID:4619584"
                     /translation="MPKLVLVRHGQSEWNEKNLFTGWVDVKLSAVGEQEAARAGELLK
                     EHNVNPDILFTSKLTRAIQTANIALTKADRIWIPVERSWRLNERHYGDLQGKDKAATL
                     AAFGEEKFNTYRRSFDVPPPPIADDSEFSQSNDERYRDVDPNVLPKTESLALVIDRLL
                     PYWQDTISKELLSGKTVMITAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDE
                     NLKPTKPSYYLDPEAAAAGAAAVANQGKK"
     gene            complement(<457331..>458455)
                     /locus_tag="AGOS_ACR057C"
                     /old_locus_tag="ACR057C"
                     /db_xref="GeneID:4619585"
     mRNA            complement(<457331..>458455)
                     /locus_tag="AGOS_ACR057C"
                     /old_locus_tag="ACR057C"
                     /product="ACR057Cp"
                     /transcript_id="NM_208813.1"
                     /db_xref="GeneID:4619585"
     CDS             complement(457331..458455)
                     /locus_tag="AGOS_ACR057C"
                     /old_locus_tag="ACR057C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL044C (GYP6)"
                     /codon_start=1
                     /product="ACR057Cp"
                     /protein_id="NP_983460.1"
                     /db_xref="GeneID:4619585"
                     /translation="MNVPVQHLVGRYPSKEQLTLKGIWGGGLYEEEELPYLNRGWCWK
                     TLLLSDQGEGSWFDIATSRAAATPEDSVRQLTGETAVEQDTDDAPLDDRLKEHATAQE
                     QLQIIQLDVSRLLLDPIFTVPEVQNDMVEILRQYMLESGRPYKQGFHELCGMFYMQLY
                     RNGYRDGIQHTTLHMFKEFIAEVAVTFYDEGNLIEWTKNTFEPILRHALPGLYEQLLM
                     HHELDNSIWLIRWSRLLFLREFELEYTLCLWDHLLTFRYPVSQLVAAIIVVCLTLIVQ
                     ELHSCEDHGDLMSILLHYPSSKLLSAPQMIRSARTLLDLWLAEQYEDMQLICDSLIKS
                     HNGAWFGRMQAAADGGHRLRLEERLKRRVGERIRRHHSVR"
     gene            complement(<458702..>459172)
                     /locus_tag="AGOS_ACR058C"
                     /old_locus_tag="ACR058C"
                     /db_xref="GeneID:4619586"
     mRNA            complement(<458702..>459172)
                     /locus_tag="AGOS_ACR058C"
                     /old_locus_tag="ACR058C"
                     /product="ACR058Cp"
                     /transcript_id="NM_208814.2"
                     /db_xref="GeneID:4619586"
     CDS             complement(458702..459172)
                     /locus_tag="AGOS_ACR058C"
                     /old_locus_tag="ACR058C"
                     /note="NOHBY320; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACR058Cp"
                     /protein_id="NP_983461.2"
                     /db_xref="GeneID:4619586"
                     /translation="MQGGNNSQRAHDGMYYTELRLPTIPEEVEPRDADGGSQSSFESQ
                     AWHTWPDSPLTAVSAGEGAEMRTMVDELVEMYHADVRHRDMHARFIREYVQALESQYE
                     FDSVVMAPLQYLQSMIRPLREVVNGTGSAGCRVRGELPVWWGCNNEENCPPPLL"
     gene            <459750..>463400
                     /locus_tag="AGOS_ACR059W"
                     /old_locus_tag="ACR059W"
                     /db_xref="GeneID:4619587"
     mRNA            <459750..>463400
                     /locus_tag="AGOS_ACR059W"
                     /old_locus_tag="ACR059W"
                     /product="ACR059Wp"
                     /transcript_id="NM_208815.2"
                     /db_xref="GeneID:4619587"
     CDS             459750..463400
                     /locus_tag="AGOS_ACR059W"
                     /old_locus_tag="ACR059W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL042W (MHP1)"
                     /codon_start=1
                     /product="ACR059Wp"
                     /protein_id="NP_983462.2"
                     /db_xref="GeneID:4619587"
                     /translation="MKQDQRPAMESMEAKKKRREMLLDDGSIPQVDVNWLFTGNSKAP
                     DPSRCGRVPSLENLSVLPQSGHEARQERRNSEACSVPASQQNETALRRTQSLSTDSKG
                     HTSNGTRKRSFLTRMFGRRKDRQMRSSPAARSEQRTGSSAGAHCVQASFDESGLMRMQ
                     TEPAKGREEERLRDFLRYYGKVGFETFQRQLAEKARSTAARPTGHLAPSFEGTQPLKD
                     PGCFEHYFEHYPVDRLGRRIPPHPDAHRFPSILKHVKRSAYSDGTIPRVKAENATTNK
                     FEALLRKVASYSSDESPSGSVGLYGDTETNGIYGLGNNGPAKYSNSFHDIPGLEEQKP
                     LKRVSFARNTYFNSPPQQICSRNPRKGEVEVKADGSVVIHKLTASERRILIQNSTGGL
                     VVGGSGHLKLINPFQTTDEGEHDHDKLHETYDTPVKRPSSPPPPSAGSGNSSSLSDSS
                     LSVESIASGSSESLLPPRMPNIPNDMLYTRCCYLREILPIPAMLKQLKPGSSDPIPLL
                     QLRNPKPSMIEILSLGDFLSIAPVLCFSMDGVSLSVQMLHIILSSLRCMGRLEKLSMR
                     NTPLDEEGWKTLAYFISSSKTLRGLDLTMIPGIPLNVQKPSKSSGQCSIPRMKCDLTS
                     RAEQNWNLFTAAIAINGNLEELIISGAKISLGQFKILLDIGCHSLERLGLAFNDLSHG
                     HCEALASWLPGCKVTGLDIGFNPLNGKMRPLAEALMRKSKVGNNSIACISLNSTDLAI
                     PPNATVETSDVVALLSALGYCENLKFLDLSNNPNMFIYGMKPLTDILPVLVGFARLQL
                     DYNNLSSTSIITLAEVLPMCTTIGYLSLVGSKLDTSSGAALVLALKKSGSLFTIDADF
                     SEMPDAIRHDVSIYSLKNLENVLELSKTGHDMGKSTSLQQELAVLLAGKTQDKEDYDH
                     LVESFAKRICDIRKRLKTVTKDLFKLRVRGELSTEGKETLIRFCFLDSSFEKALGLLA
                     QRDKSQALIWKQFLNESEGSSPDTAKAAEDELKNMDSEADSCIRHVPSINGLSSKTFR
                     ESGHAALLPFQQPPIEKLVPADDAIELRCSAHSASSHADEQTREEGEMLRKTHGIIKG
                     LEKSAKDRGTPLYTETLKKIGEGYDCDTIKKFLLGRDVNDIIAILDELQTSGVGIDDI
                     FKKGRFNSDQNIHTKLSNAERPVQLSSASELQLGASVEPDDDNTYSALIDRAYDDVLD
                     DLERTRSNHERA"
     gene            <463770..>465865
                     /locus_tag="AGOS_ACR060W"
                     /old_locus_tag="ACR060W"
                     /db_xref="GeneID:4619588"
     mRNA            join(<463770,463860..>465865)
                     /locus_tag="AGOS_ACR060W"
                     /old_locus_tag="ACR060W"
                     /product="ACR060Wp"
                     /transcript_id="NM_208816.1"
                     /db_xref="GeneID:4619588"
     CDS             join(463770,463860..465865)
                     /locus_tag="AGOS_ACR060W"
                     /old_locus_tag="ACR060W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL041W (NSP1); 1-intron"
                     /codon_start=1
                     /product="ACR060Wp"
                     /protein_id="NP_983463.1"
                     /db_xref="GeneID:4619588"
                     /translation="MSGTFNFNTQNNQGKPGDSKPAFSFGNAGNTATNTFSGFGSGSS
                     GTTPAFSFGAAKPADGTGSAPAFGGFGANKQSTANSTPVFGGFDAKKTEGSPAPSFSF
                     GGAASSAQKTEPVKQSNSTGAFTFGNTSTPSFGATEKKEENKPLFGSTASNSISSNGP
                     FPFASSAPSGKIEDKKPAFTSGAKPLFGSNKDDAPKPAFSFGASAASTEKKDSPAKSA
                     SPFGITPPAAAPEQKKADSTPAFSFGSSTTSGEQNKTTNAPSLFGNAAPVNVKEEAPK
                     PAFSFGNASSQPVKKETTPKNAFSFGESKVTATKEGDASKPTLSFMGSTKTNTQSEDA
                     PKPAFSFGASAKTGETPKPSFSLSNATDKKEPSAKPAFSLGTATDKNPAAPAFSFGST
                     TTSNASTSTKEGANKEVTPKPAFSFGKKDEGKKEDNSGSTPGTSATSTVTSAPPPPTA
                     SSAATATTNAPSSATTSKSVEPQPISLDNKTLDDLVTKLTTQLTGSAGHFETYAKKIN
                     EWDQVLVQGGEQISQLYSDTLIAEQTQSRVDQHLQYIERQQNELETFLDNYEKKAETL
                     LSEIFSSNTGSPANTNDQKRQQAFRTAEILDENLNALSVNLSSLISEINEVSETFNKA
                     TNMNIANKDEHAQLIKLLNSHLDALNSLDNSSTTLEKKLKSLHK"
     gene            complement(<466023..>470975)
                     /locus_tag="AGOS_ACR061C"
                     /old_locus_tag="ACR061C"
                     /db_xref="GeneID:4619589"
     mRNA            complement(<466023..>470975)
                     /locus_tag="AGOS_ACR061C"
                     /old_locus_tag="ACR061C"
                     /product="ACR061Cp"
                     /transcript_id="NM_208817.2"
                     /db_xref="GeneID:4619589"
     CDS             complement(466023..470975)
                     /locus_tag="AGOS_ACR061C"
                     /old_locus_tag="ACR061C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL039C (NUP192)"
                     /codon_start=1
                     /product="ACR061Cp"
                     /protein_id="NP_983464.2"
                     /db_xref="GeneID:4619589"
                     /translation="MKWSVLPFEELYNSIQAEQFDLQLYNSLLPDLKELNLSDKYPRN
                     DTSRKQLETGEITLSDGDRYKINQQFIIAAVQLADELNLDELAVAELLLSSDEELDAL
                     DQDLLLLNQGKVRFYLRKQFILQVVSYVVNVHSSESEVYRAIVEDGQLIDKILKGCKA
                     VHQQLDDIKQSINKAQILDTYDSLFQQNVNFKRDFLLKEYDILAQILYGVVKNSTKFD
                     KDKIMSVIDHVSGMDSDDFFIMYYMPALFLAWSKLSNFSESDVKALHYAFVKEINNEG
                     IYTKPVKVTLIFVFLTYFIGWCKAAPTKRAKAFDFENTVDKPMTVAVEQGALEQLMVF
                     AAETSTVEQDKSMELFYDMRSLLERHIPRLLPKQLMDMEHRTAVVIKPVSQVPNKFSK
                     ITFSAQLESQFLYVFDDFIRASISDCAFLLTKVKNAEEDSLLSGEDLYLDDISAKADL
                     ERFFLVVYYFYASRPSLSQFFWQDSESTFYGFIEWAAKCNDNLMKSCFYLMMSSLSYG
                     EENATNVYHYINGNQAISWHTIAQIISDYTVKISIVEKKMMELQPQSEEEKANFNNVA
                     LQEGLNEEVVILLSSLLTLIGSVAYDLPTEIQLSLTEMFTEVLFEFIKVNTPLIGATM
                     KVLGTLVPLTQEKREIFWTNLDKWIFKGSPLNSTDDSYRMAFQSVLTNFSDVSGFLRL
                     FSCMLAANTKNGSGKVAFGKLPYPIKLGAAYRKSGIWPYFDFIFHEIFAHVTQLTDVP
                     EKFSIVDPIFSIIQHSLSSFDYSVLLNSITAGVNLDSLIEFGDFFTYVEESPATAAFN
                     YLFEEKFFKIIFNIASAGVDELSGDLETTGQQLKMARAAIRILNMLLTYEGTYTEELC
                     PIVKKHHKETHFIPKNFGLHGLSSYYDAILFDLPLIAHCGLYIGIPDYILASESLDLL
                     KKISLRFPYSDTRKNKVLTVFESVDESARIKEAFISQVSSFIDSEESLSLKLAILDFI
                     NMNLSYTNKTVTVAHFLLGFQVTNILSLGPTLSTFINSPSSLLNSLLDILLSSLASIN
                     PRNVDYAPIRLASILMEIIVKLCRNTLTSRLTLDFLSSKGLFERIIELDPNIDNTSLW
                     CDQSLHGSFNNINSSVLDGPAVGALLAFLRYRSHLLQYLSLDLHWLSTESQQSKISAA
                     VAVLISSEIHAPTIFAFLDTLTYSKLPVAGDPPKDLTLFKNLDLSVNKIKLSSSCTGN
                     IYDFSSLDALLDLSFRTHALSVPAVDVQETSLQSIAKEETLKIKRFITTCLAHESYSS
                     LQLSVLHSWVQLVQIVVLDGSLTPVERSNFVLEVFEAIVPKINDYVEFDVAYSEELVS
                     LSVFLYDLYQKDRIQIDQEKTIDGRLHALFKTCIHGITSPLSTLCLRSDFYVLANKYL
                     LRIIKEESLAKEVLQSLKMASERLVEVICNDAISGEGSNKITGILLLDALAQIACLNK
                     TNFILDVLMKSNMLLLIIRSIKATDELLSVSSHTITLDTLLYELTAFKSTVYFLIRLA
                     KTRSGAQALIQNEIFNTIESCSFLQIDPDLGLELIFDEISVKNSNFVRVNLNLDNPLT
                     LGSQANGISLFEIVVPIFQLIVSILLSMGNANRPVMKSVKKLLVHFRKLVQGVLKRDA
                     LLESNEKYVVDDSTMEGLEQQVKLVVLLCTLTGYLGEQDV"
     gene            complement(471125..471196)
                     /locus_tag="AGOS_t0053"
                     /db_xref="GeneID:4619590"
     tRNA            complement(471125..471196)
                     /locus_tag="AGOS_t0053"
                     /product="tRNA-Arg"
                     /codon_recognized="AGA"
                     /db_xref="GeneID:4619590"
     gene            <471356..>471583
                     /locus_tag="AGOS_ACR063WA"
                     /db_xref="GeneID:9487597"
     mRNA            <471356..>471583
                     /locus_tag="AGOS_ACR063WA"
                     /product="ACR063W-Ap"
                     /transcript_id="NM_001355305.1"
                     /db_xref="GeneID:9487597"
     CDS             471356..471583
                     /locus_tag="AGOS_ACR063WA"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIL102C-A"
                     /codon_start=1
                     /product="ACR063W-Ap"
                     /protein_id="NP_001342247.1"
                     /db_xref="GeneID:9487597"
                     /translation="MLKFALLLGIFSYYTAWLLLPIFDLDGKLWLFPLPSLYAVLLPI
                     VLLLCGAFIVGSSLGALLLTSKRNVDYVHYK"
     gene            complement(<471608..>472357)
                     /locus_tag="AGOS_ACR063C"
                     /old_locus_tag="ACR063C"
                     /db_xref="GeneID:4619473"
     mRNA            complement(<471608..>472357)
                     /locus_tag="AGOS_ACR063C"
                     /old_locus_tag="ACR063C"
                     /product="ACR063Cp"
                     /transcript_id="NM_208818.1"
                     /db_xref="GeneID:4619473"
     CDS             complement(471608..472357)
                     /locus_tag="AGOS_ACR063C"
                     /old_locus_tag="ACR063C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL154W (SRP102)"
                     /codon_start=1
                     /product="ACR063Cp"
                     /protein_id="NP_983465.1"
                     /db_xref="GeneID:4619473"
                     /translation="MMDTTVYIALVIALITTAAVLIIIIHSGQAISVGSGSKKRVTSS
                     PIFIIAGPSGSGKTSLFNLLTTGEAGKTVASQIASFSDSFMLPSGVEKFKFALIDFPG
                     HVKLRQELFTTLKASSNIRGLIFMVDSTVDPKRVTETAEFLYDVLSITERKPQAIDIM
                     IACNKSESFTSRPPTMIKDALEKELGQIIERKSKDLKGAGEDDLTTVFATSGSAFKLD
                     HLEAAVQVCAGSVLNKDIDPWQAWLDENATN"
     gene            <472523..>474652
                     /locus_tag="AGOS_ACR064W"
                     /old_locus_tag="ACR064W"
                     /db_xref="GeneID:4619591"
     mRNA            <472523..>474652
                     /locus_tag="AGOS_ACR064W"
                     /old_locus_tag="ACR064W"
                     /product="mitochondrial 37S ribosomal protein RSM22"
                     /transcript_id="NM_208819.1"
                     /db_xref="GeneID:4619591"
     CDS             472523..474652
                     /locus_tag="AGOS_ACR064W"
                     /old_locus_tag="ACR064W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL155C (RSM22)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM22"
                     /protein_id="NP_983466.1"
                     /db_xref="GeneID:4619591"
                     /translation="MLGRRVAILQVNRRVISRKAFIGADIPDSLLNPRANAPLAGSLA
                     ASADTSLVIDRETLINGVASPFRNELGETIKGSNAQESRLAEATLAGMAPRGQIQLNP
                     EIAKVIRKNILSLHVPSSIRSTAARHFVEIYERKIHRPAATRMEVDAHVAALFLQNYA
                     AIYQTLSELRKRVGPGFNPERVLDVGYGPATGIVALNDLMGPEYRPSVKEAVILSHPD
                     MQKRAKIILSRQLNEVPDSSAAAVEELLETQQSEGENMDDIPEEDDLVGEVMTKKINI
                     NTRLRKDVPGSQYYDLIIVTHQLLRQEERFPVQVDENLEHYLNLLAPGGHIVIVERGN
                     PMGFEIIARARQIMLRPENYPEERGKIPRPWIRGSTTKPYNYTVVPEKHTEGSNEIEE
                     GTALLKEITEQHGEVKEADLEFEPELMESLRDRSSTREADYHLKIVAPCPHHGKCPLQ
                     TGKPAYYELDEGASLKFCNFQQSVERPKYTIELKKGKVLATPWQTPTDAIGIKGKAKA
                     GSGRENGKNSEVVNYSYLIAERAQNDSATIAAINAQRQRSGAAESGSTVANASETWPR
                     VIRQPTKRKGHVMLDLCAPSGQFEKWVVSKSFDKQAYHDARKAQKGDLWALDAKTKIP
                     GKGALNVAKLEKRHKERIKAAKLESKEKSRIVREEAAELEAVEDSSPAHMEATINALA
                     NLHADSFRSASKKRDKNRKLAVDAIRK"
     gene            complement(<474760..>475257)
                     /locus_tag="AGOS_ACR065C"
                     /old_locus_tag="ACR065C"
                     /db_xref="GeneID:4619592"
     mRNA            complement(join(<474760..475005,475255..>475257))
                     /locus_tag="AGOS_ACR065C"
                     /old_locus_tag="ACR065C"
                     /product="40S ribosomal protein S27"
                     /transcript_id="NM_208820.2"
                     /db_xref="GeneID:4619592"
     CDS             complement(join(474760..475005,475255..475257))
                     /locus_tag="AGOS_ACR065C"
                     /old_locus_tag="ACR065C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR021C (RPS27B) and YKL156W (RPS27A); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S27"
                     /protein_id="NP_983467.2"
                     /db_xref="GeneID:4619592"
                     /translation="MVLVQDLLHPTPASEARKHKLKTLVQSPRSYFLDVKCPGCLNIT
                     TVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK"
     gene            complement(<475709..>476731)
                     /locus_tag="AGOS_ACR066C"
                     /old_locus_tag="ACR066C"
                     /db_xref="GeneID:4619593"
     mRNA            complement(<475709..>476731)
                     /locus_tag="AGOS_ACR066C"
                     /old_locus_tag="ACR066C"
                     /product="ACR066Cp"
                     /transcript_id="NM_208821.1"
                     /db_xref="GeneID:4619593"
     CDS             complement(475709..476731)
                     /locus_tag="AGOS_ACR066C"
                     /old_locus_tag="ACR066C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR022C"
                     /codon_start=1
                     /product="ACR066Cp"
                     /protein_id="NP_983468.1"
                     /db_xref="GeneID:4619593"
                     /translation="MSVSPLVLFDFSTDNPNTLPREYDLAVARICVLGHGGSGKSSLV
                     LRWLHGLESGLELGSLAEDIYHKRVNYEALHLSRSQNEYRDLCANPRRLSRDARRAPH
                     NVNPLDAPLVVRHHELDVQLLDAAGMDPSDYSEIRRLQVEQADGFVLCCDYTNEESLG
                     TLQLLHRYVVSLRGDDVPIVISCCKCDLEDDRTVFLSDVQQLAREFELPPDSVLETSA
                     LENVGVDELFFLLLQRIDYYKEAMRAERRRQAGCDDFDCAPRPDPERRSLASPPPPST
                     RHSPDSTLLRSAASSDMACPSARVFSAPTSTTPSISRLASPPIKRRRPTIRRMRSQET
                     SSCIIV"
     gene            complement(<477457..>479196)
                     /locus_tag="AGOS_ACR067C"
                     /old_locus_tag="ACR067C"
                     /db_xref="GeneID:4619594"
     mRNA            complement(<477457..>479196)
                     /locus_tag="AGOS_ACR067C"
                     /old_locus_tag="ACR067C"
                     /product="ACR067Cp"
                     /transcript_id="NM_208822.1"
                     /db_xref="GeneID:4619594"
     CDS             complement(477457..479196)
                     /locus_tag="AGOS_ACR067C"
                     /old_locus_tag="ACR067C"
                     /note="NOHBY321; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E11594g"
                     /codon_start=1
                     /product="ACR067Cp"
                     /protein_id="NP_983469.1"
                     /db_xref="GeneID:4619594"
                     /translation="MAKKWGKGGQNVGTLDHCGMRMCAVSEEQQGMPALPLEVKTEIV
                     RHLSQHDLVGLASVSRAFHGTALAAIYREVVVEVGERGPVERSAVGRGTVIRSAASWR
                     RFVGVVRERRTRGELVRAVRILCLPVGVKRCESHYFVQEVLPLLTQLREFRYHIRADW
                     IPDDVYAHLPQQIALIDMPLKPIVAARKQKFLIQELLCKTYVCKGALHQYLRDISACS
                     WELRQNLTKLQLHRDGMSHSFTPRAVNVGQSLVVTQYMIDNNLPQPDGAIRDFAVIYG
                     DLDTNFWDFLKDIGPLENLRELDISGADFRPSDAVTVRNNIALRHVETLSFTNVNEIQ
                     VLPEISYEVSDMRWLLDTHFRQGFLPSIAREFRNLRRLRLDYKEAVRDSTPEFLKELA
                     GAGVRLVEIDLMIRWDKSRALTETWESTTERYVQGITAHRATLNKLSLLAKEELNYFE
                     LHKNIPAASLSKLARCENIQSLRIYGDSLQNCGGDLLEAFPRLKYLDLCGREAAGPPH
                     LGLYPAREAKLDNWYRTIHIPVRLAERITPLRFVRINTCLFECPADGPVSPCPQGFDR
                     WFERRTRVSMADD"
     gene            <480140..>485557
                     /locus_tag="AGOS_ACR068W"
                     /old_locus_tag="ACR068W"
                     /db_xref="GeneID:4619595"
     mRNA            <480140..>485557
                     /locus_tag="AGOS_ACR068W"
                     /old_locus_tag="ACR068W"
                     /product="ACR068Wp"
                     /transcript_id="NM_208823.2"
                     /db_xref="GeneID:4619595"
     CDS             480140..485557
                     /locus_tag="AGOS_ACR068W"
                     /old_locus_tag="ACR068W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR023W (MYO1)"
                     /codon_start=1
                     /product="ACR068Wp"
                     /protein_id="NP_983470.2"
                     /db_xref="GeneID:4619595"
                     /translation="MSEQCQMIWVPDAEEVFVKGQLVSTKTIKNKQNKDEKVCLVRVN
                     GKEREVLEVETAAVNPSTFDKIDDMSELTHLNEASVLYNLENRYKDDMIYTYSGLFLV
                     ALNPYSNIKVYTQDYVNLYHGSPKEDNEPHIFAVAEQAYRNLLTQRQDQSVLVTGESG
                     AGKTENTKKILQYLASITSDEKLAHTNLESFERKILQANPILESFGNAQTVRNNNSSR
                     FGKFIKIEFDEFGKINGAHIEWYLLEKSRIIQQNIRERNYHVFYQLLSGMPAGKLKTL
                     ELVSNSITDYAYLRDSNPSIPGVDDAHDFSSLLSAFNVVGFKEDEIHDIFQCIAIILH
                     IGNVEFTSTRAEQATIKNDVAPLCKLIGVDEAAFKMAVLKPKSKAGKEWVSQSKNAAQ
                     SRFILNSLSRSLYEKLFAHIVRRINRSLDHGSMTENYIGLLDIAGFEIFKDNSFEQLC
                     INYTNEKLQQFFNHHMFVLEQREYVKEDIQWDFIDYGKDLEYTIELIEKKNNPAGILS
                     ILDEESILPKSTDESFYSKLMSAWDGKSPKFKRSKLQQCFVLEHYAADVEYNVKDWLS
                     KNKDPLNDHLLTLLSESSNKLISEFYTEQSRGHFSKTASNRHKEQLTLLLDQLSSTDP
                     HFVRCIVPNTKKKAKTFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFREFFQRYKIL
                     GADPKFSNNSKKNCEYLLSCISLDPSLYKVGNTKLFFKAGVLAQLETQKEEKISGIVT
                     GLNAIIHGKTVRTAINLQFQKLQAAKVLSTTFNLYSKLMEDPWYSLYVKVKPMLGSSQ
                     FIAKSKKIAEQVKQLEKDLSATKSERDDLATKNFNVEKELAEIRTALSKETEKLQNFE
                     RLYDTAKKREEELRSAYEEAVKLKDTLQSETTINNEEYQKLQKELQQLKESREQSNTK
                     IKELETEKSNLQKQIDSMKRQVDSSTKQAMAMKADKSDLESQLRKLKLELKSKEKRVK
                     ELEQKVDNSGEDLKLKLQQVERAAATNNKRLEQLTSENKLMKDQMEKSKKEQHESQRQ
                     LSSRGSELIRLNERIEAEREQVSDLTRERDNLVAEHEQVVNQLAIARSEIAEYKKKIE
                     ALKAEAENMKENYAESSPASQALVATVENRMRGLEDELTKERAMNRFLNEKLLSAFHN
                     GGVHDAQYKESATKEDLIACYEEAKLKLRKTAFRLEKELEEKKELISRLRFTETRLAS
                     ASFDNQTICMQLKKLKELLRKSNKNINMEKELEEVDIIEFNHEKLLLEIDYLKRQLEH
                     ERNARVNAEHVASSLHSKFRQIQRSDSIPDIYKLKYEASEERVRALESKLMSSPLKDK
                     TNTSNGEIFLHRESISKYEDELKLHKLENYKLQDYLKESNKQLSTLTHELKVAKMAET
                     AMHDQLVQLEQDLASTEKQKQLLQSSVRHHQTQYENCINDLHATEAQMRDLVHSLKQS
                     EEDIQTMTDLIQKLRSQSKQKDMLIWDLEKTIGQLEGKLGDRTRAESELKKELTTLTY
                     KGNVLRAETASKIDDLLQQSTHYDAIIQDLVSQKEAAESLQTALQNKLNALTSQMDNM
                     AKDLNSLATEKLQLENDREMLLSKLKTTNVDFEKSINERTNIVNELEFLREQMVLQQR
                     QNERNESLIEQIQEEALRIKSQLNDERNKNIELYEQNQSLGRTNMQLGQRLEMLEGGL
                     ADGSEKRVWMKRIHELEMRLNEESELKFEEMKRNQGLQRMLEELKSATNNQENIISIA
                     SKDRDVVEKQFAEVASRVDGMEKYISKQDGAFKKMEQENTYYKNRIAELEQEIFLWQE
                     RYKGLSTHRRSLAQSTEEVLI"
     gene            complement(<485715..>487190)
                     /locus_tag="AGOS_ACR069C"
                     /old_locus_tag="ACR069C"
                     /db_xref="GeneID:4619596"
     mRNA            complement(<485715..>487190)
                     /locus_tag="AGOS_ACR069C"
                     /old_locus_tag="ACR069C"
                     /product="ACR069Cp"
                     /transcript_id="NM_208824.1"
                     /db_xref="GeneID:4619596"
     CDS             complement(485715..487190)
                     /locus_tag="AGOS_ACR069C"
                     /old_locus_tag="ACR069C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR024C (MAS2)"
                     /codon_start=1
                     /product="ACR069Cp"
                     /protein_id="NP_983471.1"
                     /db_xref="GeneID:4619596"
                     /translation="MLRCLSGKLPSRIIKCRGYSTEAMAENFELSTLPNGLKVATSNV
                     VGHFSALGMYAGVGTRHEVKNLRGCTNIIDRLAFKSTENMSAVQMAEALERLGGNYQC
                     TSGREYMMYHASVFNRDVEKMLSLMADTVRRPQISEQEVEEQKSAALYDAKGVRHNHE
                     MLLPEMLHEVAYRGEALGVPMATAEEAIRGVSRYHLRDYRNKFYNPQNFVAAFIGVPH
                     EEAVAMASRQFGDMENKYPPHATQPARYIGGMANSLERNNNPSLPEMYHMQIAFESLP
                     IDHPDIYTLATLQTLLGGGGSFSAGGPGKGMYSRLYTNVLNKYHFVDNCMAFHHSYSD
                     SGLFGISISVYPNAARYMAPIIAEELISLLPGGKYKLTEEEVDRAKNQLKSSLLMNLE
                     SRLVELEDLGRQILLRGNKIPVAQMISKISEVTPEDCMRVAELVLTGSVENSLSGTGA
                     PTIITQGSESAFGDSLHVLKHYGLGRYDRITQGTGSFGWSA"
     gene            <487566..>488642
                     /locus_tag="AGOS_ACR070W"
                     /old_locus_tag="ACR070W"
                     /db_xref="GeneID:4619597"
     mRNA            <487566..>488642
                     /locus_tag="AGOS_ACR070W"
                     /old_locus_tag="ACR070W"
                     /product="ACR070Wp"
                     /transcript_id="NM_208825.2"
                     /db_xref="GeneID:4619597"
     CDS             487566..488642
                     /locus_tag="AGOS_ACR070W"
                     /old_locus_tag="ACR070W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR025W (THR1)"
                     /codon_start=1
                     /product="ACR070Wp"
                     /protein_id="NP_983472.2"
                     /db_xref="GeneID:4619597"
                     /translation="MQRKFKIKVPASSANIGPGYDVLGIGLGLFLELSVSINSEQAQL
                     TNADPNNCHLEYTEDSEGYASVPLRSDENLITRTALYLLRCNNIRSFPAGTQIVVHNP
                     IPLGRGLGSSGAAVVAGALLGNEIGQLGFSKQRVLDFCLMIERHPDNITAALMGGFCG
                     SFLRDLTPAELERREIPLAEVLPGPRASGGEDTGMSPPEPPFNIGQHVKYNWNPAVKC
                     LVVIPNFELSTATSREVLPQAYTTKDLVFNLQRLAVLTTALSQNPPNPELIYPAMQDR
                     VHQPYRKTLIPGLSEILSSVTPTTHPGLLGICLSGAGPTILALATGNFEDIAGEIVAR
                     FSKWNVTCTWKLLDIAEQGSAVEA"
     gene            <488919..>489554
                     /locus_tag="AGOS_ACR071W"
                     /old_locus_tag="ACR071W"
                     /db_xref="GeneID:4619598"
     mRNA            <488919..>489554
                     /locus_tag="AGOS_ACR071W"
                     /old_locus_tag="ACR071W"
                     /product="ACR071Wp"
                     /transcript_id="NM_208826.1"
                     /db_xref="GeneID:4619598"
     CDS             488919..489554
                     /locus_tag="AGOS_ACR071W"
                     /old_locus_tag="ACR071W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR026W (VMA16)"
                     /codon_start=1
                     /product="ACR071Wp"
                     /protein_id="NP_983473.1"
                     /db_xref="GeneID:4619598"
                     /translation="MSSKGYKKPSLYGYAKIYIYSFLTLIVGSYGLYKLLTNHGEDIN
                     IGKFLSRTSPYMWANLGISLCIGLSVVGAAWGIFITGASIIGAGVRAPRITTKNLISI
                     IFCEVVAIYGLIMAIVFSSKLTVATPETLFSKSNLYTGYSLFWAGITVGVSNMICGIA
                     VGITGATAAVSDAANSALFVKILVIEIFGSVLGLLGLIVGLLMAGKTVEFQ"
     gene            complement(<489698..>492670)
                     /locus_tag="AGOS_ACR072C"
                     /old_locus_tag="ACR072C"
                     /db_xref="GeneID:4619599"
     mRNA            complement(<489698..>492670)
                     /locus_tag="AGOS_ACR072C"
                     /old_locus_tag="ACR072C"
                     /product="ACR072Cp"
                     /transcript_id="NM_208827.1"
                     /db_xref="GeneID:4619599"
     CDS             complement(489698..492670)
                     /locus_tag="AGOS_ACR072C"
                     /old_locus_tag="ACR072C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR027C (RPN1)"
                     /codon_start=1
                     /product="ACR072Cp"
                     /protein_id="NP_983474.1"
                     /db_xref="GeneID:4619599"
                     /translation="MVDDIRNNEDKQIGSASGLQTPSAKKGKTKDQKQEEELSEDDLR
                     LKADLETLVQRLLESDASLCEQSLAQLKEFIKNSTSSMTAVPAPLKFLRPSYPDLCAV
                     YDKWVDPKLKSLLADVLSVLSMTYSDEGKHDSLRFRLLSNEKDIESWGHEYIRHLALE
                     VGDVYNEQVENESDETYDQESKRAISDAEFPKDVLVQLALDIVPYFLKHNGEADAVDL
                     LLEVESIDKLPQFIDENTFQRVCQYMVSCVPLLPPPEDVTFLQTAFSLYLSENQLTEA
                     LALAIRLGEESLIRSVFDATTDPVMHKQLAYILAAQKSSFEYSAVQDIIGSTKLSEHF
                     LYLAKELNLTVPKFPEDIYKSHLDNSVRSAFASSGLDSAQQNLAASFVNGWLNLGYCA
                     DKMCLDDDNWVYKTKGDGMTSTVASIGSIYQWNLDGLQHLDKYLYADDVEVKAGALLG
                     IGVSACGVHDGDVEPALLLLQDYVTNPNAKLSSAAILGLGIAFAGSRNDELLSLLLPI
                     AADTSLSIETSAMASLALAHAFVGTCNGDITTSIMDNLLERSSIELKTEWTRFLTLAL
                     GILYMGQGDQVEDVLETISAIEHPITSAIEVLVNVCAYTGTGDVLLIQDLLYRLTPKK
                     EEEEEDDDENEDGENDEDGDDAEGERDGSGQNIPEDIDSLVQEVMNTASTTEDSAISN
                     EESTSTSKKADEDKMDVDNSKEEDAKNGDQGKHESKDDESSEKSMAHIDELTYSVLGI
                     AMVAMGEDIGKEMSLRHFGHLMHYGNQHIRRVVPLAMGLVSVSDPQMKVFDTLSRFSH
                     DPDLDVSINSIFAMGLCGCGTNNARLAQLLRQLASYYSKEQNTLFVTRLAQGLVHLGK
                     GTMTLDVFNDAQVLNKVTLASLLTVLIGLTSPTFMLKHHQLFYYLNSGIRPKFILTLN
                     EEGEPIKVNVRVGQAVDTVGQAGKPKTITGWITQSTPVLLNHGERAELETNEYISYAS
                     RIEGVVILKKNPNYKEEE"
     gene            complement(<492978..>495596)
                     /locus_tag="AGOS_ACR073C"
                     /old_locus_tag="ACR073C"
                     /db_xref="GeneID:4619600"
     mRNA            complement(<492978..>495596)
                     /locus_tag="AGOS_ACR073C"
                     /old_locus_tag="ACR073C"
                     /product="ACR073Cp"
                     /transcript_id="NM_208828.2"
                     /db_xref="GeneID:4619600"
     CDS             complement(492978..495596)
                     /locus_tag="AGOS_ACR073C"
                     /old_locus_tag="ACR073C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR028C (DAP2)"
                     /codon_start=1
                     /product="ACR073Cp"
                     /protein_id="NP_983475.2"
                     /db_xref="GeneID:4619600"
                     /translation="MVPSPAFVDGPAGCFKCRFCESSRRYQEPAIRSLQHNRLTMAAQ
                     QYRYSDHSMSSTLKLPEEDYDELEDECKRQNRQLALNFTRIGLVVVALVWGTFLLLNS
                     IPVLEESSRAQPTTSSRATRSGKLKVDFEAVRGQKFKPRFQQLQWTHGLSSVHDDKGL
                     FVKKEDDVYSLKSVFDENYTRELFRGNTFEHEGVGYVVEGFVAAPDLSYGLVRTNSTK
                     NWRHSTFATYFVYSIEKRDFHPVGQKLAVAEWSPDSQRIAYVKDNDLYLHSVADGKVS
                     RVTSDGSATIFNGRSDWVYEEEVLSSGVALWWSPTGKYVAYFKINEEQVHEFPIAYYL
                     QEADALYPEVRKIKYPKSGTPNPIVTLNIFDVAAEKNSVVNFGDNATLITEVVWVGEN
                     QVLAKYMDRSAQVLTVALVSTDENKPFTTPRVESTNGGWWDVGQTVMYVPRNDTNDRA
                     NDGYIDVVSVNGYNHLAYYSPPSASTPTILTSGAWEVVGGPVAFDLDTNDVFFIATRK
                     SSNERHLYYVNLFQPNDVQEVTDTSKEGVYDVSFSEGSRFLLLTYRGPGVPYQKLVDL
                     KSLGSDSDSNGNVFGETLYYLEENNALKENLKEYSFNYPKFQELNLGDDSEGQKVIAN
                     SYEILPPDFDSNLRNHYPVFFFAYGGPGSQLVKKEFAVSFLQVVAAQLDAIVVVVDGR
                     GTGFKGKPFRAVVTGDLGHYEAEDQIAAAKLYSEKYYVNKERISLFGWSYGGYLTLKT
                     LERDAGRYFKYGIAVAPVTDWRLYDSVYTERYMSEPLSNPRGYADAKVHNVSALAKVP
                     RFLLMHGTGDDNVHFQHTLVLLDQLNLAGVENYDLLVFPDSRHSIDIHNANVIVYDKI
                     LNWANQAYSGAFVDPK"
     gene            <496155..>497387
                     /locus_tag="AGOS_ACR074W"
                     /old_locus_tag="ACR074W"
                     /db_xref="GeneID:4619601"
     mRNA            <496155..>497387
                     /locus_tag="AGOS_ACR074W"
                     /old_locus_tag="ACR074W"
                     /product="ACR074Wp"
                     /transcript_id="NM_208829.1"
                     /db_xref="GeneID:4619601"
     CDS             496155..497387
                     /locus_tag="AGOS_ACR074W"
                     /old_locus_tag="ACR074W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL036W (SNX4)"
                     /codon_start=1
                     /product="ACR074Wp"
                     /protein_id="NP_983476.1"
                     /db_xref="GeneID:4619601"
                     /translation="MSEIKLGDQWFIIVSDPQKQRGDKSSSGSYVTYQISSKPATEGD
                     KRSGEDDITVVHRRYSDFVLLYQILANDYPACIVPPLPDKKVLNYLDRFSQSFTQKRC
                     HSLQNFLQRLAQHPVLSQSKILHTFLVSSDWDAYQKSLAETVGNLSNKEELTETIMNA
                     FKSVHSQSDEFVEIKEKSGKLDHNVSKIDKLFHRVVKKQEAIAEDYGKLGLSLRELQE
                     LVTTGDDRNSEVGNLGTKIKTFNEGMAQLSYSLRDLSRYIDYEYIIDLRDMEDYIDSM
                     KQLIKLKDQKQIDYEELSDYLTRSINEKNNLISGYGSGSNFFKSKLEEFTGINQEAAR
                     REKISKLESKVQALTTEVENAKKVADAFEKEALKEVEIFEQIKTRELKRSLTTLADHH
                     IEFYQKMVNTWSKIEESL"
     gene            complement(<497466..>498203)
                     /locus_tag="AGOS_ACR075C"
                     /old_locus_tag="ACR075C"
                     /db_xref="GeneID:4619602"
     mRNA            complement(<497466..>498203)
                     /locus_tag="AGOS_ACR075C"
                     /old_locus_tag="ACR075C"
                     /product="ACR075Cp"
                     /transcript_id="NM_208830.1"
                     /db_xref="GeneID:4619602"
     CDS             complement(497466..498203)
                     /locus_tag="AGOS_ACR075C"
                     /old_locus_tag="ACR075C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL035C (TAD2)"
                     /codon_start=1
                     /product="ACR075Cp"
                     /protein_id="NP_983477.1"
                     /db_xref="GeneID:4619602"
                     /translation="MGSMTQHMRTAIRLARYALDHGETPVACVFVHTPSDQIIAYGMN
                     DTNRSLTGIAHAEFGAIAQVQELFGEQDASIFKEVTVYVTVEPCVMCASALKQLGIGR
                     VIFGCGNERFGGNGSILAVQRDTSTAPQNRHLAIPGVLRREAIMLLRYFYVRENERAP
                     KPRAKAARKLDRETFPPLQWSQYLSEAEFVGVFGADLVSRFHADADVHADVDWALIDG
                     DHDNIIEELETQRRAFHLHQHKKLKPS"
     gene            complement(<498322..>499029)
                     /locus_tag="AGOS_ACR076C"
                     /old_locus_tag="ACR076C"
                     /db_xref="GeneID:4619603"
     mRNA            complement(<498322..>499029)
                     /locus_tag="AGOS_ACR076C"
                     /old_locus_tag="ACR076C"
                     /product="ACR076Cp"
                     /transcript_id="NM_208831.1"
                     /db_xref="GeneID:4619603"
     CDS             complement(498322..499029)
                     /locus_tag="AGOS_ACR076C"
                     /old_locus_tag="ACR076C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR049W (FSH1)"
                     /codon_start=1
                     /product="ACR076Cp"
                     /protein_id="NP_983478.1"
                     /db_xref="GeneID:4619603"
                     /translation="MARLLFLHGFLQNGRVFSEKSSGLRKLLKKAGVQCDYIDGPVEL
                     QPADLPFSVEAERWSATVDAGMNRAWFHHTDVSADLNVADALETVAAHIRAHGPYDGV
                     VGFSQGAALAAILTNRLCDLVPGHPPLKVGLFVSGYSFTEPDPVAPQALRIAARHQQA
                     FAPPPGQPTQVLFLYGAADAAVPAARSKYLQDIYVKAYGEDQVKGFEHPGGHMVPNKK
                     EIIRPIVDEIAKALGLP"
     gene            <499409..>500812
                     /locus_tag="AGOS_ACR077W"
                     /old_locus_tag="ACR077W"
                     /db_xref="GeneID:4619604"
     mRNA            <499409..>500812
                     /locus_tag="AGOS_ACR077W"
                     /old_locus_tag="ACR077W"
                     /product="ACR077Wp"
                     /transcript_id="NM_208832.2"
                     /db_xref="GeneID:4619604"
     CDS             499409..500812
                     /locus_tag="AGOS_ACR077W"
                     /old_locus_tag="ACR077W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YML083C"
                     /codon_start=1
                     /product="ACR077Wp"
                     /protein_id="NP_983479.2"
                     /db_xref="GeneID:4619604"
                     /translation="MTIQKHCLGLALRRRGRPQVTRCQVPSVRYPRIMDRLTSTNLAS
                     KVGVPMAVDAENQLVAQRLVGGGTPESGDIYKVSKPAHATTRIGAIGMSESMRGGGGD
                     SKRKTLRYVLEKQGNGPSFEAQLLLERIPDSLPPCEEFQQRLRECQDGTLLLNLATTF
                     YQPLEDVATVKALFRFRDYFFHHQGWYSLTFNQFVRVYPVISCLMVKSKGQREKVKCP
                     KAFVSESRCRMDTSHRSRSQRTRSKKPRLECDCKVNYRIEIDMTERMVTMLVKGLHTH
                     PIENVLAFKTSFFLVNILDDLCKKGHKNVNQIQDIMKQRLEPYDWDNIGFTQMLATRS
                     HFTNRIAKFHPPNGLARGFEPGTIVITHFEADKPSDERTEHDLPELVLQHGDGMLQQQ
                     LGRADPMVDTQLENEAPEEMEQLQDAIIFSLTKIGEAARNHKRNGDLQWIRKAAKKLT
                     SIAKELDLDSSSDLLKE"
     gene            <501162..>502646
                     /locus_tag="AGOS_ACR078W"
                     /old_locus_tag="ACR078W"
                     /db_xref="GeneID:4619605"
     mRNA            join(<501162..501168,501253..>502646)
                     /locus_tag="AGOS_ACR078W"
                     /old_locus_tag="ACR078W"
                     /product="ACR078Wp"
                     /transcript_id="NM_208833.2"
                     /db_xref="GeneID:4619605"
     CDS             join(501162..501168,501253..502646)
                     /locus_tag="AGOS_ACR078W"
                     /old_locus_tag="ACR078W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR046C (DBP5); 1-intron"
                     /codon_start=1
                     /product="ACR078Wp"
                     /protein_id="NP_983480.2"
                     /db_xref="GeneID:4619605"
                     /translation="MSGNAQKPDASEMLADLDLNKKTKETTLEAGSAESAPSAPAENQ
                     AKSDSNLINSEYEVKVRLADIQADPNSPLYSVKSFEELGLAPELLKGLYAMKFQKPSK
                     IQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLSRVDVAVPATQAICLAPSRELA
                     RQTLEVIQEMGKFTKIASQLIVPDSYEKNKAINAHIIVGTPGTVLDLMRRKMIQLGKV
                     KTFVLDEADNMLDKQGLGDQCIRVKKFLPKDTQLVLFSATFDDSVREYARRVVPNANS
                     LELQRNEVNVSAIKQLFMDCNDERHKFTVLCDLYGLLTIGSSIIFVQTKQTANMLYTE
                     LKREGHQVSILHGDLQSADRDRLIGDFREGRSKVLITTNVLARGIDIPTVSMVVNYDL
                     PMTANGQPDPSTYVHRIGRTGRFGRTGVAISFIHDKKSYETLAAIQSYFGDIQITKVP
                     TDDMDEMEKIVKKVLK"
     gene            <502831..>503049
                     /locus_tag="AGOS_ACR079W"
                     /old_locus_tag="ACR079W"
                     /db_xref="GeneID:4619606"
     mRNA            join(<502831..502864,502916..>503049)
                     /locus_tag="AGOS_ACR079W"
                     /old_locus_tag="ACR079W"
                     /product="ACR079Wp"
                     /transcript_id="NM_208834.1"
                     /db_xref="GeneID:4619606"
     CDS             join(502831..502864,502916..503049)
                     /locus_tag="AGOS_ACR079W"
                     /old_locus_tag="ACR079W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR276C (PMP3); 1-intron"
                     /codon_start=1
                     /product="ACR079Wp"
                     /protein_id="NP_983481.1"
                     /db_xref="GeneID:4619606"
                     /translation="MNSTKVVNVIIAIFLPPVAVFLARGWGVECIVDLLLTIFFFFPG
                     MLYALYIVLTS"
     gene            complement(<503129..>503305)
                     /locus_tag="AGOS_ACR080C"
                     /old_locus_tag="ACR080C"
                     /db_xref="GeneID:4619607"
     mRNA            complement(<503129..>503305)
                     /locus_tag="AGOS_ACR080C"
                     /old_locus_tag="ACR080C"
                     /product="ACR080Cp"
                     /transcript_id="NM_208835.1"
                     /db_xref="GeneID:4619607"
     CDS             complement(503129..503305)
                     /locus_tag="AGOS_ACR080C"
                     /old_locus_tag="ACR080C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR045W (TOM6)"
                     /codon_start=1
                     /product="ACR080Cp"
                     /protein_id="NP_983482.1"
                     /db_xref="GeneID:4619607"
                     /translation="MNGAYGIPGAGASAPKKQSMFQQFRDSPAYPVVVNLALFGVGVA
                     FVQSSLMDMMAPQL"
     gene            complement(<503390..>503680)
                     /locus_tag="AGOS_ACR081C"
                     /old_locus_tag="ACR081C"
                     /db_xref="GeneID:4619608"
     mRNA            complement(<503390..>503680)
                     /locus_tag="AGOS_ACR081C"
                     /old_locus_tag="ACR081C"
                     /product="ACR081Cp"
                     /transcript_id="NM_208836.1"
                     /db_xref="GeneID:4619608"
     CDS             complement(503390..503680)
                     /locus_tag="AGOS_ACR081C"
                     /old_locus_tag="ACR081C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR044W (IRC23)"
                     /codon_start=1
                     /product="ACR081Cp"
                     /protein_id="NP_983483.1"
                     /db_xref="GeneID:4619608"
                     /translation="MDVSLHALTDCYWAVLAAAAVARQVCKVLAWLLLGPLVAVYAYD
                     FCLYVLRLARSLVLRPRTRALCNPRWLRRRLTKDETAALVVTGVCIVTSDRD"
     gene            complement(<503956..>505224)
                     /locus_tag="AGOS_ACR082C"
                     /old_locus_tag="ACR082C"
                     /db_xref="GeneID:4619609"
     mRNA            complement(<503956..>505224)
                     /locus_tag="AGOS_ACR082C"
                     /old_locus_tag="ACR082C"
                     /product="ACR082Cp"
                     /transcript_id="NM_208837.1"
                     /db_xref="GeneID:4619609"
     CDS             complement(503956..505224)
                     /locus_tag="AGOS_ACR082C"
                     /old_locus_tag="ACR082C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR043W (WHI2)"
                     /codon_start=1
                     /product="ACR082Cp"
                     /protein_id="NP_983484.1"
                     /db_xref="GeneID:4619609"
                     /translation="MSQPQSIITQVSPEQQLGGSQLMTEQIEPDYYDENTLIHLNIQG
                     RHYYITREQLMSLPESLLLCFFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIM
                     ETYTTAQRDLENFPVGEFGRRAPHAGPKGFLGLTPSQSQPMSESQILHEKPAIIVLRE
                     DLDYYCVPSVSLALEDGSREGQDILLEQLMAQVKNAAGSHLCQQRSVFKGLYSSNRVR
                     RPDAQHQPDQLGPAEQHLMDMLCASGFREHSDWGNRSQEPGKTVISSLSLCRLMNETV
                     QEFRDQVAAARRRYDEDHVTPDAASAPPSRDQKRKSRLSTFTDNVRSRSSSRTRSSSR
                     APREPSLYDLVPRPEINTKLLLFWKKPARKCWWGLETITVDVQLNGHYDSESGTLVLS
                     RNSPLCVLTIPVNLHIRRVWTLELSVVGMQ"
     gene            505681..505741
                     /locus_tag="AGOS_AgSNR62"
                     /old_locus_tag="AgSNR62"
                     /db_xref="GeneID:4619610"
     ncRNA           505681..505741
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR62"
                     /old_locus_tag="AgSNR62"
                     /product="AgSNR62"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR62; start and end coordinates are
                     approximate; similarity is partial; In synteny"
                     /transcript_id="NR_149407.1"
                     /db_xref="GeneID:4619610"
     gene            complement(<505796..>506923)
                     /locus_tag="AGOS_ACR083C"
                     /old_locus_tag="ACR083C"
                     /db_xref="GeneID:4619611"
     mRNA            complement(<505796..>506923)
                     /locus_tag="AGOS_ACR083C"
                     /old_locus_tag="ACR083C"
                     /product="ACR083Cp"
                     /transcript_id="NM_208838.1"
                     /db_xref="GeneID:4619611"
     CDS             complement(505796..506923)
                     /locus_tag="AGOS_ACR083C"
                     /old_locus_tag="ACR083C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR042W (CUE5) and YDR273W (DON1)"
                     /codon_start=1
                     /product="ACR083Cp"
                     /protein_id="NP_983485.1"
                     /db_xref="GeneID:4619611"
                     /translation="MVVVENVPDTTLSKATDADGAKNSGRELQSASSASTKIEDGPKE
                     APAKPVLPSEDQGATTGSDGDAKASEDPAANSEARTGQKLQSQPSAEREQTLPKENSI
                     LSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDPTFEEEAALPTQAAPAAQA
                     TVPISQLQQDEMLARQLDEQFNKKDLRAERAARERRIREREEEFQRKQQRLRSEYGGY
                     GSEDDEDFIDVLNRGLQETSKKVGKWWDGIKKNFNEELDGPDARASAGPPRARQQRFN
                     SFGARDDETYPTEQQLRGVSLHDEHDDEPAPRLPPRRTSTGPLPARPDGPNVERKRWQ
                     PLPPEPVSAPTKVTAGGRNHAQNKKRDPDQDDYLINSDDEL"
     gene            507133..507216
                     /locus_tag="AGOS_AgSNR9"
                     /old_locus_tag="AgSNR9"
                     /db_xref="GeneID:4619612"
     ncRNA           507133..507216
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR9"
                     /old_locus_tag="AgSNR9"
                     /product="AgSNR9"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR9; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149435.1"
                     /db_xref="GeneID:4619612"
     gene            complement(<507340..>508221)
                     /locus_tag="AGOS_ACR084C"
                     /old_locus_tag="ACR084C"
                     /db_xref="GeneID:4619613"
     mRNA            complement(<507340..>508221)
                     /locus_tag="AGOS_ACR084C"
                     /old_locus_tag="ACR084C"
                     /product="ACR084Cp"
                     /transcript_id="NM_208839.1"
                     /db_xref="GeneID:4619613"
     CDS             complement(507340..508221)
                     /locus_tag="AGOS_ACR084C"
                     /old_locus_tag="ACR084C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR040W (GLO4) and YDR272W (GLO2)"
                     /codon_start=1
                     /product="ACR084Cp"
                     /protein_id="NP_983486.1"
                     /db_xref="GeneID:4619613"
                     /translation="MCPACCKAHRSSSFMYRQLRKMHVKAIKMRWLTGGVNYSYLVST
                     QDKKASWLIDPAEALEVLPALSHDEKQSIRAIVNTHHHYDHAGGNLAIRAALKREGVA
                     VPVIAGSTTSPVSTDIPEHLQKYTLGDSVEVLCIRTPCHTQDSICYFMRDTKTGQQAL
                     FTGDTLFTAGCGRFFEGTAEEMDAALNSRLLEHVQDHAATKVYPGHEYTKGNVHFIRS
                     AIYMSEGDNPAFDRLESFANANAVTTGQFTLQDETEYNPFMRLDDPTIRRRVGDLHRT
                     WARADVMAKLRSMKNTM"
     gene            complement(<508366..>511230)
                     /locus_tag="AGOS_ACR085C"
                     /old_locus_tag="ACR085C"
                     /db_xref="GeneID:4619614"
     mRNA            complement(<508366..>511230)
                     /locus_tag="AGOS_ACR085C"
                     /old_locus_tag="ACR085C"
                     /product="ACR085Cp"
                     /transcript_id="NM_208840.1"
                     /db_xref="GeneID:4619614"
     CDS             complement(508366..511230)
                     /locus_tag="AGOS_ACR085C"
                     /old_locus_tag="ACR085C"
                     /note="NOHBY322; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F16038g"
                     /codon_start=1
                     /product="ACR085Cp"
                     /protein_id="NP_983487.1"
                     /db_xref="GeneID:4619614"
                     /translation="MQEKDQITFENLDIEKIFGTSTNSKSCFCHVGSKVAYVASGGVV
                     VSDIRMQDGPPSAGSSMDSLEGVEKLGGAEDAEASRPTVKICSQRFFCAYSAVQHEES
                     AQSANVAKDLYGLCKQDQSILVKTGSWHENDNPDKVSFSSSSDLTPARLSPSKVKNRI
                     KTISCLNLSQDGRYMIVGELGHKPRILVYSLAPDSNDFPVFVIQQHSFGVANLKFHPS
                     DSRVFMSLGQINDGFLHVWRLTSTNVVLLGTNKNISSVTDVLWCNSKFITYGVRHLKE
                     WRIDYPAPAGSTGKIQPARTRTSIKGKNIVLREFINATFIDATQLDQNRVLLLTDKNI
                     MVSYENGTLSSVHNLETCLDGQVTSILADADNDTLWTIADGKIHAVSLEYILGNHERL
                     KVAEAALAPRGAPRHPNNSNVIKNCSFLNSQLAPLLHIAENNLKGIITVRKFSKSHLL
                     YVTTQGCLGFYDIANQCSYPMVYPVLNNIAGYKKIYTSETLLWSREGRFKKLDEHGEQ
                     ISELDLSLEPDLPYPLGSESSIGAAEMFLNTAGTVSLAVGTGNGDLLIYEYSNSKTKK
                     VLDTKAHTSKINDIVCLQTGTKTKVDVLVSIGRDRIVQVFLRTEERWELQQTLSDNKG
