GenomeNet

Database: RefSeq
Entry: NC_005785
LinkDB: NC_005785
Original site: NC_005785 
LOCUS       NC_005785            1467287 bp    DNA     linear   CON 14-SEP-2017
DEFINITION  Eremothecium gossypii ATCC 10895 chromosome IV, complete sequence.
ACCESSION   NC_005785
VERSION     NC_005785.6
DBLINK      BioProject: PRJNA10623
            BioSample: SAMN03081415
            Assembly: GCF_000091025.4
KEYWORDS    RefSeq.
SOURCE      Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895)
  ORGANISM  Eremothecium gossypii ATCC 10895
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Eremothecium.
REFERENCE   1  (bases 1 to 1467287)
  AUTHORS   Dietrich,F.S., Voegeli,S., Brachat,S., Lerch,A., Gates,K.,
            Steiner,S., Mohr,C., Pohlmann,R., Luedi,P., Choi,S., Wing,R.A.,
            Flavier,A., Gaffney,T.D. and Philippsen,P.
  TITLE     The Ashbya gossypii genome as a tool for mapping the ancient
            Saccharomyces cerevisiae genome
  JOURNAL   Science 304 (5668), 304-307 (2004)
   PUBMED   15001715
REFERENCE   2  (bases 1 to 1467287)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1467287)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2012) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1467287)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 1467287)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   6  (bases 1 to 1467287)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2007) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   7  (bases 1 to 1467287)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2002) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE016817.
            On Jan 18, 2011 this sequence version replaced NC_005785.5.
            This genome has been completely resequenced to high accuracy (derf)
            and reannotated. Gene names have been maintained, though some genes
            have been added, and many protein sequences have been corrected.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1467287
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /culture_collection="ATCC:10895"
                     /db_xref="taxon:284811"
                     /chromosome="IV"
     source          13802..74366
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1909"
     source          47762..103975
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1245"
     source          78350..128182
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1278"
     source          107269..168009
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1240"
     source          174545..222107
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2113"
     source          181005..224945
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1163"
     source          224823..286051
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1005"
     source          249920..316261
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2006"
     source          299749..364233
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1264"
     source          318911..391257
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1827"
     source          373415..442712
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1374"
     source          443286..522628
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1493"
     source          541861..614767
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1277"
     source          615387..679785
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1147"
     source          638841..687359
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1169"
     source          676754..749665
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1281"
     source          715375..784145
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1927"
     source          766021..845075
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1656"
     source          786241..837889
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1806"
     source          842093..896272
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1696"
     source          849478..908586
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1535"
     source          890960..968600
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1203"
     source          951485..1020399
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1251"
     source          977883..1023199
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1920"
     source          1020346..1087615
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1492"
     source          1082077..1141244
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1586"
     source          1088227..1134357
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1327"
     source          1176005..1229905
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1480"
     source          1213054..1262909
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1212"
     source          1225327..1292003
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1050"
     source          1297299..1360162
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2102"
     source          1311823..1375333
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2004"
     source          1375287..1449579
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1153"
     telomere        complement(1..359)
                     /note="Chromosome IV left end terminal telomere repeat.
                     Composed of approximately 20 copies of a 24 base repeat
                     unit, and occasionally sequence varients of this repeat."
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_type=terminal
                     /rpt_unit_range=12..35
                     /rpt_unit_seq="ggtgtggtgtatgggtctctcagc"
     telomere        complement(360..2200)
                     /note="Chromosome IV left subtelomeric sequence. Shares
                     some sequence similarity with other subtelomeric regions."
     gene            <2278..>3450
                     /locus_tag="AGOS_ADL400W"
                     /old_locus_tag="ADL400W"
                     /db_xref="GeneID:4619833"
     mRNA            <2278..>3450
                     /locus_tag="AGOS_ADL400W"
                     /old_locus_tag="ADL400W"
                     /product="ADL400Wp"
                     /transcript_id="NM_209049.1"
                     /db_xref="GeneID:4619833"