                     NVIKMIHDDNVVYVASADRSITKYRFEYTDDDLLIYKEKILSIKSAPINIHLFDDRFL
                     ISTNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSADKVLR
                     CYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQSDQLLEQRQFFI
                     PLTGISVNSTLRESLDEQPVSARAARPETIAPRTQYTTVSPVKLPYKCPDSRADSACS
                     PRFRMSNQRYGLSSSKSGNYCSSMRSCIGDEDLHQPTLLLQLKLFRDYLSSEDVPGPE
                     HDAIIHEIKLISSIIEPQNKLLEKYSDTLMNLIEEKFQKL"
     gene            complement(<511970..>514402)
                     /locus_tag="AGOS_ACR086C"
                     /old_locus_tag="ACR086C"
                     /db_xref="GeneID:4619615"
     mRNA            complement(<511970..>514402)
                     /locus_tag="AGOS_ACR086C"
                     /old_locus_tag="ACR086C"
                     /product="ACR086Cp"
                     /transcript_id="NM_208841.2"
                     /db_xref="GeneID:4619615"
     CDS             complement(511970..514402)
                     /locus_tag="AGOS_ACR086C"
                     /old_locus_tag="ACR086C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR270W (CCC2)"
                     /codon_start=1
                     /product="ACR086Cp"
                     /protein_id="NP_983488.2"
                     /db_xref="GeneID:4619615"
                     /translation="MEVTGLEAEMARMGNGSMAGTTAVLSVRGMTCAACVKTVDEAVR
                     AVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDCGFEARVGGCAREEQVRRLAR
                     AEETAQWRRRAAQAWAAAAVMMGLYMVAPLEEALGPTPLAGLFWRDVAGLAVASGVLA
                     TAGRPFLRGLGALRHGRGTMDTLVALSSGVTYLFSVATICRGVWLGSADPPSTFLDTT
                     VMLVAFICVGKLLESRARARAADSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVV
                     VMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPKYPGSRVLCGSVNGAAGFLYRADL
                     VGEETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVLILALLTFVCWMLICTLLA
                     TPPSIFNNSNRLYVCSRIAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKGGDV
                     IETAAAVQAILFDKTGTLTTGKLTVHNFTSESKALTPDQWALVCAAERLSEHPIARAI
                     VTYAEPYASPEAVARIVVLNHEVLVGLGVRCVLQLDGVEHRITIGSARLLPEGPSKFS
                     GSTASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHA
                     LGIPLNNVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLSGNSD
                     IVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKLNIFWAVLYNSLMLPVSMGVL
                     IPWGIQLPPMAAAAGMAMSSVSVVTSSLLLARWRPVPAASRKAAVGSWRNFFKKGPRA
                     DQVELQHLAPEV"
     gene            complement(<514604..>515377)
                     /locus_tag="AGOS_ACR087C"
                     /old_locus_tag="ACR087C"
                     /db_xref="GeneID:4619616"
     mRNA            complement(<514604..>515377)
                     /locus_tag="AGOS_ACR087C"
                     /old_locus_tag="ACR087C"
                     /product="ACR087Cp"
                     /transcript_id="NM_208842.1"
                     /db_xref="GeneID:4619616"
     CDS             complement(514604..515377)
                     /locus_tag="AGOS_ACR087C"
                     /old_locus_tag="ACR087C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR039W (CKB2)"
                     /codon_start=1
                     /product="ACR087Cp"
                     /protein_id="NP_983489.1"
                     /db_xref="GeneID:4619616"
                     /translation="MSERRLEEHGTAETADVEMADAVETNSTGSSDYVELWIDLFLGK
                     KGHEYFCDVDTEYITDRFNLINLQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLE
                     ADARKLYGLIHARYIITIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGID
                     CVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFG
                     FDLHKQAQLARWQELQRLKLERELIKKGVDLTKNGGYKK"
     gene            <515563..>518115
                     /locus_tag="AGOS_ACR088W"
                     /old_locus_tag="ACR088W"
                     /db_xref="GeneID:4619617"
     mRNA            <515563..>518115
                     /locus_tag="AGOS_ACR088W"
                     /old_locus_tag="ACR088W"
                     /product="ACR088Wp"
                     /transcript_id="NM_208843.2"
                     /db_xref="GeneID:4619617"
     CDS             515563..518115
                     /locus_tag="AGOS_ACR088W"
                     /old_locus_tag="ACR088W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR038C (HIR2)"
                     /codon_start=1
                     /product="ACR088Wp"
                     /protein_id="NP_983490.2"
                     /db_xref="GeneID:4619617"
                     /translation="MKLLKYPRQLHDGQLLAGCVVGGLLVVVGRDRISAYDCGKLQAA
                     ARGELAVREVSAEVELQVEVGEDALRYVAGGEGELVVAGDRQIWAAGADWRSAGRGTR
                     FLTVAQLAGGACVTDVKADGAGLVFVSVSGKDEVWLYATGAWERVGVVTLAAKPVTLV
                     VDPLGELLTVVLQNRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPL
                     VNSIKNGLPSAQLLDRTAGFSVQSTLVGYVDKCKILRFSPRLYEKPNKDKPPTQYNLL
                     ASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAF
                     HEVELGRLLDDAELEKLRQSVPRLEPLPPPTPKSLAKSEAKPQQDTKPDAKSSANSVS
                     AKTGKKKIAPTVITSTSMEFNEPSYTVPKDLKRRPKQETQTNGTTTKRPKRDVEPMDF
                     LDTNLLIPNISFSKARLATPKVRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITLTLK
                     DKEKDMVLFQDFTPRFVTICTCGHSFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSF
                     LEGCGDYLLCVTSMGQLFCWNVKEGKLKFPVNTIYPLLNPSIRYSDDVLTRAENITMC
                     TTTENGIPLVTLSNGDGYMFDPDMEIWLLINDSWWAYGSQYWDFTNTSHAGSSAAAGN
                     DKEDKKNKYWNADAEYLIEEVKKNKKSVVNYLESKTNDEMTRKGLIRNLQRFAKTILM
                     KEGFENLEDIVTLSHLENRLLVALKLNETNEFTKLLKVYCISLAEMGFKNRLDDVLSW
                     LYNDGEYKVGTIANEKREELLKQILVACADIRQVQRVTTSYASALGLLDVSL"
     gene            complement(<518156..>519325)
                     /locus_tag="AGOS_ACR089C"
                     /old_locus_tag="ACR089C"
                     /db_xref="GeneID:4619618"
     mRNA            complement(<518156..>519325)
                     /locus_tag="AGOS_ACR089C"
                     /old_locus_tag="ACR089C"
                     /product="ACR089Cp"
                     /transcript_id="NM_208844.1"
                     /db_xref="GeneID:4619618"
     CDS             complement(518156..519325)
                     /locus_tag="AGOS_ACR089C"
                     /old_locus_tag="ACR089C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR268W (MSW1)"
                     /codon_start=1
                     /product="ACR089Cp"
                     /protein_id="NP_983491.1"
                     /db_xref="GeneID:4619618"
                     /translation="MVRYKDLSNLISSSGITMQIKCGSGLRQFVRKASTIQNIDYANR
                     SLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAGGKCIFGTADLHAITIP
                     KPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQVPEHAELCWYLSTLTSMGALNRM
                     TQWKTKANIKDTSSEKVGAVKLGLFTYPVLQAADVLLYKSTHIPVGEDQVQQLELTRQ
                     LAQAFNSTYKTRYFREPTTLLTPTRKVLSLQNPLKKMSKSDANQNSCICVTDEPDAIR
                     RKIRSAVTDSIGHEFKYDPEGRPGVSNLINIVAGIQKKTIAAVEADIAGFKDHATFKN
                     YVTDILVAELRGPREEFARYMNDKSYIYEVERNGAERAGAIAAKTLAEVRAIMGY"
     gene            complement(<519433..>520530)
                     /locus_tag="AGOS_ACR090C"
                     /old_locus_tag="ACR090C"
                     /db_xref="GeneID:4619619"
     mRNA            complement(<519433..>520530)
                     /locus_tag="AGOS_ACR090C"
                     /old_locus_tag="ACR090C"
                     /product="ACR090Cp"
                     /transcript_id="NM_208845.2"
                     /db_xref="GeneID:4619619"
     CDS             complement(519433..520530)
                     /locus_tag="AGOS_ACR090C"
                     /old_locus_tag="ACR090C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR037W (CYC2)"
                     /codon_start=1
                     /product="ACR090Cp"
                     /protein_id="NP_983492.2"
                     /db_xref="GeneID:4619619"
                     /translation="MLWKSNGSFVIQRTISSMLWKRFYNSCSKANVQRRAPGRLPLVL
                     CGVTALGAGCAAAEYHRRNYHAELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNN
                     IWALFGARNLWAVEIKQPEIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIK
                     EYGSGEVARWLRKLPKGHIVEVRGPYPEFEFPELDADTKRDREFLWGGEPAAQLPRAR
                     PFDIALFAAGTGIVTALQLLTTEDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRV
                     DLHVFESEKGESLRLGLSKISDLVSGPFPFSENAPFEQRPKAEPVLSLVCGPDDYIAF
                     IAGPRHGLSQGPVTGLLGTKGWDNSNVYKLS"
     gene            <520608..>521594
                     /locus_tag="AGOS_ACR091W"
                     /old_locus_tag="ACR091W"
                     /db_xref="GeneID:4619620"
     mRNA            <520608..>521594
                     /locus_tag="AGOS_ACR091W"
                     /old_locus_tag="ACR091W"
                     /product="ACR091Wp"
                     /transcript_id="NM_208846.1"
                     /db_xref="GeneID:4619620"
     CDS             520608..521594
                     /locus_tag="AGOS_ACR091W"
                     /old_locus_tag="ACR091W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR267C (CIA1)"
                     /codon_start=1
                     /product="ACR091Wp"
                     /protein_id="NP_983493.1"
                     /db_xref="GeneID:4619620"
                     /translation="MPNLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNF
                     KLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEG
                     HENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA
                     SRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDT
                     TVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKE
                     VQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNVWELREE"
     gene            complement(<521645..>522469)
                     /locus_tag="AGOS_ACR092C"
                     /old_locus_tag="ACR092C"
                     /db_xref="GeneID:4619621"
     mRNA            complement(<521645..>522469)
                     /locus_tag="AGOS_ACR092C"
                     /old_locus_tag="ACR092C"
                     /product="ACR092Cp"
                     /transcript_id="NM_208847.1"
                     /db_xref="GeneID:4619621"
     CDS             complement(521645..522469)
                     /locus_tag="AGOS_ACR092C"
                     /old_locus_tag="ACR092C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR036W (PEP12)"
                     /codon_start=1
                     /product="ACR092Cp"
                     /protein_id="NP_983494.1"
                     /db_xref="GeneID:4619621"
                     /translation="MSIFSEDTQEVARYSDNPQFEEWGTDIVSNLFEMNGQLGTFQHF
                     IKGLESNYRNGKANTMVVENISNRSMEVIHKVSLLVKTLNGLVHSINAIPKNELDRTQ
                     LTTREKLNRDIRLSVQEFQRCQSEFAGIRKQINEQAKISLSEQQEEAAGAAALEEEAA
                     QQQHHIVIEREPINNEEFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSE
                     LVDHIENNIYTAVTSTNHASNELSRALRYQRRSNRWCLYLLLALLALLFLIGVTVL"
     gene            complement(<522624..>523709)
                     /locus_tag="AGOS_ACR093C"
                     /old_locus_tag="ACR093C"
                     /db_xref="GeneID:4619622"
     mRNA            complement(join(<522624..523554,523606..>523709))
                     /locus_tag="AGOS_ACR093C"
                     /old_locus_tag="ACR093C"
                     /product="ACR093Cp"
                     /transcript_id="NM_208848.2"
                     /db_xref="GeneID:4619622"
     CDS             complement(join(522624..523554,523606..523709))
                     /locus_tag="AGOS_ACR093C"
                     /old_locus_tag="ACR093C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR101C (BIG1); 1-intron"
                     /codon_start=1
                     /product="ACR093Cp"
                     /protein_id="NP_983495.2"
                     /db_xref="GeneID:4619622"
                     /translation="MQNVASWLLALVVAVVQGELLPGKSAPALLWSYKLSEGIQEYQL
                     AYNMTTVLPAPEFNAIALELLDHCNSHAYVFVNQPGLRLEDFDYEDAWTVLPNYLSRS
                     SSALRFEQVEVSPSNVFENLIAHTKRRCDVQREIILRAEQTNQFEPYIDAQSRIIQVH
                     FSPLPGDGRNERPSREDVLADHDQRLRRILGRLPSPAVTVIYTSLEPADRLSASPPRA
                     GIFPEIFEHESRRIEYERNDRDLQVNRYFPSHHPKMEPIEEVELSLLDPKFIQSNLKL
                     LKLIAVSAIGSLTWQLYSLFSPKLPVATPKGTAKRQKGQKKLVKLATAQAAKQAEEVK
                     LEVSQQEKED"
     gene            complement(<523827..>524756)
                     /locus_tag="AGOS_ACR094C"
                     /old_locus_tag="ACR094C"
                     /db_xref="GeneID:4619623"
     mRNA            complement(<523827..>524756)
                     /locus_tag="AGOS_ACR094C"
                     /old_locus_tag="ACR094C"
                     /product="ACR094Cp"
                     /transcript_id="NM_208849.1"
                     /db_xref="GeneID:4619623"
     CDS             complement(523827..524756)
                     /locus_tag="AGOS_ACR094C"
                     /old_locus_tag="ACR094C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL019W (RAM2)"
                     /codon_start=1
                     /product="ACR094Cp"
                     /protein_id="NP_983496.1"
                     /db_xref="GeneID:4619623"
                     /translation="MEAYNYEDLEPVSLELGAEGEICQIMYSPEYARVIGLLRALMAA
                     DEVSARALALNSTALRMAPSDYTTWNHRYRLVKALYGADAAKLNAELDWLDEFTLGNL
                     KNYQIWSYRQALLRLHPEPKLPRELPVLHMMLQEDAKNYHVWSYRKWAVLFFGDFRHE
                     LEYAAWMIEGDVYNNSAWAHRMFVLKSTTPSASDIQREVDYACANIELVPQNSSSWNY
                     LRGLYDQFRGGRYDEDVVDFALSFTGDLLDSESEGNALPEIRSSHALELLAHVYSQEK
                     ATHDKARRAYKGLASAYDPIRRPFWELQLSKLV"
     gene            <526246..>526973
                     /locus_tag="AGOS_ACR095W"
                     /old_locus_tag="ACR095W"
                     /db_xref="GeneID:4619627"
     mRNA            join(<526246..526330,526381..>526973)
                     /locus_tag="AGOS_ACR095W"
                     /old_locus_tag="ACR095W"
                     /product="ACR095Wp"
                     /transcript_id="NM_208850.1"
                     /db_xref="GeneID:4619627"
     CDS             join(526246..526330,526381..526973)
                     /locus_tag="AGOS_ACR095W"
                     /old_locus_tag="ACR095W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL127C (HHO1); 1-intron"
                     /codon_start=1
                     /product="ACR095Wp"
                     /protein_id="NP_983497.1"
                     /db_xref="GeneID:4619627"
                     /translation="MGPKATSGTRGRGKKVGTKTAAPLPKYKDLIVEAVVSLAERGGS
                     SRQAIKKFIRDKYAVGAKFDGQFNLAVKRGLEAGELAQPKGPAGSIKLLKKAAQPKPE
                     EAKRAAKPAKRVVKAAKPAKAKPAKAAKAAKPAKPVKAAKAASAVKPAARKLAKPVVK
                     KVGSKKVATKNAVVGKKSVVSSAASKKLLAKKAVPKKTAGRKPLVGKKVVAVSRKPAA
                     KKLAKSA"
     gene            <527645..>529162
                     /locus_tag="AGOS_ACR096W"
                     /old_locus_tag="ACR096W"
                     /db_xref="GeneID:4619628"
     mRNA            <527645..>529162
                     /locus_tag="AGOS_ACR096W"
                     /old_locus_tag="ACR096W"
                     /product="ACR096Wp"
                     /transcript_id="NM_208851.1"
                     /db_xref="GeneID:4619628"
     CDS             527645..529162
                     /locus_tag="AGOS_ACR096W"
                     /old_locus_tag="ACR096W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL128C (TBF1)"
                     /codon_start=1
                     /product="ACR096Wp"
                     /protein_id="NP_983498.1"
                     /db_xref="GeneID:4619628"
                     /translation="MALGIPYLHEYDEDTLKQRLEAVLPGLPYATQLTLKSLPLLNDI
                     STQLLRLLTITPLHVLTGSVQEDKAAQAEHELFHVLVDALIEVKEVYGDTSLLTVYDV
                     APGIWFPGCDPPLILRNFEQFVLATIRKCNLVMFMLTLLGKFQYGFQFLNECFIDIFC
                     PSNSYSTSDGGKDTGSYSVQSNASFTPCTSTFSGSLTSAIGGRLLKTHTVLYLNMKTQ
                     AFIAAMEQEDPLLNRKQILDTLFPADMATYLQLKSGEPANEFQLTPSEKDFITRCQRR
                     RETLEANTDLRDIMELYKWSDFLKEFLAYVSKNVSLLVFGKRAKCAAPKQFELSDSLG
                     YAPIQNARLSSAVHPSDSSITPAAVNTPIASASPNEVDQRTDGVKAPNGVSSCSVPSG
                     HLNEPIIARKKLQQKRMWVKEEEEALISALKVYGPAWSKILEYHGAGGSVSETLKNRT
                     QVQLKDKARNWKMHYLKKGAPVPFYLLKVTGNLEREEKFKKRSKAKRKSKGSPSQ"
     gene            <529783..>531186
                     /locus_tag="AGOS_ACR097W"
                     /old_locus_tag="ACR097W"
                     /db_xref="GeneID:4619629"
     mRNA            <529783..>531186
                     /locus_tag="AGOS_ACR097W"
                     /old_locus_tag="ACR097W"
                     /product="ACR097Wp"
                     /transcript_id="NM_208852.1"
                     /db_xref="GeneID:4619629"
     CDS             529783..531186
                     /locus_tag="AGOS_ACR097W"
                     /old_locus_tag="ACR097W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR212W (STE4)"
                     /codon_start=1
                     /product="ACR097Wp"
                     /protein_id="NP_983499.1"
                     /db_xref="GeneID:4619629"
                     /translation="MDSIRYPSIQISFLNLPETKRQSIYYQPAGDSCFRMKGYSEKIN
                     PPWQPFHAQDINVPDFPATTLEHAPEDVERQIGLAREEYKQLRTQINRIKSRIQDADL
                     QSLSKNVAPITSVNLKPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGL
                     KSNAIPLHSQWVLSCAICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCY
                     ISEIEFLDDNSILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNV
                     FASGGSDGYLYIWDKRVPTSVQSFFVSDSDVSKVKFFRNGNTIATGSDDGCTNLYDLR
                     SDCRIANYSLSRSIHGATPVQQQTYIMSNMDYTAPSGTLARASPYSPAIGTVSSSFID
                     NQGVISMDFSRSGRLLYVSYTEFGCAVWDLVKGEIIGKLDGHSDRISGVATSPDGLAI
                     CTGSWDMTMKVWSPAYM"
     gene            complement(<531330..>532047)
                     /locus_tag="AGOS_ACR098C"
                     /old_locus_tag="ACR098C"
                     /db_xref="GeneID:4619630"
     mRNA            complement(join(<531330..531983,532039..>532047))
                     /locus_tag="AGOS_ACR098C"
                     /old_locus_tag="ACR098C"
                     /product="ACR098Cp"
                     /transcript_id="NM_208853.1"
                     /db_xref="GeneID:4619630"
     CDS             complement(join(531330..531983,532039..532047))
                     /locus_tag="AGOS_ACR098C"
                     /old_locus_tag="ACR098C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL129W (TAF14) and YOR213C (SAS5); 1-intron; Tandem gene
                     duplication in this genome"
                     /codon_start=1
                     /product="ACR098Cp"
                     /protein_id="NP_983500.1"
                     /db_xref="GeneID:4619630"
                     /translation="MQSPTVERVVRLKIQQAVIPSIPPIDGLPMRRWSMDICLVGPQG
                     EEVPARIFESCTYFLHPTFEHPKRRFTVPPFRLDEQGWGEFDFKIVAKFIQNGGRATI
                     NHELSFSESAVAVDFTIMVPYHIDELRKVLLESGPVPDYSIEDRDDHPVRQKIPQMAT
                     AIAAANEEIVGEVVKTIVAYPGVSDALLKRRHRTEEFVIQLGQLPSSVLEILFNILQG
                     QY"
     gene            complement(<532259..>533070)
                     /locus_tag="AGOS_ACR099C"
                     /old_locus_tag="ACR099C"
                     /db_xref="GeneID:4619631"
     mRNA            complement(join(<532259..532993,533062..>533070))
                     /locus_tag="AGOS_ACR099C"
                     /old_locus_tag="ACR099C"
                     /product="ACR099Cp"
                     /transcript_id="NM_208854.1"
                     /db_xref="GeneID:4619631"
     CDS             complement(join(532259..532993,533062..533070))
                     /locus_tag="AGOS_ACR099C"
                     /old_locus_tag="ACR099C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL129W (TAF14) and YOR213C (SAS5); 1-intron; Tandem gene
                     duplication in this genome"
                     /codon_start=1
                     /product="ACR099Cp"
                     /protein_id="NP_983501.1"
                     /db_xref="GeneID:4619631"
                     /translation="MVATVKRTVRIKTQQSILPDVPPSVDNFPMRRWSIQLAILDEHG
                     EELPATLFDKVVYHLHPTFANPNRTFTEPPFKIEEQGWGGFELLISCHLLEKAGERKI
                     THDLHFMKDAYQVDHVIQVPINKPLLRAELEKSGPVDDGAAVSAAAIGENKRKAVTSN
                     GETKAKKVKTAVGSTVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNRTPDMNITNNV
                     EEGEFVIDLYSLPEGLLKSLWEYVKKNIE"
     gene            complement(<533261..>533812)
                     /locus_tag="AGOS_ACR100C"
                     /old_locus_tag="ACR100C"
                     /db_xref="GeneID:4619632"
     mRNA            complement(<533261..>533812)
                     /locus_tag="AGOS_ACR100C"
                     /old_locus_tag="ACR100C"
                     /product="ACR100Cp"
                     /transcript_id="NM_208855.1"
                     /db_xref="GeneID:4619632"
     CDS             complement(533261..533812)
                     /locus_tag="AGOS_ACR100C"
                     /old_locus_tag="ACR100C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR215C (AIM41)"
                     /codon_start=1
                     /product="ACR100Cp"
                     /protein_id="NP_983502.1"
                     /db_xref="GeneID:4619632"
                     /translation="MLMNSAARPMLLFRALARRSASSQAYTDALAHLKQDLKKAMLAK
                     DDTKKTTIRSLLATIKNKEIDSRDKPLDHFALHDIYSKLVAQRRESIDGFLKNGRDDL
                     VQKEQLEMQLIQAYMAALPVASAEELAARADAFLHELKSTHGALPLPKVFAQVSWPTV
                     AQDWNASPAAVRSALAAAFKKSS"
     gene            complement(<534018..>535466)
                     /locus_tag="AGOS_ACR101C"
                     /old_locus_tag="ACR101C"
                     /db_xref="GeneID:4619633"
     mRNA            complement(<534018..>535466)
                     /locus_tag="AGOS_ACR101C"
                     /old_locus_tag="ACR101C"
                     /product="ACR101Cp"
                     /transcript_id="NM_208856.2"
                     /db_xref="GeneID:4619633"
     CDS             complement(534018..535466)
                     /locus_tag="AGOS_ACR101C"
                     /old_locus_tag="ACR101C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR216C (RUD3)"
                     /codon_start=1
                     /product="ACR101Cp"
                     /protein_id="NP_983503.2"
                     /db_xref="GeneID:4619633"
                     /translation="MAKGKKKGGKAPKALPESSAVVEDDVKKEAAPTEEDRAKSRSEV
                     TGEGSSEAAGTGREEQKAGEVATAGQGVLAESAEQVKPAGQGEPTEQGEQSEAESMQA
                     LRQELEALRLQLRGTESAEGELRRLREERDQFETQYNTLLSRLSSMKSLFSKMKESQL
                     ELENTQEQLSEYERQNATLKTRLEQLSREKKESEETVVVLNTEMASLNAECETLSVEC
                     SAYKAKLSQAQERIEKEAAAYQRERQDHAKLQRNLQSRIEELTLMMDNKKHDHASLEE
                     QTKAYQQQLEQLQQEKAQQEQRGAELNTQLESLVSENERALRAKDQELQSLRGALEQA
                     QDVSRTHEAKVAELRSQIDAMSADAALKDKLEQECKERVLQIGKLRHEAVILNEHLTK
                     ALAMIKHSNSSESVDKELISNLFISFVSIPRGDPKKFEVLELISSFLSWDDEKKTQAG
                     LMHSSSDTIRKTRRNDSFVSLWAEFLERESEK"
     gene            <535738..>538260
                     /locus_tag="AGOS_ACR102W"
                     /old_locus_tag="ACR102W"
                     /db_xref="GeneID:4619634"
     mRNA            <535738..>538260
                     /locus_tag="AGOS_ACR102W"
                     /old_locus_tag="ACR102W"
                     /product="ACR102Wp"
                     /transcript_id="NM_208857.2"
                     /db_xref="GeneID:4619634"
     CDS             535738..538260
                     /locus_tag="AGOS_ACR102W"
                     /old_locus_tag="ACR102W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR217W (RFC1)"
                     /codon_start=1
                     /product="ACR102Wp"
                     /protein_id="NP_983504.2"
                     /db_xref="GeneID:4619634"
                     /translation="MVDVREFFKANSGNKPSAKGPPRKKAKIEEAKLPKGDAASPIDV
                     DLDDDDLEGLLEAKGEEKVVKREERPAVKKQPKQGIQSAGGVGSGRASAAPAGNAQEI
                     LAALPSVDLDSVHVKEGANFGFGGSGESGGDANADDFAQGAPNCLLGLTMVFTGVLPN
                     IDRPAAEALAKKYGARVTKSISSKTSVVVLGDEAGPKKLEKIRQLGIKAIDENGFRQL
                     INAMPAEGGSGVAAERARQQLKKQEEDVLREAETLARQEKERAASRASNAPGGHAAPR
                     ESDQLWTVKYAPTSLSQICGNKSSVGKLHKWLSEWDNNQRNGFKTPGRDGTGIYRAAM
                     LYGPPGIGKTTAAHLVANELGYDVLEQNASDVRSKKLLNEGIKNALDNTSVIGYFNKK
                     EHRNSRKFVIIMDEVDGMSGGDRGGVGQMAQFCRKTSSPLILICNERTLPKMRPFDRV
                     VCDIQFRRPDAQSMKARLMTIAVREGFKLDPTVVDQLVAATRGDIRQIINLLSTISTT
                     TKSIGHDNARQISAAWEKNIALKPYDITHKLFEGRNYSDAGAQSFPLYKKMELYFDDF
                     DFTPLMVQENYLSTRPTNLSPGQSHLQAAAAAADSISEGDLVDRKIRSGEQLWSLLPF
                     HAVMSSVRPASLVSGQMAGRINFTSWLGQNSKRGKYYRLLQELHYHTRLRTSASKVSF
                     RLDYLTTLKRRLLSPLVENGGEAIPNIIETMDSYYLTKEDWDVVMDFMLGYENTEAAL
                     KKISTSDKRAFTTMYNKTTHPVAINRTGTTIAISGKSGNDKPDFEEVVDADDEVPPDN
                     DDAKNDESADLKKDKLIKERKPRARKATGSSKAPAKRKKVSK"
     gene            complement(<538345..>540981)
                     /locus_tag="AGOS_ACR103C"
                     /old_locus_tag="ACR103C"
                     /db_xref="GeneID:4619635"
     mRNA            complement(<538345..>540981)
                     /locus_tag="AGOS_ACR103C"
                     /old_locus_tag="ACR103C"
                     /product="ACR103Cp"
                     /transcript_id="NM_208858.2"
                     /db_xref="GeneID:4619635"
     CDS             complement(538345..540981)
                     /locus_tag="AGOS_ACR103C"
                     /old_locus_tag="ACR103C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR219C (STE13)"
                     /codon_start=1
                     /product="ACR103Cp"
                     /protein_id="NP_983505.2"
                     /db_xref="GeneID:4619635"
                     /translation="MDDGQRRPNSLRFFQKTNSSVSLLPVEGQDSIPDLELQVLSHEG
                     SGSGVDSATTSKDYLLHEDNYYDEDDRAWHRLRHPRQGWAKCILWCLLGFLLFPMQNF
                     ITQRVGSYVHGEYRSAGGDRSRAFTIENVLAGDFMLGYELFEFIAPPRCSPVSDEGFY
                     VTLLAENDVPTFSAKKLTDDQYTKALASTSFNYGGQDYRVQKIVPSFSLDFAILSSNR
                     KPVFRHSSQANYWLRDVGANTIEPITPGGAGSPAALISYAKFSPCYRYLYFVAENDLY
                     IRQLRGDGALHRITFDGTAGIHNGKTDWVYEEEVMGSDNAVWWKDDDSAFVYLRINST
                     GVRSYAIPRYIEDDSLIPKQINYPAPGSKLPSASLILYNIADASKHEIQLDAAADYLI
                     YDAVWLSDTHFMFKVADRESRNVDIRVFNVVDKSVRTVRSVNSNIYDGWIEKMKPVLI
                     IPADKDKGRETGYVDICVDSDGYPHLFYFPDIYAANGRQLTSGPWEITSDSMSFDAEK
                     EVIYFHANKRHPMAQHIYSVALSDTGVEDSLPMPGPANNTDYYEFTFSASSKFSIMKY
                     LGPDLPSTRVGPTALTLGGSTEENSEARIISHNDHILETVAKHDLPQTSYLSAFTTDD
                     AEIHYVEIKPRHMNPKKKYPLLVSVYGGPGSRTFNTKFDVMLDQCISSGLDAIVLQIE
                     PRGTGGKGWNFRSWARQNIGHWEPRDITAVTRKYISQHAKNVDTEHVAIWGWSYGGFT
                     TLKTLEYDQGQTFKYGISVAPVTDWRLYDAVYTERYMGTPKPTNDAYGEYALIKNIDA
                     FSKVKRFLLLHGTADDNVHIENTYKLLDSFNVHNVRNYDSHIFPDSNHALTFHNAGPI
                     LYRQIYHWLENAFSGKFDALSS"
     gene            complement(<541331..>542224)
                     /locus_tag="AGOS_ACR104C"
                     /old_locus_tag="ACR104C"
                     /db_xref="GeneID:4619636"
     mRNA            complement(<541331..>542224)
                     /locus_tag="AGOS_ACR104C"
                     /old_locus_tag="ACR104C"
                     /product="60S ribosomal protein L5"
                     /transcript_id="NM_208859.1"
                     /db_xref="GeneID:4619636"
     CDS             complement(541331..542224)
                     /locus_tag="AGOS_ACR104C"
                     /old_locus_tag="ACR104C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL131W (RPL5)"
                     /codon_start=1
                     /product="60S ribosomal protein L5"
                     /protein_id="NP_983506.1"
                     /db_xref="GeneID:4619636"
                     /translation="MAFIKSIKNSAYHSRFQTPFRRRREGKTDYYARKRLVTQHKAKY
                     NTPKYRLVVRFTNKDIICQVVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATG
                     LLIARRTLQKLGLDETYKGVEEPEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVF
                     GALKGASDGGLYVPHSENRFPGWDFESEELDADLLRTYIFGGHVSAYMEELADDDEER
                     YSELFKGYIADGIEADAIEDIYTEAHAAIRADPSFKPTEKKFTKEQYAAESKKFRQVK
                     LTKEERKARVAAKIAALAAQE"
     gene            <542702..>543367
                     /locus_tag="AGOS_ACR105W"
                     /old_locus_tag="ACR105W"
                     /db_xref="GeneID:4619637"
     mRNA            <542702..>543367
                     /locus_tag="AGOS_ACR105W"
                     /old_locus_tag="ACR105W"
                     /product="ACR105Wp"
                     /transcript_id="NM_208860.1"
                     /db_xref="GeneID:4619637"
     CDS             542702..543367
                     /locus_tag="AGOS_ACR105W"
                     /old_locus_tag="ACR105W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR220W (RCN2)"
                     /codon_start=1
                     /product="ACR105Wp"
                     /protein_id="NP_983507.1"
                     /db_xref="GeneID:4619637"
                     /translation="MARTQILITDVPKARFDEQWPQLLRREMAISFPDVEPEYFTPLS
                     FLNRVVIIFRGEEDTARVYEWLRERCAREHYKVYLSEPLVGKPRGRSLTAVSPQAGDG
                     AEEAEVERPLLQIDTASAADSAAGGLFPPSPSLSPDKQISPTKIKFPDDPKVHYYMEP
                     APERHTPVPERGTGVPSDPSGTQFLYRGRSLSPRDNMPLSPSITLNRFPSERGGRRAH
                     AGQ"
     gene            complement(<543419..>544219)
                     /locus_tag="AGOS_ACR106C"
                     /old_locus_tag="ACR106C"
                     /db_xref="GeneID:4619638"
     mRNA            complement(<543419..>544219)
                     /locus_tag="AGOS_ACR106C"
                     /old_locus_tag="ACR106C"
                     /product="ACR106Cp"
                     /transcript_id="NM_208861.1"
                     /db_xref="GeneID:4619638"
     CDS             complement(543419..544219)
                     /locus_tag="AGOS_ACR106C"
                     /old_locus_tag="ACR106C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL132W (COX11)"
                     /codon_start=1
                     /product="ACR106Cp"
                     /protein_id="NP_983508.1"
                     /db_xref="GeneID:4619638"
                     /translation="MLGLGCLLRPLAGGVSRRCAGGGAHWASRPLHSSGRSRAKLDFS
                     KLTQAEIKQLRDMKVQRERAFRDRTAAYYFASVGVVFLGLAYAAVPLYRLLCARTGFG
                     GTPITDRRKFTSDKMVPVDMDKRIRVSFTSEVSQILPWKFVPQQREVYVLPGETALAF
                     YKAKNTSDKDIIGMATYSITPGGAAQYFNKIQCFCFEEQKLLAGEEVDMPVFFFIDPD
                     FATDPQMRNVDDLVLHYTFFRAQYASEAAPDGALGPAVVDAAAVEAAA"
     gene            <544400..>545554
                     /locus_tag="AGOS_ACR107W"
                     /old_locus_tag="ACR107W"
                     /db_xref="GeneID:4619639"
     mRNA            <544400..>545554
                     /locus_tag="AGOS_ACR107W"
                     /old_locus_tag="ACR107W"
                     /product="ACR107Wp"
                     /transcript_id="NM_208862.2"
                     /db_xref="GeneID:4619639"
     CDS             544400..545554
                     /locus_tag="AGOS_ACR107W"
                     /old_locus_tag="ACR107W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL133C (RDS2)"
                     /codon_start=1
                     /product="ACR107Wp"
                     /protein_id="NP_983509.2"
                     /db_xref="GeneID:4619639"
                     /translation="MSTENVQTDYASTKKRKKVVKACVFCRRSHMICDDRRPCSRCIK
                     RDIGHLCCDEKLQPGAERLQSQSPLRTETFDVQPVPEHLVAGLGVGAAGGNRYANVIN
                     HPKFVSEHIGSEFSSLNEFLTLLEDPLLMEATPSPGCNGQAADPGARGPGELVGGVLA
                     GAAPQEQPTAKENFFLTAADPSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQN
                     YMDKYMNQSSRQRILKPLSTIRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSM
                     SMPACLWRRTGEIYRGNKEFASLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIA
                     FDKGQKAVLTSCNLRSKDGRKRRPCCFSFTIRRDRYNIPICIIGNFIPIS"
     gene            complement(<545574..>546464)
                     /locus_tag="AGOS_ACR108C"
                     /old_locus_tag="ACR108C"
                     /db_xref="GeneID:4619640"
     mRNA            complement(<545574..>546464)
                     /locus_tag="AGOS_ACR108C"
                     /old_locus_tag="ACR108C"
                     /product="ACR108Cp"
                     /transcript_id="NM_208863.1"
                     /db_xref="GeneID:4619640"
     CDS             complement(545574..546464)
                     /locus_tag="AGOS_ACR108C"
                     /old_locus_tag="ACR108C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR221C (MCT1)"
                     /codon_start=1
                     /product="ACR108Cp"
                     /protein_id="NP_983510.1"
                     /db_xref="GeneID:4619640"
                     /translation="MRLVTFPGQGSAVLASSLARWCESRAGFQHSSVADVVAYVERQP
                     AAPGAIAACSTLLYQCWLERGPEQGEAMMLGHSLGELSALNASGSNALLGVHDVLEVA
                     QRRHALMREAAAAHARAHGVRGFVARVVTLRRAGDLRAQLELRGTLRLANHNSLRQCI
                     VTGAADDPAWAALPAGARVDALLNPDGIPFHNDAVLRPIQGPLYDLLWERLARNGVSR
                     ARSLDRPLLSCLDGAATDRLDVAVEKFVRSSTNVVEFVAACRTAVQAGATAALHVGPG
                     RAVGALVDRNTGLTASETLD"
     gene            <546743..>547642
                     /locus_tag="AGOS_ACR109W"
                     /old_locus_tag="ACR109W"
                     /db_xref="GeneID:4619641"
     mRNA            <546743..>547642
                     /locus_tag="AGOS_ACR109W"
                     /old_locus_tag="ACR109W"
                     /product="ACR109Wp"
                     /transcript_id="NM_208864.2"
                     /db_xref="GeneID:4619641"
     CDS             546743..547642
                     /locus_tag="AGOS_ACR109W"
                     /old_locus_tag="ACR109W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR222W (ODC2) and YPL134C (ODC1)"
                     /codon_start=1
                     /product="ACR109Wp"
                     /protein_id="NP_983511.2"
                     /db_xref="GeneID:4619641"
                     /translation="MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQ
                     GGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQA
                     FGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREG
                     VLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQRITNDLIAGSIGGSIGC
                     MLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP
                     GGGILLVVFTGVLDFCRAIHYGK"
     gene            complement(547736..547857)
                     /locus_tag="AGOS_AgSNR35"
                     /old_locus_tag="AgSNR35"
                     /db_xref="GeneID:4619642"
     ncRNA           complement(547736..547857)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR35"
                     /old_locus_tag="AgSNR35"
                     /product="AgSNR35"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR35; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149378.1"
                     /db_xref="GeneID:4619642"
     gene            <548054..>548812
                     /locus_tag="AGOS_ACR110W"
                     /old_locus_tag="ACR110W"
                     /db_xref="GeneID:4619643"
     mRNA            <548054..>548812
                     /locus_tag="AGOS_ACR110W"
                     /old_locus_tag="ACR110W"
                     /product="ACR110Wp"
                     /transcript_id="NM_208865.1"
                     /db_xref="GeneID:4619643"
     CDS             548054..548812
                     /locus_tag="AGOS_ACR110W"
                     /old_locus_tag="ACR110W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR223W"
                     /codon_start=1
                     /product="ACR110Wp"
                     /protein_id="NP_983512.1"
                     /db_xref="GeneID:4619643"
                     /translation="MSKEPLIPQQSRRRRRFIVVRFSDPTLQDLTLEVSSIPYADVTT
                     RWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNLRLEQFFESAEENDKYYIHCIVGP
                     ELTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRSVGFSDEEIELLRQQFRATYGDLD
                     TSQQPDGERADLRQLEEQWIETGATEQGAQLSSIPTANYRYNMDLLIGLMVGCLFGVF
                     SILLLKQGELFTKRQKMAVFAGIVANVIFGMTHW"
     gene            complement(<548895..>549329)
                     /locus_tag="AGOS_ACR111C"
                     /old_locus_tag="ACR111C"
                     /db_xref="GeneID:4619644"
     mRNA            complement(<548895..>549329)
                     /locus_tag="AGOS_ACR111C"
                     /old_locus_tag="ACR111C"
                     /product="ACR111Cp"
                     /transcript_id="NM_208866.1"
                     /db_xref="GeneID:4619644"
     CDS             complement(548895..549329)
                     /locus_tag="AGOS_ACR111C"
                     /old_locus_tag="ACR111C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR224C (RPB8)"
                     /codon_start=1
                     /product="ACR111Cp"
                     /protein_id="NP_983513.1"
                     /db_xref="GeneID:4619644"
                     /translation="MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNT
                     ELFPLQPQQQLTVMLATTLNLDGTEDSHGSWRPPAPGARSLADDFDYVTYGTAYKFEE
                     ANGNKDMLAVYYSFGGLLMRLEGNYRLLSNFKQENVYLLCRR"
     gene            complement(<549552..>550016)
                     /locus_tag="AGOS_ACR112C"
                     /old_locus_tag="ACR112C"
                     /db_xref="GeneID:4619645"
     mRNA            complement(<549552..>550016)
                     /locus_tag="AGOS_ACR112C"
                     /old_locus_tag="ACR112C"
                     /product="ACR112Cp"
                     /transcript_id="NM_208867.1"
                     /db_xref="GeneID:4619645"
     CDS             complement(549552..550016)
                     /locus_tag="AGOS_ACR112C"
                     /old_locus_tag="ACR112C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL135W (ISU1) and YOR226C (ISU2)"
                     /codon_start=1
                     /product="ACR112Cp"
                     /protein_id="NP_983514.1"
                     /db_xref="GeneID:4619645"
                     /translation="MLGFRQTATAIVRPVGTIGYARRCYHPKVIDHYTNPRNVGTLDK
                     KLTNVGTGLVGAPACGDVMRLQIQVDDSTGVIENVKFKTFGCGSAIASSSYMTELVRG
                     KTLADAEKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIKDYRSKRKATELR"
     gene            <550376..>553684
                     /locus_tag="AGOS_ACR113W"
                     /old_locus_tag="ACR113W"
                     /db_xref="GeneID:4619646"
     mRNA            <550376..>553684
                     /locus_tag="AGOS_ACR113W"
                     /old_locus_tag="ACR113W"
                     /product="ACR113Wp"
                     /transcript_id="NM_208868.2"
                     /db_xref="GeneID:4619646"
     CDS             550376..553684
                     /locus_tag="AGOS_ACR113W"
                     /old_locus_tag="ACR113W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR227W (HER1) and YPL137C (GIP3)"
                     /codon_start=1
                     /product="ACR113Wp"
                     /protein_id="NP_983515.1"
                     /db_xref="GeneID:4619646"
                     /translation="MADQMSATSAAPRTRADYSSLDFDVDVAWLYRGKKRGKQRKAGE
                     DGTRGRASSVSNAELSRQADSGQAGTGSASGSERSAQSAATEPAAVPERQSGGIGFLK
                     RSNSVGERPKKSLFGSLFSRRLASSSGVPLSGPPHGARASQRGDARGAESGRQCAPAG
                     IPIGRATDGMARYLNEPSSPEVRDAAPINDRPRRMEPGALPVPSLQLLSGVQLRRVAF
                     AVDKFSTDPPQQIPSRRPRRGNVLIPDEILGEVPTISQGISNPEGICGQKESQLTKDS
                     KEYKIALENYRKALKESKKHQQEAHMAALRTANEVAAFKYKQSHSQRELVPEAAVDDR
                     AKHLEIDKPTQANETSFDGEDTECGDESGKELTLDQIYTRCCHLREILPIPSTLKQVK
                     NKTAPLHTLKFLNPKPTLIDLLSFCDFIAVVPIHNVVFDNVNLTPEMFKIMITSLVNS
                     TALERLSIRNVVTDADCWAALCKFILSNRSLIKLDISQTKVRQDLARTLYRSNMNWPL
                     FIEVLQRRQHAPLEELLLNGIQFFDLSIFNGLLHAFTLRPASKKRLGVAHSFLKEEHL
                     KLLFDWASTYNVQGIDLAFNNLTDLVKPMVSKLTTMNFDHLHYFTLNSTALGFCDAAL
                     CLRALSKLPNLYFLDLSSLPAIFPEIFPFLNKYLPRFPFLKRLHLDSNDFMMDHISLL
                     SQILQKCKELLHLSMLYQPESSYGMSACAALYDFVANSPKLKNLDVDYEYIPEEISSR
                     IAVCLIRNAQKSLNEDFELDELTSQDDLLFDGELITKTAGGILSKLGTSSEKSNDDSS
                     RRYLLKKYWQKINRVHTNVQSTIDDLFEKRSKDELTLQGKENLLRLLFVENTLSKILE
                     ILADSQEVASLLDDNPEGISAPNLEAVDSSTLLMPATRLEDGYLDTQGISASTQVDRP
                     HFMATDSGRTIDVTTGRPVVLRQSSQTSIVCKKQEEEEGELHKWGYFVAQKRSGLPLP
                     QYVSEHPAQSQPSQADNATDMRVIISKIPSGAELKAAIIKAKGIASMEDLIDNVNHNR
                     VHLDNIYGIPYSTRPVSADRASVSSQSRSVCTPNEEPVSAPLPPDGHEELDEHVGETY
                     DKLLNNLSRVRSNR"
     gene            complement(<553751..>554455)
                     /locus_tag="AGOS_ACR114C"
                     /old_locus_tag="ACR114C"
                     /db_xref="GeneID:4619647"
     mRNA            complement(<553751..>554455)
                     /locus_tag="AGOS_ACR114C"
                     /old_locus_tag="ACR114C"
                     /product="ACR114Cp"
                     /transcript_id="NM_208869.1"
                     /db_xref="GeneID:4619647"
     CDS             complement(553751..554455)
                     /locus_tag="AGOS_ACR114C"
                     /old_locus_tag="ACR114C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR228C"
                     /codon_start=1
                     /product="ACR114Cp"
                     /protein_id="NP_983516.1"
                     /db_xref="GeneID:4619647"
                     /translation="MVFGYMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVL
                     VWTVGVHVAAGVALRAMSWYRRWTRRGRRYVTRVESDTSPRRIGLIGGLSGYFLGLNK
                     TVRHNPHAVSGYLLVPLLAYHAALMKWLPARAGVDVDFDFVQWLLYGGTGSAWTRWGL
                     GIMPLAGLVSVGAYHMFTGLVQLLRWRSLALRRKVFNVVVGINVVGLVSLWRLSTVRP
                     IMNVQYHRILQQLLWR"
     gene            <554692..>555738
                     /locus_tag="AGOS_ACR115W"
                     /old_locus_tag="ACR115W"
                     /db_xref="GeneID:4619648"
     mRNA            <554692..>555738
                     /locus_tag="AGOS_ACR115W"
                     /old_locus_tag="ACR115W"
                     /product="ACR115Wp"
                     /transcript_id="NM_208870.2"
                     /db_xref="GeneID:4619648"
     CDS             554692..555738
                     /locus_tag="AGOS_ACR115W"
                     /old_locus_tag="ACR115W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL138C (SPP1)"
                     /codon_start=1
                     /product="ACR115Wp"
                     /protein_id="NP_983517.2"
                     /db_xref="GeneID:4619648"
                     /translation="MGFRIRDAHYHTLAANRWSIAMSLPDWCPPFQGTKQDPSTGEDV
                     YCICKKPDGGELMVQCDGCGDWFHFTCIRIPSAYKSLVFSFYCPYCQAGITYSGTGAL
                     PRTVWKRRCRMEGCYRACARDSKYCGPEHGEAYMRALVERAGPGGQAVVQQMVRTGQF
                     ESLGTGALPLARRDVDPALYDRVVGADARLGELEAEAREVREARRPALRAQLAALSAY
                     LAWVREVNDALFHDTEEAAPRRGKARARRKPKRALCGFRADYQAPLPAADFAASYADD
                     AALLHGVCCRLRCPRHQDWASMRLGSVQFELEALDSAEQRLQLLISMRKEHLSLRFHE
                     LRAGAHPRVATPAT"
     gene            <555943..>557304
                     /locus_tag="AGOS_ACR116W"
                     /old_locus_tag="ACR116W"
                     /db_xref="GeneID:4619649"
     mRNA            <555943..>557304
                     /locus_tag="AGOS_ACR116W"
                     /old_locus_tag="ACR116W"
                     /product="ACR116Wp"
                     /transcript_id="NM_208871.2"
                     /db_xref="GeneID:4619649"
     CDS             555943..557304
                     /locus_tag="AGOS_ACR116W"
                     /old_locus_tag="ACR116W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL139C (UME1), YOR229W (WTM2) and YOR230W (WTM1); Tandem
                     gene duplication in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACR116Wp"
                     /protein_id="NP_983518.2"
                     /db_xref="GeneID:4619649"
                     /translation="MAEDREASRGTPVRLRQTTNDVPDPTVNKIKNEQFKVWKKTIPS
                     LYQYITSLKPRYASPAGVAGSVRKTIAFTDEAERRMENGVLHTSVLVSLGRDVYRQGC
                     VLPLGVHLEEADGGGALPDPEFEDSMGLQEQLRPVWTHPSADVAGMAYVGRADVAAVV
                     VATDGSVAWFRSGAPRPVQTLPPVAGSVAEVDLAVSEDGQLAVVVQSGIDGDNAHTVL
                     RVVDNGDALGKVLHTVRLSEAAVVHAVKFQGSHIFVTCSSDNTVRFWDARTPAEPLWH
                     LHGVRDGRFVAVAPSPLVGTVFATGSDTGVIKLWDIRAVIAATADEPAAELTRLVHPD
                     GDAVVELLFSADTPTQFVSVGAPGNVYHWDVEPLLQLPGEDDPNESARDSDELQQQCL
                     KFLHTVGGRRTLGPIPKRKTVAWHPTFGDVVGCIDADGLITVYKPYFGRPDDPDADDD
                     SLQ"
     gene            <557735..>559309
                     /locus_tag="AGOS_ACR117W"
                     /old_locus_tag="ACR117W"
                     /db_xref="GeneID:4619650"
     mRNA            <557735..>559309
                     /locus_tag="AGOS_ACR117W"
                     /old_locus_tag="ACR117W"
                     /product="ACR117Wp"
                     /transcript_id="NM_208872.1"
                     /db_xref="GeneID:4619650"
     CDS             557735..559309
                     /locus_tag="AGOS_ACR117W"
                     /old_locus_tag="ACR117W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR231W (MKK1) and YPL140C (MKK2)"
                     /codon_start=1
                     /product="ACR117Wp"
                     /protein_id="NP_983519.1"
                     /db_xref="GeneID:4619650"
                     /translation="MAFMFKPPEQRKRNEKSPRLSLPSTLIGSATPAGDEHASGAMGN
                     SIGSDLHREQKLRGLGQSVQIAEQLSAGSTDTAGSDVLSQHAPSSASSQTSKVLPRRP
                     VPPGMPALAFLSKHPYAQQVTGPLPTTSGEKAGSHSGATTLSAGPTRPPLPKLPYLHV
                     EPKLPCEELPYSALHAGSSSSSNIHSPSRALQEMRLISAGSTPVEPVPPAATVPPCKD
                     VDELEEEMWTHVHLKDQIEELGVLGEGAGGSVTKCKLRHGSKIFALKTITTLTTDQES