     CDS             2278..3450
                     /locus_tag="AGOS_ADL400W"
                     /old_locus_tag="ADL400W"
                     /note="NOHBY449; No homolog in Saccharomyces cerevisiae;
                     Similar to Ashbya gossypii AGL368W and AGL369W"
                     /codon_start=1
                     /product="ADL400Wp"
                     /protein_id="NP_983696.1"
                     /db_xref="GeneID:4619833"
                     /translation="MLAPFSEVLWWGACVHVWGLRPSTNEKDLERRTCSHSCTGTIVR
                     FLAQQSPLVRHKNCRLNPLFTLARCHVVAEMLRDTESKTSIEGHKVDAVNDTALKRYR
                     YRTAICWLFCYVCHVAFCNCVLARAVQLFKEEDSEKLLANLKNYAILNCYSFELMAQT
                     IAPAGRLMNGWKFTALALCSIYLIIFDPELLYVSGCLLNFFPSVKSWSLDAIAKYFIW
                     EACVLYSIVAWVPVAANFILICKYVLAEERAMELSLGAYFDEPDNDAMLENESFSLKR
                     ARVVHNLKIIKMAVAGILFIHLLLQVFLFIIAYPASVLSEVSGKSGLYAYVLVGLLFA
                     TVVRLLSILFCICYILVTSNCIRFLSSMILFVSVVQSDFVMGVCCSFILSTVSLVG"
     gene            complement(<4367..>7024)
                     /locus_tag="AGOS_ADL399C"
                     /old_locus_tag="ADL399C"
                     /db_xref="GeneID:4619831"
     mRNA            complement(<4367..>7024)
                     /locus_tag="AGOS_ADL399C"
                     /old_locus_tag="ADL399C"
                     /product="ADL399Cp"
                     /transcript_id="NM_209050.1"
                     /db_xref="GeneID:4619831"
     CDS             complement(4367..7024)
                     /locus_tag="AGOS_ADL399C"
                     /old_locus_tag="ADL399C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YPR194C (OPT2)"
                     /codon_start=1
                     /product="ADL399Cp"
                     /protein_id="NP_983697.1"
                     /db_xref="GeneID:4619831"
                     /translation="MEKLSGEFKGSPPYFNEDKDSSSLSPSLPSQDDKKYKYNVSADA
                     QETKEVLTEDQLIYITTRMGYEHATDLEHIPESVRYLESKLADLDVEKCCEIIDVHIK
                     EHDQDPNLSTEDWNDLVRFSKRDFDPKNPQQVFELKVVAAIFHYYSPYVEVRAVASPV
                     DDPTIPVETFRAYFLATLWVVIGSGFNMFFAQRQPAISLGVFAVQMLVYPCAVLWVRV
                     MPCWGFKVFGRRIALNIESQWSEKEQMFVTLLYSITNGAFYSEYNIVTQQIHYKSPMS
                     YAYQFLLSFSLQFLGFGLAGIMRRYVVYPSIALWPSSMTTIALNKALLSSDHSNGIGR
                     KKMFYITATAIFVYNWFPTYLFEALSTFNWMTWIKPDNFSLATVTGGINGVGLNPIST
                     FDWTNIGTSSLYLPFRVTLTTYLGGLLAALVTLGVYYMNYRECQFLPIFTQSLYNNRA
                     TSYRVEEILTEDRKLDEQKFQKYGFPYYTAGNIVAYGCFMCVYTALVVTSILQQGAFY
                     GRVYKTWILDLWSLRKPSSWRAVFSNDKHVLDDFHDSHSRMMRKYKEVPEWWYMTIFI
                     VSIVIGIIVVKVFKTNTPVWGLFLAVALNFVLLLPITLLQATRGVTIGLNLLLQMISG
                     LALPGNPYALMFIKAFGYNIDGQADNYLGNMKLAHYAKIPPVPLFRGQLLMVLIQIFV
                     NLGVINWQLHNIENYCDPKQRFKFTCPGIRTYFNASVMWGAIGPKRIFEHVYPIMKWC
                     WLIGACVGLFFGLWKKLSIMYKKIPYPDRFSPVIFIIGMLSFGPPYNLQYTTSGLYVG
                     FISMCYMKRYHLRVWERYNYVVAAGISCGLVFSAIVMFFTVQWKGVEISWWGNTVSYA
                     GLDYARVPLLNVTETERGYFGPELGQIPG"
     gene            complement(<9082..>9546)
                     /locus_tag="AGOS_ADL398C"
                     /old_locus_tag="ADL398C"
                     /db_xref="GeneID:4619832"
     mRNA            complement(<9082..>9546)
                     /locus_tag="AGOS_ADL398C"
                     /old_locus_tag="ADL398C"
                     /product="ADL398Cp"
                     /transcript_id="NM_209051.1"
                     /db_xref="GeneID:4619832"
     CDS             complement(9082..9546)
                     /locus_tag="AGOS_ADL398C"
                     /old_locus_tag="ADL398C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YKL096W (CWP1)"
                     /codon_start=1
                     /product="ADL398Cp"
                     /protein_id="NP_983698.1"
                     /db_xref="GeneID:4619832"
                     /translation="MKFISSMLLGAAALANVALADSEEFNFLGLRSGSKFHFSSVHAD
                     NGALKLGGKGEALSAVITDNGKLRLSDGKYAVVTASGPIIEGSEQDASTGFSVAEGYL
                     KYAGNSAFVPISVGDSYELSVRPMDPSDIAISIRAQSKTNVGAAIPDFLANL"
     gene            10299..10388
                     /locus_tag="AGOS_t0057"
                     /db_xref="GeneID:4619839"
     tRNA            join(10299..10335,10345..10388)
                     /locus_tag="AGOS_t0057"
                     /product="tRNA-Leu"
                     /codon_recognized="CUA"
                     /db_xref="GeneID:4619839"
     gene            complement(<10438..>11022)
                     /locus_tag="AGOS_ADL397CB"
                     /db_xref="GeneID:9487601"
     mRNA            complement(<10438..>11022)
                     /locus_tag="AGOS_ADL397CB"
                     /product="ADL397C-Bp"
                     /transcript_id="NM_001355316.1"
                     /db_xref="GeneID:9487601"
     CDS             complement(10438..11022)
                     /locus_tag="AGOS_ADL397CB"
                     /note="NOHBY454; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F21164g;
                     Similar to ADL397C-A"
                     /codon_start=1
                     /product="ADL397C-Bp"
                     /protein_id="NP_001342250.1"
                     /db_xref="GeneID:9487601"
                     /translation="MSSAYWHSIATMKSIFSLVTCFLALVTSAFAQASQEEQQAAVQL
                     RKLIKDESSFQLTTINQNGTPYGIRMYYISPDRCEGVEHDGQPIFLMVDTTLQQVNAK
                     NNNNVSFSVASISIEDPMKAPRANFAGELEVLQPIPALQKCFADVHPDAKPWIPSGPS
                     PVKFYRFKIKSIYYVAAKAGYNGYIDPALYANAN"
     gene            complement(<12264..>12926)
                     /locus_tag="AGOS_ADL397CA"
                     /db_xref="GeneID:9487602"
     mRNA            complement(<12264..>12926)
                     /locus_tag="AGOS_ADL397CA"
                     /product="ADL397C-Ap"
                     /transcript_id="NM_001355315.1"
                     /db_xref="GeneID:9487602"
     CDS             complement(12264..12926)
                     /locus_tag="AGOS_ADL397CA"
                     /note="NOHBY453; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F21164g;
                     Similar to ADL397C-B"
                     /codon_start=1
                     /product="ADL397C-Ap"
                     /protein_id="NP_001342251.1"
                     /db_xref="GeneID:9487602"