                     QKQIFRELQFNKSCKSDYIVRYYGMFTDEEHSSIYIAMEYMGGRSLDAIYKHLLKHGG
                     RVGEKVLGKIAESVLRGLSYLHQRKIIHRDIKPQNILLNEAGQVKLCDFGVSGEAVNS
                     LATTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQAHFPFDSGKFAANMPPIE
                     LLMLILTFTPQLKDEPEANIVWSKAFKSFISYCLKKESRERPSPRQMLRHPWIQGQMK
                     KRVNMEKFIYKCWQAR"
     gene            <559468..>560106
                     /locus_tag="AGOS_ACR118W"
                     /old_locus_tag="ACR118W"
                     /db_xref="GeneID:4619651"
     mRNA            <559468..>560106
                     /locus_tag="AGOS_ACR118W"
                     /old_locus_tag="ACR118W"
                     /product="ACR118Wp"
                     /transcript_id="NM_208873.1"
                     /db_xref="GeneID:4619651"
     CDS             559468..560106
                     /locus_tag="AGOS_ACR118W"
                     /old_locus_tag="ACR118W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR232W (MGE1)"
                     /codon_start=1
                     /product="ACR118Wp"
                     /protein_id="NP_983520.1"
                     /db_xref="GeneID:4619651"
                     /translation="MGPYLPAILRPIGRYATLYNVPRVAGQLRCYAADAKDAADAQGE
                     SAADPRVAELEKQLADKSKEAADLKDRLLRSVADFRNLQEVTRRDVQKARDFALQRFS
                     KDLLESLDNFGHALGAVSPEALQRSPEIADLHAGVRLTRDVFEKTLLKHGIAPIDALG
                     QPFDPNLHEATFELPQPDKTPGTVFHVQQPGYTLNGRVIRPAKVGVVKDPDA"
     gene            <560758..>563553
                     /locus_tag="AGOS_ACR119W"
                     /old_locus_tag="ACR119W"
                     /db_xref="GeneID:4619652"
     mRNA            <560758..>563553
                     /locus_tag="AGOS_ACR119W"
                     /old_locus_tag="ACR119W"
                     /product="ACR119Wp"
                     /transcript_id="NM_208874.2"
                     /db_xref="GeneID:4619652"
     CDS             560758..563553
                     /locus_tag="AGOS_ACR119W"
                     /old_locus_tag="ACR119W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL141C (FRK1) and YOR233W (KIN4)"
                     /codon_start=1
                     /product="ACR119Wp"
                     /protein_id="NP_983521.2"
                     /db_xref="GeneID:4619652"
                     /translation="MTSIPHRHTYYGGGATPPAATGPLSGSRGHAAGRSKKKQVTFGP
                     YIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIKIYRELNAL
                     KLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLFAQLISG
                     VHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKNDLMRTSCGSPCYAAPEL
                     VVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYQYITHTSLKFP
                     EYIKPIPRDLLRRILVSNPEVRLTVADIEQHAWLQPHAQFLMWSPSDWDAKAKAETNN
                     LFRQPSAVHAGVLRPQSSCSISSANSKGDNRGSLIMDSTLNPQPVPPQEFQSHIIMKP
                     TSPSNGLRKMSPVRRHARSNSAASIALQAVVDAERDYFNSPSIHSLHHDSLSQNTTPP
                     SSAGRVPTYAITRSATHHNGISSSLMNRNSVIIEVSPQKGSVPPVMIPGNRESLNGQE
                     SGGIAMADMSQRPTIVKDKTSSHMVPQAGRKQRPTSYQPCSTTAFAQSPDLVSGAGAL
                     VPIMGKQQRVSTASNPTFVDVGRSGSTRRLPGPNNQLLETPFEADRQIDDNPVVDDAT
                     IKSDDMLPSTLEIVAYDNECGTSPGSNGQHRRYSAIVMSEIYEQEEGERISCELSSPK
                     KMGSARPDCSTARISINTPNMGLQNRECIVSSSSPESDASSKQKSGKTDKKDKRFSLL
                     SFYSFYNNSKSSIDSSTDAVQPTGLVLDVVKHPNISRTSSQKKNPAPAGNGTQAIPRR
                     HNTLPREAQRTPVALSYVYASLDVTPNAGTPELADVPSPINLVKMAEQPHGTKQHDPS
                     TPTRSATVHGKSQRLSNNTPKGPIYEDPKPKRKTNKVSLMVSSINPSQAPQPPRQKEP
                     STARKVLDFFKRRSLRI"
     gene            complement(<563768..>564320)
                     /locus_tag="AGOS_ACR120C"
                     /old_locus_tag="ACR120C"
                     /db_xref="GeneID:4619653"
     mRNA            complement(join(<563768..564072,564302..>564320))
                     /locus_tag="AGOS_ACR120C"
                     /old_locus_tag="ACR120C"
                     /product="60S ribosomal protein L33"
                     /transcript_id="NM_208875.1"
                     /db_xref="GeneID:4619653"
     CDS             complement(join(563768..564072,564302..564320))
                     /locus_tag="AGOS_ACR120C"
                     /old_locus_tag="ACR120C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL143W (RPL33A) and YOR234C (RPL33B); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L33"
                     /protein_id="NP_983522.1"
                     /db_xref="GeneID:4619653"
                     /translation="MAESHRLYVKGKHLSYQRSKSVNNPNVSLIKIEGVTNPEDAKFY
                     LGKRVAYVYRCSKEVRGSKIRVIWGKIARTHGNSGVVRAKFRSNLPAKTFGASVRIFL
                     YPSNI"
     gene            565017..565319
                     /locus_tag="AGOS_AgSNR17"
                     /old_locus_tag="AgSNR17"
                     /db_xref="GeneID:4619655"
     ncRNA           565017..565319
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR17"
                     /old_locus_tag="AgSNR17"
                     /product="AgSNR17"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR17; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149364.1"
                     /db_xref="GeneID:4619655"
     STS             565098..565998
                     /standard_name="ha2302"
                     /db_xref="UniSTS:515518"
     gene            complement(<565394..>567424)
                     /locus_tag="AGOS_ACR122C"
                     /old_locus_tag="ACR122C"
                     /db_xref="GeneID:4619656"
     mRNA            complement(<565394..>567424)
                     /locus_tag="AGOS_ACR122C"
                     /old_locus_tag="ACR122C"
                     /product="ACR122Cp"
                     /transcript_id="NM_208877.2"
                     /db_xref="GeneID:4619656"
     CDS             complement(565394..567424)
                     /locus_tag="AGOS_ACR122C"
                     /old_locus_tag="ACR122C"
                     /note="NOHBY324; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0D07414g"
                     /codon_start=1
                     /product="ACR122Cp"
                     /protein_id="NP_983524.2"
                     /db_xref="GeneID:4619656"
                     /translation="MSPTPLYPSVSSPSHAKKTLRQKQIEEYYAAEIYPPIIDGPVDY
                     DLPQLKVYGDQRPCPELILDDSENALRPLVEEWLEKLNAMLESINTGARREIIHSNMD
                     NVFTNHAAWRDHLAVSWDLHTFNTLDDLKDRLVPFLESALLENVKLDDLADYHYKYGF
                     GKVLVHEETWDHPPIEWIQVYYSFENKIGYGKGIARLAAVEDELTGEATLKCFTFYTV
                     LEDLKAYPEKILRNRPEGVNHGQHVGRQSWLELRAKETTFDRNNQPTVLIVGGGQGGL
                     AVAARLKSFGISSLIIEKNARVGDNWRNRYKFLVLHDPIWYDEMPYLRFPPTWPVYTP
                     KDKLGDWFDAYAKSLDLNTRCASTVTGASFDELTGRWRVEVTDNLSGGVTYFAPSHLI
                     LATGHSGEPRLPKFKDQELFEGKIVHSSEHGTGAEYKGKRALVVGGCNSAHDICQDFY
                     EQGADVTMLQRSSTCIITATHGTIHNNRGLYDEDGPVTETADHIFHSMPIHLLNGMMQ
                     QQYRVSCRDDEELLRSLQRVGFKLNGGYNGTGLFGLYFRQGSGYYIDVGCSGLIADGK
                     VKLKQGVGIERFLKNGVVFTDGSRLENIDIVVLATGYTNMRETARRLFGNKVAGRLDP
                     VWGLDEEGETKTMWRNSGHPNFWFMGGNLALARYYSKRLALKIVAQEMNIFY"
     gene            complement(<567776..>568162)
                     /locus_tag="AGOS_ACR123C"
                     /old_locus_tag="ACR123C"
                     /db_xref="GeneID:4619657"
     mRNA            complement(<567776..>568162)
                     /locus_tag="AGOS_ACR123C"
                     /old_locus_tag="ACR123C"
                     /product="ACR123Cp"
                     /transcript_id="NM_208878.1"
                     /db_xref="GeneID:4619657"
     CDS             complement(567776..568162)
                     /locus_tag="AGOS_ACR123C"
                     /old_locus_tag="ACR123C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL144W (POC4)"
                     /codon_start=1
                     /product="ACR123Cp"
                     /protein_id="NP_983525.1"
                     /db_xref="GeneID:4619657"
                     /translation="MTQTKTADYTVSTLGGDDVRLLVTMPVELTASKKVPVSIVVSGR
                     CDGVNEELAATVYGVPYKGSDVVTSVLLDTADNRIRDFGSTFCRVLVKKVGLPCYVSV
                     SSSVGRMLDSGDQLAVIRKALEHLTS"
     gene            <568310..>568945
                     /locus_tag="AGOS_ACR124W"
                     /old_locus_tag="ACR124W"
                     /db_xref="GeneID:4619658"
     mRNA            <568310..>568945
                     /locus_tag="AGOS_ACR124W"
                     /old_locus_tag="ACR124W"
                     /product="ACR124Wp"
                     /transcript_id="NM_208879.1"
                     /db_xref="GeneID:4619658"
     CDS             568310..568945
                     /locus_tag="AGOS_ACR124W"
                     /old_locus_tag="ACR124W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR236W (DFR1)"
                     /codon_start=1
                     /product="ACR124Wp"
                     /protein_id="NP_983526.1"
                     /db_xref="GeneID:4619658"
                     /translation="MGISRVPVVSIVACLLPEYGIGYQGQLPWRLAREMKYFRQATTA
                     TFDPTKRNAVVMGRKTWESIPARWRPLPGRLNVVVSRTYTSPWAHDENGHVITSNSLQ
                     QCVRQLQEQARALGVERIYIMGGAEIYNQSYDLCDHLLVTELQVAPDGPAVLLDTFLA
                     RDVLEQSFAKNSAGPRALLPPSVELPECPATALEEGGFQFRFALYDHLNRD"
     gene            <569250..>570512
                     /locus_tag="AGOS_ACR125W"
                     /old_locus_tag="ACR125W"
                     /db_xref="GeneID:4619659"
     mRNA            <569250..>570512
                     /locus_tag="AGOS_ACR125W"
                     /old_locus_tag="ACR125W"
                     /product="ACR125Wp"
                     /transcript_id="NM_208880.1"
                     /db_xref="GeneID:4619659"
     CDS             569250..570512
                     /locus_tag="AGOS_ACR125W"
                     /old_locus_tag="ACR125W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL145C (KES1) and YOR237W (HES1)"
                     /codon_start=1
                     /product="ACR125Wp"
                     /protein_id="NP_983527.1"
                     /db_xref="GeneID:4619659"
                     /translation="MSQYASSSGWTSFLKSIASFNGDLSSLTAPPFILSPVSLAEYSQ
                     YWGEHPDLFLAPKLITEADGKVSAEERRMLAVVKWFIATLKSQYCSRSEALGSEKKPL
                     NPFLGELFVGSWQNKGHPELGEVVLLSEQVSHHPPVTAYTIFNDKNKVRLQGYNQVKA
                     SLSKMSLNVKQFGHALLELGDLDEQYLITLPPLHLEGLLAASPYVELEGKSCIQASNG
                     MYCSIEYSGKGYFSGKKNSFKARIFRSSGDAEDKDKALYTISGQWSGLSHIIDHRNSS
                     SKKGEELFYDSSKTSIESLHVKPIDEQHPLESRKAWQKVAAAIISGDFDTIHREKTAL
                     EQSQRELRKEEEAKGINWRRRWFKDVDYSAGTSDNAFIKLAALAQLSTRNVPSGTPVS
                     KDPKSDNVPVVHWRFVRKLWDEETEIKL"
     gene            <570851..>572161
                     /locus_tag="AGOS_ACR126W"
                     /old_locus_tag="ACR126W"
                     /db_xref="GeneID:4619660"
     mRNA            <570851..>572161
                     /locus_tag="AGOS_ACR126W"
                     /old_locus_tag="ACR126W"
                     /product="ACR126Wp"
                     /transcript_id="NM_208881.1"
                     /db_xref="GeneID:4619660"
     CDS             570851..572161
                     /locus_tag="AGOS_ACR126W"
                     /old_locus_tag="ACR126W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL146C (NOP53)"
                     /codon_start=1
                     /product="ACR126Wp"
                     /protein_id="NP_983528.1"
                     /db_xref="GeneID:4619660"
                     /translation="MSGDSRPAQYKQSSRKGKKAWRKNIDLTEIEQSIDSRIEHEITH
                     GAENLADVPSQNLFEVDTTGDELLKAKLIKRKQIKKNIKSKEILDSIKSNSKVPALLH
                     PKSHVNEKAKVQGVSKKELNRLMTLAGRNMESKLKAQVTKEGLVKAGTNDLWGSEEPL
                     KTPSGDFDLKLKDKVPEPLLKQSTTSWSRATVAPETLKHAPLRVKDTEELPHAGKSYN
                     PDKKQWEALIEKEYKIESANEERRQQMAEYKKKIQHLMETLDDREEESDEDAPQSEEE
                     LASVDEDGDFRLSLNPAVKNKKKTKYQRNRQKRHQEKVKLQQELKTLKEQLHQLEKLE
                     AIEQAVAAKTAQEASTLIPAKVKNNKKHKLGTKHSVMEDNLEVKFSDELSGSLRSLRP
                     EGNLLYDSLRKLQGSGKIETRVPIRKGRKYKQKITEKWTYKDFK"
     gene            <572283..>573182
                     /locus_tag="AGOS_ACR127W"
                     /old_locus_tag="ACR127W"
                     /db_xref="GeneID:4619661"
     mRNA            <572283..>573182
                     /locus_tag="AGOS_ACR127W"
                     /old_locus_tag="ACR127W"
                     /product="ACR127Wp"
                     /transcript_id="NM_208882.1"
                     /db_xref="GeneID:4619661"
     CDS             572283..573182
                     /locus_tag="AGOS_ACR127W"
                     /old_locus_tag="ACR127W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR238W"
                     /codon_start=1
                     /product="ACR127Wp"
                     /protein_id="NP_983529.1"
                     /db_xref="GeneID:4619661"
                     /translation="MVDLRPKQLIVVPCHSIWRQSSDTAEENLGQKRSHWHLAEFQHE
                     GNDHLAFIKHALIAIETLIASLDVSIVIFSGGKTKAVAGEVSEASSYFYLTKKLLQRV
                     QCGKSIRWAFPDAAEIPELCQKIIGRLHEKAGLSVDALFAEYVHLEEFALDSFDNLLY
                     SIGRFKEITSVYPSNITIIGFGFKKRRFIEYHARAIDFPTGQINYIEVEPTPSYDDPV
                     WLKNYFETLRTLEHRNALALFQKDWYATREPLASKKSARNPFNESHQYPLPLPHLESP
                     DFQIENDATYYNASIKSKMPWSQ"
     gene            complement(<573248..>575734)
                     /locus_tag="AGOS_ACR128C"
                     /old_locus_tag="ACR128C"
                     /db_xref="GeneID:4619662"
     mRNA            complement(<573248..>575734)
                     /locus_tag="AGOS_ACR128C"
                     /old_locus_tag="ACR128C"
                     /product="ACR128Cp"
                     /transcript_id="NM_208883.2"
                     /db_xref="GeneID:4619662"
     CDS             complement(573248..575734)
                     /locus_tag="AGOS_ACR128C"
                     /old_locus_tag="ACR128C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL147W (PXA1)"
                     /codon_start=1
                     /product="ACR128Cp"
                     /protein_id="NP_983530.2"
                     /db_xref="GeneID:4619662"
                     /translation="MASGTQRLLQVQKLFIETNRNMFGLDVRRVAARDYLKVLMWHMW
                     TLLQAAKGRRGRRLRALAAAAAAMVVTGSALTVYQFVSGLRRDGRRPGLQRSRSQILL
                     KSGAREIHVPYGDSERTKRVIIKPTHKDRYEHDRFLFKYFDKGSESRIFYSRFLAQLG
                     ILWKILIPRLADKNSLWLCLQVFFLVMRTWLSLLIARLDGHIVKDIIAARKKRFMMDI
                     ACWFLIAFPASYTNSAIKFLQRKLSLNFRTNLTRYVHDMYLDHRLVFYKLMYDQDASR
                     SVVANVDNSIANDIAKFCDAVTNLFANMAKPVIDLVFFSFYLRDNLGTLGVAGIIMNY
                     FLTGIVLRRYTPPLGKLVSKRSSAEGAYYNYHLNMINNNEEIAFYQGTEVERTKVIKI
                     YENLMEKMLEVDRAKVGYNVIEDYILKYTWSALGYAFASIPIVFAVGKTGQRKEDTNM
                     RDFIVNKRLMLSLADAGSRLMYSIKDISQLTGYTGRVFTLLRVLHRVHSSDFKYGLIE
                     DIPAPVAGQSESTDLSKNVPSDIRGTVQRNFNGIRLENIDVIIPSPKGIQGTKLISKL
                     KFQIPPVVISDMKASSAPVVSSHSVASMLLGPGSSLLILGPNSCGKSSIQRILAEIWP
                     IYNKTGLVSIPAESDLMCIAQRPYFIQGGTFRDQIIYPMSVDRFYEKGHKDRELVRIL
                     KEVKLDYLLKRSEGLSYLDFVADWKDILSGGEKQRMNFARIMFHRPKFLVLDEATNAI
                     SVDMEDYLFNMLRKCRFNFISISQRPSLIKYHDYLLEITSGTQWQYQTLGSDEAITSI
                     EAEIESLESKLTQLDAWEKEREELKRKLTH"
     gene            <576334..>576858
                     /locus_tag="AGOS_ACR129W"
                     /old_locus_tag="ACR129W"
                     /db_xref="GeneID:4619663"
     mRNA            <576334..>576858
                     /locus_tag="AGOS_ACR129W"
                     /old_locus_tag="ACR129W"
                     /product="ACR129Wp"
                     /transcript_id="NM_208884.2"
                     /db_xref="GeneID:4619663"
     CDS             576334..576858
                     /locus_tag="AGOS_ACR129W"
                     /old_locus_tag="ACR129W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL148C (PPT2)"
                     /codon_start=1
                     /product="ACR129Wp"
                     /protein_id="NP_983531.2"
                     /db_xref="GeneID:4619663"
                     /translation="MLVPHDRMVGNKRRGTMRVLGIGTDLVYMPRVVELLRRMPAGSG
                     AHARFAGKFMHARERAGALGAKDQARYVAGVWAAKEALYKAVAGADAPPAATLYRACY
                     KEADAVGRPTLQVDAGELQRAGHMRFWEERLAGTRFLLSVSHDEDYLVAFVCHVADET
                     FRAPDERQRITKNS"
     gene            <577065..>578778
                     /locus_tag="AGOS_ACR130W"
                     /old_locus_tag="ACR130W"
                     /db_xref="GeneID:4619664"
     mRNA            <577065..>578778
                     /locus_tag="AGOS_ACR130W"
                     /old_locus_tag="ACR130W"
                     /product="ACR130Wp"
                     /transcript_id="NM_208885.3"
                     /db_xref="GeneID:4619664"
     CDS             join(577065..577709,577711..578778)
                     /locus_tag="AGOS_ACR130W"
                     /old_locus_tag="ACR130W"
                     /ribosomal_slippage
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR239W (ABP140); no intron, ribosomal slippage at
                     consensus CTTAGGC site"
                     /codon_start=1
                     /product="ACR130Wp"
                     /protein_id="NP_983532.2"
                     /db_xref="GeneID:4619664"
                     /translation="MGVADLIKKFESITKEDAEEGAKEAGEAGAVLKGGSAGALAGTG
                     TEEAAGEESKLHCGQEEQEEEQEDVLPELQEQEDEQEPEQELEQEPEQEQKQEQAAEA
                     AAQEDVAAAQKLGEQETEQKEEREDEDEEDSSKNSESEEAQEEQQEDDGEGSFATESS
                     ANPGEVRRVETGRKRNNKKKGKKGKKGKGKRKRGLSSAGSSAGTLEVVSGGVSSLGKH
                     DLKDELEVMTTDVQEQALDDVHHEANNIVDPSSTTGENSGAESENGEDSQRTVDTRIG
                     RDDPFQFGQRKLADEADIWAHNAWDNVDWGDEQIRLAKEKIEEQKEYPVQEFDKKLYH
                     SNPARYWDIFYKNNKENFFKDRKWLQIEFPSLYEATKKDAGSVTIFEIGCGAGNTMFP
                     ILSANENEHLRVVGADFSPKAVELVKTSQNFNPANAHATVWDLANPDGLLPDGVEPHS
                     VDIAVMIFVFSALAPSQWAQAMDNLHKVLKPGGKILFRDYGRYDLAQIRFKKHRLLED
                     NFYIRGDGTRVYFFTEEELRAIFTEKHFKEVKIASDRRLLVNRKRQLKMYRVWLQAIF
                     SVPE"
     gene            complement(<578869..>579750)
                     /locus_tag="AGOS_ACR131C"
                     /old_locus_tag="ACR131C"
                     /db_xref="GeneID:4619665"
     mRNA            complement(<578869..>579750)
                     /locus_tag="AGOS_ACR131C"
                     /old_locus_tag="ACR131C"
                     /product="ACR131Cp"
                     /transcript_id="NM_208886.2"
                     /db_xref="GeneID:4619665"
     CDS             complement(578869..579750)
                     /locus_tag="AGOS_ACR131C"
                     /old_locus_tag="ACR131C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL149W (ATG5)"
                     /codon_start=1
                     /product="ACR131Cp"
                     /protein_id="NP_983533.2"
                     /db_xref="GeneID:4619665"
                     /translation="MGVVNELRQRTWSGMLNVEVVLNPKLVVQGMPDEQVRCHLRIPR
                     ESYLVLHLPFVLNKLRGVLRQEVKDAFHGWWFGMEDVLVHWNHPVGTLYDSLVGLRPQ
                     ERAAQFQANTLTMWTLTLNYSEDARDGSVPLVGGMQQVEDFWRHQWKQACYIIHGSSK
                     QIMSLSIPDSKTFWDCVLQRDERVFRGIASRITARKGGVKALPVRIHQTTLRELRTLQ
                     PTVKPGEWGGGTLGELLRAELPECFKNGSVLRPVVHGIEVSPESQLADLYHLFCSFDG
                     FLHISICSPVALIIPTT"
     gene            <579893..>581434
                     /locus_tag="AGOS_ACR132W"
                     /old_locus_tag="ACR132W"
                     /db_xref="GeneID:4619666"
     mRNA            <579893..>581434
                     /locus_tag="AGOS_ACR132W"
                     /old_locus_tag="ACR132W"
                     /product="ACR132Wp"
                     /transcript_id="NM_208887.1"
                     /db_xref="GeneID:4619666"
     CDS             579893..581434
                     /locus_tag="AGOS_ACR132W"
                     /old_locus_tag="ACR132W"
                     /note="NOHBY325; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F11341g"
                     /codon_start=1
                     /product="ACR132Wp"
                     /protein_id="NP_983534.1"
                     /db_xref="GeneID:4619666"
                     /translation="MRLIGAAAELKEHWLWQPEVDRVVDVFDAPEATVMVFGVFYIDK
                     FVMDVQDKIRKIHAQLEEVFRPWNEHYPWQGYSGVHLRAVRGAGGQAMVLGGVEVADN
                     AEEEEALVAGVLQRFSRAQGAEVFIKMCDTEGDFLLMMSSEALPEEYDYPVGNNRLWL
                     SAGEFKLIPRDVHGSRGLRANEAVDYLERSHFKCLTVPAVSRALEARIAQGFPARHLE
                     ALTWVHLKMRQTAHAELVRANPTVFPLLLANFLRNDLSLTGAAMEGQEAKCSDVHVLV
                     PKTHAALASLLLAHSPVARGGDLGITLGDILSLSLQDALDAGQLTTAEPKGKLEGDLV
                     SALVHTKQLERPVEFSTTELTTEVPTADKEASMDALALSLETFLTDIKDDDEGSNEHV
                     SGQGSSAGDEEARTFFESEGVDISEDDFFEYFLTEGLKMNKEQLQHYRNGAYEDCAND
                     DNAGSEHEEEDIMLEELHAMFGDKDGADGIKGIEQLFNSINLDGAPTGPLQAILKNMA
                     SHKKK"
     gene            complement(<581468..>584023)
                     /locus_tag="AGOS_ACR133C"
                     /old_locus_tag="ACR133C"
                     /db_xref="GeneID:4619667"
     mRNA            complement(<581468..>584023)
                     /locus_tag="AGOS_ACR133C"
                     /old_locus_tag="ACR133C"
                     /product="ACR133Cp"
                     /transcript_id="NM_208888.1"
                     /db_xref="GeneID:4619667"
     CDS             complement(581468..584023)
                     /locus_tag="AGOS_ACR133C"
                     /old_locus_tag="ACR133C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL150W"
                     /codon_start=1
                     /product="ACR133Cp"
                     /protein_id="NP_983535.1"
                     /db_xref="GeneID:4619667"
                     /translation="MIGSRVKQNNLKATIGASYNKLYGQFTASELREVGNYRIVKQVG
                     EGSFGKVYLATHKLTHQKVVLKTGAKSDPNVVREVFYHRQFEYPFITKLYEVIVTETR
                     VWMALEYCPGNELYDYLLLKQRIPLDETRRLFAQIVSAVFYAHSLQCVHRDLKLENIL
                     LDKNGYAMLTDFGFTRECATKTQLETVCGTTVYMAPELIKREAYDGYKVDTWSLGIIL
                     YTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLLDKNAAQRPNLNE
                     VLQHPFLQPYGALLLETVECLIKRQRRASLKFQSKTEKRLLKKLKQSGFDTNAIRAAV
                     VKRSCDSLCSLWYLLLEKEKKRELSKYPRRSRSMLSVRKVFDSASGVSTQDVLDIDNT
                     TSLRKIFSIRSEASSRGQLKEAEKEAAARRTRSASTSQNLNIPSEHSSPARAKTKSNI
                     FQKVTKFFSRAKKTQLNNNDRGFGHRRSTSRHGRRYKPAFDTLKKPLHESQGAETSAT
                     AGGDYPTSLGDRHRLRGALTIEEPKLKFKSQSSSELSIQQSLLTSEGDSNVASMSRAA
                     SLGRPRPSSMLSQHSALSNDTFNSEYSDPQSVYKAPTGSSAKVSGSGNINGGSTGDSG
                     SFSKSKVFAKRSVSIMSSASSASELSSKTDSFYDITTATSPTHLDIRATVNGTSRVES
                     AFPRADSAAITPAWLTKRDKTSILRRRVNTRTLKRNKLIRGNSTGTQSVIQEESSFSD
                     NDEQAPILAATEVVYARISNNPELDEDVPVQTDSSNSSHAELAIYPLTLNSDSKSGEF
                     LAGRSLSDVSAWSQNGSSLAVTQSQATKKESHEDQLFDQDSSSLTEYQQEKPS"
     gene            <584443..>585897
                     /locus_tag="AGOS_ACR134W"
                     /old_locus_tag="ACR134W"
                     /db_xref="GeneID:4619668"
     mRNA            <584443..>585897
                     /locus_tag="AGOS_ACR134W"
                     /old_locus_tag="ACR134W"
                     /product="ACR134Wp"
                     /transcript_id="NM_208889.2"
                     /db_xref="GeneID:4619668"
     CDS             584443..585897
                     /locus_tag="AGOS_ACR134W"
                     /old_locus_tag="ACR134W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR241W (MET7)"
                     /codon_start=1
                     /product="ACR134Wp"
                     /protein_id="NP_983536.2"
                     /db_xref="GeneID:4619668"
                     /translation="MTRMTRRGYQEAIGCLNGLQSNYANVMAVRASGERRNMMNLWEM
                     EEWSRRLGYGPGALDRLNVIHITGTKGKGSTAAFVQGIVRRYRAAGRVGLYTSPHLRS
                     VRERIRIDGEPVSEEQFSRGFFEVWDRLEATRSDEARFPHMGAGAKPGYFKFLTLLSF
                     HMFLEAGCETCVYEVGVGGAFDSTNIVRRPSVCGVTALGIDHTFMLGDTIEEIAWNKG
                     GIFKAGARALTVAGQPPAGLAVLRERAAEAGTALEEVPVLAALRDVKLGIAGDFQAAN
                     ASLAVALAAEHLRRRGEDCGLGALTAETPLPRKFVEGLEATRWEGRCQTIEDGTVTWY
                     VDGAHTKESIVAASTWFTKVAAPDRRKVLLFNQQTRDAGALLRHLHEATAPALTFDEC
                     LFTTNVTWKSGTYSADLVSHNTSKEEVSKLEVQRALQETWSSLPGGASSSSAVYSDIE
                     SAVAAIKSIQDPVDVFVTGSLHLVGGLLVVMDGK"
     gene            complement(<585997..>587127)
                     /locus_tag="AGOS_ACR135C"
                     /old_locus_tag="ACR135C"
                     /db_xref="GeneID:4619669"
     mRNA            complement(<585997..>587127)
                     /locus_tag="AGOS_ACR135C"
                     /old_locus_tag="ACR135C"
                     /product="ACR135Cp"
                     /transcript_id="NM_208890.1"
                     /db_xref="GeneID:4619669"
     CDS             complement(585997..587127)
                     /locus_tag="AGOS_ACR135C"
                     /old_locus_tag="ACR135C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR242C (SSP2)"
                     /codon_start=1
                     /product="ACR135Cp"
                     /protein_id="NP_983537.1"
                     /db_xref="GeneID:4619669"
                     /translation="MTSQGTFLENYATKDNDSLRSKMLSIASLMSGNSSTNSISSKEK
                     ERFGLRKLARSYLKASNRAEKPVNKTENQDNNEVSGAPYAKKMLIGKIHTKSGTKIYL
                     DTNKSRESLLIRKHHSHEASDEDESSVPQLKYDGDYDPVLGKLLINSSSEEEDSEWLE
                     SGLQDKCLVVLRDFPTGTGLKSVLNQVQGGALKHITPQYKKETNQLKSVELEFLCPED
                     AQHFMEYGRHAVFQINGVHLRPRWGIQSLSENFEASLNANQRDRLNLYAPSSRCLLLK
                     KQGSKNPKHSTCHYPSPRSHICDLNVQELKKDFSQFGNILDISPMISRKLCVQINFYD
                     IKSAMDALQSYKNANSPLNRKYAESWTIGYGKDITDKPCVHV"
     gene            complement(<587810..>589843)
                     /locus_tag="AGOS_ACR136C"
                     /old_locus_tag="ACR136C"
                     /db_xref="GeneID:4619670"
     mRNA            complement(<587810..>589843)
                     /locus_tag="AGOS_ACR136C"
                     /old_locus_tag="ACR136C"
                     /product="ACR136Cp"
                     /transcript_id="NM_208891.2"
                     /db_xref="GeneID:4619670"
     CDS             complement(587810..589843)
                     /locus_tag="AGOS_ACR136C"
                     /old_locus_tag="ACR136C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR243C (PUS7)"
                     /codon_start=1
                     /product="ACR136Cp"
                     /protein_id="NP_983538.1"
                     /db_xref="GeneID:4619670"
                     /translation="MSQENLQKRAVEADHEAVVAKKAKTEDDGLKEIDVGITEYLSAE
                     LPGFSGQIKQRYSDFMVNEIQKDGTVVYLRDNGFKMPAKPKPSADQVKAQQAEERERR
                     HNHAVEAELRNQLVELLGEEDMQQIEAVYRNVTKMETTRSFDDKAARTKIHQLLRKAF
                     NNELESVTSASNTFQIALANRKTRVSKEDYVEQTRDENGVINWGYGPSKNCVHFTMYK
                     ENKDTMDVVNIIAKFLRVPTKAIRFAGTKDRRAVTCQRLSIGRIGLDRINALNNALKG
                     VVLGGFSFEDEPLSLGDLNGNEFVIVIRDVSTDPNSATPLESILDRGCELLKNRGFIN
                     YFGMQRFGTFSVSTHEVGKELLLENWKNAVDLILSEQNNVLPASKEARKIWAETGDAE
                     SALRKMPRQCLAENSILHTLATQKKNEGEYESGAYYAAIMKIPRNLRTMYVHAYQSYV
                     WNTVTSKRMALFGLHAVAGDLVLVESDENAKVNIAEDSEDADDSEFSEDLRGAQFVRA
                     KALTEEDIASGKWTIDDVVLPTPGFDTTYPENETLKALYKEIMTKDGLDPFDMRRKVR
                     DFSLAGSYRHILQKTKDITYQIIHYKDSTQQLINSDFEILKNKRAKENGRNYMKDKLD
                     RICADKGGDKTAVVLKFKLGVSAYATMALRELMKAETSRRGDLCSVRTASGQV"
     gene            <590077..>591354
                     /locus_tag="AGOS_ACR137W"
                     /old_locus_tag="ACR137W"
                     /db_xref="GeneID:4619671"
     mRNA            <590077..>591354
                     /locus_tag="AGOS_ACR137W"
                     /old_locus_tag="ACR137W"
                     /product="ACR137Wp"
                     /transcript_id="NM_208892.2"
                     /db_xref="GeneID:4619671"
     CDS             590077..591354
                     /locus_tag="AGOS_ACR137W"
                     /old_locus_tag="ACR137W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL151C (PRP46)"
                     /codon_start=1
                     /product="ACR137Wp"
                     /protein_id="NP_983539.2"
                     /db_xref="GeneID:4619671"
                     /translation="MNEHSDDVYVRARLRNQFGYMTWVPEYVEDRISSKKGILQRYED
                     YQQKQAKAQEVKTDSLVKYEGAKDVPRNLLRIYRGEADTSALARYEEVVSQKPQWHAP
                     WKLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVR
                     DICISARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGR
                     DSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDPQIVSCSTDATVKLWDLVAGKPMK
                     TLTHHKRNVRDLAFNPTEFSFASACTDDIRSWKLVDGQLLTNFNSEALGIVNTLACNQ
                     DGVLFAGGDTGELSFFDYKTGHKFQKLETTAMPGSLESEKGVLASTFDRTGLRLLTCE
                     RDKSIKIWKHIDGATQDSHPGLPWNPSLVRQRF"
     gene            <591528..>592835
                     /locus_tag="AGOS_ACR138W"
                     /old_locus_tag="ACR138W"
                     /db_xref="GeneID:4619672"
     mRNA            <591528..>592835
                     /locus_tag="AGOS_ACR138W"
                     /old_locus_tag="ACR138W"
                     /product="ACR138Wp"
                     /transcript_id="NM_208893.2"
                     /db_xref="GeneID:4619672"
     CDS             591528..592835
                     /locus_tag="AGOS_ACR138W"
                     /old_locus_tag="ACR138W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR244W (ESA1)"
                     /codon_start=1
                     /product="ACR138Wp"
                     /protein_id="NP_983540.2"
                     /db_xref="GeneID:4619672"
                     /translation="MAQEEEKDAGISKYISTTDEIIIGCKCWVEKDGEQRLAEILSIN
                     NRRQPPKFYVHYEDFNKRLDEWILASRINIEREVTFPKPRDPDEKKKKKQKKSATPQA
                     TDGETLESADIMDLENLNVQGLRDEGISRDDEIKKLRTSGSMTQNPHEVSRVRNLSKI
                     IMGKHEIEPWYFSPYPIELTDEDVVYIDDFSLQYFGSKKQYARYRQKCTLRHPPGNEI
                     YRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTQRDELGHHL
                     VGYFSKEKESADGYNVACILTLPQYQRMGYGRLLIEFSYELSKKENKVGSPEKPLSDL
                     GLLSYRAYWSDTLIKLLVENGTEITIDEISSMTSLTTTDILHTAKALNILRYYKGQHI
                     LYLNEDVLLRYEKLIAKKRRSIDPEKLIWKPPIFTASQLRFAW"
     gene            complement(<592864..>593943)
                     /locus_tag="AGOS_ACR139C"
                     /old_locus_tag="ACR139C"
                     /db_xref="GeneID:4619673"
     mRNA            complement(<592864..>593943)
                     /locus_tag="AGOS_ACR139C"
                     /old_locus_tag="ACR139C"
                     /product="ACR139Cp"
                     /transcript_id="NM_208894.1"
                     /db_xref="GeneID:4619673"
     CDS             complement(592864..593943)
                     /locus_tag="AGOS_ACR139C"
                     /old_locus_tag="ACR139C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL152W (RRD2)"
                     /codon_start=1
                     /product="ACR139Cp"
                     /protein_id="NP_983541.1"
                     /db_xref="GeneID:4619673"
                     /translation="MSDGAELKMAAQKRLLTGSDLDKWKASKTFEELLRFVSSLAQSV
                     RGRENSEHAEPVSPAIEALEALLEEMQGIAAHHPVLQDAATSRFGKVEFRDFHKEVQA
                     RAEALVLQVDPSLTDEQAQELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVL
                     SEHDFTNAVLRVFVKYMDVMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATH
                     KHLKPKSIHNPEVVELFENRYLYFGCIAFINRVKTTASLRWHSPMLDDISGVRSWTKV
                     SEGMVKMYKAEVLGKLPIMQHFFFSRFLPVPDGVSPPRTSEEELADCSEHAHSTWGDC
                     CGIPIPSAVAASEATRKHSKPLPFD"
     gene            complement(<594117..>595502)
                     /locus_tag="AGOS_ACR140C"
                     /old_locus_tag="ACR140C"
                     /db_xref="GeneID:4619674"
     mRNA            complement(<594117..>595502)
                     /locus_tag="AGOS_ACR140C"
                     /old_locus_tag="ACR140C"
                     /product="ACR140Cp"
                     /transcript_id="NM_208895.1"
                     /db_xref="GeneID:4619674"
     CDS             complement(594117..595502)
                     /locus_tag="AGOS_ACR140C"
                     /old_locus_tag="ACR140C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR245C (DGA1)"
                     /codon_start=1
                     /product="ACR140Cp"
                     /protein_id="NP_983542.1"
                     /db_xref="GeneID:4619674"
                     /translation="MQDSMDDSLREAEGRQDDSEVSSGTTLGSSTPEDSGVTAKLRKK
                     YQMASALLRRELEELSVYDAKTAGVSGRSSGSGSGGLALLGGRFHVAPLRIPARRRLQ
                     TLVVAWHTSSFIYMTVLVLFLAANPLMWWFMVPYMVYYVWNRSPANGGVVRRYSPRLR
                     SLALWRYYCEYYPISLHKSEDLAPTFVPDPRGAEPREWKLRLWLWPTRVELLNLTLQW
                     TRARPQVATGPRYIFGYHPHGVGALGAFGAIATEGCNWSKVFAGIPACLCTLVNQFQI
                     PIYRDYLLGLGCTSVARKNVLKVLEQNYSVCIVVGGAQEALLSRVGSTELVLNKRKGF
                     IKLALETGNVNLVPIYAFGETDCFNVLDTGNESYLRKFQLWIKKTYGFTIPFFFARGV
                     FNYDFGFLPFRNPINVVVGKPVYVDKRRTNPTMEEIDHYHDLYVQELRNVFDKNKHKF
                     GYAGKELKIVE"
     gene            <595694..>597385
                     /locus_tag="AGOS_ACR141W"
                     /old_locus_tag="ACR141W"
                     /db_xref="GeneID:4619675"
     mRNA            <595694..>597385
                     /locus_tag="AGOS_ACR141W"
                     /old_locus_tag="ACR141W"
                     /product="ACR141Wp"
                     /transcript_id="NM_208896.2"
                     /db_xref="GeneID:4619675"
     CDS             595694..597385
                     /locus_tag="AGOS_ACR141W"
                     /old_locus_tag="ACR141W"
                     /note="NOHBY326; Non-syntenic homolog of Saccharomyces
                     cerevisiae YKL201C (MNN4) and YJR061W; Syntenic homolog of
                     Saccharomyces kluyveri SAKL0H06556g"
                     /codon_start=1
                     /product="ACR141Wp"
                     /protein_id="NP_983543.2"
                     /db_xref="GeneID:4619675"
                     /translation="MLLGRIRSKTVLKKCAYRWIRPRSLLLFVLGVALYHGAVWYLGG
                     ESTPAGDFIRLRVPSKGRAGGGAPVLREEEWLSLNDKDRWRANYDVLVRYLAGERARG
                     QLHPVVLFAWADWAPTRCPRRRPRCGEFAGGEWGAKTGPVVERVVLVAEGRNLETQAA
                     QEAAADSGVFGRGRMAAGAGQIGEGQAEQVLADTGEVVARGRRVRALRLPRLEQRVAR
                     AYRGANEQTVELEAADFALASAAARRAAAAEAVNAAHPAYRAYVERLAAEHAGAARAR
                     RGKKYFSELIQLRPGGRRGQVDARFGKAGRGPPAHETAPQMRRLMRCWERFARNEQLL
                     YWLAHGTLLGWYWQGTALEWDSDHDVQLPMRQLEHLALHFNASLLLFEDGGEVGRYYL
                     DINDHYRLAEKDPDNIIDGRLIDVDTGMYIDLTGIRAEGGKYTDGAHHVFHTLAYLDP
                     LRITLFDGLEAPIPHAVTSVLMSEYESGLFMDTFQGYHFDHEVRGWVSSACDECFDRD
                     LALEWRAHTDARAAFCERHGSPLYTECCGLLQIIPPEPAEGHIAKLSAYFKEKGY"
     gene            <597519..>600062
                     /locus_tag="AGOS_ACR142W"
                     /old_locus_tag="ACR142W"
                     /db_xref="GeneID:4619676"
     mRNA            <597519..>600062
                     /locus_tag="AGOS_ACR142W"
                     /old_locus_tag="ACR142W"
                     /product="ACR142Wp"
                     /transcript_id="NM_208897.2"
                     /db_xref="GeneID:4619676"
     CDS             597519..600062
                     /locus_tag="AGOS_ACR142W"
                     /old_locus_tag="ACR142W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL153C (RAD53)"
                     /codon_start=1
                     /product="ACR142Wp"
                     /protein_id="NP_983544.2"
                     /db_xref="GeneID:4619676"
                     /translation="MFHACGSSAARGLVAYLGSEYLRRNVDMDYITQPTQQGTQATQK
                     YVIEKFSQERIDDDVVCRVICTSGQLKIQDLKVDVREVVKKKEAIKQVWLFGRNRQSC
                     DYHLGDISRLSNKHFQIMLGEDGNLLLKDLSTNGTWLNDVRIEKGQNMILGQGDEITV
                     GKGVQQDVVNIVVFLNDNFQKKLETARLEGLRKPAKHTTLRTQSPRAPLTGIFKDFSI
                     NDEVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVDGVTRELEVLRRLNHPRIV
                     SLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVRYIHEQGI
                     SHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVIGGKNPE
                     GNGANGNLYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGSYHEGPLKDYR
                     ISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSIGAEIAVSLSQSLSQARALEG
                     MDEAEYLVAQSEVASNRKAPTHEKRVILADHIAEENVGFRMPVHPPVRYTQKAQPVLG
                     LEQDTRTHEEPVETHNERQLEDNTALLEGSVDSHTTYSTSNMQQKRKPTRAADGLFLT
                     LHPLANSSVRKRIYVNQGINPFFIGRSDECHYKIPDNRLSRIHCFFLKKRHPVGNSIY
                     ESPAQGLDDIWYCHNGTNVSYVNDMKLLPGTKVLLQDGDQVKVIWDKAQNITIAFRVE
                     INDSAGLFNSAAVTQNARHISQQTPDELALAVSFIELMRTQMHAIHNSETPPADTGSC
                     SAVAAGNDAAASSILRKIHYSTLSQVPMKKAKRAKLAQADRNEDSLQFL"
     gene            <601368..>602549
                     /locus_tag="AGOS_ACR143W"
                     /old_locus_tag="ACR143W"
                     /db_xref="GeneID:4619677"
     mRNA            <601368..>602549
                     /locus_tag="AGOS_ACR143W"
                     /old_locus_tag="ACR143W"
                     /product="ACR143Wp"
                     /transcript_id="NM_208898.1"
                     /db_xref="GeneID:4619677"
     CDS             601368..602549
                     /locus_tag="AGOS_ACR143W"
                     /old_locus_tag="ACR143W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL154C (PEP4); Tandem gene duplication in this genome"
                     /codon_start=1
                     /product="ACR143Wp"
                     /protein_id="NP_983545.1"
                     /db_xref="GeneID:4619677"
                     /translation="MKLQLLSLLVLLVPSISAENGVFYAQVYRDGVDVVSNPELISRH
                     VEAVAARHELSRRTVEDEELQVGGGKFSANVYNFENFQYSVDITLGTPAQNFRVALDT
                     GSSLLWIPSDRCTSQICRTRNRYRSGASSTFKATDKTLRLQYVKGDAKARVSYDTLYF
                     AGAKIENQGFGEAEAIGDDFSGARFDGIIGIGYPSIGYGIKPPINTLIDSGGLKDPMF
                     GIYISNAQNRNSPVGEIVLGGYNTQKFKGDIKWLPVLRKAFWETDLSAFKVGNFALDV
                     QGLTAVFDTGSSFIIMPEDTYTDFVSQFPGASHDDGTDYVDCSTVNSGPDLTLDFGGV
                     ALKLSARDYVMQLGRNTCILAVSGNSRVTGEVILGDTFLRRYYTIYNFGDNTIGVASA
                     V"
     gene            <603305..>604531
                     /locus_tag="AGOS_ACR144W"
                     /old_locus_tag="ACR144W"
                     /db_xref="GeneID:4619678"
     mRNA            <603305..>604531
                     /locus_tag="AGOS_ACR144W"
                     /old_locus_tag="ACR144W"
                     /product="ACR144Wp"
                     /transcript_id="NM_208899.1"
                     /db_xref="GeneID:4619678"
     CDS             603305..604531
                     /locus_tag="AGOS_ACR144W"
                     /old_locus_tag="ACR144W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL154C (PEP4); Tandem gene duplication in this genome"
                     /codon_start=1
                     /product="ACR144Wp"
                     /protein_id="NP_983546.1"
                     /db_xref="GeneID:4619678"
                     /translation="MRFQTLLPLAALLAPSFANAEGGVYKATLHKQSFDITPEELSMK
                     QRAASVGQKYLNALSKVVSDPSIQNEYNLFAKNNDGHVSELANLANNIYAADVTIGTP
                     PQDFRVVVDTGSSTLWVPGKECRAMACRLHKRYDHDRSSTYKENGTLTGVTYGSGSIM
                     GYVSEDTFRISDLEIPGQQFTETTDEPGSVFVFAAFDGILGLAYPSLGYGVTPPFQQL
                     MEKKLVKEPVFGMYLDDMKTGEGNGQLVLGGYDETKFKGEIAWLPVRRQAYWEVVFDS
                     VTVGDDNIPLENYGAAIDSGTSLITFPSELFNQFISKLSGVTKDRQGNVYVDCANKQT
                     APPLTFGFGGHKFSISGEDYIISVPGQSARCMPAIVQLDIDSAGKVAIIGDVFLRRYY
                     SIYDFGNNAVGLATAV"
     gene            <605113..>607170
                     /locus_tag="AGOS_ACR145W"
                     /old_locus_tag="ACR145W"
                     /db_xref="GeneID:4619679"
     mRNA            <605113..>607170
                     /locus_tag="AGOS_ACR145W"
                     /old_locus_tag="ACR145W"
                     /product="ACR145Wp"
                     /transcript_id="NM_208900.1"
                     /db_xref="GeneID:4619679"
     CDS             605113..607170
                     /locus_tag="AGOS_ACR145W"
                     /old_locus_tag="ACR145W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL155C (KIP2)"
                     /codon_start=1
                     /product="ACR145Wp"
                     /protein_id="NP_983547.1"
                     /db_xref="GeneID:4619679"
                     /translation="MMMVARVATAEHVGSAGASLPQTPGSRSFALGAHPGPQKRIGGP
                     AQGQTAFITPLVTPDGIYSRPSSPYMQASPLLKGSESGGSAGSPQSPDAPSSASGASV
                     GNAIGSGYTGNVSVAIRIKPSESSTKDPWYASNDRLIHTEFGEFQFDHVFTKGVCNQE
                     VYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQEPGLIPQCVGNIFDRISS
                     EHHGASLAYEVKVSYLEIYNEKIYDLLNYVDRQAGSTGQPSRNATGLKIRDDSKYGVK
                     VVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYDLKTGSE
                     ATSTLSLCDLAGSERAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANGLQPSPA
                     AGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKNIALNV
                     RKNEMDSHAEKDTIIQNLRKQLDEQHETIVMLRRSAAAPSGNGSTSPLDSPGVGGTSL
                     SERTHNMEKGLLEVENSILKTKLEHCEKLLDKDMMVLEDPHVREIVEMLPLDIASVLE
                     SKVQGMESQLRQYRVYVQKLESDLLKAQRNIITTHSVQFNRQSTANVQEKYGSDVDIE
                     LLLEEQEAELMELRNALKRKDKMIEALQSARRLRDSALSPTTTVLLQRKESVIDPRDP
                     QPV"
     gene            <607724..>608365
                     /locus_tag="AGOS_ACR146W"
                     /old_locus_tag="ACR146W"
                     /db_xref="GeneID:4619680"
     mRNA            <607724..>608365
                     /locus_tag="AGOS_ACR146W"
                     /old_locus_tag="ACR146W"
                     /product="ACR146Wp"
                     /transcript_id="NM_208901.1"
                     /db_xref="GeneID:4619680"
     CDS             607724..608365
                     /locus_tag="AGOS_ACR146W"
                     /old_locus_tag="ACR146W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL156C (PRM4)"
                     /codon_start=1
                     /product="ACR146Wp"
                     /protein_id="NP_983548.1"
                     /db_xref="GeneID:4619680"
                     /translation="MKPKVQSRKGFRALWMAATLLTVAVYLCVAHNRGWYDSPQVRTP
                     QRIPTSSGAAPEVWEPAKPRATRPLVNLDAVRRGGGDFRPAQNFQEIISTSPFVLFVK
                     GTDESSRYLRHLLTNEYEVTPEIAVVDLSKHRYSGDLQRYIREHKLHGPLFQLTENTP
                     DVPYLFVKGESVINTSVEKDIREPHERGQLQAELQRHAGLDAVIKKRSPPSNS"
     gene            complement(<608411..>609346)
                     /locus_tag="AGOS_ACR147C"
                     /old_locus_tag="ACR147C"
                     /db_xref="GeneID:4619681"
     mRNA            complement(<608411..>609346)
                     /locus_tag="AGOS_ACR147C"
                     /old_locus_tag="ACR147C"
                     /product="ACR147Cp"
                     /transcript_id="NM_208902.1"
                     /db_xref="GeneID:4619681"
     CDS             complement(608411..609346)
                     /locus_tag="AGOS_ACR147C"
                     /old_locus_tag="ACR147C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL157W (TGS1)"
                     /codon_start=1
                     /product="ACR147Cp"
                     /protein_id="NP_983549.1"
                     /db_xref="GeneID:4619681"
                     /translation="MAKHVEYSGRLRLHKFLSEPAELMAFKSAAPHFLHLQKKKYRKQ
                     RRTLRRYFADDSFRYLPRDNAPKKSIAKYWSYRHDLFSLIDQGNIHLTEELWYSVTPE
                     RVAKFTAAFIEACLPGATTILDVFCGGGGNVVHFAKVFQKVYGVELKLEHLYCTYRNA
                     EAYGVADRVWLKHGDWLQLAARGRFERVHVDCVFASPPWGGIDYTKTQAYDLETQLQP
                     AGLSQLLSSFLRISANVVLFLPKNSNLQQLSEITRSLLGPEAKCKVLYARENGRDKGL
                     LCFWGEAFYNFDAASPANSGERLAARLQEAHDLYG"
     STS             609569..609818
                     /standard_name="D1S3690"
                     /db_xref="UniSTS:474268"
     gene            <609871..>611700
                     /locus_tag="AGOS_ACR148W"
                     /old_locus_tag="ACR148W"
                     /db_xref="GeneID:4619682"
     mRNA            <609871..>611700
                     /locus_tag="AGOS_ACR148W"
                     /old_locus_tag="ACR148W"
                     /product="ACR148Wp"
                     /transcript_id="NM_208903.1"
                     /db_xref="GeneID:4619682"
     CDS             609871..611700
                     /locus_tag="AGOS_ACR148W"
                     /old_locus_tag="ACR148W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL158C (AIM44)"
                     /codon_start=1
                     /product="ACR148Wp"
                     /protein_id="NP_983550.1"
                     /db_xref="GeneID:4619682"
                     /translation="MPIGKLRRSKAISFRGPASPSLKFKSFETLQGKPLGEMGQNGHK
                     QEEDMAAQRPHFPAEAGAEQEMKCHVAETPAQNSQVPSTTMENGFYSFANISDNTTNK
                     NTNRYSYLSDNTACQLLAPATGTDYYKSLTPTMKPITERQNHAGTTMSLDTIPTAENI
                     SFQITLPTVPPSVISSRSSLINRQRSLSMRYSSPSSMSSLGSTPTKLTTLKRSNAIRC
                     KGGLLQFFSQYAVKTGKKLVKWKIALRKRLFKFQRRSTKNKKNSSPTTSHLKRVNGYV
                     SNVRRSFSTQSRLALVPEIVRRTPSRRHLTANTGMKDATPASPSRTSIRRTPSSIKRA
                     ASTLSSNYVYRDGSDTSSQAPELKSTGSSLAPAPSQMVRSTALTSLNSIVRQPSIVVN
                     NKVIPLSRFPGEKMQLPIREEDEEEEEPSTKTDDYVIDTSKRMSTIGEIQASRISSSS
                     GSISSHSSSIQSSHFDDASNSCPLNDSIESDSDIECTRTAWNHFLRTVIAERIRMRLQ
                     LAKLQELALLKDDSLDILYAVLRKTLDEPADKSSSTYDPDIMPENNSETGLGNGFRSS
                     DQLSRLKEGSRKRNTSSSTMLALPEALATVRRSITMPVGLNYI"
     gene            complement(<611921..>613288)
                     /locus_tag="AGOS_ACR149C"
                     /old_locus_tag="ACR149C"
                     /db_xref="GeneID:4619683"
     mRNA            complement(<611921..>613288)
                     /locus_tag="AGOS_ACR149C"
                     /old_locus_tag="ACR149C"
                     /product="ACR149Cp"
                     /transcript_id="NM_208904.1"
                     /db_xref="GeneID:4619683"
     CDS             complement(611921..613288)
                     /locus_tag="AGOS_ACR149C"