                     /translation="MPCYTTLVIYIIAHSWVSIQLCFSIKERYNTTMTNFLYLVTAFI
                     SFASVALTAQSEKEAAAELRSLMSKEKTSFLNTITATDGRPFSLVHYHVSTDRCEGME
                     KTGEPILIVVDKSPQSHSIRNNGPASFSINDNSIQYKMNGVRSTFYGSFEEQQPTDEL
                     KKCFLSVHPDSQALIPGFNPKLPTRFYKLKISGIFNVPGAATNGYHGAVSPSLYAAAV
                     PA"
     gene            complement(15464..15537)
                     /locus_tag="AGOS_t0058"
                     /db_xref="GeneID:4620006"
     tRNA            complement(15464..15537)
                     /locus_tag="AGOS_t0058"
                     /product="tRNA-Val"
                     /codon_recognized="GUU"
                     /db_xref="GeneID:4620006"
     gene            complement(<15929..>16441)
                     /locus_tag="AGOS_ADL397C"
                     /old_locus_tag="ADL397C"
                     /db_xref="GeneID:4620007"
     mRNA            complement(<15929..>16441)
                     /locus_tag="AGOS_ADL397C"
                     /old_locus_tag="ADL397C"
                     /product="ADL397Cp"
                     /transcript_id="NM_209052.1"
                     /db_xref="GeneID:4620007"
     CDS             complement(15929..16441)
                     /locus_tag="AGOS_ADL397C"
                     /old_locus_tag="ADL397C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YBR072W (HSP26)"
                     /codon_start=1
                     /product="ADL397Cp"
                     /protein_id="NP_983699.1"
                     /db_xref="GeneID:4620007"
                     /translation="MSFNSPFFDFFDAINNEVANYNRLLGRGHSSSAVTKHGKKDTTD
                     WLTNARIIPPVDVLEQEKDYEVHVSVPGIVDQDKISIEFHSDRGELVISGEVPTKETE
                     ENKDGWRVRERATGSFRRVVGLPDKPGVDAEHITANYEHGVLTLRVPKLEPRENQAVR
                     KIQVGRGSAK"
     gene            <17117..>18149
                     /locus_tag="AGOS_ADL396W"
                     /old_locus_tag="ADL396W"
                     /db_xref="GeneID:4619838"
     mRNA            join(<17117..17121,17570..>18149)
                     /locus_tag="AGOS_ADL396W"
                     /old_locus_tag="ADL396W"
                     /product="ADL396Wp"
                     /transcript_id="NM_209053.1"
                     /db_xref="GeneID:4619838"
     CDS             join(17117..17121,17570..18149)
                     /locus_tag="AGOS_ADL396W"
                     /old_locus_tag="ADL396W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL246W (VPS75); 1-intron"
                     /codon_start=1
                     /product="ADL396Wp"
                     /protein_id="NP_983700.1"
                     /db_xref="GeneID:4619838"
                     /translation="MRARALEALAECEREREREERALEVERQRRLGPVYARRSKAIEG
                     IAGFWGIVLTQHGEFANYVRAADWRYVEAIRRVEVEWAGAGAWDFAITVEFGEVEGRL
                     RAQSVRKQFTVGEDGEVRSAAVEMEWPKRYDGTFFAWFRWTGERPGEEFANGDELARL
                     FSEELFPYCVRYYAEAQRDVEEEEEEEEEEEDMY"
     gene            complement(<18171..>18497)
                     /locus_tag="AGOS_ADL395C"
                     /old_locus_tag="ADL395C"
                     /db_xref="GeneID:4619834"
     mRNA            complement(<18171..>18497)
                     /locus_tag="AGOS_ADL395C"
                     /old_locus_tag="ADL395C"
                     /product="ADL395Cp"
                     /transcript_id="NM_209054.1"
                     /db_xref="GeneID:4619834"
     CDS             complement(18171..18497)
                     /locus_tag="AGOS_ADL395C"
                     /old_locus_tag="ADL395C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL244C (SUI1)"
                     /codon_start=1
                     /product="ADL395Cp"
                     /protein_id="NP_983701.1"
                     /db_xref="GeneID:4619834"
                     /translation="MSIENLKSFDPFADTGDDEASSSNYIHIRIQQRNGRKTLTTVQG
                     IPEEYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQGDQRAKVCEFLITQLAIPKKN
                     IKIHGF"
     gene            complement(<18553..>18861)
                     /locus_tag="AGOS_ADL394C"
                     /old_locus_tag="ADL394C"
                     /db_xref="GeneID:4619835"
     mRNA            complement(join(<18553..18738,18799..>18861))
                     /locus_tag="AGOS_ADL394C"
                     /old_locus_tag="ADL394C"
                     /product="ADL394Cp"
                     /transcript_id="NM_209055.3"
                     /db_xref="GeneID:4619835"
     CDS             complement(join(18553..18738,18799..18861))
                     /locus_tag="AGOS_ADL394C"
                     /old_locus_tag="ADL394C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YCR097W (HMRA1), MATA1; 1-intron"
                     /codon_start=1
                     /product="ADL394Cp"
                     /protein_id="NP_983702.3"
                     /db_xref="GeneID:4619835"
                     /translation="MSSIEETAQAIQAICSVLLGERRRTVLPKETKEFLESVFERKRC
                     PNAKERRAIAEKCGLTPIQIRIWFTNKRMRSKTRGARF"
     gene            <18965..>19393
                     /locus_tag="AGOS_ADL393W"
                     /old_locus_tag="ADL393W"
                     /db_xref="GeneID:4619836"
     mRNA            <18965..>19393
                     /locus_tag="AGOS_ADL393W"
                     /old_locus_tag="ADL393W"
                     /product="ADL393Wp"
                     /transcript_id="NM_209056.1"
                     /db_xref="GeneID:4619836"
     CDS             18965..19393
                     /locus_tag="AGOS_ADL393W"
                     /old_locus_tag="ADL393W"
                     /note="NOHBY421; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B14575g,
                     MATA2"
                     /codon_start=1
                     /product="ADL393Wp"
                     /protein_id="NP_983703.1"
                     /db_xref="GeneID:4619836"
                     /translation="MTRTINLQLPKRTSTYSSNFLKPAGCPKYEFVEGSKKPSRPRNK
                     FIIMRTIFHNSSSKIVSAIWKHSPDQFQKYFQLLAEFEQNWHKHNHSPAAALTDAEAF
                     RVIARSLHPQPRVIKRRQQKKKVKMLCGRFSRIEDVFSSL"
     gene            <19374..>19643
                     /locus_tag="AGOS_ADL393WA"
                     /old_locus_tag="ADL393W-A"
                     /db_xref="GeneID:9487600"
     mRNA            <19374..>19643
                     /locus_tag="AGOS_ADL393WA"