                     /old_locus_tag="ACR149C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YMR210W"
                     /codon_start=1
                     /product="ACR149Cp"
                     /protein_id="NP_983551.1"
                     /db_xref="GeneID:4619683"
                     /translation="MGVLAWLPFCNEVRHTVPEQPLKFRDKEQQGSMTMLELIEKYVP
                     EFQDRATQLFHPVLPTGHLQTIFASLRNFETVDVVYYERMMLSYHDGGVGALDFATSA
                     ASLEHFQDLPNEVPPHQHRALTDRYRYLTAKEIDELASNDAKPMLIVMHGLTGGSDEG
                     YVRAIVNRARDVYGFEACVLNSRGCAQSSITTPSLYNGAWTDDIRHCVKVLRGMYPQR
                     KFYLVGVSLGASMATNYLGQEQNSSDIECAAVLGNPWDLTSGAYNLSKGLLSRYVYSP
                     ALRKNCVQVLKSNIRQLRLDPYMKKQYDEKLNSLQTIEDFDNEFTAKMFGFNTSYEYY
                     RHASSVNRLPQVRTPLLAINALDDPIVGSEALPRREVAINPYVVLLETSKGGHIGWFD
                     YKGSRWYVDPLCRFFYAFHREITKKNMIPDLDGVVLPHPHKFEKDRLVNPLVREWDTG
                     RQGSS"
     gene            <614406..>616067
                     /locus_tag="AGOS_ACR150W"
                     /old_locus_tag="ACR150W"
                     /db_xref="GeneID:4619684"
     mRNA            <614406..>616067
                     /locus_tag="AGOS_ACR150W"
                     /old_locus_tag="ACR150W"
                     /product="ACR150Wp"
                     /transcript_id="NM_208905.1"
                     /db_xref="GeneID:4619684"
     CDS             614406..616067
                     /locus_tag="AGOS_ACR150W"
                     /old_locus_tag="ACR150W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR349C (YPS7)"
                     /codon_start=1
                     /product="ACR150Wp"
                     /protein_id="NP_983552.1"
                     /db_xref="GeneID:4619684"
                     /translation="MLSNTAAAAVLGLALGTALGTSSAQSQATDFPTLAIGRDESLLP
                     VVELRVGTPGQRERLRLDITQPYMWLVSGRLYPECDRKKGNCLTGNLYFPKASETYHA
                     GDGETYNLTMADGIQISGLLGYEEVNFNRSDVRVRDGNVHLAPREGVKVERMGFLEAT
                     TMTDIHAGLGLSGRVNNPDPLGDAARGSEFFFLDKMRDAGLISSRSYSLWFGNDNTSA
                     VDLPTVLEDIGTLMLGAVDPRLYYGNFYQYDGVPSVDIASGQHTRGGYPIVPLTRVQL
                     LGTEGRQLNLTDDTFAEPVLLNSRFMTSFLPKSIVQQIARQTNAVFTKSSNRLIVECS
                     LLKEEASFRFHFGELVVEVPLSDFIGPTNLRAGTSILAPDTNETCYLKLMPSTGMGFS
                     MLGMPILRKLYIAADTESGAVGMALAVRPVDRNVTSLPRSTGEVAAIRSGSIPFATPV
                     TLPCTSSMTLSMFSKNISASVLDGFTGTIHSNGFFGPRSGELRTKSTDLISRSTSTKK
                     SDSSPSSANAAIHHPRFSGRTYFDVGYSTFSITALCSLFLIGFLI"
     gene            <616344..>618995
                     /locus_tag="AGOS_ACR151W"
                     /old_locus_tag="ACR151W"
                     /db_xref="GeneID:4619685"
     mRNA            <616344..>618995
                     /locus_tag="AGOS_ACR151W"
                     /old_locus_tag="ACR151W"
                     /product="ACR151Wp"
                     /transcript_id="NM_208906.2"
                     /db_xref="GeneID:4619685"
     CDS             616344..618995
                     /locus_tag="AGOS_ACR151W"
                     /old_locus_tag="ACR151W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR098C (SFB3)"
                     /codon_start=1
                     /product="ACR151Wp"
                     /protein_id="NP_983553.2"
                     /db_xref="GeneID:4619685"
                     /translation="MNSLAQSVSSLSLDQGANRKHKRPHRAFHTFNEPPAMASGGGLQ
                     APRSALQAEGAAPLRAGSPVMGAGAGGSSAMAPPARSTHLVPTQRLEDQQQFLTRTFM
                     PDVEAVPPFSTTQFYCGVAGACDPRVLALSAYNIPKTEQLRAVTALPLGLNVQPFAPV
                     VPSDTAVPAVDARAGEGPLRCRRCRVYANPRFRFTSDSHFICNMCQVRTQLPPEEYSP
                     LGPSGERMDLASKAELTHGTVEFLAPELYNVHKGRAAVPLHYVFLVDISTWANENKSS
                     LAAIEGVRTAINYICEQQPNCKVAIIAYDKWLRFFNLRPESSQAQELIVSELREVFLP
                     LYSGLFVRPAEAMHVIQDTLVKLESFIQDDKLSHGAEACFGSALEAALLALDTATNGN
                     GGKIIATLNTLPTVGNGNLTLRRDDGLKKSLKCDNSFYTALADRMLKAYVGLDLFCTG
                     SAFMDFATLGHPVLATSGTFRHYSNFQLDRDEFPLVNDMLHAVSSTVGYQAQLKVRCS
                     SGLSVSRYYSTACGHSDRDPVIPVVTADQSFTLALQYDSPLQAGTDVYFQASLLYTDL
                     DGVRRVRTSNTSAAVSDNIHEIFKFLNQDVVTALLVQDTLTALGDANFLGVRKSLDTR
                     LAAILTQYRALVDPSHASQLILPDALKSLPAYLLAFQKSPLLRATGSARANDRAVDYL
                     RFATYDLRRLAYRLYPQILPLHVPLSDDDYTFYDAHNLLLQFPSADDLAVRAAHGALA
                     DGGCYLIFQGDTVYLWLNDHTHPQLLRDLLAADAPPQLLPSARLPGLDTDISARVRSV
                     LDYWAALAGRRALPVQLLRPHSDPLYARTLSALVTEDASVDGLDSYDAHLVVLHRAIQ
                     DNLRHDRYLRPAAARDHDSLAQRYIQF"
     gene            <619128..>620662
                     /locus_tag="AGOS_ACR152W"
                     /old_locus_tag="ACR152W"
                     /db_xref="GeneID:4619686"
     mRNA            join(<619128..619402,619579..>620662)
                     /locus_tag="AGOS_ACR152W"
                     /old_locus_tag="ACR152W"
                     /product="ACR152Wp"
                     /transcript_id="NM_208907.1"
                     /db_xref="GeneID:4619686"
     CDS             join(619128..619402,619579..620662)
                     /locus_tag="AGOS_ACR152W"
                     /old_locus_tag="ACR152W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR348C (PAL1) and YHR097C; 1-intron"
                     /codon_start=1
                     /product="ACR152Wp"
                     /protein_id="NP_983554.1"
                     /db_xref="GeneID:4619686"
                     /translation="MQARPPPIHRASSPAADASGSLRRMSLNNPFRASTSELGGRLAP
                     DQDFHAWVTQKGVGFPYTSTQRTGSQLSFAESIAEEEGAAPDAAARYSMSPPSLRPAS
                     NNPFLDELEGYDERAGSPAPGARTHEVGATEEKERLRQRYAAEDDLPPAYEEVAGSRV
                     REAYPQEKKERPRHEQRPRREERPRESGKARPRTKERAKERTRERKERPREREERTKE
                     RKKDEKTGALPKNVDTIDKLDVTGLFGGAFHHDGPFDACTPHRNLNKKVAPVLAFPKD
                     GPNSTLSGATAHKSAMNEVFGIDEDDDSYLYSRRDVGERSSSTVNAIKNHSEVTQFDA
                     KVTADLVHGPVTQGLGSTTFLDGAPAAPVAIEAMKQSTVGRKKSLSHRLAKSPPSASA
                     IGPDPRNGNLKLTKTHSGYLEDEKEDDEDAYTGARDTDNKKESSGNKFLRRVKSLKVT
                     RR"
     gene            complement(<620924..>621865)
                     /locus_tag="AGOS_ACR153C"
                     /old_locus_tag="ACR153C"
                     /db_xref="GeneID:4619687"
     mRNA            complement(<620924..>621865)
                     /locus_tag="AGOS_ACR153C"
                     /old_locus_tag="ACR153C"
                     /product="ACR153Cp"
                     /transcript_id="NM_208908.1"
                     /db_xref="GeneID:4619687"
     CDS             complement(620924..621865)
                     /locus_tag="AGOS_ACR153C"
                     /old_locus_tag="ACR153C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR347W (MRP1)"
                     /codon_start=1
                     /product="ACR153Cp"
                     /protein_id="NP_983555.1"
                     /db_xref="GeneID:4619687"
                     /translation="MKILTFGEALELQEEISRDAAGRLNMLGRQILSRGFARTYIAPS
                     LDHLSRGKGVPGLFSSDGLQGAWFDRAEHYAQMLTAVARSGEQRPVATLVQELATQGG
                     RRREHMYATLLHNLRFAFSTLQGCAQPAPTAAPAAALLQTPSLELQGPNEPLEAGCTR
                     LHAALTQSFGSIAEFRTLLLNSSLAQSGDGFTWLVARCAGDTGDALAYDKLFVFNTYN
                     AGSPHAVSRVEHFKRVVKTETEPKPMDGTKEAVQNLQYKATTRYYPLLAIDASPKSWL
                     HDYGVFGKAAYLDRVWESTNWTAVESRLPQQRSETFI"
     gene            <621993..>623348
                     /locus_tag="AGOS_ACR154W"
                     /old_locus_tag="ACR154W"
                     /db_xref="GeneID:4619688"
     mRNA            <621993..>623348
                     /locus_tag="AGOS_ACR154W"
                     /old_locus_tag="ACR154W"
                     /product="ACR154Wp"
                     /transcript_id="NM_208909.1"
                     /db_xref="GeneID:4619688"
     CDS             621993..623348
                     /locus_tag="AGOS_ACR154W"
                     /old_locus_tag="ACR154W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL120W (VPS30)"
                     /codon_start=1
                     /product="ACR154Wp"
                     /protein_id="NP_983556.1"
                     /db_xref="GeneID:4619688"
                     /translation="MSTPSFKCQNCQCPIDMDLSLMDLSIAQRDMIVNSGGEPTNPST
                     FKIPPERLSRLHQVRRPHELTVAAAPGAAESYVFLQVNEDGLNRSKHAIEEESGEEEE
                     DDSSKTLSSNIQVLTNIFNILSSKGNIDYPVCHVCCELMMQRLKAEYADAIRKRDAYF
                     EFMDRLQKQHEKESAQEPKPASAEADLLAQKDELVTKLVALEHENDKLDKEIESLEQQ
                     LREKEQQETRAVLKQNLKDLEHIAFMKDMQSLKNQYELTLNNLDKLRKTNIFNETFRI
                     SHSGPFGTINDLRLGGFSQVRVPWQEINAAMGQLILLLATIAAKIHYELDGYRLKPLG
                     SYSKVERFDPHTQRWNVYNAYSNDDFKIGKLFHKETSLDKALEAIIAIVDQIAKRIST
                     LSRDHNDGGMELPYSMQKDKINGIPIKLLGSDPTLEWTTSCKFLLTNAKWLLAFSSQV
                     T"
     gene            <623556..>626150
                     /locus_tag="AGOS_ACR155W"
                     /old_locus_tag="ACR155W"
                     /db_xref="GeneID:4619689"
     mRNA            <623556..>626150
                     /locus_tag="AGOS_ACR155W"
                     /old_locus_tag="ACR155W"
                     /product="ACR155Wp"
                     /transcript_id="NM_208910.1"
                     /db_xref="GeneID:4619689"
     CDS             623556..626150
                     /locus_tag="AGOS_ACR155W"
                     /old_locus_tag="ACR155W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIL066C (RNR3)"
                     /codon_start=1
                     /product="ACR155Wp"
                     /protein_id="NP_983557.1"
                     /db_xref="GeneID:4619689"
                     /translation="MAEPKKIFIISDDSGLTEAFDERKLLESLRKLQFGLKINDADID
                     KAVKRIAAGIGGDIRDSELVAYIGETLASMITRHPDFSLLAARVEIKVLHKRLLGLGF
                     TGNLAVLCESGDSPEGHATKRKRAMSPCTRGPVRRELYDLAVQHRNIIDQAIDDTLDF
                     TFTYFGWKTLCKSYLLKHQGRVHETPQYMFMRVALALHGPSGDIDRVLETYRLMANKY
                     FIHASPTLFNAGTTSQFLSSCFLLGIHEDSIDGIYNALHKAALISKASGGIGIHVSDI
                     RANGSYISGTNGTSNGLVPMLSVFNSTARYVDQGGNKRPGAFCIYLEPWHADVFDFLR
                     LRRNHGKEEMRARDLFYGLWIPDLFMKRVENNGEWSLFSPNEAVGLSDCYGEAFEQLY
                     VRYERELEPYRRVKAQELWREILLSQTETGGPFMLYKDACNSKSNQKNLGTIKSSNLC
                     CEIVEYSSRDEVAVCNLASVALPTFVSVTSDAITFDYARLHSVVKVMTRNLDKAIDIG
                     DYPVPEAERSNKKHRPLALGVQGLADVFMLMRFPFNGEEAAQMNREIFETIYHAAVET
                     SIELAAEYGVYASFVGSPASKGELQFDLWGRNKDNYQFLYDDWDELKEKIKSGPGLRN
                     SLLVGPMPTASTSQILGFTESFEPMTSMIYTRRVLSGEYTLVNKYMVQDFCDLGIWSE
                     ELKNRIIKDGGSIQGIDGIPPDLKDLYKTVWELPQRKLIDLSADRAPFVDQSQSLNLF
                     LKEPTMGKLTSMHFYAWKKGLKTGMYYLRTQAAANAIQFTLTDENTLSGPVKLREGAA
                     VAQSPRHARYPSEEAGSRVSPARIETAVSSMDPSDDSDANNAFGIYDSTPIACSTENR
                     ESCDSCSG"
     gene            <626486..>627364
                     /locus_tag="AGOS_ACR156W"
                     /old_locus_tag="ACR156W"
                     /db_xref="GeneID:4619690"
     mRNA            <626486..>627364
                     /locus_tag="AGOS_ACR156W"
                     /old_locus_tag="ACR156W"
                     /product="ACR156Wp"
                     /transcript_id="NM_208911.1"
                     /db_xref="GeneID:4619690"
     CDS             626486..627364
                     /locus_tag="AGOS_ACR156W"
                     /old_locus_tag="ACR156W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL123C (RNY1)"
                     /codon_start=1
                     /product="ACR156Wp"
                     /protein_id="NP_983558.1"
                     /db_xref="GeneID:4619690"
                     /translation="MAKTASAMLFLYLLLSRCLLSHAFQEFITKFPMPMMYNFPSCSS
                     TIPSTCRNETAIADTCCFEYPGGLILHSQFWNAPYRKRSYRDFGPDDSFTIHGLWNDR
                     CDGSWDQFCRRGSSIRSVVDILSKDSLNRGGLPITGKALLRQMSMYWKGDRGDENLWV
                     HEYNKHGLCLNTLRPECYQRWGSVASAEDQAIYDYFRIAMNLHLKIDAYHALSRQGIK
                     PRCDAPYDAVRMQNALADDFGREVQMQCTGNRLTGVTYYYLLRGGILSENFQPVDPTQ
                     SSSCRGKIYWIPKSGC"
     gene            complement(<627594..>628475)
                     /locus_tag="AGOS_ACR157C"
                     /old_locus_tag="ACR157C"
                     /db_xref="GeneID:4619691"
     mRNA            complement(<627594..>628475)
                     /locus_tag="AGOS_ACR157C"
                     /old_locus_tag="ACR157C"
                     /product="ACR157Cp"
                     /transcript_id="NM_208912.1"
                     /db_xref="GeneID:4619691"
     CDS             complement(627594..628475)
                     /locus_tag="AGOS_ACR157C"
                     /old_locus_tag="ACR157C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL124W (SPC29)"
                     /codon_start=1
                     /product="ACR157Cp"
                     /protein_id="NP_983559.1"
                     /db_xref="GeneID:4619691"
                     /translation="MHVIRTVYNDDRESRGHVSKPLRFVTKAAPEHQIKGCYSPQARA
                     LGRQGGFQEQMNVSSFLNRPDTDDTLQNIRKEYLNTKRNLHDLLSSSPTRLQQGARGA
                     GEMSGNAPPLHYVGGQAEPPQQGEQDDRLRQQLRDYMSNKSRSMPPPAKYPAPGPGPA
                     DGGVQRQLDSQKMMIESLKRELDTQRTINSMLFERLDRLEEEVRYVRHSNRAPANGAP
                     FRSVSSAPSSSHTNGHVGSYASADDTKVLLGWDQPTLAHGGKHAQPPQQHTRTFSNLD
                     DSTARLIQMSAGGKQKW"
     gene            <629138..>631540
                     /locus_tag="AGOS_ACR158W"
                     /old_locus_tag="ACR158W"
                     /db_xref="GeneID:4619692"
     mRNA            <629138..>631540
                     /locus_tag="AGOS_ACR158W"
                     /old_locus_tag="ACR158W"
                     /product="ACR158Wp"
                     /transcript_id="NM_208913.2"
                     /db_xref="GeneID:4619692"
     CDS             629138..631540
                     /locus_tag="AGOS_ACR158W"
                     /old_locus_tag="ACR158W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR208W (PTP2)"
                     /codon_start=1
                     /product="ACR158Wp"
                     /protein_id="NP_983560.2"
                     /db_xref="GeneID:4619692"
                     /translation="MAGLDVRNIYNLKEVVGPARAQQCRTVQPAASPTFGALRLSGSP
                     AAQPLSPTSRTMAQRAEVGEAEHLLRERTQVLTAAEWRERQAQLGDALVLDLSTQGFQ
                     LKGAQRRVHLSFPSTLLRRPNFPFSKLVRTLNSETQASLLEHLDTSNAIVLFDDGSSF
                     WNNCLQTTITVLRKLLTYLEEQKAHTQRQVPIFLLQGGVKAFESHHFVSPAVKNGSSA
                     DKPKLTLKLCIPGRTQDSGSDGTGVTGRSALDNSSELFIQSMKGDTLHYSPSSLLKYF
                     KYHTPAKLPKHVPPWLSPFNRACDSVLSQIMGKFELLEKLEVMRLQQCLSGSTPSSTY
                     SQLAKTSSKLYSLRDLQKKYRSPRVNLEDGDEARAFHSKIDDSYNTLGQCKLERDIHE
                     ELNDNENKEILNKLAFGHSSSDAIEAASVVRQEDEDHSDAPNEYVITQGLNSFTKNRY
                     SNIIPYEHTRVRLEPSPVGNRSLAKTFLQSTSHLSPAAAPSDSNPVVDHLKVPAPSSY
                     FVKNTESAFTPLAGTTPNEPFNDYFNANYLTLPEINSKCRYIATQAPLPSTVDDFWKV
                     ITTNSVKVIISLNSDDELNLRKWDIYWGSDSVHKFNITILHSFENVRGLDGNIVRVFK
                     VQKKSTVAGSSAEDSQSNTHIVYQIQYKKWLDSCGIVMSDFLQLYNVKNALLNDPDSF
                     IRQQLEDRNTLIDIDEDPSLFRRTESHSPLLVHCSAGCGRTGVFITLDFLLTVLHSPL
                     QVYNKIDVWNMEEDLVFIVVNEFRKQRISMVQNLTQYITCYESLLDFFSLHENRGAVA
                     QY"
     gene            complement(<631648..>634725)
                     /locus_tag="AGOS_ACR159C"
                     /old_locus_tag="ACR159C"
                     /db_xref="GeneID:4619693"
     mRNA            complement(<631648..>634725)
                     /locus_tag="AGOS_ACR159C"
                     /old_locus_tag="ACR159C"
                     /product="ACR159Cp"
                     /transcript_id="NM_208914.2"
                     /db_xref="GeneID:4619693"
     CDS             complement(631648..634725)
                     /locus_tag="AGOS_ACR159C"
                     /old_locus_tag="ACR159C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL125W (KAP120)"
                     /codon_start=1
                     /product="ACR159Cp"
                     /protein_id="NP_983561.2"
                     /db_xref="GeneID:4619693"
                     /translation="MSLELTKEKLVETLERASTPRGAQPEIQKQAEQQLKIWEVQAGY
                     HFFLQSIYLDLSCSLQIRWLAIIQFKNGLDKYWRATRVNAISKDEKQSIRARLFEMVD
                     EQNNQLCIQNAHACARIARSDYPHDWPDLFEYFEKALGDYDALQNNVRTYNVLVCLNQ
                     VVKLLASARVARCRPAMQSKMPLLFPLLVRVYMTNFNQWTSSTSFEDTELSSLQVSYL
                     ALKILRRAISDVYEIPHRDQSVVEFMDISVRHFDLLLSNHDTLKMFDTYEKFVKGYGK
                     LYYNFITASPSSFILLPCCCTVLSKFTKLLSDRAADVYQENAEVNGDFWEQLSIRGFG
                     ILKRTINFIRQKGAVSLRMQANRAEVNAAIAKINTQFLNEALVTQLVDLLVDWYLKLR
                     PAELDHWSLDPEDWMNEQMTSNYEYQIRPCAENFFQDLMNCLPDFLATYLLKKLEQEG
                     SQLTSSLDDFLKKDAIFAAFQLSSVTVADMVDFDHLLINVFIPEAVGTGATSAERLRI
                     IRRRVSLIVNEWCTVKCSAESKDNCYKLFLQLLNEDDDKVVQLSVIQALRTMVGDWDF
                     QKESFAPYLNDFVVVLLRKVLSSVQYTETRLYVLNTLSDIIIQNKDSISNPLLMEVLQ
                     IVPGLWDLASSDQTQSILANALLRLLRYLSISLGAYSYNAWGAAIPIVETVCNPSSLH
                     YSLLYEDGFELWSALLQNFDPTKAQLDPRLTDSLPFLQYAIANQTEILPTLLEIVKSY
                     SLLLPKEQFFSISVFSSAFEQLSSYLLKLRDDSFEIFLSILDILTLADETDSELNLID
                     YFYKCGILKAIFDAAFLQNKLSNFQQGQLLQPVARIACINPASIVELLKNYHMSLPTV
                     AENSRLSEVDRYAITRDDTDFDGTVNYFIGRWLACFSCFYDPKIKKIHILGISSLLKT
                     GFGCILNHFNAIATIWVEILEEVNETADGDCLKYHPEPNSEYVTCDQLRQIELTRTND
                     PIHNVNLRKFIADLMSVLESELGSQYGAFLDSIDKSILSNLQIFLSVSPQSLE"
     gene            complement(<634983..>636275)
                     /locus_tag="AGOS_ACR160C"
                     /old_locus_tag="ACR160C"
                     /db_xref="GeneID:4619694"
     mRNA            complement(<634983..>636275)
                     /locus_tag="AGOS_ACR160C"
                     /old_locus_tag="ACR160C"
                     /product="ACR160Cp"
                     /transcript_id="NM_208915.1"
                     /db_xref="GeneID:4619694"
     CDS             complement(634983..636275)
                     /locus_tag="AGOS_ACR160C"
                     /old_locus_tag="ACR160C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR209C (NPT1)"
                     /codon_start=1
                     /product="ACR160Cp"
                     /protein_id="NP_983562.1"
                     /db_xref="GeneID:4619694"
                     /translation="MTSEEAAIKSLLDTDMYKLTMHAAVYVNFPDTEVVYKYTNRSAG
                     LSFNKAAIVWLEDQVSKLATLRFTAEEVAYLKETLPFLPAQYIDYISSPECRMDPATQ
                     VQLLHEQREGEERYDLNITVTGLWKDTILYEIHMLALISEAYFKFVDTDWVLDGQVEQ
                     AYRKTRLLLDNGLVFSEFGTRRRRSLLVQDLVLQGIAEAVADSGTGDTQFIGTSNVYF
                     AKKYGVKPVGTVAHEWYMGIAALTDDYRNANKNAMDFWLNTFGSEQAGLVLTDTFGTD
                     TFLPMFRPPYSDVYDGVRQDSGDPAVFTEKVAHHYLNVLHYPRFSKVICYSDSLNPEK
                     ALQYAEVARAHGMRASFGIGTNFTNDFRRHSAPDAKSEPLNIVFKLLTVNGRPAIKIS
                     DDLGKTMGDPEKVEEVKRELGYIERTWEGSDEAHRWKD"
     gene            complement(<636665..>637162)
                     /locus_tag="AGOS_ACR161C"
                     /old_locus_tag="ACR161C"
                     /db_xref="GeneID:4619695"
     mRNA            complement(<636665..>637162)
                     /locus_tag="AGOS_ACR161C"
                     /old_locus_tag="ACR161C"
                     /product="ACR161Cp"
                     /transcript_id="NM_208916.1"
                     /db_xref="GeneID:4619695"
     CDS             complement(636665..637162)
                     /locus_tag="AGOS_ACR161C"
                     /old_locus_tag="ACR161C"
                     /note="NOHBY327; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACR161Cp"
                     /protein_id="NP_983563.1"
                     /db_xref="GeneID:4619695"
                     /translation="MMYFSYNEVAIPLFSTFFGGFRRSRPSNDTLRSKREADGREAGY
                     AKLQDIQEDDIPLMPSPVGLDSARTLYLPKNDHEEPQKLFQECRSSYSWDSTLSIAST
                     DMLDDEPPAARAAAYNDAHYLFDSRNGNPYSSGSNTADGADFRSPSFFNNCESFSAAY
                     SVVDD"
     gene            complement(<637647..>640229)
                     /locus_tag="AGOS_ACR162C"
                     /old_locus_tag="ACR162C"
                     /db_xref="GeneID:4619696"
     mRNA            complement(<637647..>640229)
                     /locus_tag="AGOS_ACR162C"
                     /old_locus_tag="ACR162C"
                     /product="ACR162Cp"
                     /transcript_id="NM_208917.1"
                     /db_xref="GeneID:4619696"
     CDS             complement(637647..640229)
                     /locus_tag="AGOS_ACR162C"
                     /old_locus_tag="ACR162C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL126W (NAN1)"
                     /codon_start=1
                     /product="ACR162Cp"
                     /protein_id="NP_983564.1"
                     /db_xref="GeneID:4619696"
                     /translation="MVSNTVHPKYKLSVVSGGRPQIPRVSNRSSSQKTVTRLTHDREN
                     YIIPFNNQLKIYAIETRQCVKTVKYGNSAVLGEVFGRDDGTSVVHIALGDASGEAEHD
                     DDKLTLFSSRGHAVVVNYRGKLVDEPKQWTLGVSDGEAVLKVFENAQGAVCRVLTIAE
                     ASSGTHTYRLYAYQSGQLEQLRVFEEVLLSTWSSNDAHLAVLVRDSEGKKRLVVEPLT
                     EEGAQHSLPLPVSNLAASSNASFVTSMALDNAGQQVAVGFASGVITLINVSDGSSRLL
                     KWHIDAVLAMSFSVDDTYLISGGWEKVVSFWQLSTNLQQFLPRLNGVILDCCALDEKY
                     FSLALQMTENTSNTDYQFLILSFTDLNSRLAINGPLPVFHSAVSDVVQPLSALSTKTS
                     ISSSKIHSSKKKHLRKLLKSKRQDFTCSFSVNPLTKHLYFPHNSAVQIYDFYKNEQVS
                     YQYISSGINNAMGKVRDELNLQDPVVHRVQFTRDGLWMVTYEVESQPEGLLSSKDVHH
                     ILKFWSCESDGEWQLKTKIINPHGMSVPVTDIVVAPFTVNDSQGCITADNNGGLKYWC
                     FDKKENNWCLLKMLLPNFNHFSNNVAVAWSRDGSLLFHAFDDKVSIIDFNLFKVFESA
                     GSRGLSTISLDAPIQYLSFVNDVTLIVVTKITLQFFNLLTGQYKGSFDVYPYVNGTYK
                     PGHLHRLVSCDEKTGRVAFVVNQQEKDSNGNPTSSYRSRVLIFNPDLSERLGTFEHDE
                     YISCISWNNDTDFIFIDTNCKLGIVSTTTSSEMMEEVNVDSGFDALSASSTDFEKQLR
                     DLSKHTENTPSPDENEADLKLEFINGQQINRLINMNSFTSMFENIDNIKLDTLFDRVM
                     KVIS"
     gene            <640498..>640710
                     /locus_tag="AGOS_ACR163W"
                     /old_locus_tag="ACR163W"
                     /db_xref="GeneID:4619697"
     mRNA            <640498..>640710
                     /locus_tag="AGOS_ACR163W"
                     /old_locus_tag="ACR163W"
                     /product="ACR163Wp"
                     /transcript_id="NM_208918.1"
                     /db_xref="GeneID:4619697"
     CDS             640498..640710
                     /locus_tag="AGOS_ACR163W"
                     /old_locus_tag="ACR163W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR210W (RPB10)"
                     /codon_start=1
                     /product="ACR163Wp"
                     /protein_id="NP_983565.1"
                     /db_xref="GeneID:4619697"
                     /translation="MIVPVRCFSCGKVVGDKWEAYLNMLQEEELDEGTALSRLGLKRY
                     CCRRMILTHVDLIEKFLRYNPLEKRD"
     gene            complement(<640837..>643443)
                     /locus_tag="AGOS_ACR164C"
                     /old_locus_tag="ACR164C"
                     /db_xref="GeneID:4619698"
     mRNA            complement(<640837..>643443)
                     /locus_tag="AGOS_ACR164C"
                     /old_locus_tag="ACR164C"
                     /product="ACR164Cp"
                     /transcript_id="NM_208919.2"
                     /db_xref="GeneID:4619698"
     CDS             complement(640837..643443)
                     /locus_tag="AGOS_ACR164C"
                     /old_locus_tag="ACR164C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR211C (MGM1)"
                     /codon_start=1
                     /product="ACR164Cp"
                     /protein_id="NP_983566.2"
                     /db_xref="GeneID:4619698"
                     /translation="MVRTGQAHLCFCAGRALHGGLLRPAGRVGGAQLRFYVPLPAGSR
                     PMLRSGGFPGMVMSQRGISFIPKLAVRMIKVPAYIGGGAAAVGSYIAYKVEEASSFTS
                     DKLSQLRDFSSGVRDRLGEWLDAGGSENGDGGQGGRDGGPVGDSVAAATLLATLSEEE
                     QAAAEDEDDEEEEDEDHTGDEILNLTKQMIEIRSILNRVDTNTPGVTLPSIVVVGSQS
                     SGKSSVLESIVGRDFLPKGSNMVTRRPIELTLVNTPSGSETTADFPTHRIYNLKDFRE
                     VKRILMELNLAVPTHEAISEDPIQLTIKSPRVPDLSLVDLPGYIQVEAADQPMELKSK
                     IRNVCQKYLAEPNIILAISAADVDLANSAALRASKLADPQGLRTIGVITKLDLVEPSA
                     ARDLLMNKKYPLKMGYVGVITKGPVKTHRLFDQSAGKGVIFGGKGSKAKDQETERLET
                     IQFEKNYFREHRQEFASCQVTTKKLREKLIKILEVSMSNALEPTSRVIQQELDDTSYL
                     FKVEFNDRQLTPKSYLLSNVDVLKLAIKEFQEKFRRSELKSMLSADLDQRVLDLLASR
                     YWKDDNLQELSKNLDDESSALYWHKKLELASSSLTKLGIGRLSTTLVTNAILKELENV
                     LAMTPLKAHELIKELITNTAVNVLNAKYYSTADQVENCIKPFKYEIDLEDRDWSIARD
                     HSVALVQEELRQCNERYQMIKNSVGTRKLQQVMQYIKTDPTRKESLGFSTMLLERGSE
                     ALSLQDRASLLSFRLKMLKNKCNSTAEKDKCPEVFLNAVSDKLTSTAVLFLNVELLSD
                     FFYNFPIELDKKLSALSEEQVEMFAKEDPRISRHIELQKRKELLELALEKIDSILVFR
                     KSYKNLAGKSHP"
     gene            <644234..>647653
                     /locus_tag="AGOS_ACR165W"
                     /old_locus_tag="ACR165W"
                     /db_xref="GeneID:4619699"
     mRNA            <644234..>647653
                     /locus_tag="AGOS_ACR165W"
                     /old_locus_tag="ACR165W"
                     /product="ACR165Wp"
                     /transcript_id="NM_208920.1"
                     /db_xref="GeneID:4619699"
     CDS             644234..647653
                     /locus_tag="AGOS_ACR165W"
                     /old_locus_tag="ACR165W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL020C (SPT23) and YIR033W (MGA2)"
                     /codon_start=1
                     /product="ACR165Wp"
                     /protein_id="NP_983567.1"
                     /db_xref="GeneID:4619699"
                     /translation="MIAVDAKQEPTRKLDGQGDAVEAQLLNDILFSTLGCTAEGGKEN
                     DPDMTGYKDAGGFRVGDLEEPRGMESEDELFNAFINTCDFPKEPSGSHSGSQSGPSGG
                     PNTLNKHNIMLAEMALEGSTLRQPPFGTHMALSSSGEADALSVSPSAGTKDWSALSVS
                     AKEVAGPSSESYYQYCERLLNQALSFGRTEPIRTTYLNPADFIDVDPSALPYRLTVSD
                     IPTRSRVETQIKLDLSISPPPRQFLIHLPSDCITKQKLYLSQDEHTYPPEVRSELLYL
                     EAFLLCSSNNRATYVCSRCVKREQRRAARRKSGLSDNLIWCNNGNRRAVVFNSKQVFL
                     LKQSENSLTSKSFSLSTRIVCYCRHHKEPEGFKMMFILRDACGNVLGKDVTTPIMIMD
                     KKSNKRGGEPLKEGAESTSATDLSSLMKTAGECSTEPTSDFSGADSQPCSVGQGNINM
                     QLMNHAPILSPTSLPDDGAEAHHILDPKAQQPSQQQQYIQGLPFSSSSAAAAQRTSGY
                     KRKRTWHESPFPILDAGPRPSLGTGDRKYSYPSASSVTPLQSMPTIQNSLVVPHQTAP
                     KINKPFIHRVIPNQGPIKGGVEITLLGSNFKPGDIVKFGANRALSTQCWSDSTIVTYL
                     PPAPTAGKVLVTVTSQDDVEGELLASMPQSSAFFTYVDDTDRQLIELALQIVGLKMNG
                     KLEDARNIAKRIVGNDGNSSAGSSPGNLSSNGPANQFSNQLYYSDEALLIKVIKLLTP
                     SSNISMCTEEGHTLLHLACLKGYYQLVSLLVKKGAHVEVTDRFGFTPLHFACVNGDTR
                     ITRLLIQCKAQVSALALNGVTPSDVFTTNHRRDDRMYKLYFDEMMDVLDAAVNSSYAD
                     VQRKMSVSSLQSSEFEEEFDILDNGFRVHVSKLAYDTCLSASELESSNYEEDGDDSLL
                     FNDEASEHADASVESGEAKIYENQKQSMDGLVPEADAQPEPRAESLSRHRSETDASSS
                     TQQEGSLWNRVFSAFNDSPPKYEDLFPCGSDPSATDSKLRTHISSEEDPSRVSATLSM
                     DESQISSEDEEEALQARFNRFFQQRKNFRNDKMLLIFWIPLMIVLLSCFLINRFGQDG
                     NSVHHLSEKASMFVRMGLVKLMLGNERMKTIFRESLNNFQSRRMLGDVVAI"
     gene            <647938..>649107
                     /locus_tag="AGOS_ACR166W"
                     /old_locus_tag="ACR166W"
                     /db_xref="GeneID:4619700"
     mRNA            <647938..>649107
                     /locus_tag="AGOS_ACR166W"
                     /old_locus_tag="ACR166W"
                     /product="ACR166Wp"
                     /transcript_id="NM_208921.2"
                     /db_xref="GeneID:4619700"
     CDS             647938..649107
                     /locus_tag="AGOS_ACR166W"
                     /old_locus_tag="ACR166W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL021C (MAK11)"
                     /codon_start=1
                     /product="ACR166Wp"
                     /protein_id="NP_983568.2"
                     /db_xref="GeneID:4619700"
                     /translation="MAGNQFRIVVGSYEHNLLCLSLNLELETPLFTPIFHFQAHALSV
                     KTLDISRRYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSLRFSRATTDKDGKQQG
                     NKWLLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSNRVAVSVSEDHSIRLW
                     NLMTAKKAAVLKLKKYNQNGKYVRWCGKDAGFFAVGLVTKVLIYNAATAKVHHEISTG
                     NKTIMHMEVEHIDEKEYICVGLSTGSIQFYDAEKLYEESEDQKAAEPAFSLQGHTNRV
                     KDFRFYKNSMGHYLVSAGSDGKIVVWDIVKQEQLAVYDCGERLNCLAVCDESVEKYDT
                     VLKRTAATADIEDQSEVEEDAEELKQIMLGKQKQKQKKKKAKKAKKTSRVSVELE"
     gene            complement(<649160..>650278)
                     /locus_tag="AGOS_ACR167C"
                     /old_locus_tag="ACR167C"
                     /db_xref="GeneID:4619701"
     mRNA            complement(<649160..>650278)
                     /locus_tag="AGOS_ACR167C"
                     /old_locus_tag="ACR167C"
                     /product="ACR167Cp"
                     /transcript_id="NM_208922.1"
                     /db_xref="GeneID:4619701"
     CDS             complement(649160..650278)
                     /locus_tag="AGOS_ACR167C"
                     /old_locus_tag="ACR167C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR034C (LYS1)"
                     /codon_start=1
                     /product="ACR167Cp"
                     /protein_id="NP_983569.1"
                     /db_xref="GeneID:4619701"
                     /translation="MSAILHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESAQSV
                     FEAAEYAAAGAEVVATGSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSG
                     WREVLGRFQSGGGLLYDLEFLQDDRGRRVAAFGYYAGFAGAALGLRDWAWKQTHTDAE
                     DLPAVAPYENEQALVSEVAAACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLH
                     DKHIIRWDIAETARGGPFPEIAAADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVD
                     VSADTTNPHNPVPVYNVATVFSSPTVVVPTSQGPKLSVISIDHLPSLLPREASEAFAS
                     DLLPSLLQLPERDTAPVWLRAKELFQQHCERLSKEARL"
     gene            <650620..>652743
                     /locus_tag="AGOS_ACR168W"
                     /old_locus_tag="ACR168W"
                     /db_xref="GeneID:4619702"
     mRNA            <650620..>652743
                     /locus_tag="AGOS_ACR168W"
                     /old_locus_tag="ACR168W"
                     /product="ACR168Wp"
                     /transcript_id="NM_208923.1"
                     /db_xref="GeneID:4619702"
     CDS             650620..652743
                     /locus_tag="AGOS_ACR168W"
                     /old_locus_tag="ACR168W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL022C (CDC16)"
                     /codon_start=1
                     /product="ACR168Wp"
                     /protein_id="NP_983570.1"
                     /db_xref="GeneID:4619702"
                     /translation="MSTGNTPSQHESTLAISPFVTNRGRSQQEQRRVMMPSTGEDSLG
                     PSGMADSGTHTPRNSVVHSPLVQKTQLGTPYMAEGAATGGLLGSMSKTALFGPAVPST
                     LRKVSNVREYRRPGDSDGEGGEGYGVDLAELSAAEKLRLWRHDALMQHHYRTAEYIGD
                     KVYSMTRDPNDAFWLAQVYYNMGQYIRAVELLSRDGLDASSVMCRYLTALCLVKMEKY
                     DDALDIVGEVNPFKDDSAEHVRNLDGGIKLESSLCYLRGEIYSAQNNLDLAKECFKEA
                     VCVDVKNFEAFDRLISNNMLTPDEETEFIARLDFTDLDDNQELIRCLYSTKLSKYGDL
                     TKLKAAHRFLLDEYHLEDNKDVQTTEIELLIFQGKYLECLELCEKVLEQDEFNFDVLP
                     TYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASV
                     LDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTL
                     AEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAI
                     STYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDALH
                     SVLAMEPNHQTGQQLLKIALDVNVHLPLDNGHPLMVSAKISENMKMSSNDKKRSLGNI
                     DPVVIAKRLKQGSTSSDEGDSMDIE"
     gene            complement(<652870..>653427)
                     /locus_tag="AGOS_ACR169C"
                     /old_locus_tag="ACR169C"
                     /db_xref="GeneID:4619703"
     mRNA            complement(<652870..>653427)
                     /locus_tag="AGOS_ACR169C"
                     /old_locus_tag="ACR169C"
                     /product="ACR169Cp"
                     /transcript_id="NM_208924.1"
                     /db_xref="GeneID:4619703"
     CDS             complement(652870..653427)
                     /locus_tag="AGOS_ACR169C"
                     /old_locus_tag="ACR169C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL023W"
                     /codon_start=1
                     /product="ACR169Cp"
                     /protein_id="NP_983571.1"
                     /db_xref="GeneID:4619703"
                     /translation="MDIENSRLLEFLLTDEACGSPDKGHKVLRARQQVPSSYSRPPKR
                     LSSLRIQNLKTPRKDTRNDEYIKKDLESIILLRGTSNVGTLKVGKSPVEPVRKPRPSS
                     GAEVNGGDAGHPSGPSSKRKKSKQKGASKKDKSAPELPQTTPKAAPEAAGRKRPRPRM
                     PRKRTASKRAGDSGGQASTEAGAPK"
     gene            complement(<653516..>654385)
                     /locus_tag="AGOS_ACR170C"
                     /old_locus_tag="ACR170C"
                     /db_xref="GeneID:4619704"
     mRNA            complement(<653516..>654385)
                     /locus_tag="AGOS_ACR170C"
                     /old_locus_tag="ACR170C"
                     /product="ACR170Cp"
                     /transcript_id="NM_208925.1"
                     /db_xref="GeneID:4619704"
     CDS             complement(653516..654385)
                     /locus_tag="AGOS_ACR170C"
                     /old_locus_tag="ACR170C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL024C (URA6)"
                     /codon_start=1
                     /product="ACR170Cp"
                     /protein_id="NP_983572.1"
                     /db_xref="GeneID:4619704"
                     /translation="MLRAMGQHCGAVAAAARARAAPAALRMPALARSASCRPYSAPAA
                     GGSPKPRGGRGKLVVLLGALAAGTTLYSIMYQKAPPRELREAEDESARPLPADASVVF
                     VLGGPGSGKGTQCSRLVERMQFVHVGAGDLLRDEQNRPGSQYGELIKHHIKEGLIVPQ
                     EVTVALLRRAIEEHYRAGRRKFLVDGFPRKMDQAFTFEKTVVPSKFVLFFDCPERVML
                     ERLLTRGQTSGRSDDNIESIKKRFRTYVETSMPVVEHFAQQDKVVRLSCDQPVEEVYK
                     QVEAAVKERLGPH"
     gene            complement(<654585..>655389)
                     /locus_tag="AGOS_ACR171C"
                     /old_locus_tag="ACR171C"
                     /db_xref="GeneID:4619705"
     mRNA            complement(join(<654585..654914,654964..>655389))
                     /locus_tag="AGOS_ACR171C"
                     /old_locus_tag="ACR171C"
                     /product="ACR171Cp"
                     /transcript_id="NM_208926.1"
                     /db_xref="GeneID:4619705"
     CDS             complement(join(654585..654914,654964..655389))
                     /locus_tag="AGOS_ACR171C"
                     /old_locus_tag="ACR171C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR035C and YIR036C (IRC24) (IRC24) (IRC24) (IRC24)
                     (IRC24); 1-intron; Tandem gene duplication in
                     Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACR171Cp"
                     /protein_id="NP_983573.1"
                     /db_xref="GeneID:4619705"
                     /translation="MPRLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELR
                     ATYGEQFEYVVGDVASEDAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWR
                     RLYEVNFFSVVGLVGRALPLLKKAGGSVVFVSSGASTKAYSAWGAYGSSKAALNHFAM
                     TLAAEEPAVRAVAVAPGVVDTQMQNDIRDKFGHRMAPEALRRFTELKKNSELLDPQIP
                     ATIFANLALRGIPDCANGKYLRYNDDILAAYAK"
     gene            <655569..>657407
                     /locus_tag="AGOS_ACR172W"
                     /old_locus_tag="ACR172W"
                     /db_xref="GeneID:4619706"
     mRNA            <655569..>657407
                     /locus_tag="AGOS_ACR172W"
                     /old_locus_tag="ACR172W"
                     /product="ACR172Wp"
                     /transcript_id="NM_208927.1"
                     /db_xref="GeneID:4619706"
     CDS             655569..657407
                     /locus_tag="AGOS_ACR172W"
                     /old_locus_tag="ACR172W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL025C (PAN3)"
                     /codon_start=1
                     /product="ACR172Wp"
                     /protein_id="NP_983574.1"
                     /db_xref="GeneID:4619706"
                     /translation="MMMNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNHGKPLSTSS
                     NTGGAAAGSAEDSAASGGVTVGNTGKSTFNAKTATSFTPSVAIPDFNNIPSFTPERIV
                     SSPAGDGATAFTPSFNPYGSDSFNPSANVSGPGSAVFAAASGNAGASATAAPRSQSVH
                     VGTGGYLPLAGTAFPTVYPPSHSILQYHLYAPDPPPHLQVPLKANERTPETLFIPNNL
                     REHLLKRNLSALQVFPSDGNLPDIVGDYFGLVPLEFHNRQTGKGRYLGHQNSLYKVFS
                     NFDGKVYIIRRIHDVKTTDVGQISLPFRKWQKVSCPNVVKVKDAFTTLAFGDSSLCVV
                     HDYYPQSNSLYETHVANYTVVPVTQKYLWSYLVQLSNALNEVHRHGLSMNNISLDKVI
                     VTGDPGRIKVGDSAVHDILAFDEGRDIAKEQQADYSAVGALLMDLAQRMLGTRDQPLD
                     SMDIDPLFKRVLAYLLSDEKKTIAEFTALFSHKMLDIISSSQTYSEYIEQHLSRELEN
                     GRLFRLMCKLNFIFGRMESSMDIHWSEAGDKFPIILFYDYVFHQVDENGKSVMDLTHV
                     LRCLNKLDTGVSEKIILVTPDEMNCIIISYKELKDSIDSTFRSMTQ"
     gene            complement(657502..657572)
                     /locus_tag="AGOS_t0054"
                     /db_xref="GeneID:4619707"
     tRNA            complement(657502..657572)
                     /locus_tag="AGOS_t0054"
                     /product="tRNA-Gly"
                     /codon_recognized="GGC"
                     /db_xref="GeneID:4619707"
     gene            <657723..>658580
                     /locus_tag="AGOS_ACR173W"
                     /old_locus_tag="ACR173W"
                     /db_xref="GeneID:4619624"
     mRNA            <657723..>658580
                     /locus_tag="AGOS_ACR173W"
                     /old_locus_tag="ACR173W"
                     /product="ACR173Wp"
                     /transcript_id="NM_208928.1"
                     /db_xref="GeneID:4619624"
     CDS             657723..658580
                     /locus_tag="AGOS_ACR173W"
                     /old_locus_tag="ACR173W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR088C (EMC2)"
                     /codon_start=1
                     /product="ACR173Wp"
                     /protein_id="NP_983575.1"
                     /db_xref="GeneID:4619624"
                     /translation="MQLMRERLLELYNTKQYVVLPPDETVKLQREVTASLNSADPGLN
                     DVDRMALMEMNFYLLVYIGEEIEADVLYRTLVGRIGENSPRMHLMKATLLQVTEGDPA
                     AAKYLKNLLEKQLEYDTDSVDYLQVGKKLIALERPALSTELWMKKLLSLLEKFPLDAE
                     LWWTLAMEYYKLGQFDQAIYCFEEVLLISPLAYSAFAQLAEVLYCKAMREKPVSTDVL
                     QEALENALRAVELSSNCLKGWSFVGKISSVLEKPRLLSLALTKLREIESSSNKQHSKT
                     AKYILKSLE"
     gene            complement(<658685..>659830)
                     /locus_tag="AGOS_ACR174C"
                     /old_locus_tag="ACR174C"
                     /db_xref="GeneID:4619708"
     mRNA            complement(<658685..>659830)
                     /locus_tag="AGOS_ACR174C"
                     /old_locus_tag="ACR174C"
                     /product="ACR174Cp"
                     /transcript_id="NM_208929.1"
                     /db_xref="GeneID:4619708"
     CDS             complement(658685..659830)
                     /locus_tag="AGOS_ACR174C"
                     /old_locus_tag="ACR174C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR040W (TIP41)"
                     /codon_start=1
                     /product="ACR174Cp"
                     /protein_id="NP_983576.1"
                     /db_xref="GeneID:4619708"
                     /translation="MKRTDQGRGIRAIEVNGARELHYKTVQARRPPSARETVTKTATE
                     GPSMPSFALPKDARSTASTASTASTASTASTARRPEVERHEAAVVDGRHRCNNPNNPP
                     CAQCGSVIIPAPKATLPLEDTPSISILDWTVSTRKKPILNSQELDEWDALLAGLTLPE
                     MIFGNSFVRVENKKQNWALEFNALDALRQVELTDCGIRVSYAHKWIHSKREKQKESQE
                     LEDTSLNISHQYDWTYTTLYQGTIDGRAMVRDDSVELPLAKLSRPDPILFYDDMILFE
                     DELADNGISILNVKVRVMNECMLILSRFFLRVDDVLFRIVDTRVYVEFDSNRVIREFK
                     QYESDYKSVFAKLRSTQGHDPKAGMRDSNWVVQNLKLLTRECHVLQL"
     gene            <659996..>660592
                     /locus_tag="AGOS_ACR175W"
                     /old_locus_tag="ACR175W"
                     /db_xref="GeneID:4619709"
     mRNA            <659996..>660592
                     /locus_tag="AGOS_ACR175W"
                     /old_locus_tag="ACR175W"
                     /product="ACR175Wp"
                     /transcript_id="NM_208930.1"
                     /db_xref="GeneID:4619709"
     CDS             659996..660592
                     /locus_tag="AGOS_ACR175W"
                     /old_locus_tag="ACR175W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR037C (ERV2)"
                     /codon_start=1
                     /product="ACR175Wp"
                     /protein_id="NP_983577.1"
                     /db_xref="GeneID:4619709"
                     /translation="MKLHRQKVLSIVAAAAIVGLWYMFFGQQLSNRETYDPDVVPQQE
                     GRTPAAVRAAADKNQAPMIKGSIMPGMPDPTAKQELGRATWKLFHTMLARFPDEPSEQ
                     EREKLHTFLHLLAELYPCGECSVHFVSWLKKLPPQTSSRSAAATWGCSIHNKVNLYLG
                     KPAYDCSKILEDYDCGCGDDAAAGSLKVSVHTERPQGG"
     gene            complement(<660654..>661016)
                     /locus_tag="AGOS_ACR176C"
                     /old_locus_tag="ACR176C"
                     /db_xref="GeneID:4619710"
     mRNA            complement(<660654..>661016)
                     /locus_tag="AGOS_ACR176C"
                     /old_locus_tag="ACR176C"
                     /product="ACR176Cp"
                     /transcript_id="NM_208931.1"
                     /db_xref="GeneID:4619710"
     CDS             complement(660654..661016)
                     /locus_tag="AGOS_ACR176C"
                     /old_locus_tag="ACR176C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR086W (STE18)"
                     /codon_start=1
                     /product="ACR176Cp"
                     /protein_id="NP_983578.1"
                     /db_xref="GeneID:4619710"
                     /translation="MATGCTQHLYRRRGAQKVLETFAQTKRFRTMAEQRLPPKIQYLK
                     LKRTEELNNKLKKELARERITASNACLSIIDYTSTNKDYAVPEVWGYMKPGENHFRAS
                     AKQARPRGGHEGSCCCIM"
     gene            <661157..>661531
                     /locus_tag="AGOS_ACR177W"
                     /old_locus_tag="ACR177W"
                     /db_xref="GeneID:4619711"
     mRNA            <661157..>661531
                     /locus_tag="AGOS_ACR177W"
                     /old_locus_tag="ACR177W"
                     /product="ACR177Wp"
                     /transcript_id="NM_208932.1"
                     /db_xref="GeneID:4619711"
     CDS             661157..661531
                     /locus_tag="AGOS_ACR177W"
                     /old_locus_tag="ACR177W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR085C"
                     /codon_start=1
                     /product="ACR177Wp"
                     /protein_id="NP_983579.1"
                     /db_xref="GeneID:4619711"
                     /translation="MHIVFGKTVFPTAPPTTTAMEHPSFTLAALTVIGGSMGYWRKGS
                     VPSLAAGLVFGSTYAVAGYLLRKNAEGGLELALGASSVMLLTGLIRGVPSRFAKPVPL
                     VLTALGGFGTAYYYGKYREFYP"
     gene            complement(661605..661698)
                     /locus_tag="AGOS_t0055"
                     /db_xref="GeneID:4619712"
     tRNA            complement(join(661605..661649,661662..661698))
                     /locus_tag="AGOS_t0055"
                     /product="tRNA-Ser"
                     /codon_recognized="UCG"
                     /db_xref="GeneID:4619712"
     gene            complement(<663044..>663241)
                     /locus_tag="AGOS_ACR178C"
                     /old_locus_tag="ACR178C"
                     /db_xref="GeneID:4619625"
     mRNA            complement(<663044..>663241)
                     /locus_tag="AGOS_ACR178C"
                     /old_locus_tag="ACR178C"
                     /product="ACR178Cp"
                     /transcript_id="NM_208933.1"
                     /db_xref="GeneID:4619625"
     CDS             complement(663044..663241)
                     /locus_tag="AGOS_ACR178C"
                     /old_locus_tag="ACR178C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR036W-A"
                     /codon_start=1
                     /product="ACR178Cp"
                     /protein_id="NP_983580.1"
                     /db_xref="GeneID:4619625"
                     /translation="MVYKHGQALQHGQLLERPTMAFLVLTSDATEPFVIPSLSPTSRT
                     GSVSEPLPPRLLSPAPGVAAI"
     gene            complement(<663330..>664568)
                     /locus_tag="AGOS_ACR179C"
                     /old_locus_tag="ACR179C"
                     /db_xref="GeneID:4619713"
     mRNA            complement(<663330..>664568)
                     /locus_tag="AGOS_ACR179C"
                     /old_locus_tag="ACR179C"
                     /product="ACR179Cp"
                     /transcript_id="NM_208934.2"
                     /db_xref="GeneID:4619713"
     CDS             complement(663330..664568)
                     /locus_tag="AGOS_ACR179C"
                     /old_locus_tag="ACR179C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR084W (CSN12)"
                     /codon_start=1
                     /product="ACR179Cp"
                     /protein_id="NP_983581.2"
                     /db_xref="GeneID:4619713"
                     /translation="MIQAVTSCFQFKRCTTHLLEFIAADKPMVGDALADPSDEKLAHF
                     VRTTAALKIEYRCAQGPSPRVFELALAQLRALNRIAEWESGWVVYPLYTCARQLVQMA
                     AALDARTERAAEAAQCGDLATEDHLTQCGRAVHMSLNLCLKDRDPAASNKRHGAYYFA
                     LLLFRTYARLGAHSLVTNMVKVLESRAQDLPPVERAFGERRALTVTYCYYLGRYHACR
                     RADYEKGFRWLNTALLTCHRDHTRHHQLILTYLVPVAFLARRWYPKHHVIAAWPPPQD
                     PAAIHYAALVAALRSGDLGLYDRELVRMQLPLLRRGLYLPLSHLRPYILLRLVKAVWR
                     LSGGSSQLPIRIIAAALAYSTSATPDAGGERLLDHTECLLANLIARGYVKGYLSHGNR
                     VLVVSRTEPFPRLVRSETAA"
     gene            <664749..>665396
                     /locus_tag="AGOS_ACR180W"
                     /old_locus_tag="ACR180W"
                     /db_xref="GeneID:4619714"
     mRNA            <664749..>665396
                     /locus_tag="AGOS_ACR180W"
                     /old_locus_tag="ACR180W"
                     /product="ACR180Wp"
                     /transcript_id="NM_208935.2"
                     /db_xref="GeneID:4619714"
     CDS             664749..665396
                     /locus_tag="AGOS_ACR180W"
                     /old_locus_tag="ACR180W"
                     /experiment="RACE determination of 5' region of mRNA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR083C (ACF4); Newly annotated start codon"
                     /codon_start=1
                     /product="ACR180Wp"
                     /protein_id="NP_983582.2"
                     /db_xref="GeneID:4619714"
                     /translation="MIASGVSDVGTDKGKEPDRKTDDAPDSLRYQISAKERHIAELEF
                     QLQQARKELRELQTRASGKKEGTPAANEFTRLLHKKMQEVNQSPAVRRSKESIENFLQ
                     EVQSGSGPFVGGAALKTRLQSLKPGGASEHSLRGSTAETAGAAGFFGMLKGKLQELAL
                     DEEEESEFDREMNNSETFYLKDKLDYDSEEEVLSEEVDNNFTGNKYPQKLTNKHT"
     gene            complement(<665494..>666915)
                     /locus_tag="AGOS_ACR181C"
                     /old_locus_tag="ACR181C"
                     /db_xref="GeneID:4619715"
     mRNA            complement(<665494..>666915)
                     /locus_tag="AGOS_ACR181C"
                     /old_locus_tag="ACR181C"
                     /product="ACR181Cp"
                     /transcript_id="NM_208936.1"
                     /db_xref="GeneID:4619715"
     CDS             complement(665494..666915)
                     /locus_tag="AGOS_ACR181C"
                     /old_locus_tag="ACR181C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR036W (VMA13)"
                     /codon_start=1
                     /product="ACR181Cp"
                     /protein_id="NP_983583.1"
                     /db_xref="GeneID:4619715"
                     /translation="MAVAQGVQKILLDSTHFNDIRNTISSRHVAWDALVRSAELSEFD
                     AGIAKKLESTLLKHARGGALDLPLEQGVQALVHLLATSNNLDAKRAVLNLLSELFTSD
                     KYVHEVLRYFKKGPELVRKLYESTLTDSAADDQFVLLSCFNVVSLLIQEGLQSEELVE
                     ALVSNPNYLRVLTNLERMELAYVCIRLLQELVAVKRYRRLVWKHSAKFVPVIFQIIDW
                     ALDGRSSTRVVPTNSNNLGIQAQYYALLTLWLLSFEPQIAADLSHTYLSELLKLFKLV
                     KVTIKEKVTRLSIAILLNCVAAQVKGRKATIKNLLLLGSGLPILQQLSERKYSDDELR
                     EDLSQLHGILESEYHELTSLDEYVAELDSKLLVWSPPHTDNTFWSENAHKFKEENWKL
                     FKQLINVLKELSTSHDSSDNVALQVVLNDITHIVELQPECVDILGKLNAKVIIMELLN
                     HPNSKVKYEALKTTQAFVANTFK"
     gene            complement(<667269..>668378)
                     /locus_tag="AGOS_ACR182C"
                     /old_locus_tag="ACR182C"
                     /db_xref="GeneID:4619716"
     mRNA            complement(<667269..>668378)
                     /locus_tag="AGOS_ACR182C"
                     /old_locus_tag="ACR182C"
                     /product="ACR182Cp"
                     /transcript_id="NM_208937.1"
                     /db_xref="GeneID:4619716"
     CDS             complement(667269..668378)
                     /locus_tag="AGOS_ACR182C"
                     /old_locus_tag="ACR182C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR035W (GLN1)"
                     /codon_start=1
                     /product="ACR182Cp"
                     /protein_id="NP_983584.1"
                     /db_xref="GeneID:4619716"
                     /translation="MSELVEKTSTLLKYLDLDQRGAVIAEYIWVDSAGHLRSKGRTLQ
                     RRVESVDELPEWNFDGSSTGQAPGHDSDVYLKPVAFYPDPFRRGDNIIVLAECWNNDG
                     TPNKYNHRHEAAKLFEAHRAADIWFGLEQEYTLFDHNDNVYGWPKGGFPAPQGPYYCG
                     VGAGKVYARDVVEAHYRACLYAGLRISGINAEVMPSQWEFQVGPCTGITMGDELWVGR
                     YLLHRVAEEFGVKVSFHPKPLKGDWNGAGCHTNVSTREMRQPGGMRYIEEAIDKLSKR
                     HKEHIKLYGSDNELRLTGRHETASMATFSSGVANRGASIRIPRSVSKEGFGYFEDRRP
                     ASNIDPYLVTGIICETICGAIENADMSKEFERESS"
     gene            complement(<668759..>669355)
                     /locus_tag="AGOS_ACR183C"
                     /old_locus_tag="ACR183C"
                     /db_xref="GeneID:4619717"
     mRNA            complement(<668759..>669355)
                     /locus_tag="AGOS_ACR183C"
                     /old_locus_tag="ACR183C"
                     /product="ACR183Cp"
                     /transcript_id="NM_208938.1"
                     /db_xref="GeneID:4619717"
     CDS             complement(668759..669355)
                     /locus_tag="AGOS_ACR183C"
                     /old_locus_tag="ACR183C"
                     /note="NOHBY329; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of unannotated Saccharomyces kluyveri
                     gene"
                     /codon_start=1
                     /product="ACR183Cp"
                     /protein_id="NP_983585.1"
                     /db_xref="GeneID:4619717"
                     /translation="MTPPARFAASHALAPAAPARDTVELYLDYCCPFSRRLFLAWHDA
                     LFPRARADSRFQIVFNHVIQPWHPASQYMHEAALAVARLDPAAFLPFSRELFLHQDRW
                     FDTRTADKSRHAVYRELADFARDAAGLPADAVYDLLAVRGNDGNAVVRDLKHYVRYHR
                     QNGVHVTPSVAVNGVLAPAIDSATPPDAAWEQLVALSE"
     gene            complement(<669416..>670621)
                     /locus_tag="AGOS_ACR184C"
                     /old_locus_tag="ACR184C"
                     /db_xref="GeneID:4619718"
     mRNA            complement(<669416..>670621)
                     /locus_tag="AGOS_ACR184C"
                     /old_locus_tag="ACR184C"
                     /product="ACR184Cp"
                     /transcript_id="NM_208939.1"
                     /db_xref="GeneID:4619718"
     CDS             complement(669416..670621)
                     /locus_tag="AGOS_ACR184C"
                     /old_locus_tag="ACR184C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR034W (ARP7)"
                     /codon_start=1
                     /product="ACR184Cp"
                     /protein_id="NP_983586.1"
                     /db_xref="GeneID:4619718"
                     /translation="MALEKAVVLHFGKHSTVAGFSNRDLPQCMLPSAYLMPDGGEPVY
                     GLYELMQAKEHDIYTLFDNRGVPTDWEMLERFCRWIYATQLRVGPEELPVCITVPPDL
                     SATVRSQFHELVLCKLRAPVLQLISEPLAVTLSLGRSTALVVDVGASKVTVTPIVDGS
                     VVKTGILRSRYAGDFLDFQLMKALDDRPDGTSLYHWQQSRTWMRDFKNTMLQVSLMRL
                     SEVEKQLQKQSISFIPIPLEGRKHFLFKRQKTVTWDLKQCYRIPESLFDPSSVSPEFD
                     SADGLSDLVGKAIKKCAASITSSNGSAAQPAAAGLPSATPEQIHAALLTNVVIIGGTS
                     LLQGLEQRLVNDLSLQFPQYKLSTYATPAHVDRQLQSWQGGVNMCHLPDWKLGSWVTK
                     QEYLESLDK"
     gene            <670814..>671110
                     /locus_tag="AGOS_ACR185W"
                     /old_locus_tag="ACR186W"
                     /db_xref="GeneID:4619719"
     mRNA            <670814..>671110
                     /locus_tag="AGOS_ACR185W"
                     /old_locus_tag="ACR186W"
                     /product="ACR185Wp"
                     /transcript_id="NM_208940.2"
                     /db_xref="GeneID:4619719"
     CDS             670814..671110
                     /locus_tag="AGOS_ACR185W"
                     /old_locus_tag="ACR186W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR082C (EAF6)"
                     /codon_start=1
                     /product="ACR185Wp"
                     /protein_id="NP_983587.2"
                     /db_xref="GeneID:4619719"
                     /translation="MEKQRKEYEELKQKLKQALHEKKVQEQEWDQIQQEIFDKETEYL
                     SGNASSKYGTIVKGFDGFGKHASQDSHHFQDQDRIFSLSSALFVKQQEGVQDEE"
     gene            <671404..>672579
                     /locus_tag="AGOS_ACR186W"
                     /old_locus_tag="ACR185W"
                     /db_xref="GeneID:4619720"
     mRNA            <671404..>672579
                     /locus_tag="AGOS_ACR186W"
                     /old_locus_tag="ACR185W"
                     /product="ACR186Wp"
                     /transcript_id="NM_208941.2"
                     /db_xref="GeneID:4619720"
     CDS             671404..672579
                     /locus_tag="AGOS_ACR186W"
                     /old_locus_tag="ACR185W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR080C (AIM24)"
                     /codon_start=1
                     /product="ACR186Wp"
                     /protein_id="NP_983588.2"
                     /db_xref="GeneID:4619720"
                     /translation="MSSVSRRYISLVKPGSSSVPPIARLLAPNAAAKALFPSEDLGST
                     QFELLGESGTLARAAVPAGTSLYVRRGCMVSLYNRSGLRDIAMSHQWLQPAARMLRYR
                     SLKASIYYRLSSPAHLNCLLAPNFMSQQLWRARPVAGRTLCPLTLDGTSDWFVFGRDA
                     VVAYESNSSLVIQEGPFRWPLRRAHPLGSKLQLAQGRGSLLLSGYGTVYRVDLKDAAD
                     ELILQRRHLLAINGAAPADIHACATPYDMLPPARAARVVPPLVSLSADRRVHVEWSNL
                     CRWFSAQASHARSLAQRLYARYLHGPSDFVKIRGPRTLMVQSMYSGSAPLPSVPARAA
                     PQPLYTTDMDSLPELKVSDAKNYLSYASVGPDGNVSFRSTPDFKDSVKQIELAKNRR"
     gene            <672779..>674404
                     /locus_tag="AGOS_ACR187W"
                     /old_locus_tag="ACR187W"
                     /db_xref="GeneID:4619721"
     mRNA            <672779..>674404
                     /locus_tag="AGOS_ACR187W"
                     /old_locus_tag="ACR187W"
                     /product="ACR187Wp"
                     /transcript_id="NM_208942.1"
                     /db_xref="GeneID:4619721"
     CDS             672779..674404
                     /locus_tag="AGOS_ACR187W"
                     /old_locus_tag="ACR187W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR033C (HTS1)"
                     /codon_start=1
                     /product="ACR187Wp"
                     /protein_id="NP_983589.1"
                     /db_xref="GeneID:4619721"
                     /translation="MRNLPRINLKSTFTTFSRIMSQQKEVSAGVMASSGAKKENVKKS
                     KLQVSLKTPKGTKDWADKDMVIREAIFQRLSGMFRRHGGVTIDTPVFELREILAGKYG
                     EDSKLIYDLKDQGGELCSLRYDLTVPFARFVAMNNIQNIKRYHIAKVYRRDQPAMTKG
                     RMREFYQCDFDIAGSYESMVPDAECLSILVEGLTGLGIQDFKIKLNHRKILDGIFEIA
                     GVKEEDVRKISSAVDKLDKSPWEVVRKEITVEKGQSEATADKIGEYVKLSGSLEEVYE
                     KLAADAAVTSNEKAKQGLEEMATLTKYTRAFGINEFISFDLSLARGLDYYTGVIYEAV
                     TGASAPPSNAQELKAKAKDAEDASEYVGVGSIAAGGRYDNLVGMFAEASGKKSVSIPC
                     VGLSFGVERIFSLIKQRSERASSIRPTSTQVFVMAFGGGKDWTGYLPERMQVTKQLWD
                     AGIDTEYVYKSKANPRRQFEAAEKSGCPLAVILGKEEYLEGKLRVKRLGPEFADDDGE
                     LIDAADVVKVVKNKLAEIRVDGMDEVERLLRSL"
     gene            complement(<674533..>675978)
                     /locus_tag="AGOS_ACR188C"
                     /old_locus_tag="ACR188C"
                     /db_xref="GeneID:4619722"
     mRNA            complement(<674533..>675978)
                     /locus_tag="AGOS_ACR188C"
                     /old_locus_tag="ACR188C"
                     /product="ACR188Cp"
                     /transcript_id="NM_208943.1"
                     /db_xref="GeneID:4619722"
     CDS             complement(674533..675978)
                     /locus_tag="AGOS_ACR188C"
                     /old_locus_tag="ACR188C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR078W (BNA2)"
                     /codon_start=1
                     /product="ACR188Cp"
                     /protein_id="NP_983590.1"
                     /db_xref="GeneID:4619722"
                     /translation="MSTELPLPVLEDYFVSAANAFLPDEFPVKELQDEYYRPWETIVS
                     NLPALLLARQLRDVVDQLKVLEVKKELFEDMRQLRRAYSVLGFIANAYVWGYDDACDT
                     IPESVAAPLLKVSEALGLPPLATYAGLVLWNFCPIFEDEALAGGSVWDLSNLRTINTF
                     TGSMDESWFYLISVFFEKRGAQSMNDGLNAIRAVRSGDRAGVVAHLQALAEGIDSLGA
                     LLGRMEEMCDPYVFYYRIRPYLAGWKNMADLGLPNGVRYGDRGEYRTYVGGSNAQSSL
                     IQMLDILLGVEHFQTGVSKTAGRSISAGSNGNGYINDMRNYMPEGHRLFLAHLQQVAN
                     IRDYVLSHNFDAELVLAYDACVSMMKSFRDRHIQLVTRYIVLQAKKKEPSTKPHATLR
                     SGLSKHSGTMEQRGTGGTSLIPFLKQCRDETGSAAASAWGKRILYHGVLRVKDNSILD
                     LPKKGVPVVASRSDELVNSYSEQENHLPGHW"
     gene            complement(<676283..>676873)
                     /locus_tag="AGOS_ACR189C"
                     /old_locus_tag="ACR189C"
                     /db_xref="GeneID:4619723"
     mRNA            complement(<676283..>676873)
                     /locus_tag="AGOS_ACR189C"
                     /old_locus_tag="ACR189C"
                     /product="ACR189Cp"
                     /transcript_id="NM_208944.1"
                     /db_xref="GeneID:4619723"
     CDS             complement(676283..676873)
                     /locus_tag="AGOS_ACR189C"
                     /old_locus_tag="ACR189C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL107C"
                     /codon_start=1
                     /product="ACR189Cp"
                     /protein_id="NP_983591.1"
                     /db_xref="GeneID:4619723"
                     /translation="MPGGQLTVEVPAPRADTGSGPSGAHGAANRRITINRDGCVNPSL
                     IESFLRELRRTTDNVVNQRTNDLQNAPAQELGARCVDYVGSTLLPAWHIRGQVIDFCA
                     TQASQIRASLQLGGDESHVPAAVDPTVNPYVTVEEQERHRARLGDVMKMENWVANQRE
                     IERILQRTTLARVNSVCGQLDEFASQVQALTDRRNN"
     gene            complement(<677106..>680111)
                     /locus_tag="AGOS_ACR190C"
                     /old_locus_tag="ACR190C"
                     /db_xref="GeneID:4619724"
     mRNA            complement(<677106..>680111)
                     /locus_tag="AGOS_ACR190C"
                     /old_locus_tag="ACR190C"
                     /product="ACR190Cp"
                     /transcript_id="NM_208945.1"
                     /db_xref="GeneID:4619724"
     CDS             complement(677106..680111)
                     /locus_tag="AGOS_ACR190C"
                     /old_locus_tag="ACR190C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL106C (SRO77) and YPR032W (SRO7)"
                     /codon_start=1
                     /product="ACR190Cp"
                     /protein_id="NP_983592.1"
                     /db_xref="GeneID:4619724"
                     /translation="MFKSRRLKNVTNALKSVRGGDSGHLNGKLFELTEVCRSGVGGNV
                     VAMAFDPVQSLLAVATETGEVHVYGKQQVEVVFTLKIKAAKAMRFVKGVYLVVVDRSD
                     GLTVISLHRKCILASIYAPGKITAVEVDPSVDWMLLGLQNGSVIVYDVDRDVLSPYMI
                     ENLQKSTVFPRERSSPVVSIQWHPRELGTLLIAYERVVVTYSLVENCIKQQFVYELPP
                     GAPGGDPGADINKPRAPFVVQALYHPNGLHILTVHADNSLVFWDANNGELIQARTLFD
                     MDVHVPGSYENLNGMRNDRIKKVAWICDADPEKTSLLIAGGTAPHGTETFGLTMLDFG
                     TTPKYSVTSYEKMSHYYSNPVRQKSFMLPSESSIVDFLPLPRKSPYFAGNHDPSLILV
                     LLANGELDTLLYPSGNVTHRASLFPQSLSWVRPTVTVATAANIPTKQWLGMMSCTYNK
                     DHFLKGGAQVRKTARRHYGRTAFITGHSNGSVRIWDASHRELEETSVFNINVAQALGT
                     TDNVAVEHVSFAAETAELAVSVSSGDVLLYKFQDNPMFNPNGVAGELDGSFARLGIGN
                     MSELLVDVSDRAPSHMKVGFCPLSAVRANLGKVSAVTNSNIGFVAVAYEDGSLLVIDR
                     RKPAVIYMENLRRLKLKSAYVKSIEFSIMAFRDDGYSSILLFCGTDAGELLIFKVLPE
                     LSGRFVVNFVDNLSLHDQSPILKVETLSIEHASSCQASIGKMQELKTGTIIRGCVVLT
                     SGSGIQLITDWAVKPTCKSFSVPLATTGCAFVPYKGAKDQLLTGIILIALQINSEIKL
                     LSLPDLKELKTLVPPTTPQAQYLRNSSVLHNGDLMLRVGPAEAILFSILPGQSQDNTS
                     AADAETDVLYNPKLHFPARPHVGALQWARGSMLVKCDELAELLSGGNRPPPKYPESKL
                     SSVAHSASSASPSSEADQETQYQAPMKHSQRGNASWRSFTKSVQNGIDYLEDSVNDYA
                     AAANKSMNDALEQTRKDIVKGAFKSKMGI"
     gene            complement(<680403..>683852)
                     /locus_tag="AGOS_ACR191C"
                     /old_locus_tag="ACR191C"
                     /db_xref="GeneID:4619725"
     mRNA            complement(<680403..>683852)
                     /locus_tag="AGOS_ACR191C"
                     /old_locus_tag="ACR191C"
                     /product="ACR191Cp"
                     /transcript_id="NM_208946.2"
                     /db_xref="GeneID:4619725"
     CDS             complement(680403..683852)
                     /locus_tag="AGOS_ACR191C"
                     /old_locus_tag="ACR191C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL105C (PKC1)"
                     /codon_start=1
                     /product="ACR191Cp"
                     /protein_id="NP_983593.1"
                     /db_xref="GeneID:4619725"
                     /translation="MGAAMMNNVEQDILRKIERERNIIQGASNLKKRTDNVMVIQKCN
                     TNIREAQQNIQYLEDTLKKLHLESQAVAVSQVYPGYRQLSTMAPHEHRFSRLDLSKYD
                     CPSLSQRIQYMLQQLEFKLRVERQYQEANDKLTKLYQIDGDQRSSSAAQGGAQESKQR
                     IQLLTKALKKYQALNVDMEQLKEQADDALNSQQKFRRKQLTGEFTIGLTAIRDIDHIQ
                     SPLFSKNPETIITVKVDDVVRAKTKPTRTDRWHEEFTIHVDKGNELEITVYDRINDRI
                     VPVAVMWLLLSDVAEEIRKKKVGQVGSPTWLEAASQLPDASDPYLNTSTAHLPLGGLP
                     LATLDQPPPESAPDTAHAQPITTSAWFVLEPAGQIMLTLGFSKSNQNVRKDIPGGLRR
                     HGAIVNRKDDVYEKHGHHFVQKSFYNIMCCAYCGDFLRYSGFQCQDCKFLCHKKCYNN
                     VVTKCIAKTSTDGDPEEAKLNHHIPHRFEPVSNRGTKWCCHCGYILPWGKKNVRKCSE
                     CSIMCHTQCAHLVPDFCGMTMEMANKILTTIQDTKRNQQQRQKSSPAGQMLEDASKMI
                     PYNTTGSSIEARGGAAFSKRPTASTETSPTSQLLAEDHSVQPYPDISNLPSATSSSEP
                     QDKHSKRQTRLIYDDDDTTEDSAYYRFSEMTGQKEAQAESATLDPGSVYLLNDELLDD
                     HPTTALMWQTMKEEEEQRWLLEQKKKEISKQINQEAPSQWDPQQNPFNSDPSESITQR
                     TLAAEAETSVQLSEAPKSLSSANYDNYVNCASNLELPSEEMESIPQHPPAPLSPPKAQ
                     PVQPASGRHKRKTPKRRKVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKD
                     HIIQNHDIESARAEKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHV
                     QNQRLSVRRAKFYAAEVLLALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLCKDE
                     MWFGNRTSTFCGTPEFMAPEILREQAYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEV
                     FNAILTDEPLYPIDMAGDIVQIFQGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDD
                     ILNLRVEPPYIPTIKAADDTSYFEKEFTAAPPTLTPLPSILSSNLQEEFRGFSFMPDD
                     LVL"
     gene            complement(<684502..>687492)
                     /locus_tag="AGOS_ACR192C"
                     /old_locus_tag="ACR192C"
                     /db_xref="GeneID:4619726"
     mRNA            complement(<684502..>687492)
                     /locus_tag="AGOS_ACR192C"
                     /old_locus_tag="ACR192C"
                     /product="ACR192Cp"
                     /transcript_id="NM_208947.1"
                     /db_xref="GeneID:4619726"
     CDS             complement(684502..687492)
                     /locus_tag="AGOS_ACR192C"
                     /old_locus_tag="ACR192C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL104C (SEA4)"
                     /codon_start=1
                     /product="ACR192Cp"
                     /protein_id="NP_983594.1"
                     /db_xref="GeneID:4619726"
                     /translation="MGFIKQVTNWTNDEWHDYLSVNPTRDEVTHYRVDPNDESDGSIL
                     KSSTFKDFSSITCLDYSQSEVGLVGVAEKNGYLRLFNVFEVVTDGMVGGTSSNAFDIK
                     VRAKQQRPINSVGINNNGLVAMGLDRSRSDPSLQIWDVNYQNTSSNIVNPAFSYCQNE
                     STVSLKFLNETNIIAASTNLIKEVDLRASTPVYQHPSRLSYDIKINPYNSWQFSSYGD
                     DGTLAIWDRRKLVSNTSSSDYLEAKPLLQFEKLVGHGAASRKYMNSCFRWSAVRGLEF
                     CTLHNGEVIRRWRLGSIPLSSNASSSESGDTTPGPQMEELFVSTVNDIPTTYDRVVTF
                     DYIPKSNNDSNFICMRQSGTIYRMSTPGGVCKVAFDNMNSFMATDNNKGETKELRISC
                     RTQQSLSKNLRAGMKNLTFEDLDLSENTNNPDSDSEESNSLDKEFNNSDFETDDESEE
                     NDDAASACEHRYLVKPEKLLQNDISTIMRKRAALGYGLDPMTTVELIDQSKSLQNNAY
                     IRNTWRWIAIAKSSVDDGTMVSGELDLGYEGIYGIWNGLDGLSNQARYKEGSAFTEKQ
                     LNRELEKIILMRGKTRLRLETARHIGSLVNTSKPIQRKLCMIISGWDLTPTEIEEKYM
                     NLISLNNYEKAAGWAVFFGDVQRAIEILSSAKKERLRLIATAIAGYLAYKDQPGNNAW
                     RQQCRRLSSELDDPYLRIIFSFIADNDWWDILYESAISLRERLGVALRFLNDGDLTRF
                     LHRTVTNVIENGELEGLILTGITPNGINLLQSYVSKTSDVQTAALLSIFGCPRYFCDT
                     RVDEWIYIYHNMLNSWNLFTMRAKFDGLRTKLSRNSQGIVKCTVRPRQMYIQCLKCNK
                     NINKPADANPLLPRQGSGIKGIPAKKYAWNSSNPNTHGAPSQKYLCPHCGSPYPRCAI
                     CLLPLGSGSLPIVISGSADHAVTRHIPEGQDPALYESRRLKLNEWFSFCLSCNHGMHA
                     GHAEDWFEKHFICPVPGCTCNCND"
     gene            complement(<687673..>689862)
                     /locus_tag="AGOS_ACR193C"
                     /old_locus_tag="ACR193C"
                     /db_xref="GeneID:4619727"
     mRNA            complement(<687673..>689862)
                     /locus_tag="AGOS_ACR193C"
                     /old_locus_tag="ACR193C"
                     /product="ACR193Cp"
                     /transcript_id="NM_208948.1"
                     /db_xref="GeneID:4619727"
     CDS             complement(687673..689862)
                     /locus_tag="AGOS_ACR193C"
                     /old_locus_tag="ACR193C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR031W (NTO1)"
                     /codon_start=1
                     /product="ACR193Cp"
                     /protein_id="NP_983595.1"
                     /db_xref="GeneID:4619727"
                     /translation="MSSGQTPVRAQEEGPKLREEKHYRDFYPDLNHSVLLPVFTASGE
                     ETALQDIEYKARINALRQLSRASGSLKQIIYKNKVTVERLGPQLKKTCFKPCKVKVTQ
                     LNGKYHVPAVFHRYGYRSNVQTLNVDLARRAYMKKTDDLLRNENEFFVDVSRYLRDFK
                     VQYDMDEQDDLYLQYLNSGKARGSANALSAELFEILITALEIEWFYLERKIPQRHPTN
                     QQSSTHESEAAIAHYELYGSDDGSGSSADQSCAICNGTDSDNSNAIVFCDGCDVAVHQ
                     ECYGVVFIPEGQWLCRRCMISKNRKINCLFCPSNTGAFKQTDTGSWGHVICGIWIPEL
                     FFANQHYMEPIEGIDMVPRSRWKLNCYICKQKCGACIQCSNKNCFVAYHVTCAKRAGL
                     FMTFGGCTVPEAASKNFRPGVKLESFCDKHSPSGWGDCQVGILKTRRYFENIKEMVMR
                     GNQRATSSEAQQPPTRNRWKTNRGTPIAPQLFATILKQLLDKFGIAEAEQTAIDICKY
                     WSMKRELKRGAPLVRIFDPTSFNSMDSADILKRVAFADVLLNDLAKLDELSTLLVRRQ
                     QAAQARLDAVDIINDLGFHPVRHLVQKNVTTHWSTKEFIALMNFEPAFAGVLAKVDSD
                     QYDSIASFSREVRTLFDQIAKEKDIPVELVSTITVCQRQFSKQIAKIEGLDVHKLMSR
                     DFIFEGKKIREVDWHGPILMKEEELSEVEEDELTPAQERILKSFLRY"
     gene            complement(<690191..>691732)
                     /locus_tag="AGOS_ACR194C"
                     /old_locus_tag="ACR194C"
                     /db_xref="GeneID:4619728"
     mRNA            complement(<690191..>691732)
                     /locus_tag="AGOS_ACR194C"
                     /old_locus_tag="ACR194C"
                     /product="ACR194Cp"
                     /transcript_id="NM_208949.1"
                     /db_xref="GeneID:4619728"
     CDS             complement(690191..691732)
                     /locus_tag="AGOS_ACR194C"
                     /old_locus_tag="ACR194C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL156W"
                     /codon_start=1
                     /product="ACR194Cp"
                     /protein_id="NP_983596.1"
                     /db_xref="GeneID:4619728"
                     /translation="MTANSEFNKRRLENIKRNNELLKKLNLAGIPARIRSEAGIEDHR
                     KASGGAVKKKQGKAPVKREAKPAPIPTRRSRRLRGEAADVEGEAGAGSDTAQNVKQEE
                     EWKELKEARVVGDIKLSDLIKSEDDGELLEKFRRYADKSFSGGDFFEELQRHQKPNPE
                     VQRLREEMRLQQYDVFDPKELAIVHERVTALCFHPSQEKKLIVGGDTAGTVGLWNVAD
                     ENPDPEHPDSVPDITRFKLFSRNVSKIEVFPTDSSKILAASYDGALRSIDMQSLKSDE
                     LLHFQNEHGDTLGISDCQFSYDSPNVVMLTTLGGEFAQRDLRTKPDTMNIMRLSDKKI
                     GCMAIDPSRPYSVATASLDRTLRIWDLRKTVAKPDWSQYEDYASHEVVSTYNSRLSVS
                     AVSYAPIDHTLVCNGYDNTVRLFNARADLPSELQPDFTIQHNCKSGRWVSVLKARFKL
                     NMDVFAIANMKRAIDIYTSRGEQLSHLETSTVPAVVSWHPMQNWIVGGNNSGKVFLFT
                     DAPQE"
     gene            <691910..>692242
                     /locus_tag="AGOS_ACR195W"
                     /old_locus_tag="ACR195W"
                     /db_xref="GeneID:4619729"
     mRNA            <691910..>692242
                     /locus_tag="AGOS_ACR195W"
                     /old_locus_tag="ACR195W"
                     /product="ACR195Wp"
                     /transcript_id="NM_208950.1"
                     /db_xref="GeneID:4619729"
     CDS             691910..692242
                     /locus_tag="AGOS_ACR195W"
                     /old_locus_tag="ACR195W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL157C"
                     /codon_start=1
                     /product="ACR195Wp"
                     /protein_id="NP_983597.1"
                     /db_xref="GeneID:4619729"
                     /translation="MVSNILSVFNPPPSRDLTEEETKDCLPCQLMSSAFALGFGSYLL
                     SGRAFRYNEKDKAKGITLEEFNRYNPAWWRNSLRTVGGALVLLGVVRGTEGWLWNSDK
                     YTKEKNSR"
     gene            complement(<692326..>693918)
                     /locus_tag="AGOS_ACR196C"
                     /old_locus_tag="ACR196C"
                     /db_xref="GeneID:4619730"
     mRNA            complement(<692326..>693918)
                     /locus_tag="AGOS_ACR196C"
                     /old_locus_tag="ACR196C"
                     /product="ACR196Cp"
                     /transcript_id="NM_208951.1"
                     /db_xref="GeneID:4619730"
     CDS             complement(692326..693918)
                     /locus_tag="AGOS_ACR196C"
                     /old_locus_tag="ACR196C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL159W (STE7)"
                     /codon_start=1
                     /product="ACR196Cp"
                     /protein_id="NP_983598.1"
                     /db_xref="GeneID:4619730"
                     /translation="MSQHIFQTKSLKRKNLKKLTLEAGGSEELEGAARGDILRATEDR
                     LSGAPTLLKAGARPMRSPEPVWGLGSVPGPASVQGVLDMASSQRAAEPATQRPGLFHN
                     GTPDNQLRGGKPCMTLRMKRMQKPLNLNIEPEGVKSKVVIAQPSPTNSDSSTSVSPIV
                     PSKITSNKRDNRLSTKFSRLSIFQDDNNDIQLEDLVQLGKIGAGNSGTVVKTLHVPDS
                     RIIAKKSIPVENSELVKNQLMRELTIMKNVKEQKNIVGFYGAYYTAIKNHEIIILMEY
                     MDCGSLDKISSTYRRYCSRNKVPMNASTSWFTELSLSKISYAVLNGLSYLYQDYKIIH
                     RDIKPSNILINSKGFVKICDFGVSKKMIDSIADTFVGTSTYMSPERIQGSCYNTKGDV
                     WSLGLMIIELVTGEFPLGGHNDTPEGILDLLQRIVNEEPPSLPASGDFSADIMDFVNC
                     CCVKDERKRSSLQELMTHRYITKYNDSDDYQRTFRHWCKKIKKRIKADKMIQREEMER
                     ARLVNRQLERSAQAAMAARSGR"
     gene            <695410..>696864
                     /locus_tag="AGOS_ACR197W"
                     /old_locus_tag="ACR197W"
                     /db_xref="GeneID:4619731"
     mRNA            <695410..>696864
                     /locus_tag="AGOS_ACR197W"
                     /old_locus_tag="ACR197W"
                     /product="ACR197Wp"
                     /transcript_id="NM_208952.1"
                     /db_xref="GeneID:4619731"
     CDS             695410..696864
                     /locus_tag="AGOS_ACR197W"
                     /old_locus_tag="ACR197W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL160C (DHH1)"
                     /codon_start=1
                     /product="ACR197Wp"
                     /protein_id="NP_983599.1"
                     /db_xref="GeneID:4619731"
                     /translation="MSEDWKKKLNIPKKDTRPQTDDVLNTKGNTFEDFYLRRELLMGI
                     FEAGFERPSPIQEEAIPIALARRDILARAKNGTGKTAAFVIPTLEIVKPKVNKIQALI
                     MVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRLNEPVHVLVGTPGRVLD
                     LASRKVADLSECSLFVMDEADKMLSRDFKSLVEQILSFLPQNHQSLLFSATFPLTVKE
                     FMVKHLNKPYEINLMDELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNST
                     NRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQA
                     VNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAI
                     PAQIDKSLYVAEDTSAVPVPFPLDTMQGNARAAQQMPHPQQQAQLGGMPQPIPQQIQP
                     PLAHQQAQPPPQVYPPQMYHQGIPPQQFANPPQF"
     gene            <697837..>698763
                     /locus_tag="AGOS_ACR198W"
                     /old_locus_tag="ACR198W"
                     /db_xref="GeneID:4619732"
     mRNA            <697837..>698763
                     /locus_tag="AGOS_ACR198W"
                     /old_locus_tag="ACR198W"
                     /product="ACR198Wp"
                     /transcript_id="NM_208953.1"
                     /db_xref="GeneID:4619732"
     CDS             697837..698763
                     /locus_tag="AGOS_ACR198W"
                     /old_locus_tag="ACR198W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR209C (PNP1)"
                     /codon_start=1
                     /product="ACR198Wp"
                     /protein_id="NP_983600.1"
                     /db_xref="GeneID:4619732"
                     /translation="MASFDINQERAVIQDAAEFLNGEITAHFGATCEFKPRVLIICGS
                     GLGGISHVISSNPQPLSVPYSAIPGFKASTIVGHAGDLLFGFMNKTPVVLMKGRLHGY
                     EGNTAQEITRPIRILNELGSIGVLVVTNAAGAVNPEFSACELMCINDHISFPGLCGFH
                     PLRGPNFDETGPRFLATSDAYDLKLRQLLFSKHKELGIARRLHEGVYAHVSGPTFESR
                     AESRLIRLVGADCVGMSTVPEVVVARHCGWRVLALSLITNCVVLSPAASALDTNPVPL
                     DLGKAEHSEVIVNAAAASADVEQLVEAVVGAL"
     gene            complement(<698886..>699773)
                     /locus_tag="AGOS_ACR199C"
                     /old_locus_tag="ACR199C"
                     /db_xref="GeneID:4619733"
     mRNA            complement(<698886..>699773)
                     /locus_tag="AGOS_ACR199C"
                     /old_locus_tag="ACR199C"
                     /product="ACR199Cp"
                     /transcript_id="NM_208954.1"
                     /db_xref="GeneID:4619733"
     CDS             complement(698886..699773)
                     /locus_tag="AGOS_ACR199C"
                     /old_locus_tag="ACR199C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR208W (SEC13)"
                     /codon_start=1
                     /product="ACR199Cp"
                     /protein_id="NP_983601.1"
                     /db_xref="GeneID:4619733"
                     /translation="MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIQIFEVDGDSHK
                     LVDSLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYEVHSASV
                     NSVKWAPHEYGPLLLCSSSDGKFSVVEFKENGTTSPIIIDAHAIGVNAACWAPATIED
                     DGQQSQHLRRIATGGADNLVKIWKYNPEANTYLLEDTLAAHADWVRDVAWSPSVLPRA
                     YLATVSQDRTCIIWTQENNQGPWTKTLLKEDKFPDVLWRASWSLSGNILALSGGDNKV
                     TLWKENLEGKWESAAEIEQ"
     gene            <700049..>700300
                     /locus_tag="AGOS_ACR199WA"
                     /db_xref="GeneID:9487598"
     mRNA            <700049..>700300
                     /locus_tag="AGOS_ACR199WA"
                     /product="ACR199WAp"
                     /transcript_id="NM_001355306.1"
                     /db_xref="GeneID:9487598"
     CDS             700049..700300
                     /locus_tag="AGOS_ACR199WA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR374W-A"
                     /codon_start=1
                     /product="ACR199WAp"
                     /protein_id="NP_001342248.1"
                     /db_xref="GeneID:9487598"
                     /translation="MYEPVSNYVLEELREQIPKISVRGEPESILLSCLYQELLSRVIE
                     ESKRFADRDSTKHITAEHLDEAVEALLGDVDRGADGAWP"
     gene            complement(<700329..>701663)
                     /locus_tag="AGOS_ACR200C"
                     /old_locus_tag="ACR200C"
                     /db_xref="GeneID:4619734"
     mRNA            complement(<700329..>701663)
                     /locus_tag="AGOS_ACR200C"
                     /old_locus_tag="ACR200C"
                     /product="ACR200Cp"
                     /transcript_id="NM_208955.1"
                     /db_xref="GeneID:4619734"
     CDS             complement(700329..701663)
                     /locus_tag="AGOS_ACR200C"
                     /old_locus_tag="ACR200C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR375C (BCS1)"
                     /codon_start=1
                     /product="ACR200Cp"
                     /protein_id="NP_983602.1"
                     /db_xref="GeneID:4619734"
                     /translation="MSGVSGVPQIDLEKVRNESDGSMGGMAKGLFRQVVEGNPYFAAG
                     GGLMVLGTTIAVLRKGVIRLSSLAYHQMLVDLEIPSKDKSYLWFLQWMAQHPSRSSRH
                     LSVETNYMQHNNGSVTTNISFVPGPGTHLIRYKGAFMLVKRERSGQIANFSNGTPFET
                     VKLTTLYRDRGLFTDLLQDAKRLAVKAQTGKTVVYTSWANEWRPFGQPKAKRMLSSVI
                     FDRGVKEAILGDVQEFLKNGSWYHERGIPYRRGYLLYGPPGSGKTSFIQALAGELDYN
                     ICIMNLADSNLTDDRLNYLMNNLPERSIMLLEDIDAAFVKRKKNDDGYTNGVTFSGLL
                     NALDGVASSEEMITFMTTNHPEVLDPAVLRPGRIDYKVLVGNATPHQIEQMFLRFYPD
                     DSALCAEFVAKAVALGVPVSTAQLQGLFVLNKNDAASALSMVETLKYPNHAF"
     gene            complement(<701797..>702507)
                     /locus_tag="AGOS_ACR201C"
                     /old_locus_tag="ACR201C"
                     /db_xref="GeneID:4619735"
     mRNA            complement(<701797..>702507)
                     /locus_tag="AGOS_ACR201C"
                     /old_locus_tag="ACR201C"
                     /product="ACR201Cp"
                     /transcript_id="NM_208956.3"
                     /db_xref="GeneID:4619735"
     CDS             complement(701797..702507)
                     /locus_tag="AGOS_ACR201C"
                     /old_locus_tag="ACR201C"
                     /experiment="RACE determination of 5' region of mRNA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR126C (IAH1); Newly annotated start codon"
                     /codon_start=1
                     /product="ACR201Cp"
                     /protein_id="NP_983603.3"
                     /db_xref="GeneID:4619735"
                     /translation="MDFKKFLMFGDSITEFAFNTRISPESGRDEFCVGAALTNAYTRK
                     LQVTQRGFSGYNSRWALKLLPQILATERDIVIAYVFFGTNDAAMDSVQTVPLVEYVRN
                     MTEMVQMLHAANIKVVLVGPALHDAHKWLRDESGSVTPGSRNNANNKLYSDALAGVAR
                     EQRTGFVDLHRAFSEAGGERWSDLLVDGIHYSGRGYEVFYKELMAVIDRTFPELSPDN
                     VPFRFPNWRDVAPDGSNL"
     gene            <702638..>704131
                     /locus_tag="AGOS_ACR202W"
                     /old_locus_tag="ACR202W"
                     /db_xref="GeneID:4619736"
     mRNA            <702638..>704131
                     /locus_tag="AGOS_ACR202W"
                     /old_locus_tag="ACR202W"
                     /product="ACR202Wp"
                     /transcript_id="NM_208957.2"
                     /db_xref="GeneID:4619736"
     CDS             702638..704131
                     /locus_tag="AGOS_ACR202W"
                     /old_locus_tag="ACR202W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR376W (ARH1)"
                     /codon_start=1
                     /product="ACR202Wp"
                     /protein_id="NP_983604.2"
                     /db_xref="GeneID:4619736"
                     /translation="MGLATIIARRAYGQCGRARKRVSIVGSGPSGFYTAVHLLTRATE
                     PLHVTLWESLPTPFGLSRYGVAPDHPEVKNCEDRFTELANRYHVAAQPGEHSFEFVGN
                     ITVGRDVALRELLAAEDAVVLSYGCSGDRRLGIEGEADTAGVFTSRQFVNWYNGHPRH
                     AQDAALSGFDWARVRRVGIIGNGNVALDIARLLLTAREEALWGQTDINPHALQALRRA
                     PLEEVRLIGRRDFLGSKFTNKELREMWELERCGVRGHIAPEHFTPEAWAALPLDRATK
                     RRIDMCQQYLLPYAARGSKSASKYPPPAEGYSKAWVSDYLKTPLYIRRDGAGAISALT
                     VCKNSLTPENKVVRHLDEQLDYELDVLITSLGYRGQPLPEFGALGVAFDADRVSNSRG
                     RVLRQDGSLIPGLFASGWIANGSRGVIMTTMMNSFAVGDEVLQYLAQSPPKDHSHGID
                     LRDSTHTTWADWIQIDKTEKQRAARGQPRQKLLSVAQMLEAARARDT"
     gene            <704284..>704641
                     /locus_tag="AGOS_ACR203W"
                     /old_locus_tag="ACR203W"
                     /db_xref="GeneID:4619737"
     mRNA            join(<704284..704340,704396..>704641)
                     /locus_tag="AGOS_ACR203W"
                     /old_locus_tag="ACR203W"
                     /product="ACR203Wp"
                     /transcript_id="NM_208958.2"
                     /db_xref="GeneID:4619737"
     CDS             join(704284..704340,704396..704641)
                     /locus_tag="AGOS_ACR203W"
                     /old_locus_tag="ACR203W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR377W (ATP17); 1-intron"
                     /codon_start=1
                     /product="ACR203Wp"
                     /protein_id="NP_983605.2"
                     /db_xref="GeneID:4619737"
                     /translation="MIAKRALSTLIPPKIVSPKNLTSAGSAKRIANVVELYKALPQGP
                     APVRQATGMIGKYRAKYFDGDNASGKPIVHFAIFVLCLGYSMDYYFHLRHHKGEGH"
     gene            complement(<704697..>704954)
                     /locus_tag="AGOS_ACR204C"
                     /old_locus_tag="ACR204C"
                     /db_xref="GeneID:4619738"
     mRNA            complement(<704697..>704954)
                     /locus_tag="AGOS_ACR204C"
                     /old_locus_tag="ACR204C"
                     /product="ACR204Cp"
                     /transcript_id="NM_208959.1"
                     /db_xref="GeneID:4619738"
     CDS             complement(704697..704954)
                     /locus_tag="AGOS_ACR204C"
                     /old_locus_tag="ACR204C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR378C (LSM6)"
                     /codon_start=1
                     /product="ACR204Cp"
                     /protein_id="NP_983606.1"
                     /db_xref="GeneID:4619738"
                     /translation="MSSAMQGPAVTSSSTFLSNIIGKPVNVKLHSGMLYQGTLESIDG
                     FMNVALVDASEYYESEQNPVIHRYESDVFLRGTQVMYISEL"
     gene            <705744..>708983
                     /locus_tag="AGOS_ACR205W"
                     /old_locus_tag="ACR205W"
                     /db_xref="GeneID:4619739"
     mRNA            <705744..>708983
                     /locus_tag="AGOS_ACR205W"
                     /old_locus_tag="ACR205W"
                     /product="ACR205Wp"
                     /transcript_id="NM_208960.1"
                     /db_xref="GeneID:4619739"
     CDS             705744..708983
                     /locus_tag="AGOS_ACR205W"
                     /old_locus_tag="ACR205W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR127W (RGA1) and YDR379W (RGA2)"
                     /codon_start=1
                     /product="ACR205Wp"
                     /protein_id="NP_983607.1"
                     /db_xref="GeneID:4619739"
                     /translation="MSVSHRGSIVSTATGGSSSRAGVVPSCTRCTLAITTGHAYELGG
                     DRWHTHCFTCYKCDKELTCDSDFLVLGTGTLICFACSDSCKGCGKKIDDLAIILSSSN
                     EAYCSECFKCCKCDRKIEDLRYAKTKKGLFCISCHERLLAKRKYAEEKKRRLQKELPI
                     VPGQAGATTGTSTPDREQFKIPVRSAARPVSPRRLSEPRRLSEPRRLSEPRRLSRRGS
                     STSENTVPSTKSTSYSAQRPDADSAASDVVRSNTSQGLGTVTTADTRSTSSLGPALDP
                     QERHIKSNSWSVVAQFLEDDDDGSDYGTNTDAPSINIDKHSSESPCATASADSTSDNG
                     KRNSAVQPAAKGIGTPPRESADDESSSREQDVRKRASKDSYDVVTPKSHTRNLSVDDV
                     LQRTLTKDYSESTSTIDNLAPPANDRPRRFPLNKTPLRNRDESPINGRSPVSHRRGLI
                     MSESGEFINELLASPNNVEHLKKDNVALSEHIDAPPLVKGLEDPVLQKDNTAGKHFKV
                     SGAFSFSPKLEVAAGTVGNQSHLTHSASSSSLDPKHVRPLNGTGNTSNTGTPNKMGSK
                     LARSASVRSKVASLIHGKKTPTRNQAPEGAYDTHTGWGVSSMSQQHPAGAATNSVGRK
                     LPPHGRGQSDSTIYNQFSPTLNTRPSFDHQRSHSGTTGATNVAIHMTPPLNTMDSPYS
                     NSVLERKMSVGRNHIVGRDALMENRTPTNEEFVRRDIISEELQLRQLKLEINDLQYTK
                     TQLTSEVDQLKKLKEHLQFQVDQLKTERKDLQNTGTSVESLDDVQEVVVKQAVTANTS
                     SNLKPRFWKFFSGKPSSSTGSASGSSGSGPSTGNPQIGISHPVLQNPNEFDDWNLKAV
                     NNGAELYGSSLESRVAFEGTDIPMIITTCMRHIESKVEYLTSEGLYRKSGSQLLIEQI
                     EGEFTQWKPNTPPPERLLEFLRQDIHAVSGVLKRYLRKLPNPLFTFEVYEPLMQLVRD
                     EKLSSSVPLKSAKSSPVYAPAIEKLAAILKTLPPEHLRVLSVICQHVNRVAQYQDANL
                     MNMNNLALVFAPGIIRDYTGEKDIIDMRERNYLIGFIFMNYEDIFAKIF"
     gene            complement(<709056..>709295)
                     /locus_tag="AGOS_ACR206C"
                     /old_locus_tag="ACR206C"
                     /db_xref="GeneID:4619740"
     mRNA            complement(<709056..>709295)
                     /locus_tag="AGOS_ACR206C"
                     /old_locus_tag="ACR206C"
                     /product="ACR206Cp"
                     /transcript_id="NM_208961.1"
                     /db_xref="GeneID:4619740"
     CDS             complement(709056..709295)
                     /locus_tag="AGOS_ACR206C"
                     /old_locus_tag="ACR206C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR379C-A"
                     /codon_start=1
                     /product="ACR206Cp"
                     /protein_id="NP_983608.1"
                     /db_xref="GeneID:4619740"
                     /translation="MVKRFSGLQKDVLHLYREFIRVAYTKAPENRPHFIGYIREEFRR
                     HKDLPRKNFVAIEHLLRVGKKKLALYSSPEIKDIR"
     gene            <709510..>711129
                     /locus_tag="AGOS_ACR207W"
                     /old_locus_tag="ACR207W"
                     /db_xref="GeneID:4619741"
     mRNA            <709510..>711129
                     /locus_tag="AGOS_ACR207W"
                     /old_locus_tag="ACR207W"
                     /product="ACR207Wp"
                     /transcript_id="NM_208962.2"
                     /db_xref="GeneID:4619741"
     CDS             709510..711129
                     /locus_tag="AGOS_ACR207W"
                     /old_locus_tag="ACR207W"
                     /note="NOHBY330; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E02596g"
                     /codon_start=1
                     /product="ACR207Wp"
                     /protein_id="NP_983609.2"
                     /db_xref="GeneID:4619741"
                     /translation="MLWIVRFSQCRLFSLPFVAAGLAPQLGEMMPLDPELAESHRIGY
                     VQWALCVVFFVWYLIVVAFATSGWYEIMTKFTSQMASQRLWDGAGTEEESEAAVSIIR
                     PCRGIEPEMAMCLESCIKQEYPPEKLEVLFCVESEDDECLPILTALLAQYPTRNLKVL
                     VGREAFGPNPKVNNLAKAYRSAQHDIVWILDSNVWAPPGMLRRSVASLAGSLDNGRKT
                     RRPVVLTHHIPLGIGLNAQSRSARLEEMFLFSSHAKFYVAFNKVGVAPCVNGKSNLYR
                     RSALNRAVQVLGDGAVTSALFRDDAIKRCARLNALKTANSVAHTHLPFTRITWAQNEL
                     RRTVVGPEQQQHSHGIEFFSTYIGEDNMIGTALWDMLGGRTGMTGQCVYQPLHYSVNH
                     DGLQNYFDRRVRWQRVRKYMVLAATLLEPTTESILIGLMGSYALPRLLAAAHPTTAAF
                     AYFVLHMAAWCYMDRIQYNTLVRTLDPTIAFGHRYPAASYERPFYNWLQYWLLREVLA
                     FPIWIKAMSGSVINWRDRPFRIKPDLTAESL"
     gene            <711699..>714320
                     /locus_tag="AGOS_ACR209W"
                     /old_locus_tag="ACR209W"
                     /db_xref="GeneID:4619743"
     mRNA            <711699..>714320
                     /locus_tag="AGOS_ACR209W"
                     /old_locus_tag="ACR209W"
                     /product="ACR209Wp"
                     /transcript_id="NM_208964.2"
                     /db_xref="GeneID:4619743"
     CDS             711699..714320
                     /locus_tag="AGOS_ACR209W"
                     /old_locus_tag="ACR209W"
                     /note="NOHBY332; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E02618g"
                     /codon_start=1
                     /product="ACR209Wp"
                     /protein_id="NP_983611.2"
                     /db_xref="GeneID:4619743"
                     /translation="MLQMALMHRPNEKRKVARRACLACRDKKIRCDGEARAERGGDPA
                     VCSNCALQRLECVFVRSQRGGRRPPKKQLPHTKFLLQTFGPMRMAEAKLDRGASRVRL
                     APPFTQSRSRDCMDDELRDPRYCLQVAPLETAAPSTPMREFSTASNLGRCQRYLLPPH
                     VPHSGPRSSPVAQPGQCMQPPVSGGTAFPKLPIEQPMPPHAAFHPSTCAASLKPSRRA
                     SLGVGSSPSAFPLPFTSHAVRPMTMTNPAVQLMSSKDSAAGSTQCRSSCNTDTRLSPF
                     TSSMTLNTVHNNTVRSSDAAQYSVGRYHADFGSLPSEVVEQCIDAYYIYVEPHLRLLS
                     DSEERPENVGTLNSAVQSAIFLCASPYVKHSITYDSAYFLDMLRKSWHKLENEYAIVQ
                     HVLLLCYFYLNHTPLSGNCKSTIEKLIRILILGKVPDSLARKHTDMQLAQFVPRAMAE
                     NCAHMLQLLCRVFYLLQKIMLFSQDSKWLASLLSSLNVDNLMKAFIPVGVPTSYKYTG
                     KLFSTKSHLPSTEHMLHVLYSSWQEGRIPNNEFIGTLQQMQPSINANVYRLGDMNTIH
                     LQSISNLNVKVVSDSMLLRYLSCCSRDGIKFQLDLRAPDSDVSMQSAHGFLTRILSDL
                     DAWTIRQLLLQLFILADILYSLGLAANGMPSTRLPDMKSRYNMSQPSRSKRSNAISCS
                     SSNSPLSTEETHGFRTEVWCDEEYISKKSILQLEESNSSTEMLHGDGSAGEAVGVSCG
                     PYPEFFDNLLVDMLPTLVVIILLFSNYVVPQYAGGKWTFKSPAKRRIPIGDMTFNGEF
                     KDICSGTLLFHTIPAEDITQDVVFQMLDTIINGRSILCQLRSYADTVVVKSQRLNYNS
                     AISRNLTKLLALLGAVV"
     gene            complement(<714553..>716250)
                     /locus_tag="AGOS_ACR210C"
                     /old_locus_tag="ACR210C"
                     /db_xref="GeneID:4619744"
     mRNA            complement(<714553..>716250)
                     /locus_tag="AGOS_ACR210C"
                     /old_locus_tag="ACR210C"
                     /product="ACR210Cp"
                     /transcript_id="NM_208965.1"
                     /db_xref="GeneID:4619744"
     CDS             complement(714553..716250)
                     /locus_tag="AGOS_ACR210C"
                     /old_locus_tag="ACR210C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR128C (ADE2)"
                     /codon_start=1
                     /product="ACR210Cp"
                     /protein_id="NP_983612.1"
                     /db_xref="GeneID:4619744"
                     /translation="MDHRTVGILGGGQLGRMIVEAANRLNVKTVVLDGPNSPAKQINA
                     VGEHVEGSFGVAADIEELAQRSDVLTVEIEHVDVGTLRGLQAKMPSLTIYPTPEAIEL
                     IQDKHVQKEHLSGHGVAVAESIAVEGTEPALVAVGEQLGYPYMLKARKLAYDGRGNFV
                     VKSRDSIAEALETLADRSLYAERWAPFVRELAVMIVRSPEGQLFSYPMVETVHQNNIC
                     HLCYAPARVADSIQLRAKLLAERAVATLPGAGIFGVEMFLLEDGELLVNEIAPRPHNS
                     GHYTIDACVTSQFEAHLRSILGLPMPRGFSSMATSNTHAIMLNVLGDPQVKDKELAIC
                     ERALETPGASVYLYGKESKPKRKVGHINIVASSMQEAERKLRFITGGAVSLEEDGHNP
                     QGDASPLVGIIMGSDSDLPVMSKACEILTQFGVPYEVTIVSAHRTPHRMSKYAIEASE
                     RGIKAIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSVLDGVDSLHSIVQMPRGVPVAT
                     VAINNSTNAALLAVRLLGAYDTKYHALMQQFLLKQEEEVLGKAEKLETIGYRAYLDQ"
     gene            <716697..>718586
                     /locus_tag="AGOS_ACR211W"
                     /old_locus_tag="ACR211W"
                     /db_xref="GeneID:4619745"
     mRNA            <716697..>718586
                     /locus_tag="AGOS_ACR211W"
                     /old_locus_tag="ACR211W"
                     /product="ACR211Wp"
                     /transcript_id="NM_208966.2"
                     /db_xref="GeneID:4619745"
     CDS             716697..718586
                     /locus_tag="AGOS_ACR211W"
                     /old_locus_tag="ACR211W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR380W (ARO10)"
                     /codon_start=1
                     /product="ACR211Wp"
                     /protein_id="NP_983613.2"
                     /db_xref="GeneID:4619745"
                     /translation="MKPIGLTGMGLQSAGDSGEELKSGWMPAEMPLGEYMFRRLMSAG
                     TKTVFGVPGDFNMGLLEHMYGEAVCAEGLQWIGTCNELNAAYAADGYSRYCNKIGCVV
                     TTLGVGELSALNGVAGAFAEHVKVLHIVGVSMRAAQTHPELHGNVHHLVPRLRNSNFE