                     /old_locus_tag="ADL393W-A"
                     /product="ADL393W-Ap"
                     /transcript_id="NM_001355314.1"
                     /db_xref="GeneID:9487600"
     CDS             19374..19643
                     /locus_tag="AGOS_ADL393WA"
                     /old_locus_tag="ADL393W-A"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YLR154C (RNH203)"
                     /codon_start=1
                     /product="ADL393W-Ap"
                     /protein_id="NP_001342252.1"
                     /db_xref="GeneID:9487600"
                     /translation="MFLVPCKVRYSGPTAEFQSLNHIRGRKIVGKDILSKFPDSNAYL
                     ARPDNVATLNAILNCERDGNDQRLLSELHKFHENLDLNDAIHAST"
     gene            20996..21068
                     /locus_tag="AGOS_t0059"
                     /db_xref="GeneID:4619837"
     tRNA            20996..21068
                     /locus_tag="AGOS_t0059"
                     /product="tRNA-Val"
                     /codon_recognized="GUG"
                     /db_xref="GeneID:4619837"
     gene            <21270..>23027
                     /locus_tag="AGOS_ADL392W"
                     /old_locus_tag="ADL392W"
                     /db_xref="GeneID:4620008"
     mRNA            <21270..>23027
                     /locus_tag="AGOS_ADL392W"
                     /old_locus_tag="ADL392W"
                     /product="ADL392Wp"
                     /transcript_id="NM_209057.1"
                     /db_xref="GeneID:4620008"
     CDS             21270..23027
                     /locus_tag="AGOS_ADL392W"
                     /old_locus_tag="ADL392W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR202W"
                     /codon_start=1
                     /product="ADL392Wp"
                     /protein_id="NP_983704.1"
                     /db_xref="GeneID:4620008"
                     /translation="MKFLNIGLLLAGATAAIVPDDVDKDTDSADSISLRELKLGQLNF
                     LHTTDTHGWLGSHVSQPDYDATWGDYVSFAQRFRERVKDKDLILIDSGDKRTGNGLSD
                     LTSPMGLKSSGIFNLQKLDLLTLGNHELYTEDVVRLEYYGTAMEPELSDKYVTSNVEF
                     ITEDGDVYPFGNKYRYFETPNQNLRVLAFAFMFDFPWAAKNVRLTPLAEEVKKDWFTQ
                     TVEKYPADKLDIIVVFGHLPVTRGENEELLQLHKRLRESYPDTIIQYFGGHTHVRDFV
                     VLDEKATALQSGRYSETVGFLSIDDVAKEKPEFFRSYMDFNLRSFMHHSGYKNIEEFR
                     TKDGEYVNAQIEELREKLGLNTVFGYVPEDYYLDAEPIESPNNIYNFLTNKILPTLRS
                     DAYDETVSRFIMINTGSMRYDLYRGNFTADVEYIVTPYQNDWKYIEVPTKLGGILAAY
                     MNSGKPIFTSIANELPRLSRRDSRCPVITDANLSRGYTTADDAGCTGDDTPHQSTPSY
                     PVPNVVQSVEINEEAGEDGTAHLVFYSFMEKRIVVALNELNILQKVTTKTYSAADVKL
                     YGGPNSRQLLRNYFKSLSY"
     gene            complement(<23596..>24610)
                     /locus_tag="AGOS_ADL391C"
                     /old_locus_tag="ADL391C"
                     /db_xref="GeneID:4619840"
     mRNA            complement(join(<23596..24367,24597..>24610))
                     /locus_tag="AGOS_ADL391C"
                     /old_locus_tag="ADL391C"
                     /product="40S ribosomal protein S4"
                     /transcript_id="NM_209058.1"
                     /db_xref="GeneID:4619840"
     CDS             complement(join(23596..24367,24597..24610))
                     /locus_tag="AGOS_ADL391C"
                     /old_locus_tag="ADL391C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR203C (RPS4B) and YJR145C (RPS4A); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S4"
                     /protein_id="NP_983705.1"
                     /db_xref="GeneID:4619840"
                     /translation="MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPL
                     IVFLRNRLKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVITLEATNENFRLV
                     YDVKGRFAVHRITDEEATYKLGKVKRVQLGKKGVPYVVTHDGRTIRYPDPNIKVNDTV
                     KVDLATGKITDFIKFDTGKLVYVTGGRNLGRIGVITHRERHEGGFDLVHIKDSLENTF
                     VTRLNNVFVIGEQGRPWISLPRGKGIKLSIAEERDRRRAQQGL"
     gene            <25176..>27626
                     /locus_tag="AGOS_ADL390W"
                     /old_locus_tag="ADL390W"
                     /db_xref="GeneID:4619841"
     mRNA            <25176..>27626
                     /locus_tag="AGOS_ADL390W"
                     /old_locus_tag="ADL390W"
                     /product="ADL390Wp"
                     /transcript_id="NM_209059.2"
                     /db_xref="GeneID:4619841"
     CDS             25176..27626
                     /locus_tag="AGOS_ADL390W"
                     /old_locus_tag="ADL390W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR204W (MNL1)"
                     /codon_start=1
                     /product="ADL390Wp"
                     /protein_id="NP_983706.2"
                     /db_xref="GeneID:4619841"
                     /translation="MNWEDILCAIFCSLFFAVVAASELFSPFSFNKYELEHYKNEIRS
                     LFYHGYDQYLQHGYPFDEVRPISCVPNKRNFQDPYDISTNDVLGNFTTTLIDSLTTIA
                     VMGDVDKFLEGVELVNKVIPADFSLNVTVQVFETTIRLVAGLMSAHLYAVDPTKKVYL
                     GSQYDGHLLAKAKKLADRLLPAYLTETGLPVPRVNLANGLEGVPEELLQENNAAASAS
                     PMLEFTMLSYLTFDEKYRLIARYAFNKTWSLRSDLNLLPMSFNPHTEDVYHPMTGVGA
                     SIDSFYEYAIKGSILFDDSDLHSVWETAYYALSVYSKSDWFFQNVHTATGDIVTPWID
                     SLSMFFPMLQVLHGDIADAELKNLMSLKLWNTYGGIPERWLFTTLYKKQQVTVNDTVQ
                     LEWYPLRPEFVESTYSLYRATKDAFYLNIGRSILQALSTRFKTKCGFAGIQNVITGEP
                     HDRMESFVLGETLKYLYLLFDVSNELHTQKRTNQIFSTEAHPLWLTASMKARYEKNKY
                     CENDVYIQNLRRLQELDQLKSRANSSTAEEAMIPAPDFKTEDSEESLKDRVAAPILEA
                     SHVEYDHVRGTCRPLRRNKSAFYDSHLLNHFHRLFEIDYRYNVTLLRPHWMRSQHAIE
                     LESGFYRRWSTAAAQSQLATNTVSLELILDGANRPLFPPQSTRDCFYRYFPALRCSRL
                     RVERITPNATSSYGLQVAPAAFCGLSYESIAGPACDRSLPEFLLLTAVDGQAIAQEEV
                     VLVDYEDLFGPHALHLKHVLGYNAQHQLLLNCVPVVNVYVQWSGHAAKAHFGSCRTAA
                     LHNPAQDFQCSPLHNRID"
     gene            <28136..>30271
                     /locus_tag="AGOS_ADL389W"
                     /old_locus_tag="ADL389W"
                     /db_xref="GeneID:4619842"
     mRNA            <28136..>30271
                     /locus_tag="AGOS_ADL389W"
                     /old_locus_tag="ADL389W"
                     /product="ADL389Wp"
                     /transcript_id="NM_209060.1"
                     /db_xref="GeneID:4619842"