                     APNHKVYSEMVSGRVSCCCEFLEDLETACDQIDHVIREIWRHGKPGYLFVPADMPNMK
                     VSSRNLVQAPTIMLESAVLERTNLAACDRIGIEILQHLYQSSTPAILCDGLCDRFGLT
                     GDVRRLVELTGMWNFSTIMGKSILDETQPHYKGVYYGAGSKERNALLQECDLILYLGP
                     VKDEVNTWKYTFQFNPQSMIIELHPEYVSLTRNGEQTILNSGHLLPVLRSILAHLNVA
                     NLSFNYPTAKKRVPREHQYAADEPITQGMLQHMIPECLNPGDVMVVDTGTFQFSVFDM
                     KFPTDLKCISQSFYLSIGMALPAALGVACAMREFPRLHLGPKLANEGYTPRLVLCEGD
                     GAAQMTIQELSTFIRYELPVEVLLWNNDGYTVERVIKGPTRSYNDIMSWDWTKLLRVF
                     GDFDGTRSESVRVKDFNSLIEHLSSWKSDKKRSKIRLMEVILDKMDISATLKELAKQF
                     QHNAA"
     gene            complement(<718782..>721646)
                     /locus_tag="AGOS_ACR212C"
                     /old_locus_tag="ACR212C"
                     /db_xref="GeneID:4619746"
     mRNA            complement(<718782..>721646)
                     /locus_tag="AGOS_ACR212C"
                     /old_locus_tag="ACR212C"
                     /product="ACR212Cp"
                     /transcript_id="NM_208967.2"
                     /db_xref="GeneID:4619746"
     CDS             complement(718782..721646)
                     /locus_tag="AGOS_ACR212C"
                     /old_locus_tag="ACR212C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR129C (AFI1)"
                     /codon_start=1
                     /product="ACR212Cp"
                     /protein_id="NP_983614.2"
                     /db_xref="GeneID:4619746"
                     /translation="MVSRMGPLGSGGQGQGRTGPGLQQAPTVVRNGPMRRAGRGEATR
                     EPATNVEYILAAEFDNKLGPVLKHQFPKNLPGFKSTNSNLSNLAGLMIPNGIENRPGE
                     SDFTTFILYKDRYAQTFQLFPNDNAKGSLKPTAESHGHLGGSPSSRLESMILEEDENA
                     GSSKTSLSQAREIPLFFINVVHAKIDNANERGAVIKSLAVGTSLQNFFIFKPLLMMAL
                     DEYIKMPNIRILIECFNMINSLDLSLMNRIHSNKVLQNILNSINNDEIINEIFDPEEK
                     SLKHILRVNELPKHDVNGNSIVFKQGAMVYRFDSFKPQVLPEHFTKIPLQIDLIKYDA
                     IKLNINYKDHVLKFLRQFIPQISLLDRNDPSWRLMVNSTTLSKDSLCQFVLALSNFIN
                     AFDHQHYFQNSSVIIFPYMDISMIDELRNEFSVKKTGNYFSIVGVSNPIFEMQKDVWD
                     FYYDLDSATLLTQAKPSKMNPVTIIGSTNPQNNRSSELLMKIFNKHPTSHVTIKQETP
                     KMGLLLKFIQYIVLQQHDNQTVLNVFKRVIILQLIHLFSRLNHDSGPSIELLLKDEYM
                     LTYKDFIMFPEFFEYSSLKCIRLMHNLETCLQHVFFPKNRSREVRKRVLTQLYGHLKN
                     IYKFMSVNKAHMGRFLNVCLNYPLTHPFETFDLEKSDFSKINLTIALRHEMKHTEALD
                     GLCYAQSNIIDYFSLDKGLSLVFYPLLINPTADTFAASSDPTNSNSVKESPQSNHSRV
                     STEIRGTSAASNHQSENLSVISSIYENNIDIESAYSMRDDVTTVTCTAQEDLVQLVEK
                     IRRLTIKILLRIERHHIGNMLINKKLNPIFPLTYRTLKKEYFPVSPRRSANDDTVSGA
                     PADLYIAPGTPLSGSAGVTKSEITISPQRKELLQELSLISTAQQDALSVGNKTETTSM
                     QSKLELLQSLTNLELVTVRNTESPDPEVTSGTSSDVAGKA"
     gene            <722729..>724873
                     /locus_tag="AGOS_ACR213W"
                     /old_locus_tag="ACR213W"
                     /db_xref="GeneID:4619747"
     mRNA            <722729..>724873
                     /locus_tag="AGOS_ACR213W"
                     /old_locus_tag="ACR213W"
                     /product="ACR213Wp"
                     /transcript_id="NM_208968.1"
                     /db_xref="GeneID:4619747"
     CDS             722729..724873
                     /locus_tag="AGOS_ACR213W"
                     /old_locus_tag="ACR213W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR057W (MNL2)"
                     /codon_start=1
                     /product="ACR213Wp"
                     /protein_id="NP_983615.1"
                     /db_xref="GeneID:4619747"
                     /translation="MAGALVALARRTRSVLVFATTALILFYYTVENQIDMLNSYAQTE
                     HLPQISKASGDSAPTPPDDLADPVQLVAKNRYFPLLLDTWRDAPQVHDTAEVRRRAPR
                     YDTLHAKVEIRERPARGMRGRVQAPVHLLEADDDRLRAIRDAFMQDWQQYKRLAWGHD
                     GMQPLSAQPYDTTGLATTMILSLEMLYLVGATDDAEAVLQFLGGFEFHADKMPADWNA
                     TSDPTLGALIGAYELSHEPVLLSKAVELADIILEAFNTPSGAAMAPLDVRSPLQNRHP
                     YRRSALAHLAGVSVEFARLTQLTRDQKYFNSIYGLYDLAANSEDEFDLEGLVTDYVDP
                     SGCEITTSEIRGIKSIFQGRYIGCKLVRRLRPAVGARGSSDAEGIQYYSWDGLAAWCR
                     SLQDLALIVTDPELSAAFKNTLKAALEAIMNNMIFRPALPESAAASEPDEPLFVSAVR
                     TWSYTDASTGTDVVKVMREFDMTDASCALSGVLALAGAALFVDDSKYKSTANGIMEGC
                     ARLQQLLGTPVERVYVDPCDAADCYFDADKKSQLLSEGYYRKQGDHNDLLDGVKLTKS
                     GAARITGAKKYIFVDTERSYDRDLESWDPARPLFVNDWELLQSPEGHMIESLFYMFRL
                     SGDSKLRLRAWEHWEALVKLHTAVGAKGVAERKPSAFRNILAGEREDILPPEWFSKSL
                     KYLYLMFSDGLKVGNLDDWVITAKGNMFRKTI"
     gene            complement(<724983..>725915)
                     /locus_tag="AGOS_ACR214C"
                     /old_locus_tag="ACR214C"
                     /db_xref="GeneID:4619748"
     mRNA            complement(<724983..>725915)
                     /locus_tag="AGOS_ACR214C"
                     /old_locus_tag="ACR214C"
                     /product="ACR214Cp"
                     /transcript_id="NM_208969.1"
                     /db_xref="GeneID:4619748"
     CDS             complement(724983..725915)
                     /locus_tag="AGOS_ACR214C"
                     /old_locus_tag="ACR214C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIL119C (RPI1)"
                     /codon_start=1
                     /product="ACR214Cp"
                     /protein_id="NP_983616.1"
                     /db_xref="GeneID:4619748"
                     /translation="MNKDQLQIGTCRNGAGVSGAGGAHDHASTIKLPPLTNHHMQQFS
                     EVNNGQGFPGRPVISSPSGQTQQFGSGTIAPQAISGGSVASATPQDSFEGSNSYKLPK
                     YARTTWKPHEDISLLRILLNSKQQLSDPQFISSPRRKFWQWISDQLYRESHISRNTRQ
                     CRDRFNLLYKKTSKRFATQPPPPPQDELEKLLKMLLESFAFNPEGNIILCEQRAPSSA
                     SSSSSSTVVMAPSSQNQYSQDGQVMPFPSYQQCSGNNSQSSAVPGPGMNEPLVQIIHN
                     LSAEVSSLRQEVTQIKQLLTRKSCSDSSPSIPNW"
     gene            complement(<726871..>728280)
                     /locus_tag="AGOS_ACR215C"
                     /old_locus_tag="ACR215C"
                     /db_xref="GeneID:4619749"
     mRNA            complement(<726871..>728280)
                     /locus_tag="AGOS_ACR215C"
                     /old_locus_tag="ACR215C"
                     /product="ACR215Cp"
                     /transcript_id="NM_208970.2"
                     /db_xref="GeneID:4619749"
     CDS             complement(726871..728280)
                     /locus_tag="AGOS_ACR215C"
                     /old_locus_tag="ACR215C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR058C (SHM2)"
                     /codon_start=1
                     /product="ACR215Cp"
                     /protein_id="NP_983617.2"
                     /db_xref="GeneID:4619749"
                     /translation="MPYHLSESHKKLISSHLSESDPEVDAIIKDEIDRQKHSIVLIAS
                     ENLTSTAVFDALGTPMCNKYSEGYPGARYYGGNQHIDRMELLCQRRALEAFHVTPDRW
                     GVNVQSLSGSPANLQVYQALMKPHERLMGLHLPDGGHLSHGYQTETRKISAVSTYFES
                     FPYRVDPETGIIDYDTLEKNAVLYRPKILVAGTSAYCRLIDYKRMREIADKVGAYLMV
                     DMAHISGLVAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGVRSVHPKTGEEVM
                     YDLEGPINFSVFPGHQGGPHNHTISALATALKQATTPEFREYQELVLKNAKVLETEFK
                     KLNYRLVSDGTDSHMVLVSLREKGVDGARVEHVCEKINIALNKNSIPGDKSALVPGGV
                     RIGAPAMTTRGMGEEDFARIVGYINRAVEIARSIQQSLPKEANRLKDFKAKVEDGTDE
                     IAQLAQEIYSWTEEYPLPV"
     gene            complement(<729208..>729957)
                     /locus_tag="AGOS_ACR216C"
                     /old_locus_tag="ACR216C"
                     /db_xref="GeneID:4619750"
     mRNA            complement(<729208..>729957)
                     /locus_tag="AGOS_ACR216C"
                     /old_locus_tag="ACR216C"
                     /product="ACR216Cp"
                     /transcript_id="NM_208971.2"
                     /db_xref="GeneID:4619750"
     CDS             complement(729208..729957)
                     /locus_tag="AGOS_ACR216C"
                     /old_locus_tag="ACR216C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL031W (HAC1)"
                     /codon_start=1
                     /product="ACR216Cp"
                     /protein_id="NP_983618.2"
                     /db_xref="GeneID:4619750"
                     /translation="MTSHTVNDIPADFKSTLPPRKRAKTQEEKEQRRIERILRNRKAA
                     HQSREKKRLHLLYLERKCALLERIVAHVDLGALVAARGDAALGRAVTEYEAVAREGSG
                     TPSFAITLADERSDKDEGAGLSAATTPSVKSPCASGATPGSPCTTVGEEAFGRRDFVL
                     EAKPEPLAAESYSYGAFAPAYEEGPRAFGGRPAASESWNLLLTQSQNYPLGGSSIFKD
                     DLNEPFELTDSSVDFDHWRNPAAVVQWKRRV"
     gene            complement(<730478..>731155)
                     /locus_tag="AGOS_ACR217C"
                     /old_locus_tag="ACR217C"
                     /db_xref="GeneID:4619751"
     mRNA            complement(<730478..>731155)
                     /locus_tag="AGOS_ACR217C"
                     /old_locus_tag="ACR217C"
                     /product="ACR217Cp"
                     /transcript_id="NM_208972.1"
                     /db_xref="GeneID:4619751"
     CDS             complement(730478..731155)
                     /locus_tag="AGOS_ACR217C"
                     /old_locus_tag="ACR217C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR059C (REX2)"
                     /codon_start=1
                     /product="ACR217Cp"
                     /protein_id="NP_983619.1"
                     /db_xref="GeneID:4619751"
                     /translation="MLRLRRQLRRICLSRPARRANPYLAPGELYKPIVWIDCEMTGLD
                     HTSDHIIEVCCLVTDGHLNPVDDGYESVVHASAAALAAMDAWCTQHHGASGLTARALA
                     CPKSAAQVEAELLAYIRRLVPRPGRAVLAGNSVHMDRLFMLRDFPAVVAHLSHRIIDV
                     SSLAEVCARHNPALHAATPRKRAAHTARADILESIAQLRWYRAHYLVPPEMTCTSADD
                     PASPTPT"
     gene            <731432..>736138
                     /locus_tag="AGOS_ACR218W"
                     /old_locus_tag="ACR218W"
                     /db_xref="GeneID:4619752"
     mRNA            <731432..>736138
                     /locus_tag="AGOS_ACR218W"
                     /old_locus_tag="ACR218W"
                     /product="ACR218Wp"
                     /transcript_id="NM_208973.2"
                     /db_xref="GeneID:4619752"
     CDS             731432..736138
                     /locus_tag="AGOS_ACR218W"
                     /old_locus_tag="ACR218W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL033C (RIM15)"
                     /codon_start=1
                     /product="ACR218Wp"
                     /protein_id="NP_983620.2"
                     /db_xref="GeneID:4619752"
                     /translation="MSEADVWQQAATAGRGAEQAHREARDADSASTSSVDSVNYLQYL
                     EKATAKNPSVLLELDPDGNVKYVSQVWETVVGTRCAEVVGRPVSEVILGGDQDKLVFQ
                     KAVAMMCQDDRSCRVRFLTALGPERAAADGEAVVELEAQGTLIHDGEISSLPAHSMWI
                     VKPFYEVDELDDLPPDFVKRLGFGAKLFSHYLQQIEDLEVLDEQELPTPKCELCRVCE
                     TLVPAWWLETHSEMCVCEHRIESAVQLIHDELVELKRLIEDLTGALGQPGAAAEYKGL
                     ALPQPDPSDLGPAKQAPVMLHPSLSCPNLSDDEHNPFRRASRSGKDARSLFHHVRFPF
                     KQLSLLSDLCEDAININTSELLDADVREQDSPYGLLNMQSVTYRFSPNTKNNIDHVTA
                     WDAQLGVDDPAINLLTQDTVELVKRKVEMVLRLDNTMRHSLKIKHEVDCQVVNLIKDK
                     IESNKINLQADETMQDLGQAAQPLFGTSCSPSSSRIATPLPQRPQSRILTDSYMASSS
                     VTDLKAVMNVGMPPLDYTSRSNSGSHPLSRSITPRQAITDHSSSAYQLPLTVSNSNTS
                     GGTPVDTKPPTIGTPRASSTSQCNLPKLSTIINLTPRRGSPLSSVGMNTPFSTIQRKS
                     TVKSIGEKSPMSSPFMVGSDLLSPEGHLPSATAPKPPLSPLLLATNQAKAPTPSIKDY
                     DIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQSEK
                     PYVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYITEVIIGVDDMH
                     MSGIIHHDLKPDNLLIDSNGHVKLTDFGLSRIGLIQRHKKHHSRHCSIQAVTSKSRHN
                     SLTPDEALEQNGAVTCTPSNLLEGLMVSRRGERSDSISSSHSQLDAQTLHRTGSQVSF
                     SIMDISRSGTPPPPLPAPIASLQNQLSQQPGQQQHSHMNQPQQLSLAPSSSGSMPKRS
                     ASVFSSDNSDTSRDFALFHPDEDGSRRFFGTPDYLSPETILGTGESGASDWWSVGCIL
                     FEFLLGYPPFHASTVEDVFKNILSGQIDWPSFPNKETELEYLSPEAKDLILKLLESNP
                     EERLGANGAQEIKEHPYFKGINWSKVYDEEASFVPTVDNPEDTDYFDLRGADLDELLR
                     DNYGEDDLQSTSGMHTPNSSMRTDKKQPSNHSSGNSTPVPKMSIASVFDPLSQDNTSS
                     NSNSPILKHIPLAIPPHLRERRPSKLNDIQTEFGSFSYRNLSALDKANKDTINRLKSE
                     HYSDHHHVRASPGSLSSSSSEASSKLKAANPGSSASSPICNNAGKGTFSRAGSPQMAR
                     THSPSRRNSIEQSAAPGAGTITQRRHTWDHHITLDNDYPPPGPPITKFKSPLSPTQNM
                     GTSRSRMQSRTSSQRTSISEISMEDDERHIALSKVNTLRSRRRSGRKSSSGTSEVGYN
                     MDVLLCEPIPIHRYRLTRDLESLGCSVVAVGTGDEIVRRATSGVRFDLIITTLKLPKI
                     GAVDITRLLRQTTSINCTTPIVAVTVNYHDAGTHIFDDVLERPIGTEQLRKLVSKYAL
                     FKSQQHEDTILSDSEM"
     gene            <736511..>738298
                     /locus_tag="AGOS_ACR219W"
                     /old_locus_tag="ACR219W"
                     /db_xref="GeneID:4619753"
     mRNA            <736511..>738298
                     /locus_tag="AGOS_ACR219W"
                     /old_locus_tag="ACR219W"
                     /product="ACR219Wp"
                     /transcript_id="NM_208974.2"
                     /db_xref="GeneID:4619753"
     CDS             736511..738298
                     /locus_tag="AGOS_ACR219W"
                     /old_locus_tag="ACR219W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR060W (FRS1)"
                     /codon_start=1
                     /product="ACR219Wp"
                     /protein_id="NP_983621.2"
                     /db_xref="GeneID:4619753"
                     /translation="MPTISVYKQQLFDLLGKNYSNEEFDELCFEFGIELDEDTTEEAL
                     KNNEEPELKIEIGANRYDLLCIEGIAQSLNEYVGRAETPKYKLAAPTTKLYIEPSTEQ
                     IRPYAAAAILRNIKFDERSYASFIALQDKLHSNLCRNRTLVAMGTHDLDSIQGPFHYK
                     ALPPTDFKFVPLFQSKELTGKEVVDLYKTPEQKNNLGRFVHIIENSPVYPVIFDSQDQ
                     VCSLPPLINSERSKISIDTRNVFIEVTATDRTKAEVVLNQLVAMFSRYCEDKFSVEAV
                     EIVSEHNNESRITPNFTERKINVSAEYINSCLGLQLSLEEICACLKKMSLHGKPAGND
                     KDTIEVSIPITRPDILHPCDVLEDAAVGYGYNNLPKHNKLSNANFVAAPLPINKVSDI
                     FRIASSQASWLEVLPLTLCSHDENFKFLRLEDDGTTAVKLANPKTAEYQVVRTSLLSG
                     ILKTVRENRKQALPIKVFESGDVVFKNPALERKAYNERHWAAVYVGKNSGFEIIQGLL
                     GKIMQTFRTSWLPDYGKDSDGRGYWIEEDTSIPTYFPGRGAKVMFRSRQGAEVKQIGH
                     LGVLHPEVMNNFEIPYAGSYVELNSEVFL"
     gene            complement(<738425..>741274)
                     /locus_tag="AGOS_ACR220C"
                     /old_locus_tag="ACR220C"
                     /db_xref="GeneID:4619754"
     mRNA            complement(<738425..>741274)
                     /locus_tag="AGOS_ACR220C"
                     /old_locus_tag="ACR220C"
                     /product="ACR220Cp"
                     /transcript_id="NM_208975.1"
                     /db_xref="GeneID:4619754"
     CDS             complement(738425..741274)
                     /locus_tag="AGOS_ACR220C"
                     /old_locus_tag="ACR220C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL034W"
                     /codon_start=1
                     /product="ACR220Cp"
                     /protein_id="NP_983622.1"
                     /db_xref="GeneID:4619754"
                     /translation="MGRRDDNLTSGLRELKIGSGSHIVKGAAGSALPSAERRGGEHMR
                     STKDVADQGIDVPSMVKRALSDSRRRSKLRAANSGDASACSASPQEQESPRSSVAPVT
                     PATSTLETVYQEAESSDEDWQPMPAIASYDVYDERGELAVTRLSDSPVDISGMDSAAS
                     LDSSVRGKDCGAFGYTKAAGEEQAQRAYATNKKTDFLFRKTAAGSSMGSAVAEDITIY
                     DDRDSTPVGIRSAGEQLVLTKTLLNDRAKFAYLGAVTVLANQTCTNLAELCLCSKNVT
                     SSKKLAHRLHILQKNMGVWQSTICQRLYAHLGVSAEEIEMIQKLPMHGIRLQDLCKCL
                     KTTQVIENPWMKSGDDIMMPDEVKKNQTLEIDVSWTIICDLFLLLVHDSVYDSRSRTL
                     LMRFAEVLDISRGDICEFEKRVIDTLDLEQSTDEQVWIEKNHMHERRKENRKKKLAYV
                     GLVTIGGSLVLGLSGGLLAPVIGASLAAGLSTIGVTGAAGFLTGAGGTAIVAVSSTAI
                     GGNIGRKAMNKRMGSVKTFEFRPLHNNRRLSLIVSVSGWMIGKEDDVRLPFSPVDPIE
                     GDLYSLHWEPDMLKSTGQTINILASEIVTQTIQQILGATVLTALMAAIQVPNLLSKLG
                     YIIDNPWNVSLDRAWAAGLILADTLMAQNLGARPISLVGFSLGSRVIYSCLLELSKQG
                     AIGLVEDVYLFGSPLVYNRDEMVMARAVVSGRFVNGYSDKDWILGYLFRVTAGGLKTV
                     AGISPIEGIEGIENMNCTELVEGHMAYRKNIPSLLKRLGVAVLSEEFTEIDDSPDPEQ
                     VKRERKLIHDLQDVQDKLANKKDKKQKGTWVSKWFKPKREQWQEMYEDSLRNNAAAAT
                     TTNGAVAPTVQSEQSCQTLEDASPIIDTDALVEELQYLKEVVDKEMTNYKDVNDLMKD
                     VAEHAQRGLRRTDIALSDDEFGNEENVTYAFADDI"
     gene            <741589..>742154
                     /locus_tag="AGOS_ACR221W"
                     /old_locus_tag="ACR221W"
                     /db_xref="GeneID:4619755"
     mRNA            join(<741589..741600,741807..>742154)
                     /locus_tag="AGOS_ACR221W"
                     /old_locus_tag="ACR221W"
                     /product="60S ribosomal protein L22"
                     /transcript_id="NM_208976.1"
                     /db_xref="GeneID:4619755"
     CDS             join(741589..741600,741807..742154)
                     /locus_tag="AGOS_ACR221W"
                     /old_locus_tag="ACR221W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR061W (RPL22A) and YFL034C-A (RPL22B); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L22"
                     /protein_id="NP_983623.1"
                     /db_xref="GeneID:4619755"
                     /translation="MAPNTSRKQKITKTFTVDVSSPTENGVFDPASYAKYLVEHIKVD
                     GHLGNLGNAITVEENGTTVTIVSTAKFSGKYLKYLTKKYLKKNQLRDWIRFVSSKTNE
                     YKLTFYQVTPEDEEDEE"
     gene            <742309..>743247
                     /locus_tag="AGOS_ACR222W"
                     /old_locus_tag="ACR222W"
                     /db_xref="GeneID:4619756"
     mRNA            <742309..>743247
                     /locus_tag="AGOS_ACR222W"
                     /old_locus_tag="ACR222W"
                     /product="ACR222Wp"
                     /transcript_id="NM_208977.1"
                     /db_xref="GeneID:4619756"
     CDS             742309..743247
                     /locus_tag="AGOS_ACR222W"
                     /old_locus_tag="ACR222W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR063W"
                     /codon_start=1
                     /product="ACR222Wp"
                     /protein_id="NP_983624.1"
                     /db_xref="GeneID:4619756"
                     /translation="MSKALPVHHSGTLPPQQLADLFKDAFRGELYGEHQDELAETVQQ
                     VKGDLYNRDYIAAFDSQEKRAAYCCRWSPSRAVAYSSLFAHLAPVRNVLTCAGGTSRN
                     VLCVGGGAGGELVAAANLFTATRDFDARHRPDAPADANAARLAIRIVDIADWSAVVDR
                     VAAAVRSSWLFHLAPALDVAFAHTDILQPAASLGLPSLDLLTLLFTTNELFLENRAAT
                     VRLFQRLNAECRSGCLLLIVESAGSYSHITVGSKKFPVQFLIDTLLLGPRGREAGGPW
                     TLLSESDALWYRGDPAVDYPVKLENMRFFYRLYVKK"
     gene            <743500..>744356
                     /locus_tag="AGOS_ACR223W"
                     /old_locus_tag="ACR223W"
                     /db_xref="GeneID:4619757"
     mRNA            join(<743500..743522,743588..>744356)
                     /locus_tag="AGOS_ACR223W"
                     /old_locus_tag="ACR223W"
                     /product="ACR223Wp"
                     /transcript_id="NM_208978.1"
                     /db_xref="GeneID:4619757"
     CDS             join(743500..743522,743588..744356)
                     /locus_tag="AGOS_ACR223W"
                     /old_locus_tag="ACR223W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL034C-B (MOB2); 1-intron"
                     /codon_start=1
                     /product="ACR223Wp"
                     /protein_id="NP_983625.1"
                     /db_xref="GeneID:4619757"
                     /translation="MSFFNSLKGLGRTSKKNKSSPTRPPQTSVSGSVYGSPQANGSRM
                     SVSKARSPTQRSVVQAAAADKVESQQVMFLSEPFVRTALVKGSFKTIVQLPKYVDVGE
                     WIALNIFEFYTNLNQFYGVIAEYVTAEAYPTMNAGPRVEYLWLDANSRQVALPAGQYI
                     DLALTWINNKVNDKTLFPTKSGLPFAQHFIRDMQRIMIQMFRIFAHIYHHHFDKFVHL
                     SLEAHWNSFFAHFVSFAKEFNLLDRKEMAPLELLIESFERQGKII"
     gene            complement(<744585..>748472)
                     /locus_tag="AGOS_ACR224C"
                     /old_locus_tag="ACR224C"
                     /db_xref="GeneID:4619758"
     mRNA            complement(<744585..>748472)
                     /locus_tag="AGOS_ACR224C"
                     /old_locus_tag="ACR224C"
                     /product="ACR224Cp"
                     /transcript_id="NM_208979.1"
                     /db_xref="GeneID:4619758"
     CDS             complement(744585..748472)
                     /locus_tag="AGOS_ACR224C"
                     /old_locus_tag="ACR224C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL036W (RPO41)"
                     /codon_start=1
                     /product="ACR224Cp"
                     /protein_id="NP_983626.1"
                     /db_xref="GeneID:4619758"
                     /translation="MLRNYRAFKGGNLLRHGARHWASRPPVGAAMVTGVGVTHLALSG
                     ARSTSTASPANDMNVSFERSSSVSISPDFALFDTTDAPILASQRSNVMNQWALLEACL
                     CTGYLDRAFKILKSLYSIDSHRPYFMNDYNSYLLRYCEENQPKSDASVQELRQKVFDD
                     ISKHFPEVQLNAKSAAILVRYALSANPYSAQKEDVRTLMEFATSRKQLLEHNDVLRVQ
                     DYASLCKMGLCDLKHVPIVTRSLVQDSLGVSSTDKSVEVVEEEPELVSAESEDLLSED
                     IKSLDKNAAELRSVGTFGMRAVRHSLLGLELGEKQRERLSGLAVDPLLKASMPAENGI
                     DFFEIYKSLETDKERQAFDSFLEDFNSERQCDLESRSVTAAKQRWKHEFAEAQARGAL
                     SVQRSLNAQLWEWYLGMIPLLKEEVKACRELLASDILLTERRPHIRSRLEYAPYITLV
                     NPEKMCVITILELLSLNSTGGVSEGMRTTRAVLAIGKAVEMEYRSEALLKSEKSIFKE
                     VRANSNEFKKLVQRAKTTFRNTQIEESKVLWPHNIKAKVGSLLISMLIHVAKVNVKGV
                     DPVTNKTVYGKAPAICHTFQYRMGSKVGVLKLHRSLANQMSSDRLSANFQPQHLPMLV
                     KPRPWTSWNSGGYLFTKSTLIRSKDSPEQSAYIKAVTGKGVVQNVYKGLNVLGETAWT
                     VNKNMLHIISKVWNSGTEFLDIPPQQDELLLPAKPRGEDGSEPEPIVLKRWKQECRFL
                     NAEYQKHRSMRCDANYKLEIARAFIGEKFYFPHNMDFRGRAYPLAPHFNHLGNDMTRS
                     LLIFWEGKRLGKEGLRWLKIHMGNLYGLDKQTFEARVAFTEAHLEDIKDSAENPLNGK
                     GWWKKADKPWQCLATCMEINNAYKLSNPEDYVSHQPVHQDGTCNGLQHYAALGGDIEG
                     ARQVNLVPSDKPQDVYAFVAKLVTERLEKAALEGDQNAAQLKNLITRKVVKRTVMTNV
                     YGVTFIGATNQIDKELQDAFPDNSYDMARYLTKHVFNSIRELFHAAHLIQDWLGESAK
                     KISKSIRLDLELEKIKKLDNSIMMTSVIWTSPLGLPVVQPYRDIKKKQIHTNLQTVFI
                     ADPFAVNPIDPRRQMAGFPPNFIHSLDASHMLLSAIECGRLGLQFAAVHDSYWTHASD
                     VPKMNKALRNEFVKMHQVDLIQRLKNEFDARYKNYLEVKRIKKRSELGQELLLLRSRL
                     SKSLGRPITMKDELEMERKRQNLLNSEDPVLRAEGERMVTTVSFMSDKDTTDMETSTH
                     QSVCALVPLKFSGIPPKGSYDIRQLVNSKYFFS"
     misc_feature    complement(749106..749386)
                     /note="similar to part of Saccharomyces cerevisiae Ty3b_g;
                     contains stop codons"
     gene            750890..750961
                     /locus_tag="AGOS_t0056"
                     /db_xref="GeneID:4619759"
     tRNA            750890..750961
                     /locus_tag="AGOS_t0056"
                     /product="tRNA-Gly"
                     /codon_recognized="GGA"
                     /db_xref="GeneID:4619759"
     gene            complement(<751362..>752877)
                     /locus_tag="AGOS_ACR225C"
                     /old_locus_tag="ACR225C"
                     /db_xref="GeneID:4619626"
     mRNA            complement(join(<751362..752699,752866..>752877))
                     /locus_tag="AGOS_ACR225C"
                     /old_locus_tag="ACR225C"
                     /product="ACR225Cp"
                     /transcript_id="NM_208980.1"
                     /db_xref="GeneID:4619626"
     CDS             complement(join(751362..752699,752866..752877))
                     /locus_tag="AGOS_ACR225C"
                     /old_locus_tag="ACR225C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL037W (TUB2); 1-intron"
                     /codon_start=1
                     /product="ACR225Cp"
                     /protein_id="NP_983627.1"
                     /db_xref="GeneID:4619626"
                     /translation="MREIIHLSTGQCGNQIGAAFWETICGEHGLDFNGTYSGTDELQR
                     ARLNVYFNEASSGKWVPRSVNVDLEPGTIDTVRNSNIGNLFRPDNYIFGQSSAGNVWA
                     KGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFP
                     DRMMATFSVVPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLP
                     QPSYSDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTSI
                     GAQSFRALTVPELTQQMFDARNMMAASDPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQ
                     TRNSSYFVEWIPNNVQTAVCSVPPQGLDMSATFIGNSTSIQELFKRVGDQFGAMFKRK
                     AFLHWYTSEGMDEMEFSEAESNMNDLVSEYQQYQEATVEDDEELNYGDEQPMVENFE"
     gene            <753347..>754492
                     /locus_tag="AGOS_ACR226W"
                     /old_locus_tag="ACR226W"
                     /db_xref="GeneID:4619760"
     mRNA            <753347..>754492
                     /locus_tag="AGOS_ACR226W"
                     /old_locus_tag="ACR226W"
                     /product="ACR226Wp"
                     /transcript_id="NM_208981.1"
                     /db_xref="GeneID:4619760"
     CDS             753347..754492
                     /locus_tag="AGOS_ACR226W"
                     /old_locus_tag="ACR226W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER095W (RAD51)"
                     /codon_start=1
                     /product="ACR226Wp"
                     /protein_id="NP_983628.1"
                     /db_xref="GeneID:4619760"
                     /translation="MSQVQEHIIQDPHSSQYNIHATGASERQGSSEHTDGDVIEVHAE
                     SGRGQGYEEDVALAAFVPLERLQVNGITNNDLKKLRENGLHTVEAVAYAPRKDLLEIK
                     GISEAKADKLLAEAARLVPMGFVTAADFHLRRAEMICLTTGSKNLDTLLGGGIETGSI
                     TELFGEFRTGKSQLCHTLAVTCQIPLDMGGGEGKCLYIDTEGTFRPIRLVSIAQRFGL
                     DPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSIMALYRTDFSGRGEL
                     SARQMHLAKFMRALQRLADQFGVAVVVTNQVVAQVDGAAMFNPDPKKPIGGNIMAHSS
                     TTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGIGDPREDDED"
     gene            <755397..>757793
                     /locus_tag="AGOS_ACR227W"
                     /old_locus_tag="ACR227W"
                     /db_xref="GeneID:4619761"
     mRNA            <755397..>757793
                     /locus_tag="AGOS_ACR227W"
                     /old_locus_tag="ACR227W"
                     /product="ACR227Wp"
                     /transcript_id="NM_208982.1"
                     /db_xref="GeneID:4619761"
     CDS             755397..757793
                     /locus_tag="AGOS_ACR227W"
                     /old_locus_tag="ACR227W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL061C (SKT5) and YER096W (SHC1)"
                     /codon_start=1
                     /product="ACR227Wp"
                     /protein_id="NP_983629.1"
                     /db_xref="GeneID:4619761"
                     /translation="MESPRSYPPSDQADQADQADQQKGSTTYEESAVYSENSYLHSLV
                     ENDGGSGEPQAGKGLPPMDALHIMVPDQIDTIQLDGNVPVLDDRLDLGVGEPPLELQA
                     LDFVAVADSFQAQAEALTVAPYINIELNGAFDTEDLSEKPQLAAGPLSEDARASGSST
                     SSRAQGCSSLSLLNSQSTSTMHLGSSHGMRSSVTGSYDSRKPKIKPVDLSHLYLVNNS
                     DSITLTQTNESVAHFSHKMISECLGDDSESILVPRLKALEMYKKNVKKSKDPDVLFQY
                     AQYMLQTALTMDVSPIIETEDPRRKGLCKKLSPTENLKEQFLKEAKVYLTKLSVKGYK
                     DAQYLLADAYSSGAFGKVNHKDAFILFQSSAKHGHVEAAYRTAVCFEKGLGTTRDSRK
                     CIEFLKFAASKNHPAAMFKLGLYSFHGRMGLPNDVNTKQNGIKWLSRAAARATELTCA
                     APYELAQVYENGFLDIIIPDESYATELYLQAAALGHVPSTTKLGKLYEQGNEIVPQDT
                     SLSVHYYTDAAMKGDPEAMLGLCAWYLIGAQPAFDRDDREAFQWALKAAKKGYGKAQY
                     TVGYFHENGKGCKKDIDMAYKWYECAADNEDPRALRKLASRTDKKKRNSTVFNFSFLK
                     PDDFESKLQRMDVGEYSPLCLDFQGTLARTNAASRSKHGINTSCSYDVINVITDDQSL
                     GMEMDDGMQRPAQQRCLTPISRQTSSFLSEVSPYQSSNNPMAPNYAAENQAVELRPVA
                     TGQTSNSSTSCGPREKDQEIMPSNIPGERWHTSAAPEGAPFNNVAPKKVTDRNVCVIT
                     "
     gene            complement(<758101..>761490)
                     /locus_tag="AGOS_ACR228C"
                     /old_locus_tag="ACR228C"
                     /db_xref="GeneID:4619762"
     mRNA            complement(<758101..>761490)
                     /locus_tag="AGOS_ACR228C"
                     /old_locus_tag="ACR228C"
                     /product="ACR228Cp"
                     /transcript_id="NM_208983.1"
                     /db_xref="GeneID:4619762"
     CDS             complement(758101..761490)
                     /locus_tag="AGOS_ACR228C"
                     /old_locus_tag="ACR228C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL063W (KIP1)"
                     /codon_start=1
                     /product="ACR228Cp"
                     /protein_id="NP_983630.1"
                     /db_xref="GeneID:4619762"
                     /translation="MLEQAEKLMKRNSSGAMSAPQSKPLARSRSSTMPTTTQKRVRSS
                     QQSEGEPEYNIKVYVRCRSRNEREIREKSSVVISTLGNNGREVILTNPGTGSNKTYTF
                     DRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSE
                     DDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKDVS
                     LEDHNFNGMAPPESIRIYDSLKTDRTSPNGYSIFVKGMEEMYIRSAQEGLKLLMDGSL
                     KRKVAATKCNDLSSRSHTIFTITTNVTKIHPISGEQYVKVGKLNLVDLAGSENINRSG
                     AENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIA
                     TISPAKISMEETVSTLEYATRAKSIKNTPQVNQLMAKESCIIEYIQEIERLRKELRAS
                     HSKEGIYITQEKFETYESNSILVEEQQAKIDNLQEQLRRLKEKFLEQTKLIKEKDGQI
                     KELDVANRKYLEQSKDLTIYINGIHSKLEDYEHTMIGIHNNNMKLLEDINDNRGNIHE
                     DLLAKVDHIETCNLIISREITSLISIRNVLQAYSDRFKTVLGGVFEELQEKLTQVGRT
                     TEESQLDVDLSFVDEKFEEVTDIIKATCENLVRTMDEHVSNMKLETTDLTSSCASLLE
                     KECQALHGKLQKYVESMKQELNSTLQEMVRDLDMKASSMLNVVQCTKDGLISHKKELE
                     ADLESQKREHFDIAQTMEEQLQKIVGKERQNIQESMKASYDFLMKQMVETELRQKNFE
                     ESIVSKVKGLLSHSNNGMSKMSSYAVGRLYDSAIGGVNSIENTVSSATFSMKNDLQEF
                     QMDISPICDSRRFGDEFTAVETRISEAIREELTPKLQDITSKACNLIGLGVQDINQKA
                     LGVSDDQRRELRSVINNTNNHADRLRSEIGTLVNYVSQEHRDNIMQISQTQDEILQEQ
                     IASIGRTFDVLGNINKPDANVRTSVPIEHELNSAINELPPLYMPQRPLSLCSHGRQLL
                     DEAYSGNENLSPSTGKFSNFPTPCGDMSAQTPTTPMPVPDQPLTKMPVPQTISSLRSL
                     RRLTMDICEHSADMTLGSIHESQKAMDSSRRYTLEPRLFEK"
     gene            <762384..>763190
                     /locus_tag="AGOS_ACR229W"
                     /old_locus_tag="ACR229W"
                     /db_xref="GeneID:4619763"
     mRNA            <762384..>763190
                     /locus_tag="AGOS_ACR229W"
                     /old_locus_tag="ACR229W"
                     /product="ACR229Wp"
                     /transcript_id="NM_208984.1"
                     /db_xref="GeneID:4619763"
     CDS             762384..763190
                     /locus_tag="AGOS_ACR229W"
                     /old_locus_tag="ACR229W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR192C (HCR1)"
                     /codon_start=1
                     /product="ACR229Wp"
                     /protein_id="NP_983631.1"
                     /db_xref="GeneID:4619763"
                     /translation="MSWDDEEFEVRTSTKDQPMVVSWDDEFNNDDDDALLESWDAEEV
                     PKQKQKPKAAPKAAKKVDKKGETVLLEIDTLDEKTRKELLKKAELNSDLNNAAALFDG
                     LGVAEEHPRARALRQEEELAALSRPAALTKQTPFESHPLFSEAETKSDFQDLRKALST
                     AIAGMAEKSSLNYSGALAIDLIRDVAKPLSIESIRQTVATLNVLIKEKERQERQARLA
                     KVKGGTATGGAGKKKAKAARPNLGGAFKKDQEFSLEDNSEFADFGDDDFM"
     gene            complement(<763420..>764616)
                     /locus_tag="AGOS_ACR230C"
                     /old_locus_tag="ACR230C"
                     /db_xref="GeneID:4619764"
     mRNA            complement(<763420..>764616)
                     /locus_tag="AGOS_ACR230C"
                     /old_locus_tag="ACR230C"
                     /product="ACR230Cp"
                     /transcript_id="NM_208985.1"
                     /db_xref="GeneID:4619764"
     CDS             complement(763420..764616)
                     /locus_tag="AGOS_ACR230C"
                     /old_locus_tag="ACR230C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR191W (PEX13)"
                     /codon_start=1
                     /product="ACR230Cp"
                     /protein_id="NP_983632.1"
                     /db_xref="GeneID:4619764"
                     /translation="MSASKPRPKPWETANMSSATSSSGTMDESNTVIPTSVTAASSLG
                     GGSGDYGHTPDLPTKPAGLGDESGYKSMNSQFGMNSTPYGGSMYGSGGLYGNSMYGGG
                     GFGSMYGGGFGNGYGGYGSMYGGGYGGMYGMGANGMNNNGGIAESTQATFHLIENLIG
                     AVAGFAQMLEATYMATHNSFLTMVSVAEQFQYVKEMLGSFFGIFAMIKFLKRVLFKLT
                     GGRMGVAPKKQLPPASGDKGKMLQEFDQFRSGKNSAGSTGERKRARIAWKPLFLFFAA
                     VFGFPWLLNKFIMKLQEMQNRGRIATPHQPQSLDLNSLEFARAIYDFTPENPRIECAL
                     KKGDLMAIISRQDPTGKESQWWKVRTKKGDVGYVPCNYIELIRRKKEIELSAGSGTGP
                     SEVVSA"
     gene            complement(<765211..>766650)
                     /locus_tag="AGOS_ACR231C"
                     /old_locus_tag="ACR231C"
                     /db_xref="GeneID:4619765"
     mRNA            complement(<765211..>766650)
                     /locus_tag="AGOS_ACR231C"
                     /old_locus_tag="ACR231C"
                     /product="ACR231Cp"
                     /transcript_id="NM_208986.1"
                     /db_xref="GeneID:4619765"
     CDS             complement(765211..766650)
                     /locus_tag="AGOS_ACR231C"
                     /old_locus_tag="ACR231C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR190W (MMR1)"
                     /codon_start=1
                     /product="ACR231Cp"
                     /protein_id="NP_983633.1"
                     /db_xref="GeneID:4619765"
                     /translation="MGITSITIGGVPLSPGLSPVLAPVDGHGGLGAPALLQLDERRGS
                     QRYETSLSKLAELTPGGGSASAGSPVSSLRLPAQSLFRVGSPMRTSMMSQVPKMLRPE
                     YMNVKAGWRDQLFKTRNSIPKDGAVTVASALTSSAVPTMPRELAHEAPLEGTSAWEQA
                     GDGAQVAEASGKTGQARPSAFNSYNKGSAAKHSSTHTPKVGNGSKSKHARELSVISCL
                     SGKTLFEPDSLQPPTGSISQPPSGSVYQFPSASPVSSSSSANLAYAVDENGFVMSNNK
                     HRDSVLSATMEDRFWMDYQDEINQGHRMSSDGLQFEPLKGPSLSLQTERFELKVKRLE
                     VQIEELQLQNDKLKHSMEHSAIQDKLLLDALHEAREGRNNYNQDAERSLKALERKIQG
                     YKRTIYALTTYDGYGPLRHKVALLNDEQLEAIANDDVAAASVCGQPEGAEHAPADKKE
                     SNPVDEQPSRGRSYRARNRGLHLNLSIVE"
     gene            complement(<767320..>769002)
                     /locus_tag="AGOS_ACR232C"
                     /old_locus_tag="ACR232C"
                     /db_xref="GeneID:4619766"
     mRNA            complement(<767320..>769002)
                     /locus_tag="AGOS_ACR232C"
                     /old_locus_tag="ACR232C"
                     /product="ACR232Cp"
                     /transcript_id="NM_208987.1"
                     /db_xref="GeneID:4619766"
     CDS             complement(767320..769002)
                     /locus_tag="AGOS_ACR232C"
                     /old_locus_tag="ACR232C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER086W (ILV1)"
                     /codon_start=1
                     /product="ACR232Cp"
                     /protein_id="NP_983634.1"
                     /db_xref="GeneID:4619766"
                     /translation="MVFNACGRRSGNLVSSALRTGRRYSGTLHKLYTQLKPQELLPDN
                     TPDYVRMILRSSVYDVIEESPMSEAKLLSAKLDTNVCLKREDLLPVFSFKLRGAYNMI
                     SNLDEYQKSAGVIACSAGNHAQGVAFSARELGIRAMIVMPTSTPSIKYNSVAAMGAEV
                     VLYGKDFDEAKAECARLAQLHKLTDIPPFDHPYVIAGQGTIATEILRQVHNASQIGAV
                     FCGVGGGGLIAGIGSYLKRIAPHIKIIGVETHDAPTLHTALKQGRRTMLPAVGCFADG
                     TSVRMMGEETFRVARDVVDEVVLVNTDELCAAIKDIFEDTRAIVEPSGALGVAGLKKY
                     IASHQDAENSRHTYVPVLSGANMNFDRLRFVSERAVLGEGKEVFLAVTIPDVPGSFKR
                     MNQIIHPRAVTEFSYRYNEHARRNQDGTARACIYTSFSVADPAAEVPDVLTRLRALGF
                     DARDISANELAKSHARYLVGGAARVPNERLFAFEFPERPGALTNFLAGLDSSWNITLF
                     HYRNHGADVGRVLVGIAVPSDEYSAFDAFLSGLGYAYQEETGNPVYREFLLC"
     gene            <769384..>771072
                     /locus_tag="AGOS_ACR233W"
                     /old_locus_tag="ACR233W"
                     /db_xref="GeneID:4619767"
     mRNA            <769384..>771072
                     /locus_tag="AGOS_ACR233W"
                     /old_locus_tag="ACR233W"
                     /product="ACR233Wp"
                     /transcript_id="NM_208988.1"
                     /db_xref="GeneID:4619767"
     CDS             769384..771072
                     /locus_tag="AGOS_ACR233W"
                     /old_locus_tag="ACR233W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER087W (AIM10)"
                     /codon_start=1
                     /product="ACR233Wp"
                     /protein_id="NP_983635.1"
                     /db_xref="GeneID:4619767"
                     /translation="MQGGPGGFRLVLKRSLFTPAKGASALIKQGNTHELLQGLGYIRQ
                     SQSGLVHWLPLGLRCLRNVENIVRKRMDECGGQELQLSTLSPETLWQRTGRWENKELF
                     KLRDAKGRNYCLSATCEEDVTWLMSECLESYKDLPSLVYQIGTKYRDELRPRGGLLRS
                     REFLMKDAYSFHADSQDAMQMFHKMKQVYDQIFTDLKVPFKSAAADCGSIGGELSREY
                     HYIHEKGEDVLYSCNSCRQVSNVEMCASIPTEPGQHTGAVAVAYALNQVHDTLLCLYY
                     PANRTLNWNLALSVMDNDIDMTLANVGNDRVLELFLEQNTDPMFSSVVRVMDSRLNSR
                     SQFPDFPLQTYLKSNFSQLSGHSLVHATQGELCGDCGKGTLDARNSIEVGHCFYLGRT
                     YSEALGAAVRMRTNETTTLEMGCYGIGISRLVGAIADVTRDSQGLCWPSCVAPYKVSL
                     NYAGEDENVRTVRSLLSLEPYESPAGTSLGASLQLSQQLGIPLSVIVGKKSWPHVEIE
                     VRGRRFSDTWRDEHRKLHEHYGWRAVPAADGAREKHYCLPEHLDAVIAVLLRDL"
     gene            complement(<771155..>771427)
                     /locus_tag="AGOS_ACR234C"
                     /old_locus_tag="ACR234C"
                     /db_xref="GeneID:4619768"
     mRNA            complement(<771155..>771427)
                     /locus_tag="AGOS_ACR234C"
                     /old_locus_tag="ACR234C"
                     /product="ACR234Cp"
                     /transcript_id="NM_208989.1"
                     /db_xref="GeneID:4619768"
     CDS             complement(771155..771427)
                     /locus_tag="AGOS_ACR234C"
                     /old_locus_tag="ACR234C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YER019C-A (SBH2) and Syntenic homolog of Saccharomyces
                     cerevisiae YER087C-A (SBH1)"
                     /codon_start=1
                     /product="ACR234Cp"
                     /protein_id="NP_983636.1"
                     /db_xref="GeneID:4619768"
                     /translation="MSSTAVPPGGQRTLQKRRAAQSAKEKQQKQTPTSTRQAGFGGSS
                     NSILKLYTDEANGLRVDPLVVLFLAVGFIFSVIALHVIAKVSGKLF"
     gene            <771961..>773697
                     /locus_tag="AGOS_ACR235W"
                     /old_locus_tag="ACR235W"
                     /db_xref="GeneID:4619769"
     mRNA            <771961..>773697
                     /locus_tag="AGOS_ACR235W"
                     /old_locus_tag="ACR235W"
                     /product="ACR235Wp"
                     /transcript_id="NM_208990.2"
                     /db_xref="GeneID:4619769"
     CDS             771961..773697
                     /locus_tag="AGOS_ACR235W"
                     /old_locus_tag="ACR235W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL051C (PIN4)"
                     /codon_start=1
                     /product="ACR235Wp"
                     /protein_id="NP_983637.1"
                     /db_xref="GeneID:4619769"
                     /translation="MLTSRTMVTGATETQRPGCVVAGPGAEGESENDGDDAGAAPQGE
                     DVIPTAIVIKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTEE
                     TMQVVQHLNGKEIGGRRLRVEYKKMLPQAERERIEREKREKRGQLEEQHRSVSNVSLQ
                     SMGKMPSTNVLAPGPSSSQIFSNFVNGPGAGGVSSQAVGPAPLSSQMLSAQSTAHSVG
                     LPKPQSLSSERYYAPLPATSNLLLAPQQLDFNDPDVLEIYSQLLLFKDRERQYHELAY
                     PLGLSAAQKRIINVLCSFLGLVEVYDPSFILIRRKVLDHATLQSHLQQQGQATAAQPL
                     QAHSTGDSLQRSQSYTSVLQVHAAATVAAAQQQQRQSQVSSQQMQSQQVMQQPPQSPG
                     QVLLHPIASYDGISSAQQQQQQLLRSQGTTPSLLQNRIPSGYATTHTPSSSLLRQHGV
                     SPPQNQVPMNSSTSTSRMANLLYNNASALSQPNTPSLANDSRFHPPGLQPPDSGTSCT
                     TPSNSATVATGATAPLAPQHTNGSVHSNYSVHSIHDYVPISSAGNEINALEEGLTRSL
                     SGLDIGKRNVWG"
     gene            <774163..>776376
                     /locus_tag="AGOS_ACR236W"
                     /old_locus_tag="ACR236W"
                     /db_xref="GeneID:4619770"
     mRNA            <774163..>776376
                     /locus_tag="AGOS_ACR236W"
                     /old_locus_tag="ACR236W"
                     /product="ACR236Wp"
                     /transcript_id="NM_208991.2"
                     /db_xref="GeneID:4619770"
     CDS             774163..776376
                     /locus_tag="AGOS_ACR236W"
                     /old_locus_tag="ACR236W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL052C (SAS3)"
                     /codon_start=1
                     /product="ACR236Wp"
                     /protein_id="NP_983638.2"
                     /db_xref="GeneID:4619770"
                     /translation="MTISADSQAKKSKMLDGLDIKDIIQGDEQDGAGNGGSRRVHRPR
                     DGNGPDYRIHKPMAAVGWLQGRIPSDVAEWGRWNAHVDFPDGTKNKVRIRYDPRKLYD
                     FRRVLRASAAETGPPPHLDFEIYETENLLNMLDNESYPYRGAIANKKDYSTSKTTPTL
                     RDRQFFQKLLFQSANAARTNGNTLLSFTEEEPKGRPSKAERAHKVSYIYFNDHEIKTW
                     YTAPYPEEYSKNRILYICDSCLKYMNSKYIYYRHKLKCSMMHPPGNEIYRDGKISIWE
                     IDGREQVIYCQNLCLLAKLFLNSKTLYYDVEPFVFYLLTENVKTGQGLKFNVVGYFSK
                     EKLNTTDYNLSCILVLPTHQRLGYGHLLMDFSYLLSRREFKWGTPEKPLSDLGLLSYR
                     NYWKIKMAQVLRSLKPIIAKSTYFCISLEDIANLTGMTPTDVIFGLEQLGCFYRYSSI
                     DGRKYAIRIDSWDEIEHIYQQWESKAYITLDPDKLIWRPLIFGPSCGINAVGTMVETS
                     TGAHRNTGAVGSSQGTDLFKNSISVLVNFMHDDISDSRTMEKMAWDKIVAQQKNAREV
                     QKDATDPAILELAYVHPSFTNGSTAEYGVKPVRRNPPAIRETPKVGSPATPEERDDMT
                     PLEDVYEDSFDQTHLSDQDDEYTDQGEEEDDEEEDDEEDDGMNVGRFNSNALPSRAYS
                     RRSASEHSNNRTRSSRHQQSVPHVESDDDEDLEEHWVDALETVSRTRRILRNRTA"
     gene            complement(<776905..>778302)
                     /locus_tag="AGOS_ACR237C"
                     /old_locus_tag="ACR237C"
                     /db_xref="GeneID:4619771"
     mRNA            complement(<776905..>778302)
                     /locus_tag="AGOS_ACR237C"
                     /old_locus_tag="ACR237C"
                     /product="ACR237Cp"
                     /transcript_id="NM_208992.2"
                     /db_xref="GeneID:4619771"
     CDS             complement(776905..778302)
                     /locus_tag="AGOS_ACR237C"
                     /old_locus_tag="ACR237C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER088C (DOT6) and YBL054W (TOD6)"
                     /codon_start=1
                     /product="ACR237Cp"
                     /protein_id="NP_983639.2"
                     /db_xref="GeneID:4619771"
                     /translation="MTSTKAMTGSARNPSSWDPQDDVLLRHLKEVKKLGWKEIAQYFQ
                     SRTPNACQFRWRRLKSGSLKTGARAEEEEEGLLQAAFAREGKFVKPRAASFNSTALGP
                     RENARAADEENIGLIPKIVIRSRRGSVVQQSQAQAAAGAPPSLVAALNTTFANSKARK
                     DSFSSRTRRSSFQLDRRLSVTQLSTTPTRRSSLVAAPTSVSALFPGRRESFNTNTSNA
                     TSRRGSAVYIPRRGSFSHNFTDLPRHGHFLQHGAAGPMPTALQQPWSEEEDRLLQARQ
                     EHRLSLDELSILLPHRSDEEIQWRIDSISPVVNAAVTMSPSASPFRAARERSFNEDTA
                     IEEDEDDRHEEFKDRTPVDYNHSSNLSSASSAKKEQRQSPIFFNKSKETSPTTSDGTT
                     RSNTIVPPQAAEGKALNFNSVNTHTAHVGPEVKLQSVSTGDEYHNILIHHSHHHPQAA
                     ATPLPSLNSIFKNVL"
     gene            <778652..>779722
                     /locus_tag="AGOS_ACR238W"
                     /old_locus_tag="ACR238W"
                     /db_xref="GeneID:4619772"
     mRNA            <778652..>779722
                     /locus_tag="AGOS_ACR238W"
                     /old_locus_tag="ACR238W"
                     /product="ACR238Wp"
                     /transcript_id="NM_208993.1"
                     /db_xref="GeneID:4619772"
     CDS             778652..779722
                     /locus_tag="AGOS_ACR238W"
                     /old_locus_tag="ACR238W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL055C"
                     /codon_start=1
                     /product="ACR238Wp"
                     /protein_id="NP_983640.1"
                     /db_xref="GeneID:4619772"
                     /translation="MSKLRYYDIAVNLADPMFQGVYRGKARHGGDLAAVLERCRGARV
                     DVLLATGSSLAESAHTRALVREYAGNGPRLLYTAGVHPCCADELARPGALAELRQLWA
                     ECAGDETFRALGEMGLDYDRLEHAGRPAQLRAFEAQLRLSCEFAAVPLFLHMRASCAD
                     FIEMMGRFVRGFTSADELDEELRAAGARGANASGRTEYRFAAERKMVVHSFTGTAAEL
                     DALLALSPHVYIGLNGASLRTAEGLENARRLPLQRLLLETDAPWCEIRRTHAAHELIA
                     EGGPEAWREAYPDLTEWYESVRAERLDRVPEGERAHTMVRSRNEPCAIGQVAVAVARA
                     RGVLVTEVAEAAWQTACAVYGS"
     gene            complement(<779821..>781191)
                     /locus_tag="AGOS_ACR239C"
                     /old_locus_tag="ACR239C"
                     /db_xref="GeneID:4619773"
     mRNA            complement(<779821..>781191)
                     /locus_tag="AGOS_ACR239C"
                     /old_locus_tag="ACR239C"
                     /product="ACR239Cp"
                     /transcript_id="NM_208994.1"
                     /db_xref="GeneID:4619773"
     CDS             complement(779821..781191)
                     /locus_tag="AGOS_ACR239C"
                     /old_locus_tag="ACR239C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL056W (PTC3) and YER089C (PTC2)"
                     /codon_start=1
                     /product="ACR239Cp"
                     /protein_id="NP_983641.1"
                     /db_xref="GeneID:4619773"
                     /translation="MGQILSNPVIDKEQGRSGDALTAYGMCAMQGWRMSMEDSHIVDL
                     DISPEGSDDHIAYYCVFDGHGGASVAQFCGEQFSRILQQQKDFGGDAPNFARALVAAF
                     IAADEELLKDPVLANDHSGCTATTLLVSHKQQLLVCANSGDSRTVLSTDKNAKALSFD
                     HKPTLRSEQSRIMAADGFVEMDRVNGNLALSRAIGDFEFKSNPNLAPHEQIVTCVPDV
                     LEHKLDYEKDEFVILACDGIWDCLSSQECVDLIHYGIQQGMGLQDIASRVIDVCCSPT
                     TEGTGIGCDNMSFIVVALLRENETEDQWFERMRAKKYQGLLSFEAQRRKVFSYHYDFI
                     NEDDDNLFDISTKRPEERNRGSGSLPPMHATTREDPDEEDGANPADGRQHLYSLEELI