     CDS             28136..30271
                     /locus_tag="AGOS_ADL389W"
                     /old_locus_tag="ADL389W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR205W (SCH9)"
                     /codon_start=1
                     /product="ADL389Wp"
                     /protein_id="NP_983707.1"
                     /db_xref="GeneID:4619842"
                     /translation="MMNFFSKNQPSAHEQQDRPRSTANGFFPSFTHTATPTTALSENS
                     YAIGTTGLNAGKQENVLTHMKEINRQDSYQNDHSQPPQQIFPQTSSHQSHTLKDHLTV
                     TKPPPAVPPMAPENADKSASDSNMPRGKLKVTIVKAKDLLTSSDQTQPYVVCTYESSE
                     FISDGPESIDHTQRTHNARWGNRMAANEKNVRPLYTRQSSSQLDKLAAHHNYNTTSSN
                     PVWHHETTFDVIGARSELEISVYDAAHGDVFLGQVRLRPNTHTKHDVHNQWSKLNGRT
                     VGESVSGEILVRWEYWHTEKRHYGPQDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKV
                     LSKKVIVKKNEIAHTIGERNILVRTASKSCPFIVGLKFSFQTPTDLYLVTDFLSGGEL
                     FWHLQKEGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFG
                     LSKADLKDRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAED
                     NQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAVNDGAEVRAHPFLSDI
                     DWEALRNKQIPPPFKPHLTSETDTSNFDPEFTQTSTSFMNKQPIAATPLSPAMQAKFA
                     GFTFVDESAIEEHNANYNSRKFLQNSYFMEPGSFIPGDPTMPPAEDVIEDGDDDSMDL
                     ASKGNTDHLQPDYNDHHMDDDFVSGRFEI"
     gene            <30850..>32298
                     /locus_tag="AGOS_ADL388W"
                     /old_locus_tag="ADL388W"
                     /db_xref="GeneID:4619843"
     mRNA            <30850..>32298
                     /locus_tag="AGOS_ADL388W"
                     /old_locus_tag="ADL388W"
                     /product="ADL388Wp"
                     /transcript_id="NM_209061.1"
                     /db_xref="GeneID:4619843"
     CDS             30850..32298
                     /locus_tag="AGOS_ADL388W"
                     /old_locus_tag="ADL388W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR206W (SKN7) and YJR147W (HMS2)"
                     /codon_start=1
                     /product="ADL388Wp"
                     /protein_id="NP_983708.1"
                     /db_xref="GeneID:4619843"
                     /translation="MAEEIQMMGGMEVGKKLPAAQKGCVPRGNGSRAAYNDFVRKLFA
                     ILESGEYTDIISWTKEGNSFVVVDTNEFTTNILPKHFKHSNFSSFVRQLNKYDFHKVK
                     RTPEERQSSVYGEHSWEFQHPRFRRNDEAALDRIKRKTVTQKKVSLTDDMLAGHQRVG
                     NGAVAFPAMDLGATTNLLLNNTINKTKFSQLKKRVDSIELHNQQLRAENNSLKIEFQK
                     MSSRYNSMVENLVSLKNYNNSLVENFNLLVSTLAQQGLKVPHPLNLGNYASSQVAKNS
                     SASDVQPHVSPLGTVAPTSIPLAQATPSKEEANPPTSLRPGFHVLLVEDDSVCIQLCS
                     KFLRKYGCSVEVVTDGLSAIETVEKFQYDLVLMDIVMPNLDGATATSVIRSFDNQTPI
                     IAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRYLKDRIPLTEQASVVGTAQ
                     SGAQPPLLKEEQGGIQDQVLLQGEPLLKKPRV"
     gene            complement(<32499..>33965)
                     /locus_tag="AGOS_ADL387C"
                     /old_locus_tag="ADL387C"
                     /db_xref="GeneID:4619844"
     mRNA            complement(<32499..>33965)
                     /locus_tag="AGOS_ADL387C"
                     /old_locus_tag="ADL387C"
                     /product="ADL387Cp"
                     /transcript_id="NM_209062.2"
                     /db_xref="GeneID:4619844"
     CDS             complement(32499..33965)
                     /locus_tag="AGOS_ADL387C"
                     /old_locus_tag="ADL387C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR207C (SET5)"
                     /codon_start=1
                     /product="ADL387Cp"
                     /protein_id="NP_983709.2"
                     /db_xref="GeneID:4619844"
                     /translation="MGQSSLKLETIPLNDCHFSDAAPVGSVIPTESEVYDAVAQLWRQ
                     EPELERAGWEEWRARLKAIHPGWSLSVAHICRTLEKHCMSITGITQFTYHELVTSKES
                     PALREPHLAKVQVTWSEKGKGLVARRPLAKGELVFAEDALSFIPPLEKSTLVHLSKAC
                     GSCGTSLSQNRYYYVMNNLDCDNCTTIWCTKGCRNLDTTHDFLKHPMSRNKRCSAQKW
                     LKFEQFCKENTWHSAYSVGVMFARYYLHSDRRLQGNFESLAEVSQRVRLHAADTMNSG
                     AAFDLGVDLTANAQSVCMWEEGYGLFCDAFPLAKDEYDLDFEKFLRYVGKFNLNQVNG
                     QIYMLLSHLNHSCEPNIYYELEGHHINVYARKEIKSDEELTVSYVNPLHDVDLRRREL
                     RVNWGFLCLCDRCKREISKKNIDKAGHSSTTAGPEPQSYRGHRRKSSLRASKPTLQDL
                     LENGKEFDIEIPSQPGFAARRASVRFDSKVVTAVEERQ"
     gene            <34065..>34835
                     /locus_tag="AGOS_ADL386W"
                     /old_locus_tag="ADL386W"
                     /db_xref="GeneID:4619845"
     mRNA            <34065..>34835
                     /locus_tag="AGOS_ADL386W"
                     /old_locus_tag="ADL386W"
                     /product="ADL386Wp"
                     /transcript_id="NM_209063.1"
                     /db_xref="GeneID:4619845"
     CDS             34065..34835
                     /locus_tag="AGOS_ADL386W"
                     /old_locus_tag="ADL386W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER182W (FMP10)"
                     /codon_start=1
                     /product="ADL386Wp"
                     /protein_id="NP_983710.1"
                     /db_xref="GeneID:4619845"
                     /translation="MMAYKYPVGAARRQLQANIRTCKAIVNILVRKASYTTGRQFAVA
                     RRPPKWYGLGIFGASFGLGWLITQHLSYADLMAWLFYDQLPADDEKVRNYQAGLLQRA
                     HELPATKDLFESGFRQVFPERGQRNVLINQTLRRPGALSIEPLFFYNPKTKTTVGIYH
                     LGMRLTGYPFLVHGGILATVLSDLMREAVTFVTGTDYEVTEHIKISYCFPTLANQFVV
                     VRTTRVEDHGNNVRLEAEIINQSGTRTLVRAKGSFTTG"
     gene            complement(<34842..>35498)
                     /locus_tag="AGOS_ADL385C"
                     /old_locus_tag="ADL385C"
                     /db_xref="GeneID:4619846"
     mRNA            complement(<34842..>35498)
                     /locus_tag="AGOS_ADL385C"
                     /old_locus_tag="ADL385C"
                     /product="ADL385Cp"
                     /transcript_id="NM_209064.1"
                     /db_xref="GeneID:4619846"
     CDS             complement(34842..35498)
                     /locus_tag="AGOS_ADL385C"
                     /old_locus_tag="ADL385C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER183C (FAU1)"
                     /codon_start=1