                     NAGGIQITQGGNNTSYIHGSALSEVLASLVGATGGIVARPAQRADAEDNVSEEQDGKK
                     LEEIQE"
     gene            <782476..>784209
                     /locus_tag="AGOS_ACR240W"
                     /old_locus_tag="ACR240W"
                     /db_xref="GeneID:4619774"
     mRNA            <782476..>784209
                     /locus_tag="AGOS_ACR240W"
                     /old_locus_tag="ACR240W"
                     /product="ACR240Wp"
                     /transcript_id="NM_208995.1"
                     /db_xref="GeneID:4619774"
     CDS             782476..784209
                     /locus_tag="AGOS_ACR240W"
                     /old_locus_tag="ACR240W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL149W (DAS1)"
                     /codon_start=1
                     /product="ACR240Wp"
                     /protein_id="NP_983642.1"
                     /db_xref="GeneID:4619774"
                     /translation="MPETRGSFPLEKLPDELVKEVFSHLPQSERLKLCYLNWRCHRLA
                     MQLLYSRIYLNDSNVVKSDYVDLAINWTFLYIPSFLKEEESRAVANEKLKKLICTFQT
                     NPDTLNLVQWVRINWDLNPVLQKSILSLLCNKSRSLQRLENVTDPNCNDIVAFGYMSR
                     RNLTSLDMAPPNSLPERPVCSTYIPALARYLRQRISCKLSHMTLFMDPVQLFNCIYPL
                     EYKLQIRDLKLHWRREFYPVGEFQVRRNSPLQKLSEIFDLRALKVLTIISWNESLSKR
                     ELEMLQEFEEFTNIEDLSLISVAQDTLVLMSLFNKLVNLKRLKMDFLENYVPQATKPE
                     IFLSILISCKKLQFLDIRFEGLDSPIISMEHEKYQVLRNCPCAKCEKTHDEIINKKIF
                     HFPDDKKFKDMDEFMAKDIFAMMRYQSLLPYSKACDSYPSVRTQPMNMDQFVQIMNES
                     MLLYRKSRGQLKDHPLDAEELDLSEALDLLPHAPFTRQDVIDCFHTLIHHYQRTYVTL
                     LSEFPELRFLMLNDIPTIIVEEISERIPHPVFFHEGYFSNLHGWTYRFKWRNNDDNKD
                     VMTVNRQITLC"
     gene            complement(<784351..>786738)
                     /locus_tag="AGOS_ACR241C"
                     /old_locus_tag="ACR241C"
                     /db_xref="GeneID:4619775"
     mRNA            complement(<784351..>786738)
                     /locus_tag="AGOS_ACR241C"
                     /old_locus_tag="ACR241C"
                     /product="ACR241Cp"
                     /transcript_id="NM_208996.2"
                     /db_xref="GeneID:4619775"
     CDS             complement(784351..786738)
                     /locus_tag="AGOS_ACR241C"
                     /old_locus_tag="ACR241C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR064W (OAF3)"
                     /codon_start=1
                     /product="ACR241Cp"
                     /protein_id="NP_983643.2"
                     /db_xref="GeneID:4619775"
                     /translation="MMPLKKRQRQTLVCSNCKRRKSRCDRGKPACGNCIRLGNRETCH
                     YFISPSEKGGDGGDSPGESAGSNGALERWQFVRAHSCGRVDLTAGRTVVFGKRSAVYV
                     AGVLSTDAVRYRDLYLELLSVFSHAAIKKTVSQLHAQAQVGAQEASLPNSVKRVIRME
                     DEGMLQESSPYILAKHKKVHQSLVDGFAQSRYEGRQQFADVEEAAKQHLVERYIFLQK
                     VLPAFKKHVLPLIPIYDERMLCVTVEQLYDDYQKRGKFSAKNGDLITVATILLITRLV
                     YLAIRFDKCSVVNVKYNRILELDTEPYAALAYELLPRDKLLRKVTLPQLQCLILLRFH
                     NWCSPMDGDGESLQYSNVLMGTIYACCKEIGASWLSFKEPDKYDFAKARGSNSRFTMA
                     FAEMEPGEVDSANESVVKLYQQIWAVVLHWDRNVSMLTGLEPIIGTSMKPAAMSSYNN
                     WYADMISLDYLKWQLLTRINEDPSEVNLEEVKPIISEIRQRLGQFTSESELAFEQELI
                     LQLVELSILHAAFIGPTSNVSAAEHRKNYQELLERIIHLSGIFITYFHDPPTTNHQYG
                     RFYTNKIVEVAMYRVYQILTGLILRISSACQDQSLKPTLMKFYKNLCSLYFNELGYDY
                     YQVFKRLFEAKVKYKILEQTANPVFIMLRYLFAEIQSGNMESMKSQELIGLIYGEYKK
                     MGGELNLDMMDLWNHIVPTQCDHNIGLNSLFTTEIFPTDQYSDYNLFVSFYDYASNKL
                     TEDTNQAAEKSIAHNPSTSIHDLCKGGASPHFDLLEGILDPLDFMTYLDSIPGET"
     gene            <786925..>788298
                     /locus_tag="AGOS_ACR242W"
                     /old_locus_tag="ACR242W"
                     /db_xref="GeneID:4619776"
     mRNA            <786925..>788298
                     /locus_tag="AGOS_ACR242W"
                     /old_locus_tag="ACR242W"
                     /product="ACR242Wp"
                     /transcript_id="NM_208997.1"
                     /db_xref="GeneID:4619776"
     CDS             786925..788298
                     /locus_tag="AGOS_ACR242W"
                     /old_locus_tag="ACR242W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR063C (LAS1)"
                     /codon_start=1
                     /product="ACR242Wp"
                     /protein_id="NP_983644.1"
                     /db_xref="GeneID:4619776"
                     /translation="MRVVPWQSEQEVQELKRWFYPAKFGDGDDKRSRAMQRVKAYWTR
                     GSYVPHVIDSTSQLVGCQVFDREGAPEEIVKLSYSMALIRYVNGMLDPTQQSQFAIPL
                     HTLAELLGLPSWFVELRHAGTHERELPSVEMLRLACARALEWLWENYWDSDERNEESE
                     EEDGEGEEECKCGNHAVHMQQLQQQLESYAQFKDGFKEYRYMWEEGAAVATSAFGDET
                     DSGKEFVRKWLADYRDVWRSLRGCPGAFVEALLTHYDSTLLELSLTRLEWLDLEVCRW
                     LLQSYRSCLEPYEEAPLLRRRTKNSKHLLRFTKRVLAWINLKRAMHYWDRWHPIFLVE
                     QSFLTRFMIETLQPRITEALNDKKFRKKLYTSDINSQLDEVLDALSKKGISAAELSVF
                     DADEHSPASEDAAHEPLSPKHPADEVSGLLQDLESVKLRLKRQKTSAPRGWTPYPAWQ
                     PKPFGCL"
     gene            complement(788327..788447)
                     /locus_tag="AGOS_AgSNR128"
                     /old_locus_tag="AgSNR128"
                     /db_xref="GeneID:4619777"
     ncRNA           complement(788327..788447)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR128"
                     /old_locus_tag="AgSNR128"
                     /product="AgSNR128"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR128; start and end coordinates are
                     approximate; in synteny"
                     /transcript_id="NR_149360.1"
                     /db_xref="GeneID:4619777"
     gene            complement(788566..788631)
                     /locus_tag="AGOS_AgSNR190"
                     /old_locus_tag="AgSNR190"
                     /db_xref="GeneID:4619778"
     ncRNA           complement(788566..788631)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR190"
                     /old_locus_tag="AgSNR190"
                     /product="AgSNR190"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR190; start and end coordinates are
                     approximate; similarity is partial; In synteny"
                     /transcript_id="NR_149367.1"
                     /db_xref="GeneID:4619778"
     gene            <789202..>789843
                     /locus_tag="AGOS_ACR243W"
                     /old_locus_tag="ACR243W"
                     /db_xref="GeneID:4619779"
     mRNA            <789202..>789843
                     /locus_tag="AGOS_ACR243W"
                     /old_locus_tag="ACR243W"
                     /product="ACR243Wp"
                     /transcript_id="NM_208998.1"
                     /db_xref="GeneID:4619779"
     CDS             789202..789843
                     /locus_tag="AGOS_ACR243W"
                     /old_locus_tag="ACR243W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL148W (RPA34)"
                     /codon_start=1
                     /product="ACR243Wp"
                     /protein_id="NP_983645.1"
                     /db_xref="GeneID:4619779"
                     /translation="MVSMSNEYVSDSSDSEREVEERFEVPAGFKQCKHLKDFKKPKGS
                     KQELWLMKLPSSVDIGKLKKIPVDFAGDAPASFSVDGKKYVVREDLSQEDGPGGSAKA
                     SRFAVLAPRSKDVLKADAKLQIAKFFNVSESVEIPAIDYDRVRQPRKDVTKVTGLKTR
                     HFATGYDAEDFADAAAAEPPKKKHRKSDDKKEKKEKKDKEKKKEKKEKRKHKD"
     gene            complement(<789946..>790848)
                     /locus_tag="AGOS_ACR244C"
                     /old_locus_tag="ACR244C"
                     /db_xref="GeneID:4619780"
     mRNA            complement(<789946..>790848)
                     /locus_tag="AGOS_ACR244C"
                     /old_locus_tag="ACR244C"
                     /product="ACR244Cp"
                     /transcript_id="NM_208999.1"
                     /db_xref="GeneID:4619780"
     CDS             complement(789946..790848)
                     /locus_tag="AGOS_ACR244C"
                     /old_locus_tag="ACR244C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR062W (TFA2)"
                     /codon_start=1
                     /product="ACR244Cp"
                     /protein_id="NP_983646.1"
                     /db_xref="GeneID:4619780"
                     /translation="MSNDLLANLNAFKSKIKTAPVITTRRKVVAHQDSGSHSGGARQS
                     KAMKRETPRDGGDQGAGQPSAAKKMKLGTASPQKAAVPSRSENGALDSTHLSTKMLIA
                     TEYIQERAEPVPIDQIESYLSLPKDNSVIPMLKGLAKFKFDPKKNTLQYVSIYDVHSA
                     EELLKLTRTQVTFKGISCKELKDGWPQCFEVIDELEKKNRILVSRTKKDNSPRFVWYN
                     FGGPLGEIDEDFVKMWENCKLPQRSELPRKLQDLGLKPASVDPATIKKQGSTRVEAKK
                     RKQRKGKITNTHMAGILKDYSDRV"
     gene            791173..791269
                     /locus_tag="AGOS_AgSNR42"
                     /old_locus_tag="AgSNR42"
                     /db_xref="GeneID:4619781"
     ncRNA           791173..791269
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR42"
                     /old_locus_tag="AgSNR42"
                     /product="AgSNR42"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR42; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149387.1"
                     /db_xref="GeneID:4619781"
     gene            complement(<791294..>792340)
                     /locus_tag="AGOS_ACR245C"
                     /old_locus_tag="ACR245C"
                     /db_xref="GeneID:4619782"
     mRNA            complement(<791294..>792340)
                     /locus_tag="AGOS_ACR245C"
                     /old_locus_tag="ACR245C"
                     /product="ACR245Cp"
                     /transcript_id="NM_209000.2"
                     /db_xref="GeneID:4619782"
     CDS             complement(791294..792340)
                     /locus_tag="AGOS_ACR245C"
                     /old_locus_tag="ACR245C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL147C"
                     /codon_start=1
                     /product="ACR245Cp"
                     /protein_id="NP_983647.2"
                     /db_xref="GeneID:4619782"
                     /translation="MRRSFSILQTLGSKSRGHGAELSKELRTTLRYLGREPSLLSSLL
                     SRERVEEEHVVELLNRGLPDAKSGQERVGEHYAQLLGRLGRAVEQHEARGTLAEQVRT
                     CGTDGAALVALLEHAVADGAGPREMAQVVLSAHFGAAQARAAVGAVGRCATHGADLAL
                     LLCYRARERVWYEQWRGRWLAGYGELHSLSQKMLWRTMVALEDMAAVNAGLESLGALC
                     DARQVVMVHQVLHAHAHLLTPALLEVSLARNQLLFCKAMRLLAGHASARSTRWAAALV
                     RASISHKLAVDMTAPGAVSVQQYAFASAMHDVLAAVADGSPDSHLRDGAGALLRELHR
                     ADGEKPQPVLNFLS"
     gene            <792704..>793990
                     /locus_tag="AGOS_ACR246W"
                     /old_locus_tag="ACR246W"
                     /db_xref="GeneID:4619783"
     mRNA            <792704..>793990
                     /locus_tag="AGOS_ACR246W"
                     /old_locus_tag="ACR246W"
                     /product="ACR246Wp"
                     /transcript_id="NM_209001.1"
                     /db_xref="GeneID:4619783"
     CDS             792704..793990
                     /locus_tag="AGOS_ACR246W"
                     /old_locus_tag="ACR246W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL146W (IDS2)"
                     /codon_start=1
                     /product="ACR246Wp"
                     /protein_id="NP_983648.1"
                     /db_xref="GeneID:4619783"
                     /translation="MSYGFSGSGGMGCSRPTTPELTKELNIPKDVASAMRKSLSYDFL
                     NVPGGDEQASPIGTPTTATAEDGADGLESETGDGPRAADEGGKGEFADYQLWHHHRGS
                     DVGVAKSQSSTYESLLEVMLGWDFSGKQTGGDKGAPRGSSEEALAVRQWLNPRSSFSA
                     ASTNEPELCLTASRKSSLMTLSRSASSAFERKCWITVCTSLADMQPILALRKSLQNIQ
                     SKYRLLVLYDAEQSDVAECLVSHDFYTLGITPLAPRLSAELASDGTLLPRWLLLAAWH
                     ELNGAYDDVCYLSPYLLAVASIDELLDFNDEIDNETCTLVVNRTRIPSVITFKPHNEI
                     RMVFDEYLTVYGADLEKLEKLRGLSDWGILSELFSESCHRLSDRYGVDVGDDSLPVMR
                     GVKVLDFGHVKPWLHAADDKNAYVRLWWSFWDNGTV"
     gene            <794319..>795206
                     /locus_tag="AGOS_ACR247W"
                     /old_locus_tag="ACR247W"
                     /db_xref="GeneID:4619784"
     mRNA            <794319..>795206
                     /locus_tag="AGOS_ACR247W"
                     /old_locus_tag="ACR247W"
                     /product="ACR247Wp"
                     /transcript_id="NM_209002.1"
                     /db_xref="GeneID:4619784"
     CDS             794319..795206
                     /locus_tag="AGOS_ACR247W"
                     /old_locus_tag="ACR247W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL145W (SFH5)"
                     /codon_start=1
                     /product="ACR247Wp"
                     /protein_id="NP_983649.1"
                     /db_xref="GeneID:4619784"
                     /translation="MPSDMLQFPSENDRQTFERLVSELPDLIHKRCHDYDELYGHKLL
                     EEGPAEVAKFYSKDHAHALLFKFLKANAFSYEGAVKQLVSTLNWRREFQPLKAAFAEE
                     HDERLMAAGYISYDASAAPNTRTVTWNLYGKLGACKDLFADQDTFIRYRVGLMERGLQ
                     ALNLLDPDNCSMTQVHDYKDVSVWNMNADVKKCSRRVIAIFQDHYPELLYAKYFVNVP
                     TILRWVYDVVRAFVSEETSRKFVVLNDGTKLAAYFAGVPAAYGGTAPATLAELPKPAS
                     RPSPYALFLLQKHISEELD"
     gene            <795539..>795964
                     /locus_tag="AGOS_ACR247CA"
                     /db_xref="GeneID:9487599"
     mRNA            <795539..>795964
                     /locus_tag="AGOS_ACR247CA"
                     /product="ACR247W-Ap"
                     /transcript_id="NM_001355307.1"
                     /db_xref="GeneID:9487599"
     CDS             795539..795964
                     /locus_tag="AGOS_ACR247CA"
                     /note="NOHBY336; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0C06204g"
                     /codon_start=1
                     /product="ACR247W-Ap"
                     /protein_id="NP_001342249.1"
                     /db_xref="GeneID:9487599"
                     /translation="MQVAGSKYETLRSAAAAKSGVAKQRQNKSTLQRRLRSLSGRQPK
                     RWHCESTPRQGVVIDESLAHLAMQQENNGFFYIIELPTPGTVLEDAPSPRYETEEPPA
                     WGTGDQDARPDPARRLQQACSIVVEELPDQEDIEMSDVY"
     gene            <796275..>796745
                     /locus_tag="AGOS_ACR248W"
                     /old_locus_tag="ACR248W"
                     /db_xref="GeneID:4619785"
     mRNA            <796275..>796745
                     /locus_tag="AGOS_ACR248W"
                     /old_locus_tag="ACR248W"
                     /product="ACR248Wp"
                     /transcript_id="NM_209003.1"
                     /db_xref="GeneID:4619785"
     CDS             796275..796745
                     /locus_tag="AGOS_ACR248W"
                     /old_locus_tag="ACR248W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL143W (TIM17)"
                     /codon_start=1
                     /product="ACR248Wp"
                     /protein_id="NP_983650.1"
                     /db_xref="GeneID:4619785"
                     /translation="MTADHSRDPCPLVVLSDFGGAFAMGVIGGCVWHGIKGFRNSPLG
                     ERGSGAMSALKARAPVVGGNFGVWGGLFSTFDCAVKAVRKREDPWNAIIAGFFTGGAL
                     AIRGGWKHTRNSAITCAALLGVFEGVGLMFQRYSAWQAKPMAPPLPDQPQPMQA"
     gene            complement(<797013..>798944)
                     /locus_tag="AGOS_ACR249C"
                     /old_locus_tag="ACR249C"
                     /db_xref="GeneID:4619786"
     mRNA            complement(<797013..>798944)
                     /locus_tag="AGOS_ACR249C"
                     /old_locus_tag="ACR249C"
                     /product="ACR249Cp"
                     /transcript_id="NM_209004.1"
                     /db_xref="GeneID:4619786"
     CDS             complement(797013..798944)
                     /locus_tag="AGOS_ACR249C"
                     /old_locus_tag="ACR249C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL141C (YAK1)"
                     /codon_start=1
                     /product="ACR249Cp"
                     /protein_id="NP_983651.1"
                     /db_xref="GeneID:4619786"
                     /translation="MKEERKSIWNPAFDMSAGAAKTGKVLGRQSFRNPWGEPGSPAGR
                     RQSGFQQLATTFEEGQGEEERARRRSSLIVPPTRAAGPEPLLRETYGDSWGYGSEFQR
                     RQSVAVAGTYHSPGYFETGAQQPSTSPSLMVAHAVPYRKLSAYPPLAGALVPAASLNS
                     TLRGSAGGVAAAVPQMRKVGARQELAPVLHAMPKFRRASLNSKTVSPLIALTKSLIIT
                     YSLCSDEFSYQTSKNPKRLLTKPSEGKLNNGHDNINSDYILYVNDVLGMEQQRKYLIL
                     DILGQGTFGQVVKCQNMQTKEIVAVKVVKSKTEYLNQSIMEAKILELLNKRIDPLNQH
                     HFLRLHDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSMNLIKNFCKQLLDSLCVLK
                     ESKLIHCDLKPENVLLVSPDRPELKVIDFGSACEEARTVYTYIQSRFYRAPEVLMGIP
                     YSTSIDMWSFGCIVAELFLGIPVFPGASEFNQMTRIVEMLGVPPPWMCEMGKNTYNFF
                     RKLHPQEKAWALKTVDEYNVEFNASEEVGKQYFKWTKLDDVIRNYRISKKIGASSQLL
                     EREMQDRQCLTHFLFGVLNLNPLERWTPQQALLHPFITGQPFDKEWYPPGTLPKKVNK
                     LPSLQDGATKELNKLHLGE"
     gene            <799205..>799783
                     /locus_tag="AGOS_ACR250W"
                     /old_locus_tag="ACR250W"
                     /db_xref="GeneID:4619787"
     mRNA            <799205..>799783
                     /locus_tag="AGOS_ACR250W"
                     /old_locus_tag="ACR250W"
                     /product="ACR250Wp"
                     /transcript_id="NM_209005.1"
                     /db_xref="GeneID:4619787"
     CDS             799205..799783
                     /locus_tag="AGOS_ACR250W"
                     /old_locus_tag="ACR250W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL140W (RPB4)"
                     /codon_start=1
                     /product="ACR250Wp"
                     /protein_id="NP_983652.1"
                     /db_xref="GeneID:4619787"
                     /translation="MNVSTSTISTKRRGLKKVVEEENAATLQLGEEFQLRQINHQGQE
                     EELIALNLSEARLVIKEALQHRRRVFGQWRDGLEEDEADGEHNMTQEKELAMLDKLLE
                     KTTGGQNQALKQTMVYLTNFARFRDQETVTAVTQLLASTGLHPFEIAQLGSLACEDAD
                     EAKTLVPSLGNKISDEDLERILKELSNLETLY"
     gene            complement(<799788..>801026)
                     /locus_tag="AGOS_ACR251C"
                     /old_locus_tag="ACR251C"
                     /db_xref="GeneID:4619788"
     mRNA            complement(<799788..>801026)
                     /locus_tag="AGOS_ACR251C"
                     /old_locus_tag="ACR251C"
                     /product="ACR251Cp"
                     /transcript_id="NM_209006.1"
                     /db_xref="GeneID:4619788"
     CDS             complement(799788..801026)
                     /locus_tag="AGOS_ACR251C"
                     /old_locus_tag="ACR251C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR061W (KTR2) and YJL139C (YUR1)"
                     /codon_start=1
                     /product="ACR251Cp"
                     /protein_id="NP_983653.1"
                     /db_xref="GeneID:4619788"
                     /translation="MRNRWSHLLLVLFAGATILALLGRLKNVGERSLDQWYAARSYEI
                     LHKFDNVRRYDQLFRPPKMSTNSYVDLLEFRPLVADGPRENATLLMLCRNWELPGVLS
                     SMRSLEDRFNSRFHYDWVFLNDVPFDVDFVEATSAMASGRTFYGLVPDEDWNTPRWID
                     PLRYEECLQDMLAKDVPYGGSRSYRNMCRFNSGFFFRQELLDNYDYYFRVEPNVEYFC
                     DFPYDPFRVMREHRKKYGFVITLTEYEQTVPTLWQAVRAFAAEHPELVDLATNLHEFV
                     TSGPAAPSALADLEYNLCHFWSNFEIGDLNFFRSPAYLTFFEHLDRAGGFYYERWGDA
                     PVHSLAAALLLRADEVHHFEEIGYFHVPYGTCPSAHVARLAQRCVCNFGREAVDIEHT
                     SHSCLDHWWRRGGGKFFLSM"
     gene            complement(<801169..>801975)
                     /locus_tag="AGOS_ACR252C"
                     /old_locus_tag="ACR252C"
                     /db_xref="GeneID:4619789"
     mRNA            complement(<801169..>801975)
                     /locus_tag="AGOS_ACR252C"
                     /old_locus_tag="ACR252C"
                     /product="ACR252Cp"
                     /transcript_id="NM_209007.1"
                     /db_xref="GeneID:4619789"
     CDS             complement(801169..801975)
                     /locus_tag="AGOS_ACR252C"
                     /old_locus_tag="ACR252C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR060W (UTP30)"
                     /codon_start=1
                     /product="ACR252Cp"
                     /protein_id="NP_983654.1"
                     /db_xref="GeneID:4619789"
                     /translation="MDAPIDAEGLASKALNALLKQCAADPALSRDAHVQLVINTKKPM
                     GTKNDYVPRIIPLQHCRLQKPSSLRILLVVKDPSTPYRNALKADSATSELFADIISVK
                     RLKTKYRGAKLSELFRQFDMVVADHRVQHLLPHILGSAFYRSNKKVPFVVQLSRQPQP
                     SRSGAPDDVDPKYVRAQLRSICRNTWYLPTPDNCLTVRIGVVGVHRPEEMLHNIEDVV
                     KFLCDKNQRPQGGAIRGGVKSLFVKTSNSVSLPIYKASEKPVEFEDQIRL"
     gene            complement(<802229..>803419)
                     /locus_tag="AGOS_ACR253C"
                     /old_locus_tag="ACR253C"
                     /db_xref="GeneID:4619790"
     mRNA            complement(<802229..>803419)
                     /locus_tag="AGOS_ACR253C"
                     /old_locus_tag="ACR253C"
                     /product="ACR253Cp"
                     /transcript_id="NM_209008.1"
                     /db_xref="GeneID:4619790"
     CDS             complement(802229..803419)
                     /locus_tag="AGOS_ACR253C"
                     /old_locus_tag="ACR253C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL138C (TIF2) and YKR059W (TIF1)"
                     /codon_start=1
                     /product="ACR253Cp"
                     /protein_id="NP_983655.1"
                     /db_xref="GeneID:4619790"
                     /translation="MSDSITNPENSEIQTNYDKIVHKFDELKLKEVLLRGIYGYGFVD
                     PSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDESIKAPQALILAPTREL
                     ALQIQKVVMALALHMDVKVHACIGGTDPREDAEALRAGAQIVVGTPGRVFDMIERRNF
                     KTDHIKMFILDEADEMLSSGFKEQIYKIFTMLPPTTQVVLLSATMPKEVLDVTDKFMN
                     KPVRILVKKDALTLEGIQQYYINVESEEYKYDCLSDLYDSISVTQAVIFCNTRRKVEE
                     LTKRLTDDSFTVSAIYSDLPQAQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVI
                     NYDLPNNKENYIHRIGRGGRFGRKGVAINLVTDRDVGDMRELERFYSTQIEELPANIA
                     DLFD"
     gene            complement(<803742..>805535)
                     /locus_tag="AGOS_ACR254C"
                     /old_locus_tag="ACR254C"
                     /db_xref="GeneID:4619791"
     mRNA            complement(<803742..>805535)
                     /locus_tag="AGOS_ACR254C"
                     /old_locus_tag="ACR254C"
                     /product="ACR254Cp"
                     /transcript_id="NM_209009.1"
                     /db_xref="GeneID:4619791"
     CDS             complement(803742..805535)
                     /locus_tag="AGOS_ACR254C"
                     /old_locus_tag="ACR254C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL137C (GLG2) and YKR058W (GLG1)"
                     /codon_start=1
                     /product="ACR254Cp"
                     /protein_id="NP_983656.1"
                     /db_xref="GeneID:4619791"
                     /translation="MLVGIATLLYSADYLPGAFTLAFRVRELLVESREHRLVLLATPE
                     VLDNVSEDVLRALHELYDEVIRLAGDESASKTALARHRTNLAALGRPELADTFHKLQL
                     WKLTQFRKVLYLDCDAFPLHSGFLEAVDQVPDQAPRQLAAVPDCGWPDLFNSGVMVLV
                     PSLAVHGELAAHVETALSIDGADQGLLNLFFNRACHRGTLPNEWRTLPFLYNVTVPNA
                     GYQATPALDYFRRRIAVVHFIGHEKPWISRGVSDSFRELWWQTYNRFLARHFSCPAFS
                     TGNASEGPDVSAPQADGTQSWAPAPESRQAARAFAARPAAPAHDPYSSAPVCESHAGT
                     PVYESHAGAPAFESHSGAPAFESHSGAPAYESHAGAPAAEQQPQAYSQSWAPLPSPQP
                     PAPAPKTHLWTPMQEPQLAVPSCPEPLPSAPCAWDGTKEPPSKDAPPEAYKLALVGTY
                     SWSTASPTLVPEDALLAESASLGSPFHSCKSTDKLPLCNPSPGPPRPAPAAAPRPPGI
                     HLPAPAAPARPRPVRSSLQPAPELLRPEPPAVAPAAASSSAAPAPPAAPAADPAPTEA
                     PRASPAPAAAAAPPLFPWERYKPKSTRVFPE"
     gene            complement(<806045..>806381)
                     /locus_tag="AGOS_ACR255C"
                     /old_locus_tag="ACR255C"
                     /db_xref="GeneID:4619792"
     mRNA            complement(join(<806045..806284,806358..>806381))
                     /locus_tag="AGOS_ACR255C"
                     /old_locus_tag="ACR255C"
                     /product="40S ribosomal protein S21"
                     /transcript_id="NM_209010.1"
                     /db_xref="GeneID:4619792"
     CDS             complement(join(806045..806284,806358..806381))
                     /locus_tag="AGOS_ACR255C"
                     /old_locus_tag="ACR255C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL136C (RPS21B) and YKR057W (RPS21A); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S21"
                     /protein_id="NP_983657.1"
                     /db_xref="GeneID:4619792"
                     /translation="MENDKGQLVELYVPRKCSATNRIIKAKDHGSVQINIAQVDENGH
                     AVPGEYITYALSGYVRARGEADDSMNRLAQKDGLLKNVWSYSR"
     gene            complement(<806630..>808408)
                     /locus_tag="AGOS_ACR256C"
                     /old_locus_tag="ACR256C"
                     /db_xref="GeneID:4619793"
     mRNA            complement(<806630..>808408)
                     /locus_tag="AGOS_ACR256C"
                     /old_locus_tag="ACR256C"
                     /product="ACR256Cp"
                     /transcript_id="NM_209011.1"
                     /db_xref="GeneID:4619793"
     CDS             complement(806630..808408)
                     /locus_tag="AGOS_ACR256C"
                     /old_locus_tag="ACR256C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR056W (TRM2)"
                     /codon_start=1
                     /product="ACR256Cp"
                     /protein_id="NP_983658.1"
                     /db_xref="GeneID:4619793"
                     /translation="MFIRRTVLKSIPPLQFHLLRRYTMATDPKLATFPAGSPANVGID
                     GAAAEMKRPGSPTDLKTQPKKKARKPKKYKAKPVDPTSPAGVLQFEIDELLREQGLSR
                     VQVETDVTPILNDVRGGPMQQKYNRRLIDVHVLKLTSSGDGLAIVDSPEDSNKKQLVL
                     VPFGLPGDVVTIQVHKTHPHYAEASLLEVQTSAEMRHDDLINCKYFGKCSGCQYQFLT
                     YDQQLQLKQRTVSNAFKFFAPQLLAEGLLPTVGETVASPLQFAYRTKLTPHFDMPRKV
                     KQLETRPPLGFGQKGRPTWRHSDAGGSAAILDIEDCPIGTEIIRRGMRNERARFEETF
                     KNYKKGATILLREHTKVLNPAAPVEEQLDPGSCDPVSGQVSHLRVDADPPLLKLCTTN
                     TRQIVTEYVDGCTFEFSAGEFFQNNSSILPVVTAYVRDNVRIPNSGPEDKHYLVDAYC
                     GSGLFSITASKGVDRVIGVEVSADSVAFAERNAKTNGVTNCTFIVGKAEKIFASIDTP
                     CDRTSVILDPPRKGCDDVFLKQLAEYNPARIVYISCNVHSQARDVQYFLKETPNGARY
                     KVDSIRGFDFFPQTHHVEGVCVLSRD"
     gene            complement(<808660..>809439)
                     /locus_tag="AGOS_ACR257C"
                     /old_locus_tag="ACR257C"
                     /db_xref="GeneID:4619794"
     mRNA            complement(<808660..>809439)
                     /locus_tag="AGOS_ACR257C"
                     /old_locus_tag="ACR257C"
                     /product="ACR257Cp"
                     /transcript_id="NM_209012.1"
                     /db_xref="GeneID:4619794"
     CDS             complement(808660..809439)
                     /locus_tag="AGOS_ACR257C"
                     /old_locus_tag="ACR257C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR055W (RHO4)"
                     /codon_start=1
                     /product="ACR257Cp"
                     /protein_id="NP_983659.1"
                     /db_xref="GeneID:4619794"
                     /translation="MSAGPLQAAPKKNYGALIGAGPAVGGAAFNRTLSEVASYERSRR
                     DHATPDYRIKIVVVGDGATGKTSLLMSYTQGQFPEDYVPTIFENYVTNIEGPRGKVIE
                     LALWDTAGQEEYSRLRPLSYGDVDIVMVCYAADNRTSLTNAEELWFPEVRHFCPHAPM
                     MLVGLKSDLYSLDALDRLVDPTDAELVARKMGAFVHLQCSAKTRQCLEDVFNTAIHTA
                     LYDELRAPPQRGVKGMFKKKQQRDPQAQSYKRVRKHRCVVL"
     gene            <809741..>821992
                     /locus_tag="AGOS_ACR258W"
                     /old_locus_tag="ACR258W"
                     /db_xref="GeneID:4619795"
     mRNA            <809741..>821992
                     /locus_tag="AGOS_ACR258W"
                     /old_locus_tag="ACR258W"
                     /product="ACR258Wp"
                     /transcript_id="NM_209013.1"
                     /db_xref="GeneID:4619795"
     CDS             809741..821992
                     /locus_tag="AGOS_ACR258W"
                     /old_locus_tag="ACR258W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR054C (DYN1)"
                     /codon_start=1
                     /product="ACR258Wp"
                     /protein_id="NP_983660.1"
                     /db_xref="GeneID:4619795"
                     /translation="MTDDQVAQALVGYVFNVAKLFLKLGAEQDAFARTHGAKFEEWVG
                     NGNMRTLFLVKDEEGEVQVLEELEGPEAEGPEQSGRLLLIKNRPFVDGSAPMESQVQV
                     LHLPPRAHFDGFKSFVSFGVATMFDAVVSTNSNLEAKQESINSARRKIKDLSLSLQSL
                     QQFIEVPDISATAHPLIKKIIAEGANPRNYTTYISDEQFADSQFLNSLQKIANGWIKS
                     AQNLTKLTRNIEDGSATDEIRFWINLEQSLLALEKQIAIPEVEITLSILTAAKRFHAT
                     VTFISDTGLRDRILETQSYNQIMSDFPLADLQTATSFTKLGEAIESISIALKKLKVST
                     YPLARAVTFVEKISTELDQKLREMLPNLISSDFISFQEDYDHCIKIINQWEALLKEFT
                     SLIRELMRKRSEKFIFMKIDTQTDSLKEVLNTVAAFRKKHDILIHVLKGIGYDTLSED
                     IQSIYEPVQYQDPLRDNASKWANAEAAYNQRVSLLENKLVDMLKKKLDDCKSSDSMFS
                     IFEKYRPLMKRPRIQGAVREYQHELLHNVKDDLEHIHQQLSLQKWNSELSRLNDIPPV
                     SASIIWSKQLTKKLQNLTSRLGLILGEDWISTSEGSQIFVECSSIMKVLNTDKLFETW
                     VSNVSSQNFLLDEPIFKILITNEEYELHVNFDSVVGSLFKEVRNLMWMGFNVPSNIIK
                     NSRRVRSLYPHAVMVSELLQTFVSAVQSFQERPHTWLLLKDETENIWQLLSAMITDTW
                     DSVPLFEDDASHERAEDIQRDEPSILRLEHSIGELLSKFQQLDGLEKGLSSCLQQLEV
                     FGKLDLQNLEVLINKIQLLVDQATLHGFHNMSGFIDYLNTRIRSYLVSTVSKILEESQ
                     LSPKKHYILQQGKKVTISPSIEETKKAWMRDFQKTLEVATNLPKITDKKFDITEGQME
                     NFTDIGTDLSESLIKAFLRIEDACHAIDEHFQKWKKLELLWCLDELTLLERLGSDVEV
                     SYRFLLDFMEERKAIDMVDSEITIAGDTMINNEQVYVRVSAKYDNWQRVLCEKLLENY
                     MDHASEFDTQLVHSRRLLETSIINLGSLSKTTELIAYVDDIKNNLDLMFTRYSLLLNT
                     QKLLQKLRFRIPQNFIHAEQIESDLVSLREICLRKEDLINKNRDAISNKLEAELLKIQ
                     EVANSLSQSWSKKKPLSVSIQPSEALSVLNTFEDSIAKVNTERELINRAAKILLVPIK
                     LQNVLSPVIEEVNDYKAVWSSVDGLWNSFNATLSVKWADFESTAVKHRLEALMKKCQD
                     MPPKVLQYKIFQNIAGSIEATLKSMHLLKALKEPAIKPRHWSILFKQLGASHIVSGNI
                     DDQTFTLEDILQLNILLNEVSVKKIVIKARNENVLESSLSQMKARWRATKFDQFVHSS
                     GLVLVKGWDVIFSNCNDDLNMITSMKNSPYFKVFEQEALEWETKLSNFYDIVLSWVEV
                     QRQWMYLFGILAKKTEMKNLLPIEASKFASLTSEYNSLLLKLYGSEIAIDILHVHSTL
                     PTLKRMAESLTKIRKSLNDFLETQRRLFPRFYFVGNEDLLQIIGAGDNFSEFSRHLSK
                     LFSSVSDFIYDESLIQGVYSLEGETLLFANPVRVTPSSKLDQWMNEVDLEIKLTLSTL
                     VKNCLESYRTSGSLKHIIEKYPFQALLLALQCTWTNKIETSMTKDNFGSICSSIDEEM
                     ASLAAVIDSYPTVTEKRKVESLIVELVHLKTITETLKNVELEQIDFHWKQTQRFYWDD
                     NSNDPLNSITIEQSCVSFCYGFEYIGVPERLIYTPLLDSCFNAMVLALSEHMGGCPFG
                     PAGTGKTETIKALGQNFGRMVLVFNCDDSFDFQAMSRLLFGITQVGAWGCFDEFNRLE
                     EKILSAVSTQVEAIQLSLVQGKPEIEVLDKKGSLNSNTGIFITMNPGYAGRSELPENL
                     KKMFREFAMMKPDALVIAEVILTILGLENPRVLAEKIVSLFKLLNDKTTSQKHYDFGL
                     RALKSVLRNCLTILRSTTDLDSTQVLLRSLNEMVVPKLISVDEAVYEEAIADFFPGSR
                     IKPSNEQLLSYLASYCESNQLVASDLFIKKCSQFYDIQKTQQAIILAGDAGTGKTSVW
                     KSVINSMKRSGAKENIVYIIDTKTLKKEDLYGKLDPVTFDWKDGIFTHLLRKTLLDTM
                     GNFKNSNIWIVFDSDLDPNYTETLNSVLDDNKVLTLPNGERLKIPPNLHILFEVQDLE
                     HATAATVSRCGMIWFANNTLAAQDILISCLSREVATLQQDADVHDNIIATIQDIFAQF
                     IQGSTLGNVIEATYKADHIMGVDFCRFIETAVTLLSCDIKKNKKQLSRLSQVACVRYM
                     SKRLALVLIWAFVGGSDLETREKFSETICELLGISDIPTGSKFLLDYDVSVATQDWVP
                     VSAEVPKTSLESHEVLIPDLIIPTVDTVRHETLLFDLLNADRPLILCGPPGSGKTMTL
                     YNTLKRSDRFNIIGINFSKDTSVELFLKTLEQHTICTPTSRGIIMQPKAHGKQLVVFC
                     DEINLPMLDEYGSQPVILFLRQLIEKRGFWNVQESKWVFIERIQIVGACNPPGHAGRV
                     SITPRFLRHASIVMVDYPGQIAMEQIYETFFNAIFKLTPKLKGFASDFTKASLQVYYD
                     CKATYTSEAHSHYIYSPRELTRWVRGIHFTISDSGNIDLAYMLELWAHESLRLFSDRL
                     VSSSEKNIFQSILQNAITTHFPNQPLGSLESSQLLFSNWLSLNYSKVVKSEMYTFIKE
                     RLKTFAEEELDTELTIYDDMIDNILRIDRILKQVQGHGILVGPNYSGKTTITRFVAWM
                     NGIKVVRPTIHRHFTIENFDEFLKQMLLRCGTESEKICLIIDESNILETSFLERMNTL
                     LANSDVPGLFEADEYEALLSKIGQRISQLGLLLDTEQEMYDWFTSEISKNLHVIFNIN
                     DPDNRESTQLITSPALFNRSVINWIGTWSSRSCLHVVNEVIKNMPLDRADYTIPHHAA
                     ANLIVPDGNLVTIRDVVANLFVLFHEQYHRLLGNSQGSPSAFLTSLRRFQSLYMSKLK
                     ELEEHQRFTLVGLEKLKDTVIKVKQLNQSLSQKQVELQQKEKEARDTLDKMLVDQNEA
                     ERKQEASVEIQKILALQEKEINERRKIIMADLAVAEPAILEAQRGVKNIKKQQFTELR
                     SMLNPPDAVKTTLEAVCVILGYSCKTWKDIQLAIRKDEFVTDIVYYNTETMMTPAMKQ
                     DIETDYLSRPKFNYESVNRASLACGPLYQWIVAQISYSEMLVKVTPLKEEMVKVENEM
                     LQNKARLMAAGEMIKELQTSIESSKVSYSKLIREVEITKTEMESVQSKVERSIKLMES
                     LTGEKERWIKNTEHFKDWNKNLIGNCFLSSLYESYCGPHDQSLRLKLFTIWSNTLAKF
                     GIEYEPTYSFITDMVNPLTKVNWVACGLPDNELFVANFHIAMNSCHYPYVIDPSSTIV
                     DTFANFYGRKMMITSFLDVGFVKQLENALRFGGCILIQDGEFFDPIISHLIAKEFKKA
                     GGRLTVQIGDHEVDVSTSFQLIIHSKDPNSYMSSFVKTRMAVINFTVSKGSIEAQALQ
                     ITLEKENPELQKQRTDLLKLNGEYKLHLRSLEDKLLESLNESDGSILENDSLISTLEQ
                     LKIESSEIAKKIEETNTVIVKVEDLVNEYNVLGEQSVLIFNLLESITQWHWFYQIPIE
                     QFMECFSSIFATKTRENMTRSEHLLLALYEHVYMWFSHVFKDRDRMAFGILLFASYHH
                     SRESKFFSEHFWKIIEGIASDTLGTVEHITDTKLEQLVAAANEKDYLKGLKSLLEFLP
                     ESSWHDSVPKYQNIIVACERGVDGTFKVQQLAQEMGKTVHSVALGSAESISMAEQDLI
                     QYSGEGKWLLLQNLQMSHEWANTVLPKKLESIKANPDFRVFMTCGIQSKPLVVPLLSR
                     SYKIAYEGEPGVLNTVCELWRTQSEELKNVKPVEKLHSKFILVWFHSIIMARCRLAPI
                     GFTKKYDFHDGDFHAGSKFLDHIFEQSSNGKEHVDPDLVPWKLVSDTIGKIIYGGKVD
                     DPADLDWCKRSARRMFSSDAYLNNFEVVQGLTVPIDRSSYSQYDKWFKSLDAAAERTT
                     AWLELSDASALQNFYAHEARMICKKIIQTNGPTSLIH"
     gene            <822179..>823393
                     /locus_tag="AGOS_ACR259W"
                     /old_locus_tag="ACR259W"
                     /db_xref="GeneID:4619796"
     mRNA            <822179..>823393
                     /locus_tag="AGOS_ACR259W"
                     /old_locus_tag="ACR259W"
                     /product="ACR259Wp"
                     /transcript_id="NM_209014.1"
                     /db_xref="GeneID:4619796"
     CDS             822179..823393
                     /locus_tag="AGOS_ACR259W"
                     /old_locus_tag="ACR259W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL134W (LCB3) and YKR053C (YSR3)"
                     /codon_start=1
                     /product="ACR259Wp"
                     /protein_id="NP_983661.1"
                     /db_xref="GeneID:4619796"
                     /translation="MTAQASDNIPNIRGRRPRGVSDHSGAKLPQYDPGSHPPGYFKPY
                     MSAFRFKCREYLLPFTANQSDYIALLQRQYRTPWRDSYFAYTALLGSHMFYVIALPIP
                     RWLGYGVVTRDLVYVLGYSIYITGYLKDYFCLPRPASPPCHRIALSKYTTKEYGAPSS
                     HCANATAVTLLFLVYAWRSRMDCSALQFFLCLVLLAVYYVTLTLGRIYCGMHGLLDIV
                     TGSAIGVFCFTVRLITRDYLSFDQATAQFSWWFPFFAVAIGLLMLFYHVEPVDPCPCF
                     EDSVAFIGVITGIEAAEWLFPRLFHETTSQYLVFQWSYVAIPAACARIVAGILCVLLW
                     KSVLSKKLVYSLLSVLMTDDRPAAHAEHPRTGHVRPLVPRIDILGRFFVYMGVPMTVI
                     IVCPTVFALLGI"
     gene            <823888..>824823
                     /locus_tag="AGOS_ACR260W"
                     /old_locus_tag="ACR260W"
                     /db_xref="GeneID:4619797"
     mRNA            <823888..>824823
                     /locus_tag="AGOS_ACR260W"
                     /old_locus_tag="ACR260W"
                     /product="ACR260Wp"
                     /transcript_id="NM_209015.1"
                     /db_xref="GeneID:4619797"
     CDS             823888..824823
                     /locus_tag="AGOS_ACR260W"
                     /old_locus_tag="ACR260W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL133W (MRS3) and YKR052C (MRS4)"
                     /codon_start=1
                     /product="ACR260Wp"
                     /protein_id="NP_983662.1"
                     /db_xref="GeneID:4619797"
                     /translation="MDPPELDYEALPENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTR
                     MQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAVYFATYE
                     MCKSRLIDPEDRQTHQPLKTALSGTLATVAADALMNPFDTIKQRLQLHPSDSMTKCAV
                     RMYQREGIAAFFYSYPTTIAMNIPFAALNFVIYESSTKIFNPSNNYNPWIHCLCGGIS
                     GATCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLK
                     PRIISNMPATAISWTSYEFAKHLLFTNSNAHLDNH"
     gene            complement(<825055..>826278)
                     /locus_tag="AGOS_ACR261C"
                     /old_locus_tag="ACR261C"
                     /db_xref="GeneID:4619798"
     mRNA            complement(<825055..>826278)
                     /locus_tag="AGOS_ACR261C"
                     /old_locus_tag="ACR261C"
                     /product="ACR261Cp"
                     /transcript_id="NM_209016.1"
                     /db_xref="GeneID:4619798"
     CDS             complement(825055..826278)
                     /locus_tag="AGOS_ACR261C"
                     /old_locus_tag="ACR261C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR051W"
                     /codon_start=1
                     /product="ACR261Cp"
                     /protein_id="NP_983663.1"
                     /db_xref="GeneID:4619798"
                     /translation="MSAACLASWVVTACIVASVCSVVLSAHTMWSQLINYRKPQQQRL
                     VLRIQLMVPIFSLTCFIAVVKPDIAMVLIDPVREIYESFVIYTFFSLLTLLLGGERNI
                     LVNLAPEQKRIQHPIPVVGRWVLPMVDMADPKAFLAVKRGILQYVWFKPVYCLGMSAF
                     QVLEWDLGCKWLTLVYNASASWSLYNLALFWKCLYNELRKYNPWPKFLCVKLIIFASY
                     WQGMVITLLHYLNVIQDCEGTNMGYVYHNVALCLEMVAFALAHRWAFSWTEYSAQNIP
                     LGARMHFWYAVRDWLGWKDLIWDFRTTFIGSDYTYRNFDAANTNPEGRIKRINDGLRY
                     TNCGAERHWINDKQPRYGSMDEDSWVDLASELPIYVPEDQNYPVVWDARSYRYTRGIR
                     QLRENIIRERTSSAV"
     gene            complement(<826557..>827507)
                     /locus_tag="AGOS_ACR262C"
                     /old_locus_tag="ACR262C"
                     /db_xref="GeneID:4619799"
     mRNA            complement(<826557..>827507)
                     /locus_tag="AGOS_ACR262C"
                     /old_locus_tag="ACR262C"
                     /product="ACR262Cp"
                     /transcript_id="NM_209017.1"
                     /db_xref="GeneID:4619799"
     CDS             complement(826557..827507)
                     /locus_tag="AGOS_ACR262C"
                     /old_locus_tag="ACR262C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL131C (AIM23)"
                     /codon_start=1
                     /product="ACR262Cp"
                     /protein_id="NP_983664.1"
                     /db_xref="GeneID:4619799"
                     /translation="MFRRIVAVPSSWSSLQLFSTSAVRSSNGLAAILEQVSAKKSAPR
                     EAKTPSKYADRKPQHSSPVRKKKVFVRWTTGSEKAREIANTVVSEVLSIRSDGRLRLI
                     LPEENRIQELSMQDVARQLDLEVHSLRFIKSETDAGGRPLPLVKRVSVREAFRVHAER
                     MAAEREKELLRKGVSARRVGAKERRAPDSKQVRISWQISPTDFSNQKSKEIRGHLERG
                     HTVLVLLANKDASGPAPQVSPRELQRRSSLLDELAAILEDINCSVVRSGDPASRVELK
                     LVPKAPQEVDRHALKEQRRLQRAEKLKRRLERRGPASAQE"
     gene            complement(<827823..>834545)
                     /locus_tag="AGOS_ACR263C"
                     /old_locus_tag="ACR263C"
                     /db_xref="GeneID:4619800"
     mRNA            complement(join(<827823..834491,834543..>834545))
                     /locus_tag="AGOS_ACR263C"
                     /old_locus_tag="ACR263C"
                     /product="ACR263Cp"
                     /transcript_id="NM_209018.2"
                     /db_xref="GeneID:4619800"
     CDS             complement(join(827823..834491,834543..834545))
                     /locus_tag="AGOS_ACR263C"
                     /old_locus_tag="ACR263C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL130C (URA2); 1-intron"
                     /codon_start=1
                     /product="ACR263Cp"
                     /protein_id="NP_983665.2"
                     /db_xref="GeneID:4619800"
                     /translation="MAKLTDLIPTAPVTPALDADHGRLMTLELKDGTALQGYSFGAPV
                     AAAGELVFQTGMVGYPESITDPSYEGQILVITYPMVGNYGVPDRQLMDELVESLPRYF
                     ESNRIHVAGLVVAHYTEKHSHWLAQSSLGQWLREEGVPAIYGVDTRALTKHLRDSGSM
                     LGRLAVQKADANLQEATGDQWRACFDVPEWVDPNVQNLVAKVSVNEPRLYTPRLESAV
                     RGPDGKILRVVAVDVGMKYNQIRCFVQRGVELLVVPWDYDFQEEEYDGLFISNGPGDP
                     SVLTELASRLSGALLEKKTPIFGICLGHQLLARASGASTLKLKFGNRGHNIPCTSTIS
                     GRCYITSQNHGFAVDVDTLADGWKPLFVNANDGSNEGIYHTELPYFSVQFHPESTPGP
                     RDTEFLFDVFINSILEHKNSGVLKSVEFPGGRVEDHLKAHPRQEPKKVLVLGSGGLSI
                     GQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVYFLPVTAEFVRKVI
                     LHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTSIDTIITTEDRELFANAMDE
                     INEKCAKSKAASTVDEALEAVKDIGFPVIVRAAYALGGLGSGFASNEQELVDLCNVAF
                     ASSPQVLVERSMKGWKEVEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTL
                     SDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKAT
                     GYPLAYTAAKLGLNIPLNEVKNSVTQSTCACFEPSLDYCVVKMPRWDLKKFTRVSTLL
                     SSSMKSVGEVMSVGRTFEEAIQKAIRSTDYSNLGFNETDMELNIDEELANPSDLRIFA
                     IANAFAKLNYSVEKVWQLTNIDRWFLEKLHSLITFGREVEAFGTKEALPRSLMKQAKQ
                     LGFDDRQIAKFLNSNEVAIRRVRKEYGIVPFVKQIDTVAAEFPAFTNYLYLTYNASEH
                     DLEFNDHGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRQNNVKTIMVNYNPETVSTDYD
                     EVDRLYFETINMERILDIYEVESSAGVVVSMGGQTSNNIAMSLHRENVKILGTSPEMI
                     DSAENRYKFSRMLDQIEVDQPAWKELTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNT
                     VYSKDDLESYLNQAVEVSREYPVVITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENA
                     GVHSGDATLIVPPQDLDPETVRRIVDATAKIGRALKITGPYNIQFIAKNNEIKVIECN
                     VRASRSFPFISKVIGVNLIEMATKAIMGIPVTPYPIEKLPDDYVAIKVPQFSFPRLAG
                     ADPVLGVEMASTGEVATFGHSKYEAYLKSLLSTGFKLPKKNILLSIGSYKEKQEMLPA
                     VQKLYKMGYKLFATAGTADFISEHGIPVQFLEFLNEDDEKSEYSLTQHLANNKIDLYI
                     NLPSANRFRRPASYVSKGYRTRRMAVDYSVPLVTNVKCAKLLIEALARNLTLDVSERD
                     AQTSHRTVTIPGLINISAYVPNISNVTQGPAELKEVTRLSVESGFTYSQIMPRSTVGP
                     VITNATSLKAAQSVCENSAYTDFGFTVAATANNVEEVASLANQATALFIPYRELTNKV
                     SLVAEHLKNWPVEKQIIAEAKTSDLASVILLASLQGRPIHITGVSHKEDLALIMTVKE
                     KMNNVTCDVNIHSLFVSQDDYPEALFLPTKEDQDFFWRNLQEIDAFSIGSMPTLLATV
                     TSNKVVTGLGIKEALPLLLSAVNDGRLTLEDIVERLHDNPAKIFNIPEQDAKVEIDLD
                     FTFRHTKRWTPYTKGGLTGGVERVLLDGQTVVLSGDLVASAALGEAVVPTSNNYTSTP
                     LLNAEPLHSFVPPSSSGKKRFSFSRERGNSFASAGDHEEAVIDQPLEQRLMSSRPPKE
                     LSPPSALRELVRAHNPFRGRNILSVNQFKRSDFHALFAVAQELRAAVEREGVLELMKG
                     RLLTTIFYEPSTRTSSSFIAAMERLGGRTVNINTSASSVKKGETLQDTIRTLACYSDA
                     IVLRHPDEMSAHIASKYSPVPIINGGNGSREHPTQAFLDLFTIREELGTVNGISVTFM
                     GDLKYGRPVHSLCRLLKHYQVRINLVSPKELSLPDGLRNELIDAGLLGIESESLTPEI
                     ISRSDVLYCTRVQQERFEREEDYLRLKNTYIVDNKILAHAKQQMVVMHPLPRVSEIRE
                     EVDYDHRAAYFRQMRYGLFVRMALLAMVMGVNL"
     gene            <835306..>837615
                     /locus_tag="AGOS_ACR264W"
                     /old_locus_tag="ACR264W"
                     /db_xref="GeneID:4619801"
     mRNA            <835306..>837615
                     /locus_tag="AGOS_ACR264W"
                     /old_locus_tag="ACR264W"
                     /product="ACR264Wp"
                     /transcript_id="NM_209019.1"
                     /db_xref="GeneID:4619801"
     CDS             835306..837615
                     /locus_tag="AGOS_ACR264W"
                     /old_locus_tag="ACR264W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR113W (AZF1)"
                     /codon_start=1
                     /product="ACR264Wp"
                     /protein_id="NP_983666.1"
                     /db_xref="GeneID:4619801"
                     /translation="MAPQSSSSAPTGAGQHDCSHRVGPSQQNRQDSMSIYTNFNQQRL
                     STDNSISSFLNIDSHGERGGGGSGGTGGGGGPASAGGGGSSTAGEMAYGRGYSIVNSW
                     PTASQGEPGRGSNGGSAFTTARRTSEQLEPFAMPRFKTPSYSQGRSASGGMGAIQLVS
                     GGGGGRNDSLPSSKRNSIFFGSAESTDLDFFNQAAGSAHGASGTGGSAGAANGSKMGP
                     PVLKPGPVPSQPTHHQSEDIDVFFNPSLSRKNSIKFNADDFADFQFKRRDSSVRATLD
                     NSNYAPGPPPPNANPKRTDQSLSPIGKEADEMGIDPEVAVADASGVDDVEETLKRHLS
                     PLMTGGSSNHRSVPAASATTGVAVNKHPITNDRRHEVNDEPKLKRQRTKKSVTSMSPV
                     SSSVSADHHIAAKLKEALSDDAETATIEDARPLLGATKVDQLMLVIQARKKGVTDKVP
                     RNPDGSLMLEDAPSIIPPPSQLVGGVEKPKSRGVKQHKCPYCHKCFTQSTHLEVHVRS
                     HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHMLTHE
                     NYKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQTLNRLTQKLAEMDPSEDMPTKERELL
                     EYFASLYKNSNRGIKGRGKGNTRIVPSIDTDEDSKNTGVQSHSRVQQQPPPFQESQAG
                     AVPAVTHMPDPTIVAARALGSLKPIAKKKSLSDLNYSLEMDDPKDPETNEFSFHEPAF
                     GTRRNDAPTPATENPSGTEVQFKNVFSSS"
     gene            complement(<837774..>838475)
                     /locus_tag="AGOS_ACR265C"
                     /old_locus_tag="ACR265C"
                     /db_xref="GeneID:4619802"
     mRNA            complement(<837774..>838475)
                     /locus_tag="AGOS_ACR265C"
                     /old_locus_tag="ACR265C"
                     /product="ACR265Cp"
                     /transcript_id="NM_209020.2"
                     /db_xref="GeneID:4619802"
     CDS             complement(837774..838475)
                     /locus_tag="AGOS_ACR265C"
                     /old_locus_tag="ACR265C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR115C (TRS33)"
                     /codon_start=1
                     /product="ACR265Cp"
                     /protein_id="NP_983667.2"
                     /db_xref="GeneID:4619802"
                     /translation="MDGSTRTSTETDAEEQARLQRQFRLFQEALPKVSAAAYQMLLGA
                     VVPTSAAVQRELEGKEVPAAAHQQLAQLAEDERERAEVSARVGQIGFQVGSKVTELLV
                     FSNNPGLHFGQMDLLGVMKFICREVWKHLFGKQIDNLKTNHRGTFYLFDYDYQPIRDF
                     ALEGEVSERELRMVEPYLHLPCGVIRGILASLGFGEEDTVSVTVSFVELPKERVATPH
                     QFPRGVNFNVQIAGK"
     gene            <838682..>840562
                     /locus_tag="AGOS_ACR266W"
                     /old_locus_tag="ACR266W"
                     /db_xref="GeneID:4619803"
     mRNA            <838682..>840562
                     /locus_tag="AGOS_ACR266W"
                     /old_locus_tag="ACR266W"
                     /product="ACR266Wp"
                     /transcript_id="NM_209021.2"
                     /db_xref="GeneID:4619803"
     CDS             838682..840562
                     /locus_tag="AGOS_ACR266W"
                     /old_locus_tag="ACR266W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR114W (BZZ1)"
                     /codon_start=1
                     /product="ACR266Wp"
                     /protein_id="NP_983668.2"
                     /db_xref="GeneID:4619803"
                     /translation="MSNISIGNDLKDSYTETRKWVIGNTKWLQDLASFYHERSKLERE
                     YGEKLAGLTKEYFGRKSNSTVVLSVGETPTITPGSLESASQVAWNEVLSQTENVAKDH
                     KRLAKEMQTQVADQLASLEKRCDLILNTIDGFNHELVNKRDYAYSCLEKAKKRYDESC
                     QAMEAARQKQSKSGSSSKAQRKVDEKEHEMNIAKNDYLIQINQTNRLKDKYYFQDVPE
                     ALDLLQDLNESRIRVLNSIWRRASDLEREAHKKIDERLSAADDVVGQNYPHLDTSMFI
                     KHNFREWKEPDDYQYVPSPVWHDDETFSVPSDVELHDLKIRLAKAQNSYNRLQLVVHD
                     EMSTLTQLNKKKQEMKLNAAVDPYEFQELLKKYLATVSSFTTHETSKLEAEVEIESIQ
                     NNVGDSHDLSKEGLDISRRFKKSSMFGMFKRATAPRSTGANDDISEMSVDVASKSSPK
                     HHGLSLFRSKRIRAQSTESSGMQSSTMDDSSSMMSISNEEHKGGNRVLFPYTKQDEDE
                     VTIAPGNSIVLLRQDDGSGWVKIRNASTQQEGLVPSTYVEINEHHSIGKPVPRAPPPR
                     KGAAPLKTVTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNY
                     CN"
     gene            complement(<841316..>842719)
                     /locus_tag="AGOS_ACR267C"
                     /old_locus_tag="ACR267C"
                     /db_xref="GeneID:4619804"
     mRNA            complement(<841316..>842719)
                     /locus_tag="AGOS_ACR267C"
                     /old_locus_tag="ACR267C"
                     /product="ACR267Cp"
                     /transcript_id="NM_209022.1"
                     /db_xref="GeneID:4619804"
     CDS             complement(841316..842719)
                     /locus_tag="AGOS_ACR267C"
                     /old_locus_tag="ACR267C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL116W (DMA2) and YHR115C (DMA1)"
                     /codon_start=1
                     /product="ACR267Cp"
                     /protein_id="NP_983669.1"
                     /db_xref="GeneID:4619804"
                     /translation="MAGESQRRRGQSINSILTSFGIRQQTNELNGGQGQHVQPMDIQP
                     VAAATGSQVSLGSNITPTVTVAAGGAGGGGNLASMLGTTPFDAEEAAAAGTEGSTNSA
                     TLVQAGVGAGAHLPITLVLGQSDAEASGNHNVSSAAFEGKDSGLASLKNVRHFIYPAV
                     PPADANKLNIELAHDGRTIEQQDENTIKMLKDKNGLFSLRLTPFIDHSTTNNPGLFFD
                     PIVRTAGPSSQLVIGRYTERVREAIGSLPDHFHPVVFKSKVVSRTHGVFKVDEQGNWY
                     VRDVKSSSGTFLNQMRLAQASVMSKDYPLKDGDILQLGMDFRGGTEEIYRCVKMRVEL
                     NKSWKRRANAFNKEALARLRNLQKLTAGLEEEDCSICLCKIKPCQAIFISPCSHSWHY
                     QCIRRLVMTQYPQFICPNCRSSCDLEASLDSEDEEEDEVGKEGHYKEEAAIESRTRSP
                     LAAAIQEENEEDIQMLS"
     gene            complement(<843117..>844775)
                     /locus_tag="AGOS_ACR268C"
                     /old_locus_tag="ACR268C"
                     /db_xref="GeneID:4619805"
     mRNA            complement(<843117..>844775)
                     /locus_tag="AGOS_ACR268C"
                     /old_locus_tag="ACR268C"
                     /product="ACR268Cp"
                     /transcript_id="NM_209023.2"
                     /db_xref="GeneID:4619805"
     CDS             complement(843117..844775)
                     /locus_tag="AGOS_ACR268C"
                     /old_locus_tag="ACR268C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL117W (MLS1) and Non-syntenic homolog of Saccharomyces
                     cerevisiae YIR031C (DAL7)"
                     /codon_start=1
                     /product="ACR268Cp"
                     /protein_id="NP_983670.2"
                     /db_xref="GeneID:4619805"
                     /translation="MVAVSLERVQVLGQIDAEPRFKPSTTTVADIVTKEALEFVVLLH
                     RTFNGRRKDLLARRQELQQRLDSGEATLDFLPETRAIREDPTWQGPPLAPGLVNRSTE
                     ITGPPLRNMLINALNADVNTYMTDFEDSLAPTWENITYGQVNLYDLIRSRADFAVGSK
                     QYQLRDRFERLATLLVRPRGWHMVDKHVLVDDEPISASILDFGLYFFHNAAKLVEVGK
                     GPYFYLPKMEHHLEAKLWNDIFNVAQDYIGMRRGTVRATVLIETLPASFQMDEIIWQL
                     RQHSAGLNCGRWDYIFSTIKKLRGQSQHVLPDRDQVTMTSPFMDAYVKSLIRTCHRRG
                     VHAMGGMAAQIPIKDDPAANEAALAKVRADKIRELQNGHDGSWVAHPALVPICNEVFR
                     NMGTPNQIHVVPEVHIGARDLVNTSISGGRVTIAGIRQNLDIGLQYMEAWLRGSGCVP
                     INNLMEDAATAEVSRCQLHQWVRHRVKLADTGENVTPDLVRGLLRERTDALARASRAG
                     SSNKFALAAKYLEPEITAERFTDFLTTLLYDEIVTPTNASKSRL"
     gene            complement(<845055..>845963)
                     /locus_tag="AGOS_ACR269C"
                     /old_locus_tag="ACR269C"
                     /db_xref="GeneID:4619806"
     mRNA            complement(<845055..>845963)
                     /locus_tag="AGOS_ACR269C"
                     /old_locus_tag="ACR269C"
                     /product="ACR269Cp"
                     /transcript_id="NM_209024.1"
                     /db_xref="GeneID:4619806"
     CDS             complement(845055..845963)
                     /locus_tag="AGOS_ACR269C"
                     /old_locus_tag="ACR269C"
                     /note="NOHBY333; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0E10868"
                     /codon_start=1
                     /product="ACR269Cp"
                     /protein_id="NP_983671.1"
                     /db_xref="GeneID:4619806"
                     /translation="MHSVRVGYIPEHFSAPLLFAQTLGFFAQRGVTAKLVPFPSGSGH
                     LIQALDAGELDLALGLTEAFVRGIADTPAGAAPRYQIAGTYVRSPLNWAVSVGAASPL
                     EHVDQLDGGRVGVSRVGSGSYVMSYVLALQRGFRRPFAAHPVCHTFAGLRAAVNDGAA
                     DAFLWEHFTSKRYHDAGEIRLLGNIPTPWPSWVLVKHTALEPAALAAFAAALDDGIAH
                     FEAHPEAAVALITQHFDYSAEDAAAWRTTVRFHRPCCTLHDRTAVVDATLAVLQAAGV
                     LRHAADPELVQRNVERGLYAAPAGEI"
     gene            <846320..>848962
                     /locus_tag="AGOS_ACR270W"
                     /old_locus_tag="ACR270W"
                     /db_xref="GeneID:4619807"
     mRNA            <846320..>848962
                     /locus_tag="AGOS_ACR270W"
                     /old_locus_tag="ACR270W"
                     /product="ACR270Wp"
                     /transcript_id="NM_209025.1"
                     /db_xref="GeneID:4619807"
     CDS             846320..848962
                     /locus_tag="AGOS_ACR270W"
                     /old_locus_tag="ACR270W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL118C (DCP2)"
                     /codon_start=1
                     /product="ACR270Wp"
                     /protein_id="NP_983672.1"
                     /db_xref="GeneID:4619807"
                     /translation="MSLPLRNPLDSVSLERALEDLIVRFIINVPPEDLATVERELFHF
                     EEAQWFYTDFVKLTNPHLPNMKFKTFASYVISLCPLVWKWQDVNPEEALQKFSKYKKS
                     IPVRGAAIFNETLNKILLVKGTESDSWSFPRGKISKDEDDVDCCIREVMEEIGFDLTN
                     YVLEDQYIERNIGGKNYKIYLVKGVPQDFAFKPQVRNEIEKIEWRDFWKLSRSIHKSN
                     NKFYLVSSMVKPLSLWVKKQKQIQGEEQLKQYAEEQLKLLLGIGTQEEAADPGRDLLN
                     MLQSSVGQKKPLVFSDDESQASISTSAPTTVPPAPSTANSQSVQPIAAGAYAGYPFPF
                     PQYPIPGMQTINPFQFVQSSHQGVFATHSTFTTSHQYPQAQAPQTQQPVPGAVVYPVQ
                     SQLQQAYQPPHTPVVKPSVIEDRAPHSKQLLELLKNPRKPEVEDESTAKTLLKLLKNP
                     TKENRTSANTVPSSKGAVSGPSGGRSISGQSIDTANLPSGMASSMGAKSTAIPLYSPR
                     SSLSEMTLPDEPLGGYEEFESSSEEEQGEELAYMNLQEPTSSVMESNAKVENNTLDNI
                     SHVDTSGNLSTRSLQSEKTEKSKPTAKPKIKLLKRGETLTPLTPSISSQTATSESSAA
                     GPTVPSEKDVSSRIQNSQGNELLDVLKSKAQPEPSVASTSPAKELLNTLNKPQGSVYQ
                     NLLFGANHRKSDDESSPRHSPVSQQARTHEFLNLLKRPQAKAENEELQSVLLTPPANS
                     GMVQNSSTLPNIPYGNLHQDQAAALLFPQQPPQFQQPYAATNTNSKELLAILRKPASN
                     QQKQLHEQTPANPVDQPTTLASEQQNLVKQQISNPSQSLQQGTPLQQPQPQHTQSPSN
                     LHVTGNTAAAQELLGMLRKSRVVP"
     gene            complement(<849040..>850425)
                     /locus_tag="AGOS_ACR271C"
                     /old_locus_tag="ACR271C"
                     /db_xref="GeneID:4619808"
     mRNA            complement(<849040..>850425)
                     /locus_tag="AGOS_ACR271C"
                     /old_locus_tag="ACR271C"
                     /product="ACR271Cp"
                     /transcript_id="NM_209026.1"
                     /db_xref="GeneID:4619808"
     CDS             complement(849040..850425)
                     /locus_tag="AGOS_ACR271C"
                     /old_locus_tag="ACR271C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL119W (NCS2)"
                     /codon_start=1
                     /product="ACR271Cp"
                     /protein_id="NP_983673.1"
                     /db_xref="GeneID:4619808"
                     /translation="MKCKRCTTSEGCLVSRNETFCGECFSRFVLLKFRKQMMMDEYCQ
                     QVFKVLYADKHRTAVEADEQNKRSVVLVPLSLGSSSLAMLDLLNQTLSEQRAAHNRTG
                     FQVKVVLCGFSADMDELKRLAESLQTERLAMNSDCIKLYLLDLDRSFSTCEIHKLLLA
                     NDNHGSRKIATRENATLSSILDQFSRRSSRDDMLWFARQHLIKKFASQHQVKVIMWGH
                     SVTRLADEVMSLVIKGRGAQIAATLDSTGMDVEYGALFKNLYPLRDVLLSEIDAYCSL
                     SKLQRYIYNYSLQGSLFIKSQDEAAQANRAVPMAKNMTINELTRQYFDAVEKDYSNVI
                     STIVRTASKLDYPISNGTEVIYCSICNNRVYVDPSKWLKSITVNNCHPPASDEDMSML
                     QMWESSSKGKETLARNQARSNIWSTAAEAPLCYGCVVTLNETKDRELNWPSREHDVSQ
                     VLAEFTLTDEE"
     gene            complement(<850922..>851371)
                     /locus_tag="AGOS_ACR272C"
                     /old_locus_tag="ACR272C"
                     /db_xref="GeneID:4619809"
     mRNA            complement(<850922..>851371)
                     /locus_tag="AGOS_ACR272C"
                     /old_locus_tag="ACR272C"
                     /product="ACR272Cp"
                     /transcript_id="NM_209027.1"
                     /db_xref="GeneID:4619809"
     CDS             complement(850922..851371)
                     /locus_tag="AGOS_ACR272C"
                     /old_locus_tag="ACR272C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YKL096W (CWP1); Tandem gene duplication in this genome"
                     /codon_start=1
                     /product="ACR272Cp"
                     /protein_id="NP_983674.1"
                     /db_xref="GeneID:4619809"
                     /translation="MKFISSFFLGAAALANVVLADSEEFSFLGVRSASKFHLSAVHAE
                     EGVLKIGGPGQALSGIITDDGKLKLSDGTYAVVKDNGALVESSQENGSSGFSVTDGYL
                     QYVGNSGFFPVSNGNSYDLSVKPAEGSETAIGIRALNNAGAPIPDFP"
     gene            <853038..>853493
                     /locus_tag="AGOS_ACR273W"
                     /old_locus_tag="ACR273W"
                     /db_xref="GeneID:4619810"
     mRNA            <853038..>853493
                     /locus_tag="AGOS_ACR273W"
                     /old_locus_tag="ACR273W"
                     /product="ACR273Wp"
                     /transcript_id="NM_209028.1"
                     /db_xref="GeneID:4619810"
     CDS             853038..853493
                     /locus_tag="AGOS_ACR273W"
                     /old_locus_tag="ACR273W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YKL096W (CWP1); Tandem gene duplication in this genome"
                     /codon_start=1
                     /product="ACR273Wp"
                     /protein_id="NP_983675.1"
                     /db_xref="GeneID:4619810"
                     /translation="MKFLSTVFLGAAALANMALADSEQFYLLCIKSASQFHYSSIHPV
                     NGQLKVIGKPDGLSAVVTDDRKLKFSDGTYAVVTQKGPVVEGSKDNASTGFFVADGHL
                     QYADLSFMPAPNGDSFDLSVTPSTDPRVVLAIRATNNSGGVIPDFPAHN"
     gene            <854580..>855860
                     /locus_tag="AGOS_ACR274W"
                     /old_locus_tag="ACR274W"
                     /db_xref="GeneID:4619811"
     mRNA            <854580..>855860
                     /locus_tag="AGOS_ACR274W"
                     /old_locus_tag="ACR274W"
                     /product="ACR274Wp"
                     /transcript_id="NM_209029.1"
                     /db_xref="GeneID:4619811"
     CDS             854580..855860
                     /locus_tag="AGOS_ACR274W"
                     /old_locus_tag="ACR274W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL041C (NOP12)"
                     /codon_start=1
                     /product="ACR274Wp"
                     /protein_id="NP_983676.1"
                     /db_xref="GeneID:4619811"
                     /translation="MSALNKLFGDERKRDLESNVAALFSQSSGPVDTLEVKSKPRTLL
                     PVVSKRQETETAKPAEPTEIVEADLPRKRAKKAKKTNEDDDHLEEKYMQQVLKEDSDH
                     ESEAEAPTEPVVELKPSKRASRPDMKEEELAKAERTVFVGNVPHEAITDKKVYKEFKQ
                     LVAQRKLSKEDEDDEEQKAEKYAVESIRFRSIAFEEALPRKVAFVQQKLHHTRDSVNA
                     YVVYAEKEAVTAACKLNGSVFHDHHLRFDSVAHPAPHDRKRSVFVGNLDFEESEESLW
                     KHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKALLLNDKKMAVGKGRKLRV
                     TRCRNMQKVQRQSNTAALPKLTDQQKTKLGRARKVLGKADRATLGKLTIEGTRATKGA
                     NTPNLRVKKARSKTGRVTKRSQAFKKAEANKKQK"
     gene            <856127..>856918
                     /locus_tag="AGOS_ACR275W"
                     /old_locus_tag="ACR275W"
                     /db_xref="GeneID:4619812"
     mRNA            <856127..>856918
                     /locus_tag="AGOS_ACR275W"
                     /old_locus_tag="ACR275W"
                     /product="ACR275Wp"
                     /transcript_id="NM_209030.1"
                     /db_xref="GeneID:4619812"
     CDS             856127..856918
                     /locus_tag="AGOS_ACR275W"
                     /old_locus_tag="ACR275W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL014C (SYN8)"
                     /codon_start=1
                     /product="ACR275Wp"
                     /protein_id="NP_983677.1"
                     /db_xref="GeneID:4619812"
                     /translation="MVYILELSYEIDKLRNLVDERSRLVEVLKIQPSANDNIQLKKHL
                     NKVLGMLRELSKDILHSRDEGLRGLVERYNDCLSDIPDGLIEKSDYMFELGRMPDSGD
                     DSPPDMKRVRFQDKLDVHEAQNYEERVFPPYKDDPEAALDREREQLLQGGTAGGRTTH
                     SPFTNQDLFMQQQQQLMEQDTHLEHLAASVHQSHRISTGIHREVTEQNEGILTDLESM
                     LNNSGQRLDRAKKRLVIFERTVRDKGHCILIVILIFILLLIVIVF"
     gene            complement(<857242..>857733)
                     /locus_tag="AGOS_ACR276C"
                     /old_locus_tag="ACR276C"
                     /db_xref="GeneID:4619813"
     mRNA            complement(<857242..>857733)
                     /locus_tag="AGOS_ACR276C"
                     /old_locus_tag="ACR276C"
                     /product="ACR276Cp"
                     /transcript_id="NM_209031.1"
                     /db_xref="GeneID:4619813"
     CDS             complement(857242..857733)
                     /locus_tag="AGOS_ACR276C"
                     /old_locus_tag="ACR276C"
                     /note="NOHBY334; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F07755g"
                     /codon_start=1
                     /product="ACR276Cp"
                     /protein_id="NP_983678.1"
                     /db_xref="GeneID:4619813"
                     /translation="MLNQPSADRRNSMNQKIRYQQHQQPQPAKFSATVGTVTSTQNIS
                     REARAKLNCMKSFMNDPIFFVEPYYQAPALPLQGQIAQQASSPIVSPGQVHSFLDRSG
                     LTAQHHGYMQLQAGTARLAAPDMYARYHYLDQQTAQAPYTQRHYHQMRAKSQLQGQSN
                     RSW"
     gene            complement(<857929..>859065)
                     /locus_tag="AGOS_ACR277C"
                     /old_locus_tag="ACR277C"
                     /db_xref="GeneID:4619814"
     mRNA            complement(<857929..>859065)
                     /locus_tag="AGOS_ACR277C"
                     /old_locus_tag="ACR277C"
                     /product="ACR277Cp"
                     /transcript_id="NM_209032.2"
                     /db_xref="GeneID:4619814"
     CDS             complement(857929..859065)
                     /locus_tag="AGOS_ACR277C"
                     /old_locus_tag="ACR277C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL042W (NGL1)"
                     /codon_start=1
                     /product="ACR277Cp"
                     /protein_id="NP_983679.2"
                     /db_xref="GeneID:4619814"
                     /translation="MPRRLLPTMAPSKALPARMINRQLLPVYSGSASAGCRSERRFNL
                     LTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLLEYELFHKYHADILCLQELTGKDYEK
                     FWRKQMKRRMNFESQYAQKPPPAYWKRSQEEMDGVGTFYNADKFEHVATDLEYLSDTL
                     GVLTPTEKEWMAQTQVEVTDATGHVVEKQSLKTVLTQRNQVCLFVTLLHKPTGSLFVV
                     VNTHLYWKYDEVKLAQCFIIMRRLKAIVKRLLTRKDTSYSNIKVLLSGDLNSSQDALS
                     VRFLRGQVVKVAGLEFQNPMRSFLNGSLYDYIPKDSFDNTCYSGKIKGIFDYVWFHGR
                     DFRLLQVLSGKEVSEELSSTAQTGLPNELHPSDHIPIYAEFEVL"
     gene            <859350..>860453
                     /locus_tag="AGOS_ACR278W"
                     /old_locus_tag="ACR278W"
                     /db_xref="GeneID:4619815"
     mRNA            <859350..>860453
                     /locus_tag="AGOS_ACR278W"
                     /old_locus_tag="ACR278W"
                     /product="ACR278Wp"
                     /transcript_id="NM_209033.1"
                     /db_xref="GeneID:4619815"
     CDS             859350..860453
                     /locus_tag="AGOS_ACR278W"
                     /old_locus_tag="ACR278W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL043C (NTG2) and YAL015C (NTG1)"
                     /codon_start=1
                     /product="ACR278Wp"
                     /protein_id="NP_983680.1"
                     /db_xref="GeneID:4619815"
                     /translation="MAVLRRVKRPRVDIEVERVSKYFKKEESLSTELADVSDSQVSIN
                     AIKAMEAPEFFNYVESRTIDLLPVDRKLEDNNRFPPNFVGIYSKVRLMRSKIITPVDT
                     VGCASLPLTLNEKYGILKDQIKPLHYRLQLLVALMLSAQTKDETNAIAMNNLMDYCMN
                     NIGIKEGITLEALLQIEEKQLDTLIHPVGFHRKKAAYIKRAMPMLQEEFGGDVPTTIE
                     GFNSLPGVGNKIGFLALQKSWGIVAGIGVDVHVDRLSKMWRWVDAKKCKTPEHTRKAL
                     EEWVPRELWNEINPLLVGFGQVICPSRGKRCDLCLANDICNNVDRKLVKLRNFNESPA
                     SLRGDHSQLLTHLQHTLVASGSAAPRIKKEETE"
     gene            complement(<860591..>862402)
                     /locus_tag="AGOS_ACR279C"
                     /old_locus_tag="ACR279C"
                     /db_xref="GeneID:4619816"
     mRNA            complement(<860591..>862402)
                     /locus_tag="AGOS_ACR279C"
                     /old_locus_tag="ACR279C"
                     /product="ACR279Cp"
                     /transcript_id="NM_209034.1"
                     /db_xref="GeneID:4619816"
     CDS             complement(860591..862402)
                     /locus_tag="AGOS_ACR279C"
                     /old_locus_tag="ACR279C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL016W (TPD3)"
                     /codon_start=1
                     /product="ACR279Cp"
                     /protein_id="NP_983681.1"
                     /db_xref="GeneID:4619816"
                     /translation="MSERGEDLYPLALLMDELKHDDIANRVEAMKKLDTIALALGPQR
                     TRDELVPFLTEVAQDDEDEVFAFLAEQLGKFVPYVGGSKYATLLLPALEILASTEETL
                     VRDKAVSSLNNIAQELSQEQLFREFIPLIENLATNEWFSSKVSACGLFKAVLVRVEDD
                     KFRKELLALFLQLTQDDTPMVRRAAGRNLPTLIDLLTQNIDLSTSGDWDYISNMFQRL
                     VSDNQDSVKFLAVDVLISILKFFNKKKDSTHTKGLLHSAIQLVSDEAWRVRYMSADRF
                     EDLASQFISDPAYIDELISPFLALCEDNESDVRKAIAKQIPGFAKLLPNSAVILKKLL
                     PVVQTLCMDENETVRASLASEITGLAPLLSKQEAIDNLIPILLNMLKDEFPDVRLNII
                     AKLKVVNEAIGIDFLTENLLPAITELAKDDNWRVRMAIIEYIPLLAEQLGVDFFDQQL
                     ADLCLSWLWDAVYSIRHAAVINLKKLTEIFGSAWSRDQIISCLLKSDSQVLENFVYRI
                     TLLSALTELVPVVSSAVITEKILPFINHLSTDGVPNIRFNAAKSYAVIVEALGKNYAD
                     LSNEVILPNLEKLCQDNDVDVRYFAGQSLEKCKSILG"
     gene            complement(<862856..>863929)
                     /locus_tag="AGOS_ACR280C"
                     /old_locus_tag="ACR280C"
                     /db_xref="GeneID:4619817"
     mRNA            complement(<862856..>863929)
                     /locus_tag="AGOS_ACR280C"
                     /old_locus_tag="ACR280C"
                     /product="ACR280Cp"
                     /transcript_id="NM_209035.2"
                     /db_xref="GeneID:4619817"
     CDS             complement(862856..863929)
                     /locus_tag="AGOS_ACR280C"
                     /old_locus_tag="ACR280C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL044W (PEX15)"
                     /codon_start=1
                     /product="ACR280Cp"
                     /protein_id="NP_983682.2"
                     /db_xref="GeneID:4619817"
                     /translation="MSKVITKPSLSLDSLLQHELFQDARAGKVDSQEERLRECRDLYL
                     KAHFGGFLVKVYQYGLLEDGAQRYTADVWGWVLAAVNGLRSANEIPSSVLRQLRTELS
                     RSSGGVYDVVSALSVLERARLLLSYFRSAVRLGSLDTAENADYLRRVEGNLCRELGRL
                     VLDVHSEQELGYLVKLVELYLLDLQVRCLHREMDKSLYWTLCRKFPLMSRKLSGSPQS
                     RNGVSCEEHILLQLQPKKKTIKNKHASSERRVARPSSAAPPRPGARQQDRVARPNLPL
                     MTPGSPMLTADRSENCERKPRHSYAAILNYLPKWLTDFTDSRFIALVVMLAIALRKLR
                     WFKLLSSHGLVHIRTIFNAARGL"
     gene            complement(<864520..>868299)
                     /locus_tag="AGOS_ACR281C"
                     /old_locus_tag="ACR281C"
                     /db_xref="GeneID:4619818"
     mRNA            complement(<864520..>868299)
                     /locus_tag="AGOS_ACR281C"
                     /old_locus_tag="ACR281C"
                     /product="ACR281Cp"
                     /transcript_id="NM_209036.2"
                     /db_xref="GeneID:4619818"
     CDS             complement(864520..868299)
                     /locus_tag="AGOS_ACR281C"
                     /old_locus_tag="ACR281C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL045W (PSK2) and YAL017W (PSK1)"
                     /codon_start=1
                     /product="ACR281Cp"
                     /protein_id="NP_983683.2"
                     /db_xref="GeneID:4619818"
                     /translation="MPFIGASHTSNDIFRHLKEKHAIGGGHAGVSVASSVTSMEADTP
                     ERYATSGSASSALEEKLEAVSRGDDKAPGNLNAPKLRSVSVSSAASHGQELDTQELLT
                     FPNESTHAYSYNPLSPNSLAVRLSILKRSLEIMIKNPSLLRDTTSSDDIAPLPSIVSR
                     YSMDRTYSASVKRSPMDQPPQQLRNASSAALSALFNGPVATTVPSSQSLDTQSPPMLS
                     PSLGTLPAYSASGSYPFRQQQLGTLPIAWEIGSDTSDSPETASELEVRRFFHESPSLA
                     SLPEPPQQQPPPQSIYDHHPSHSSEFICEKKRELEGLLTLLNDTLENKDNDKASDLLM
                     ISLLNINKLSLGVSTNADGVDPAKKVSNEQELKKQLLESLAQPFHEYSTQETTIQASQ
                     DENYLQPFTDELTSIQDPIDYSRTYEAPRILHTFISGKYTAPQAIFTCSQHHPWQFRA
                     ANDLACLIFGISKLAFKALTLLDLIHTDSRSFVLNKIMSTEGQEQVFTGEIVGVIQPG
                     VTSLSSPASAASSASSHTQKFIWASMWAKRKNGMIVCVFEKVPCDYMNVMLNLDDFSV
                     RDISGGEGLQLQPEITSSIPPPTITPKTKSVKFANEINDVAAISRSLANLIEKVKSGE
                     LLNKHDDLLPVPVRVNDHINTVRYFTLNHLSINIPCAVTSSILEDDLKLQIHSLPYQA
                     GMFIVNSKTLQLISFNKSISKNMFGLHYIELINQPITKIIPSFPSLLKYNNTMYPHLN
                     INLSKNKGLVLTEHYFRKLQSQMNRSAEDFYSSIGIDAVHRDGCTIKVDIQLRVLNMS
                     HILLWITHSRDVFFKNYNTNPSQLKILNEREIATISSGTNSATSSKHTTDKFKLEELS
                     KLKSELQTLTLHIDGRESNSNAVAKSECVLSDDMSTAVAEETDVNTTTSSMAVQAKDS
                     MMSTDSCSKWEIAKKYTQDKSQFVSDDNFKVDENLILHTNSSFREGSDSPLRPLNSES
                     SASFDNSNIAPEREIGASKHVTKFSDFTVLQKMGEGAYGKVDLCMHKKEKYVVVIKLI
                     FKERILVDTWVRDRKLGTIPSEIQIMATLNKKPHENIMRLLDFFEDDEYYYIESPMHG
                     ETGSIDLFDLIELKTNMTEHEAKLLFKQVASGLRHLHENGIVHRDIKDENVIVDNRGR
                     VKIIDFGSAAYVKRGPFDVFVGTIDYAAPEVLGGDPYEGKPQDVWAVGVLLYTIIYKE
                     NPFYNIDEILDGDLRISPAVVVSEECVALITRILNRSVNRRPTVDDICGDKWLGI"
     gene            complement(<868706..>869981)
                     /locus_tag="AGOS_ACR282C"
                     /old_locus_tag="ACR282C"
                     /db_xref="GeneID:4619819"
     mRNA            complement(join(<868706..869812,869862..>869981))
                     /locus_tag="AGOS_ACR282C"
                     /old_locus_tag="ACR282C"
                     /product="ACR282Cp"
                     /transcript_id="NM_209037.2"
                     /db_xref="GeneID:4619819"
     CDS             complement(join(868706..869812,869862..869981))
                     /locus_tag="AGOS_ACR282C"
                     /old_locus_tag="ACR282C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL018C and YOL047C; Tandem gene duplication in
                     Saccharomyces cerevisiae; 1-intron"
                     /codon_start=1
                     /product="ACR282Cp"
                     /protein_id="NP_983684.2"
                     /db_xref="GeneID:4619819"
                     /translation="MPRAETMQLPAEEAPRSVAFHRRQARRVRRTLSTQFLPVTTLYQ
                     LIVQPAYYFTFLANVLVHAFAQGAAVAIAVAFWMSTVGLAFPPALPFVLPHAVWQGCL
                     VGAVCCRNYHLEYMETYIASLLVTGEGEFLFSPMASRRWRFWYCDMPLFIWHYLSFWG
                     FHILLLVLTFVPYVGPLVVLVLNSKATGAAYYARAQGFELTHAQRREKFVDLFMFGST
                     AAVLEFLPVIGGISYTTTLVAARRMVRADYTHAAQTAREAAQSARAAANLAREATRSM
                     QTAPTSRTVMAAQAAVFSAQDAALAAEAAANARDAAAAERAARELRRLAQSPRSAVLS
                     ARAQPASRSASQSMRAASQSAWSAAGSSRALSERALSTRSVLTSGRSAAPSASSSRRP
                     PSTRADRVIQRSRSRT"
     gene            <870387..>871067
                     /locus_tag="AGOS_ACR283W"
                     /old_locus_tag="ACR283W"
                     /db_xref="GeneID:4619820"
     mRNA            <870387..>871067
                     /locus_tag="AGOS_ACR283W"
                     /old_locus_tag="ACR283W"
                     /product="ACR283Wp"
                     /transcript_id="NM_209038.1"
                     /db_xref="GeneID:4619820"
     CDS             870387..871067
                     /locus_tag="AGOS_ACR283W"
                     /old_locus_tag="ACR283W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL018C and YOL048C (RRT8) (RRT8); Tandem gene duplication
                     in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ACR283Wp"
                     /protein_id="NP_983685.1"
                     /db_xref="GeneID:4619820"
                     /translation="MVVGMGHGQIWVQAVTLVILYIITFAAILVFLVLLWTPLFLPIS
                     VIFGPAGPLGYVLTLYANAQFFTTMIVNSHLATPLLDYTIASLMGIHIEYKRHNPELV
                     EPEAFSAYDVLTVLRLVMSVAVMVVLVTIPILGPVLLMFVMNVKFSYDFYERFLILRG
                     LNQVQRRDVFYQHILQFAYFGGSYTVLNFVPLFSVWGFVCYPLAIKMWATSNIIHFTA
                     EEVESITE"
     gene            complement(<871134..>872585)
                     /locus_tag="AGOS_ACR284C"
                     /old_locus_tag="ACR284C"
                     /db_xref="GeneID:4619821"
     mRNA            complement(<871134..>872585)
                     /locus_tag="AGOS_ACR284C"
                     /old_locus_tag="ACR284C"
                     /product="ACR284Cp"
                     /transcript_id="NM_209039.1"
                     /db_xref="GeneID:4619821"
     CDS             complement(871134..872585)
                     /locus_tag="AGOS_ACR284C"
                     /old_locus_tag="ACR284C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL049W (GSH2)"
                     /codon_start=1
                     /product="ACR284Cp"
                     /protein_id="NP_983686.1"
                     /db_xref="GeneID:4619821"
                     /translation="MTNTIPTLPEWSAEEVEQRLLPELLQWSLANGGTIYPPGFNINQ
                     AEALTMTLFPTPLPRKALEKAVRVQTTYNELYARIAQDKNGWLSEVTEQLANFDANFT
                     GRLWKLYLEAQAIGISQKIGLGVFRSDYLLDADSGDLKQVEFNTVSVSFAGLSTKVGA
                     VHNFLNESGKYSRNGGRFYESEVPISESAFLLPRALASAADKYNSLTGSRDTIVAFIV
                     QRGERNVVDQRILEYNLFERQGVKSVRLMLHEVHERTRLDPITKRLYLTSTGQEIAVV
                     YFRTCYSPQDFASEQDWKNRLSLELSYAIKAPNLLTQLSGTKKVQQLLSEEAVLAKFL
                     PADRRSDIGATFVNLYPLDDSPLGKEGKRLALEMPERYVLKPQREGGGNNIYKEDIPA
                     FLGTIPEEEWNGYVLMELINPKLNENVLVRGQELFQEPLISELGIYGTILFSDEEIYS
                     NDYAGWLLRSKLPSSNEGGVAAGFGCVDSMVLY"
     gene            complement(<873071..>877033)
                     /locus_tag="AGOS_ACR285C"
                     /old_locus_tag="ACR285C"
                     /db_xref="GeneID:4619822"
     mRNA            complement(<873071..>877033)
                     /locus_tag="AGOS_ACR285C"
                     /old_locus_tag="ACR285C"
                     /product="ACR285Cp"
                     /transcript_id="NM_209040.2"
                     /db_xref="GeneID:4619822"
     CDS             complement(873071..877033)
                     /locus_tag="AGOS_ACR285C"
                     /old_locus_tag="ACR285C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL051W (GAL11)"
                     /codon_start=1
                     /product="ACR285Cp"
                     /protein_id="NP_983687.2"
                     /db_xref="GeneID:4619822"
                     /translation="MELDWRSTLSNQERSKYITELAQILADISQINGGARANFDLEKL
                     KKTAEQFETSLYASSSSKELYLDAMRKRIAAMDAAKKKTLANQKQKAAAQRKGFGLAP
                     TLNPQMFLNQQAQARQQARPMRGSVGGGQSPVMMMPQHGVPAHVAHGVPPGVAVSQAK
                     RAQLSLQQQQQINEMKVAEIPRELLQRIPNIPPGVTTWQQVTELAQQKRLTQSDLQIA
                     KQVYQMHQQMMVKSKMQQASLNQLTPQQRAQLQQRQQSTQQSQSAPPQAPQVAQSQQV
                     PAQKPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQHAAAQAQLQHPNAYQQKNMMAQQSAAALQQGQQQPRQ
                     MGPQQAREVPNVLNKLNQVFSPAEQKALYENGKKLVQDLQLAGKLPASLTQQQQILYI
                     KKYINQMVLKKLQQNIRLAQQIGAANSANTQSQMAAQAGARFTPGMAQHSQFAQQQHT
                     GNQAQVQSQVSQSISQQQAQLTQKVQQAQQSQLQQTQEQDPQHTQLADSFSQRQFTSP
                     TLAKPSANVSTIAQQQTQPTALSQSHPQQQQGSQAQQQLLQQQQGSQAQQQLLQQQQQ
                     QPPPPPPQPQQQTQQPQQPQQQQQPQPQPQLQQQQQLGLQPHQPQLAQAQAQQPQPQQ
                     QTQQQTQQQQQQQQQQQQQQTQQQTQHQPQPQLKPQSQQPQPVPQQVQSQQPQQVQSQ
                     QQPQPQQLSQPAQQQSQQQQQQQQQSQQQKLRQVQLPQQTPKITLPRPTEQDMMILKR
                     INSEVAKSPLRLSNITNQLTPEQKQMIKNKLQANQQLLSNVDNFIPTLYLITRNEENV
                     RQLLQIRMLAKEIMEHASKGVFIVPPDVVDKVIFRYQKYYEFIKEQLLRRHQQLFSTR
                     QQQMQQQVVQQQQAGQIKLGQNAVGAPQNPQVTTNTDIAMQQQRVQGSFQQMQQQIRQ
                     QQVKQAQLQQAQQQAQQQQQAQQLQQGHMPVQQSMPLAGVQTVMATQAATLPQHASPV
                     SSNTANIPKTGDAPVSIDSVTPVPPGIVNSSGPSPVAGKQILAATMVPQHKLSPTKSD
                     FAQAPTADNPYQVDELRLKNLAIRKAEIMSRFKHRQEIFEHSPVDLFLCTLADCMGIK
                     DGSYELLAPIPALMVEQINGTGKKKFTKAQQRVREQDSIECYVKDNKLMMSSKFSADE
                     RSYSIHDRDISSCFLDLYGLSDCTSLSFDSSSAEPPTEQVNKKRSHDSLEISPAESDS
                     SLLNDSKKLKVDSPDDLFMTSNMMLDNKNAQPPIGLGLGVGLGEAGSSIWNWNYWESL
                     "
     gene            complement(<877334..>880393)
                     /locus_tag="AGOS_ACR286C"
                     /old_locus_tag="ACR286C"
                     /db_xref="GeneID:4619823"
     mRNA            complement(<877334..>880393)
                     /locus_tag="AGOS_ACR286C"
                     /old_locus_tag="ACR286C"
                     /product="ACR286Cp"
                     /transcript_id="NM_209041.1"
                     /db_xref="GeneID:4619823"
     CDS             complement(877334..880393)
                     /locus_tag="AGOS_ACR286C"
                     /old_locus_tag="ACR286C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL019W (FUN30)"
                     /codon_start=1
                     /product="ACR286Cp"
                     /protein_id="NP_983688.1"
                     /db_xref="GeneID:4619823"
                     /translation="MEPDTPERIYGQADERERAQVVGSSPGEQRAESSPLKRYGAGEA
                     AEAVAAQLRTRFEYRAGAEAEGGNGLDEQMQKMRQQYPDFSDTLIRAVFKSNSFSLPL
                     TMSRLDELRAKKSAKSWAMPSKKLGATARLPSLKPGRYGAEAVASPERSSKVTLERQT
                     TSIFDRYSHVIQRGKVEAPAPVWSAPTKKRKLVRAEDLLAAKPEERVSLSDEEEDAIS
                     ADGSADEASGDEYEERTPELDIDDQVLTFLNEADAGDIADLAETSIGKAAAVVAKRPF
                     RSLEAFGAMDFEADDEVASTGENAKRGSRRRGPTKRDGAKMLDKIMQSMKGYNAIESL
                     IKKCSSYRRLIADQIKKWGVEMGENESELNFMDTKGSPHGESDSESDTPTTASTELVP
                     NGDGKKDGSADNASDGDYSDENDEDDEEFEDVYEEESDDDDFGKVTRRHPSGRGRGRP
                     EKKNVKFFKRKPKLLAPDIELKDYQQTGLNWINLLYQHNLSCILADEMGLGKTCQVIS
                     FLAYLKEQNHTGPHLVVVPSSTLENWLREFKKFCPQLKIEPYYGSQQERAELRDILEE
                     NDGQYDAIVTTYNLASGNKADVSFLKNRQFNVVIYDEGHMLKNSMSERFTKLMKIHAN
                     FRLLLTGTPLQNNLRELMSLLEFIMPSLFVSKKDELAAVFKQRARTSDSNKDYNPLLA
                     QEAIDRAKTIMKPFILRRRKDQVLKHLPAKHHHIEYCDMTPEQQAIYNREIRLVMEHR
                     RMVRDGVLPTDAGERALVAQSTSKNLIMALRKAAIHPLLFRHHYSDDRIAEMSERILA
                     EPEYADSGNRDYIREDMSYMCDLELHRLCCRFPSLASFQLSEPTWMASGKVHRLQPLL
                     RAAIARREKTLVFSLFTQVLDILELVLSSLGIAFLRLDGSTPVNDRQALIDRFHTDTD
                     VPVFLLSTKAGGFGINLVCANHVIIFDQSFNPHDDRQAADRAHRVGQTREVAVTTLVS
                     RATVEEKILQLARHKLALDSSVSDRRADDLDHRLAALLEDIIYEEHT"
     gene            <880743..>881769
                     /locus_tag="AGOS_ACR287W"
                     /old_locus_tag="ACR287W"
                     /db_xref="GeneID:4619824"
     mRNA            <880743..>881769
                     /locus_tag="AGOS_ACR287W"
                     /old_locus_tag="ACR287W"
                     /product="ACR287Wp"
                     /transcript_id="NM_209042.3"
                     /db_xref="GeneID:4619824"
     CDS             join(880743..880787,880789..881769)
                     /locus_tag="AGOS_ACR287W"
                     /old_locus_tag="ACR287W"
                     /ribosomal_slippage
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL020C (ATS1); no intron; ribosomal slippage at consensus
                     CTTAGGC site; ACR287WpmRNA"
                     /codon_start=1
                     /product="ACR287Wp"
                     /protein_id="NP_983689.2"
                     /db_xref="GeneID:4619824"
                     /translation="MYKIYALGSNGSGQLGIGHYKDVMVPHLTFECAKKPIKIACGGN
                     HSLMLMEDGQLWAAGDGRQGQFASKDTKCAFAWSELPGTFEDVACGWDYSVVIDEHGN
                     VLACGAGLNGELGLGHVKCSGAWRRVTTCLNPSRAVYSSFQNVVLRDGNKLYGWGPNR
                     KGQLKEPKNKGFDTPTLIYEGRDITQVAMGKDFIAIVDAGKLVISGTMKDRINDIIRD
                     ISSEEIIKIAAMWSSLHIWTKRDIFSYGNGNYGQMFVWERPPNMTHFAAGSEHGVMSL
                     ADGRVFCWGWGEHGNCGPSAKGHDAASPFNDKSNIVSPLNCVLETNEKIIWIQGGCAT
                     SWVCTKC"
     gene            <882342..>884552
                     /locus_tag="AGOS_ACR288W"
                     /old_locus_tag="ACR288W"
                     /db_xref="GeneID:4619825"
     mRNA            <882342..>884552
                     /locus_tag="AGOS_ACR288W"
                     /old_locus_tag="ACR288W"
                     /product="ACR288Wp"
                     /transcript_id="NM_209043.1"
                     /db_xref="GeneID:4619825"
     CDS             882342..884552
                     /locus_tag="AGOS_ACR288W"
                     /old_locus_tag="ACR288W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL021C (CCR4)"
                     /codon_start=1
                     /product="ACR288Wp"
                     /protein_id="NP_983690.1"
                     /db_xref="GeneID:4619825"
                     /translation="MNNPPPMMGYQPSGGGSVTQMLGTPQPLAQPLHQTGPTQQAQQM
                     LQQPPGLVSSGTRQMLGQIGQVGSNPLCHPHQSDPTLVNNPIWKLQLQLAAISRQSVG
                     QANVYARQNAMKKYLMTQTNGSQQPADMAKSLVDFTKQYLLEMAADPAVPNNAALAAS
                     GQQIQRPHGTPVSTPSTPKAELANNAQTTPSILLQQQQKKLSQFNIDEDDEVEHRMMA
                     PVNTKYDEQLWHTIDLSNLSVYNLNENLFKYDFLTRLYLNGNNLTHLPASIKQLQNLR
                     VLDVSHNRLTELPPELGMCYQLKYLYFFDNMVSTLPWEFGNLFNLQFLGCEGNPLDRQ
                     LIKILTEKSVTGLIFYLRDNAPEIPLPEPRRFIEVNADGESVETYRCIEESTNHLNEE
                     LLKKSFTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEV
                     ESKTYEEFWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDA
                     IDFSSVWMKHKKFQRTEDYLNRAMNKDNVALIIKLRHERTGEHVWVVTTHLHWDPHFN
                     DVKTFQVAVMLDYIEKLLKQHGGVGSPQDKKKIPLVICGDFNSQLDSAVVELFNTGSV
                     RSHKDIEGRDFGYMSQKNFAHGLALKSSYGSIGELPFTNLSPTFTDVIDYIWYSTQAL
                     RVRGLLGEIDPAYAAKFIGLPNDKIPSDHIPLLARFEFTKGSSATINTNGNKTV"
     gene            <884847..>886100
                     /locus_tag="AGOS_ACR289W"
                     /old_locus_tag="ACR289W"
                     /db_xref="GeneID:4619826"
     mRNA            <884847..>886100
                     /locus_tag="AGOS_ACR289W"
                     /old_locus_tag="ACR289W"
                     /product="ACR289Wp"
                     /transcript_id="NM_209044.1"
                     /db_xref="GeneID:4619826"
     CDS             884847..886100
                     /locus_tag="AGOS_ACR289W"
                     /old_locus_tag="ACR289W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL022C (FUN26)"
                     /codon_start=1
                     /product="ACR289Wp"
                     /protein_id="NP_983691.1"
                     /db_xref="GeneID:4619826"
                     /translation="MDDRRQLIDNTGTLESSGDGTTVSGFNASGKKEENQALTTCLAI
                     GIALLWPWNCLLSASLFFQQTLFTDSTVYAAIYTSTMMTTSTGASLVYNFYLSQRQSG
                     YVNRVSRGLECQAGVFGALCVLVLAHRAIPMPLTFVLLMALVLLSSLATTMTQNGIMA
                     ITNIYGPSYSRAVMVGQAIAGVLPSVVMFVLSLATQQERQSSGSAIVYFLSTVGISVT
                     ALLLYRSSSLHAGLVTPAQAIHVPFRLLYSRLQAVVLSIFITFLFSLSFPVFANATLA
                     AVLLPNSQFIPLAFTIWNAGDLFGRLVADRPWVQAASIPHRLLAASALRGFMIPVFFL
                     FNINGTHPHSGLLLDLLYLFWHLFFGLTNGLFITLAFMSVSALLDSDDQRKAASGFTN
                     LFLALGLTCGSIFSYLVVFLLPSVH"
     gene            <886522..>888789
                     /locus_tag="AGOS_ACR290W"
                     /old_locus_tag="ACR290W"
                     /db_xref="GeneID:4619827"
     mRNA            <886522..>888789
                     /locus_tag="AGOS_ACR290W"
                     /old_locus_tag="ACR290W"
                     /product="ACR290Wp"
                     /transcript_id="NM_209045.2"
                     /db_xref="GeneID:4619827"
     CDS             886522..888789
                     /locus_tag="AGOS_ACR290W"
                     /old_locus_tag="ACR290W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL023C (PMT2) and YOR321W (PMT3)"
                     /codon_start=1
                     /product="ACR290Wp"
                     /protein_id="NP_983692.1"
                     /db_xref="GeneID:4619827"
                     /translation="MQVNTAMHDRDEMSTTGYQRHEAGPANKRGKASAEDGAGVQEED
                     VSKLREVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYY
                     LRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAM
                     CAPVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVL
                     FHNERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNM
                     SVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSV
                     GIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDR
                     IRGLPAWSINETEHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHWEVSGYGDAQV
                     GDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEV
                     ACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALV
                     PDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLIT
                     VYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALY
                     FALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGMEGPS
                     SNYKHLNWLKTWSIA"
     gene            complement(<888924..>890978)
                     /locus_tag="AGOS_ACR291C"
                     /old_locus_tag="ACR291C"
                     /db_xref="GeneID:4619828"
     mRNA            complement(<888924..>890978)
                     /locus_tag="AGOS_ACR291C"
                     /old_locus_tag="ACR291C"
                     /product="ACR291Cp"
                     /transcript_id="NM_209046.1"
                     /db_xref="GeneID:4619828"
     CDS             complement(888924..890978)
                     /locus_tag="AGOS_ACR291C"
                     /old_locus_tag="ACR291C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR322C (LDB19)"
                     /codon_start=1
                     /product="ACR291Cp"
                     /protein_id="NP_983693.1"
                     /db_xref="GeneID:4619828"
                     /translation="MVFPRLVATGRRGSAGGSDHVVELGLEIESPPCVLYGPPTESAG
                     ALLSGLVTVHVQGAGAEAGGCVVARLTLVLEQQVTYGRPFVAGPLGSCAACRERRREL
                     ARWEVVAQAAELAGGRHAYPFSHLLAGELPATSTLGSAGATQIRYELVADAVYRAGGG
                     EERRRELRLPVLVTRSILRGPDRNSLRVFPPTDVTATAVLPSVIYPRSTIPLELQLGG
                     VCCADRRWRMRRLTWRIDEKVRVRSHACAAHRARLRALEEEVRAKTARNLKKPAKPIK
                     RTPDMGPQVTVSVATVEDPLPFDAGSAAARQEADVGNMDDDADTQSAFIHPSDHAMQQ
                     ELQELQARIRQQQLEEERKQETSHYIEEVRTIAGTDIRSGWKSDFSGSGKIELVMEID
                     CMKLNSGVTNPVNMVSTTSPYLARGQAPVNVTCDVEDPTLGISVNHLLLVEIIVAEEM
                     LHYTNGQLLSKGEAQGEGEGQGEALAEAKPAGLAGSHADQRLAELSPMFANRNNSMFR
                     ASAEEHSPGLEPDGSTAGADKRIVGTPTGAARVLRMQFKLTMTERSGLGISWDDEVPP
                     KYQQVKFLYPPSYDEAVSASVSEVSGSSRVVSGPESNPAVRAPVAASPTQPPAVREGP
                     SSLGTSGSAARDMMFISESSTLCIGGESPSALPAVEDASLGHRVCVRKVSELLDTDRI
                     TQ"
     gene            <891521..>895840
                     /locus_tag="AGOS_ACR292W"
                     /old_locus_tag="ACR292W"
                     /db_xref="GeneID:4619829"
     mRNA            <891521..>895840
                     /locus_tag="AGOS_ACR292W"
                     /old_locus_tag="ACR292W"
                     /product="ACR292Wp"
                     /transcript_id="NM_209047.1"
                     /db_xref="GeneID:4619829"
     CDS             891521..895840
                     /locus_tag="AGOS_ACR292W"
                     /old_locus_tag="ACR292W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL024C (LTE1)"
                     /codon_start=1
                     /product="ACR292Wp"
                     /protein_id="NP_983694.1"
                     /db_xref="GeneID:4619829"
                     /translation="MRAEGNDMAESGRAVFSAADYYPAPSGRVITYAAGGRGRQIMAA
                     DVTALVAALTSPVDGVEYELFADFFLVYRNFLEARRLLELLEARFDWSLGEIGAGRAK
                     ARVVGEITLVRTFVLLRHWVINYFAQDFLPDVALRERFLAFVNGLGGAAGGTRPKIVA
                     NIVVSLKKTWAYTVRLIWDDLDLEREFELRSADAWLQFQIPDVTQLKTEAGLQRDSRL
                     SFYARQSSTNPSFRNESVLSLYRPKDNFQLPVRNNDYNIKQGTRIKKRTASMFLYPQD
                     SLNAPSGNQKPQCSLEPPFPAHSHVRKISHISKVTNVSNVIKEVAYPTSPAVESFFPP
                     TPSKKLEFTVNSTYVPPAAAECSREPSAQKKPRSPNGYRAVTGLLSKWRMNHLSRHKA
                     CDRTSTVEPAMDNLIKYVFSISSLESPKGDIQEEREISPSKFDILSARTIEEVEHLIT
                     VENEVLQKVTAHEGKVPITSSSAREARFPPLLNEAPLLDQAPLGNGQEYSVIDNLNLY
                     RTVSTIATSVIKLTRTASQRQTKVTLPPPPPLRQRPTSLSAFRGSSSRMLLSDSLRRD
                     GYQNSKASLHLRPLASADENAEGSSVQASNPPQVIFHTHALIKTPTDKVFDAKAVEDT
                     SPKTSLVSTQVTDARPPSYESTITYDSDLQDITMRDYNTSNQTENHNDGTLDTNQPIL
                     NRKTNHSNLREFLFEASTSGSPAAHTTQEPTDESTGRLGACPTVMRSISEPIPTVMRS
                     NNGDTHTKAKPEFNIQSHDDTFSRKPMRPSLLSPPINIRGSFDTLHRKNVPAPISVPP
                     NPVTKNASVSPASGRISIIKKSGNRTSPTTRSPLLDTTSAFMEKTDSFAKQEASLNAL
                     ENDLQAILITTGRRSSTFSKSGTDSTIATNVLLESIQTSPQKNTHLMTNISEDDSASN
                     TDTKPMEFSSVGIESSASNSSSFADALCEPANRSSPSHNPYSGQCTTIEDRYRRSRFA
                     SQPDSLLGYINENGNKYIFSPGETAEDASPKKDMETLKTKFMTTKEPPVCPSGNDADL
                     ALIISKLKETNPSAERIETENPNDDANNLTPPATSSSNNENSSDPVAVALMKLEGTFA
                     KPAKEDNTASKLNSPRSSVLAKEVEKLDFQKWRFPSSKTMNKRQSMFIERRRTMTDIF
                     SSATEDTSSEEQSPKLSDREIRELLETYKLQDPRLNIKNVEHHVPFILMYDSCSIAKQ
                     MTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIARFNLTVDW
                     IISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWRL
                     IEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALNSEKRDW
                     IVPNEIVNYNKFQTNVQIVKNFIQRVQWARFYDIRADEDLLSKCVYISALSHEEIGYL
                     TSF"
     gene            complement(<896243..>897403)
                     /locus_tag="AGOS_ACR293C"
                     /old_locus_tag="ACR293C"
                     /db_xref="GeneID:4619830"
     mRNA            complement(<896243..>897403)
                     /locus_tag="AGOS_ACR293C"
                     /old_locus_tag="ACR293C"
                     /product="ACR293Cp"
                     /transcript_id="NM_209048.2"
                     /db_xref="GeneID:4619830"
     CDS             complement(896243..897403)
                     /locus_tag="AGOS_ACR293C"
                     /old_locus_tag="ACR293C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YLL057C (JLP1)"
                     /codon_start=1
                     /product="ACR293Cp"
                     /protein_id="NP_983695.2"
                     /db_xref="GeneID:4619830"
                     /translation="MTVRVGAGNGANGNFDTHFFAEQDEVGDDGILRLANRYILNSKF
                     PKFLPTWDHSQKYPPLVFHKYLDPALRADPQLPRFLNENVQISKITPRFGSEVRGLQL
                     SSLDAAGKDELALLASQRGVLVFRDQDFASKGPGYFEQYGSHFGKLHVHQTSGAPAGH
                     PYLHVTFRRPDRKEFERVFRDHHSSIRFHSDVSYELQPPSYTFFTVLEGPDGGGDTLF
                     SDATEAFNRLSPPLQDFLSKLHVLHSAKEQAQNAQEQGGIQRREPVAHIHPLVRVHPV
                     LKTKSFFVNRGFTRKIVELKQTESDLLLDFIYNIIENTHDLQLRASWEPGTVTVWDNR
                     RVNHSAIIDWEEPVSRHGVRITPHGERPVEDLKYLNDGDYYTSQAEVDYFTE"
     telomere        897503..907131
                     /note="Chromosome III right subtelomeric sequence. Shares
                     some sequence similarity with other subtelomeric regions."
     telomere        907132..907494
                     /note="Chromosome III right end terminal telomere repeat.
                     Composed of approximately 20 copies of a 24 base repeat
                     unit, and occasionally sequence varients of this repeat."
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_type=terminal
                     /rpt_unit_range=907467..907490
                     /rpt_unit_seq="ggtgtggtgtatgggtctctcagc"
CONTIG      join(AE016816.3:1..907494)
//
DBGET integrated database retrieval system