                     /product="ADL385Cp"
                     /protein_id="NP_983711.1"
                     /db_xref="GeneID:4619846"
                     /translation="MSKRTLRTQLKQALDAVPKPALLEQGQQVLLALEPVLQQHRSFA
                     CYLNMDSGEAPTEAILERLFQLGKDVYLPRCTDSSASGIAGAGSHMRRHLTFYHMQSM
                     AAVRALRPQGKYGLREPPAEAPPPALPDVDVVLMPGLGFCADTGARLGRGAGYYDNYV
                     SRTQQLHGRRPLLVGLALSQQLMLHVPLEPHDQCLDAVACGDGQLRWAQRAPGEIVDI
                     "
     gene            <35747..>36877
                     /locus_tag="AGOS_ADL384W"
                     /old_locus_tag="ADL384W"
                     /db_xref="GeneID:4619847"
     mRNA            <35747..>36877
                     /locus_tag="AGOS_ADL384W"
                     /old_locus_tag="ADL384W"
                     /product="ADL384Wp"
                     /transcript_id="NM_209065.1"
                     /db_xref="GeneID:4619847"
     CDS             35747..36877
                     /locus_tag="AGOS_ADL384W"
                     /old_locus_tag="ADL384W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR208W (BAT1) and YJR148W (BAT2)"
                     /codon_start=1
                     /product="ADL384Wp"
                     /protein_id="NP_983712.1"
                     /db_xref="GeneID:4619847"
                     /translation="MSTAELDASKLKVIRKEEPTVFEQNADFTFGRLFIDHMLVVEWK
                     RESGWQAPEIRPYGNLSLDPSACVFHYGFELFEGMKAYRTEDGRVTLFRPEMNAARMN
                     RSAARIGLPQFDAEQLVELIGKLVELDRQFVPQRPGYSLYIRPVMIGTSASLGVTAPD
                     SALLYVIACPVGPYYKSGFSAVRLLATDNVTRAWPGGFGDKKLGGNYAPCIPSQEEAA
                     RLGYHQNLWLFGPEKYITEVGTMNAFFVFKDSTTGKKELVTAPLDGTILEGVTRDSVL
                     TLARERLSPEEWDVSERYYTISEVAERAAKGEVVEAFGCGTAVVVSPIKEIGWNDQAI
                     KIPLLPGEETGEFTKQVAHWISEIQYGKVEYNNWSRTIADLK"
     gene            37469..37539
                     /locus_tag="AGOS_t0060"
                     /db_xref="GeneID:4619848"
     tRNA            37469..37539
                     /locus_tag="AGOS_t0060"
                     /product="tRNA-Gly"
                     /codon_recognized="GGG"
                     /db_xref="GeneID:4619848"
     gene            <37638..>38825
                     /locus_tag="AGOS_ADL383W"
                     /old_locus_tag="ADL383W"
                     /db_xref="GeneID:4620009"
     mRNA            <37638..>38825
                     /locus_tag="AGOS_ADL383W"
                     /old_locus_tag="ADL383W"
                     /product="ADL383Wp"
                     /transcript_id="NM_209066.1"
                     /db_xref="GeneID:4620009"
     CDS             37638..38825
                     /locus_tag="AGOS_ADL383W"
                     /old_locus_tag="ADL383W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR085C (ASA1)"
                     /codon_start=1
                     /product="ADL383Wp"
                     /protein_id="NP_983713.1"
                     /db_xref="GeneID:4620009"
                     /translation="MRFTLRAHVSTVTDLKPVSHRQTPHLLSADSKGCLYLWNLISRR
                     PIASIDLKTHIIAIEVVGQGLYAALARDNKLRFISLQEESRLTRINDKVSRELQSLEI
                     VYEIPVNCLNFANFALQDLGLRNYRLWCCNTMDAESIDVYEFQLGDRQSFKRTFNAIN
                     LFDSVAGLAEAKQKFRFDKMGIVMRFIVAGDTVFCGYESGVVVGLRIRDKSLQICYAS
                     FAHYPEPVLSLAHDRTERRVFSSSTTDQVCVHNIPTPDLPVVTSVSGIQVVANAGTRE
                     EVINAPLKKIGHLAVLNDILLLTSWHGYVLGLQDQKELFRYRKERNLLCVDDSTDGQA
                     ETKKEKPWINPGPIAGIAHSTDSQLVLEKLPIGGHRRLKNFLEHKWYITGYNDGTITV
                     SQI"
     gene            complement(<38868..>40217)
                     /locus_tag="AGOS_ADL382C"
                     /old_locus_tag="ADL382C"
                     /db_xref="GeneID:4619849"
     mRNA            complement(<38868..>40217)
                     /locus_tag="AGOS_ADL382C"
                     /old_locus_tag="ADL382C"
                     /product="ADL382Cp"
                     /transcript_id="NM_209067.1"
                     /db_xref="GeneID:4619849"
     CDS             complement(38868..40217)
                     /locus_tag="AGOS_ADL382C"
                     /old_locus_tag="ADL382C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR084W"
                     /codon_start=1
                     /product="ADL382Cp"
                     /protein_id="NP_983714.1"
                     /db_xref="GeneID:4619849"
                     /translation="MSVASEKPIRLAVLGGSCTGKTSFISRLTVDIVREAHYPTRKQN
                     NWLFTFNPTDPLARAILDEKAHERYYYSDEHAVPEPVFRTPSITDHVLLSPPVYQSFI
                     QNYQMVKHALAVGQRLADQRTLLKSDNQYYQYKNEDVGHGPDSCSRRTARLQERTRRR
                     GAVDRCLPSNYTPPRYSSISIDIIDTPAYDPDMVIPFLEVSLFSNLDKSILRGLADHP
                     RKPVSTQSLLVASGASELNGKVDGYIFVYSALPELNYAEPPSYDSLNRVSGGVGQAPA
                     QGQAVEYKRTSAQDGGFSLLSSIRACFLDAWTEFRNYQRRAAQIKEGDIYSLMYSLKQ
                     AWKPDPQATGKDKGTRELSASLDQIDLNPDSPNSPPPMLIICTHILDPLHSPLLVEHG
                     KRLAVEWKCAFVALDSMSDFNVDVAMACIIRDIVEKEKLLNKHITKKKGVLHKIIKG"
     gene            <40547..>41473
                     /locus_tag="AGOS_ADL381W"
                     /old_locus_tag="ADL381W"
                     /db_xref="GeneID:4619850"
     mRNA            <40547..>41473
                     /locus_tag="AGOS_ADL381W"
                     /old_locus_tag="ADL381W"
                     /product="ADL381Wp"
                     /transcript_id="NM_209068.1"
                     /db_xref="GeneID:4619850"
     CDS             40547..41473
                     /locus_tag="AGOS_ADL381W"
                     /old_locus_tag="ADL381W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR128C (ATG14)"
                     /codon_start=1
                     /product="ADL381Wp"
                     /protein_id="NP_983715.1"
                     /db_xref="GeneID:4619850"
                     /translation="MQCTICHRPSTVWYCAHCVNTSPKLILRYKLELTQICEEVTEMR
                     DIVTSTLENAISEKEGLLGKHMERLQHLRLKRYNARLSHRARELEQHLDSKLSRRDGL
                     RRALKQLSPDVAVVPAEDPDEYRELRHKLTLLQNVVSMKSTQKFEELCQWFVFTCSTT
                     EDDHFPYSIRFIPVCNIRNWRLLSTAQESLQHMCEFVIYASRALLVDIPFGSHSEKLT
                     TDHIAAVSHFTVNLLTILIKRKRLQERPDVPDLLGRYDIDGLLYLLCSGGDVESITGT
                     CPPTYKVVHEFVRTALEDGDQSEERGHWMVLE"
     gene            <41757..>43307
                     /locus_tag="AGOS_ADL380W"
                     /old_locus_tag="ADL380W"
                     /db_xref="GeneID:4619851"
     mRNA            <41757..>43307
                     /locus_tag="AGOS_ADL380W"
                     /old_locus_tag="ADL380W"
                     /product="ADL380Wp"
                     /transcript_id="NM_209069.1"
                     /db_xref="GeneID:4619851"
     CDS             41757..43307
                     /locus_tag="AGOS_ADL380W"
                     /old_locus_tag="ADL380W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR127C (VMA2)"
                     /codon_start=1
                     /product="ADL380Wp"
                     /protein_id="NP_983716.1"
                     /db_xref="GeneID:4619851"
                     /translation="MISDNELFALNKQAATAGLKAKPRISYNTVAGVNGPLVILERVK
                     YPQYNEIVNLTLPDGSIRQGQVLEVRGDRAIVQVFEGTSGIDVKKTTVEFTGQSLKIP
                     VSDDTLGRIFDGSGRPIDNGPKVFAEDYVDINGSAINPYARIYPEEMISTGISAIDTM
                     NSIARGQKIPIFSASGLPHNEIAAQICRQAGLVRPTKDVHDGHEDNFSIVFAAMGVNL
                     ETARFFKQDFEENGSLERTSLFLNLANDPTIERIITPRLALTTAEYLAYQTERHVLTI
                     LTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVEGRNGSITQIPIL
                     TMPNDDITHPIPDLTGYITEGQIFVDRQLSNKGIYPPINVLPSLSRLMKSAIGEGMTR
                     KDHGDVSNQLYAKYAIGRDAAAMKAVVGEEALSMEDRLSLEFLENFEKTFISQGAYEN
                     RTIFESLDHAWSLLRIYPKEMLNRISPKILDEFYNRARDSDADDADDDEEDDDSDESH
                     QEAERSLI"
     gene            complement(<43797..>45395)
                     /locus_tag="AGOS_ADL379C"
                     /old_locus_tag="ADL379C"
                     /db_xref="GeneID:4619852"
     mRNA            complement(<43797..>45395)
                     /locus_tag="AGOS_ADL379C"
                     /old_locus_tag="ADL379C"
                     /product="ADL379Cp"
                     /transcript_id="NM_209070.1"
                     /db_xref="GeneID:4619852"
     CDS             complement(43797..45395)
                     /locus_tag="AGOS_ADL379C"
                     /old_locus_tag="ADL379C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR083W (MDM36)"
                     /codon_start=1
                     /product="ADL379Cp"
                     /protein_id="NP_983717.1"
                     /db_xref="GeneID:4619852"
                     /translation="MEYTDPILSHFADKSSLDAAKLGELLEAQRVESRARGEEAREEA
                     ALRQCEATLSMYTDLIKLKVLLRKTWDLQALDKSVQVRFGPAGAGEAKELTRPTEDFY
                     RDIALKTVAKCDKISKALEQLTVDSHATIHAIQEFSHGQAHEYYMRDSVCLLLEMWFL
                     CGNLLRELKRSVASFFMKAKLLLVDHELECIQSSISGHAAQEQYHALSETISSYNSFI
                     RVLLQQLQDAENSGDQSLFEDCLGVFLDVESMYQSLNMTWLLRENRLLQADITAIERE
                     QFDREEQRNAERIGQLVDEAVHKDTHTGDADATSVVFDASEDTIVADQCIEKSQLGSS
                     GTLAPPVVANRTDNERSELLSNLEQTSISQELPNLLKAFNNAKRLELELENVRMSPET
                     RSPMGSPRSPAMTDSALQHHSPTLQASTYGRMSSSTSPRARTFTSLKDTTPALLLPPG
                     MNSNPCRMGPSLAGSSILEGLGHKKQDTKSGDDKAIPATKLKQDMMKLMTSNSVLQHG
                     APQAPIYGFGSNVLNNLYGIRSRK"
     gene            <46376..>47860
                     /locus_tag="AGOS_ADL378W"
                     /old_locus_tag="ADL378W"
                     /db_xref="GeneID:4619853"
     mRNA            <46376..>47860
                     /locus_tag="AGOS_ADL378W"
                     /old_locus_tag="ADL378W"
                     /product="ADL378Wp"
                     /transcript_id="NM_209071.1"
                     /db_xref="GeneID:4619853"
     CDS             46376..47860
                     /locus_tag="AGOS_ADL378W"
                     /old_locus_tag="ADL378W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR126C (TPS1)"
                     /codon_start=1
                     /product="ADL378Wp"
                     /protein_id="NP_983718.1"
                     /db_xref="GeneID:4619853"
                     /translation="MTEEVRKQAQQLTLDTQRSEEHSGNVVVVSNRLPVTIKKNDSGE
                     YEYSMSSGGLVTALQGLKKSTKFQWYGWPGLEIPEGDREQVQRDLLEKFNAIPIFLSD
                     ELADLHYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANRAFAEAIQKNLRDDDIVW
                     VHDYHLMLLPELLRNYIATANLQNVKLGWFLHTPFPSSEIYRILPVRQEILRGVLSCD
                     LLGFHTYDYARHFLSSVHRILNVNTLPNGVKFQGRFVNVAAFPIGIDVNNFTEGLQKE
                     SVVQRVKQLKETFKDCKIIVGVDRLDYVKGVPHKLHAIEVFLNEHPEWIGKVVLVQVA
                     VPSRGHVEEYQYLRNVVNELVGRINGQFGTVEFVPIHFMHKSVPFEELISLYSISDVC
                     LVSSTRDGMNLVSYEYIACQAENKGSLILSEFTGAAQSLNGAFIVNPWNTDELAEAIH
                     ESLTLPIEKREANWEKLYKYISKYTSSYWGETFVHELYKLSSQK"
     gene            <48319..>49587
                     /locus_tag="AGOS_ADL377W"
                     /old_locus_tag="ADL377W"
                     /db_xref="GeneID:4619854"
     mRNA            <48319..>49587
                     /locus_tag="AGOS_ADL377W"
                     /old_locus_tag="ADL377W"
                     /product="ADL377Wp"
                     /transcript_id="NM_209072.2"
                     /db_xref="GeneID:4619854"
     CDS             48319..49587
                     /locus_tag="AGOS_ADL377W"
                     /old_locus_tag="ADL377W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR125C (PTC4)"
                     /codon_start=1
                     /product="ADL377Wp"
                     /protein_id="NP_983719.2"
                     /db_xref="GeneID:4619854"
                     /translation="MGQLLSHPLTEKTIVYNDYLLEANGKHANLPDGSMKPYAKERHH
                     RHLHLRRQFTENKSQEVVLTDTSSEITKEHASCTQFFNCVGSMQGYRMTQEDAHLVSN
                     CDTQLVASFRNPMNNNAVEKLRISVFGVFDGHGGDECSQFLADSEKGLLKWIKYSFEN
                     HEYCSISDSASTASSRRAFCTVEGLISQIFRDAFALQDKDLHCHFANSPCGSTAVVAA
                     IINSETLYVVNCGDSRCILASMNSCIKTMSFDHKPQHIGELIRINDDGGTVSLGRVGG
                     VLALSRAFGDFQFKRSVAYKDSQLTNSIRRYIPAAEAQVTVEPDVLTHSLDYAKDEFL
                     VLACDGIWDIYSNKALTQFIKYHLTLGLRLDDIVTKLLDHGLAGADSNTGVGFDNMTI
                     IIIVLNKPGETLSQWYAKMKMRMEQEKGLV"
     gene            <49782..>51719
                     /locus_tag="AGOS_ADL376W"
                     /old_locus_tag="ADL376W"
                     /db_xref="GeneID:4619855"
     mRNA            <49782..>51719
                     /locus_tag="AGOS_ADL376W"
                     /old_locus_tag="ADL376W"
                     /product="ADL376Wp"
                     /transcript_id="NM_209073.2"
                     /db_xref="GeneID:4619855"
     CDS             49782..51719
                     /locus_tag="AGOS_ADL376W"
                     /old_locus_tag="ADL376W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR123C (TFC1)"
                     /codon_start=1
                     /product="ADL376Wp"
                     /protein_id="NP_983720.2"
                     /db_xref="GeneID:4619855"
                     /translation="MKCHYREIRLSRVRSRPINKHTIYRKQATITSGWASMSEEVART
                     RSTTPTDVPGPRAREFTLDLPRIPSIEFPLKVSQSQESIEKVINMCGGLPKVRRALAA
                     HSDSSHDLELRLNDGSEEDGRPQFFNEHPIIGKRVQQRDEAIVLKISMPRGTMERNDG
                     DVRKALASLPASKVKAVPVAILHNTVRFREMSDFQVRLDNNPSAKEFNDSFGTLNWEK
                     FKKFVETIPDYDDKPFENIGKVVFDRASVCPSSDFQLPPIPRFSMVGLPFIYKYRSNP
                     YATKTASGESKVVGTYIKNYQQFVHDFSPSVSVPLTPHPELVKQYELAKKTKVYPGSK
                     SDSKFYEKLEQCLPILTELFNRRHVWIKRHIDGIIPQDLHVVLKIALSLVSYRFTKGP
                     WRNTYIKLGVDPRSSNEYAKYQTEYFKIERRLLRNTAVRKNVPDPPERFYRTNTPNDI
                     DSRFRFDGKQIPWYLMLQIDLLTDEPNIKEVFQNAVYLDTPKELTGWFSELDLTKIRK
                     IVKYELGCMVQGNYEFNEHKLKYFKVMLYVKETLSSKDGDGDVHMTDEKEDAEDEDED
                     NGVETGELDETVLQADEEDEDEIPMHRALTQPEGSEDSDEFSIKTASFKEIVERIARS
                     DPETADYLAKDLDGFVLETQI"
     gene            <51891..>52409
                     /locus_tag="AGOS_ADL375W"
                     /old_locus_tag="ADL375W"
                     /db_xref="GeneID:4619856"
     mRNA            <51891..>52409
                     /locus_tag="AGOS_ADL375W"
                     /old_locus_tag="ADL375W"
                     /product="mitochondrial 54S ribosomal protein YmL36"
                     /transcript_id="NM_209074.1"
                     /db_xref="GeneID:4619856"
     CDS             51891..52409
                     /locus_tag="AGOS_ADL375W"
                     /old_locus_tag="ADL375W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR122C (MRPL36)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL36"
                     /protein_id="NP_983721.1"
                     /db_xref="GeneID:4619856"
                     /translation="MFRSLITKRFISGPPGLSTAQASLPKRPLRKIRPGKARPAIYHQ
                     FNVQIELSDGSVITRKSQYPKAEIRLIQDQRNCILWNESRTDLVVVDANTGGRMDKFK
                     QKYGSAYSMKTADPQAATEASAEHQADAKAASEEDDSAFGMDDYLDLLSANAVAVQSG
                     GKLAGKQKKSKK"
     gene            <52620..>53051
                     /locus_tag="AGOS_ADL374W"
                     /old_locus_tag="ADL374W"
                     /db_xref="GeneID:4619857"
     mRNA            <52620..>53051
                     /locus_tag="AGOS_ADL374W"
                     /old_locus_tag="ADL374W"
                     /product="ADL374Wp"
                     /transcript_id="NM_209075.1"
                     /db_xref="GeneID:4619857"
     CDS             52620..53051
                     /locus_tag="AGOS_ADL374W"
                     /old_locus_tag="ADL374W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR082C (DIB1)"
                     /codon_start=1
                     /product="ADL374Wp"
                     /protein_id="NP_983722.1"
                     /db_xref="GeneID:4619857"
                     /translation="MGSVFLPHLHSGWHVDQAIVTEEERLVVIRFGSDSDRSCMLMDE
                     ILYSIAEKVVNFAAIYVCDTTEVPDFNEMYELQDPMTVMFFYKNKHMRCDFGTGNNNK
                     MNFVVDNKQEMIDIIETVFRGARRNKGLVVSPYDYNYKRIQ"
     gene            <53437..>55413
                     /locus_tag="AGOS_ADL373W"
                     /old_locus_tag="ADL373W"
                     /db_xref="GeneID:4619858"
     mRNA            <53437..>55413
                     /locus_tag="AGOS_ADL373W"
                     /old_locus_tag="ADL373W"
                     /product="ADL373Wp"
                     /transcript_id="NM_209076.1"
                     /db_xref="GeneID:4619858"
     CDS             53437..55413
                     /locus_tag="AGOS_ADL373W"
                     /old_locus_tag="ADL373W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR121C (GRS1) and YPR081C (GRS2)"
                     /codon_start=1
                     /product="ADL373Wp"
                     /protein_id="NP_983723.1"
                     /db_xref="GeneID:4619858"
                     /translation="MASEDVQLARKAVEFNRENLESVLKRRFFFAPAFELYGGVSGLY
                     DYGPPGCAFQANIVDVWRKHFILEEDMLEVDCTMLTPYEVLKTSGHVDKFSDWMCQDP
                     KSGEIFRADHLVEEVLEARLKGDKAARGISAAPEEEDADKKKRKKKVKQIKAEKLDDS
                     VIQEYESVLAKIDGYSGEELGELMVKFNIGNPVTGETLEPPKAFNLMFETAIGPSGQL
                     KGYLRPETAQGQFLNFNKLLEFNNGKTPFASASIGKSFRNEISPRSGLLRVREFLMAE
                     IEHFVDPENKNHPRFDEVKNLKLKFLPKGVQEAGRTEPIESTVADAVASGMIDNQTLG
                     YFIARIYQFLTKIGVDEEKLRFRQHMSNEMAHYATDCWDAELKTSYGWIECVGCADRS
                     AYDLTVHANKTKTALVVREKLDVPRQVTQWEIELTKKLFGPKFRKDAPKVENYLLNLS
                     QDELASKAEQLSSDGKIVFQVEGIEGDIELDSKFISIEHKTKTEHVREYVPNVIEPSF
                     GIGRIIYAIFEHSFWSRPEDAARSVLSFPPLVAPTKVLLVPLSNNADLAEVVTEVSRV
                     LRKEQIPFKVDDSGVSIGKRYARNDELGTPFGITIDFESIKDGSVTLRERDSTRQVRG
                     SVTDIIRAIRDITYNGVTWEEGTKSLTPFVSQSE"
     gene            <55636..>56106
                     /locus_tag="AGOS_ADL372W"
                     /old_locus_tag="ADL372W"
                     /db_xref="GeneID:4619859"
     mRNA            <55636..>56106
                     /locus_tag="AGOS_ADL372W"
                     /old_locus_tag="ADL372W"
                     /product="ADL372Wp"
                     /transcript_id="NM_209077.1"
                     /db_xref="GeneID:4619859"
     CDS             55636..56106
                     /locus_tag="AGOS_ADL372W"
                     /old_locus_tag="ADL372W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR120C (CBP6)"
                     /codon_start=1
                     /product="ADL372Wp"
                     /protein_id="NP_983724.1"
                     /db_xref="GeneID:4619859"
                     /translation="MSSTPVKDAAKQLVKTLEKFPAERIKHMQCFRDVQLSRFRRIAG
                     LESAPKDTKKPSISDIKDILNRTSGPLGLRKDLLKKMANAMPQEHFTPTSIEQQRLAL
                     ERILSNRYKTHYEVGDKLYKPAGKPQYYERLLAEVQGRSKESLLTAMRTVLFGK"
     gene            complement(<56220..>57131)
                     /locus_tag="AGOS_ADL371C"
                     /old_locus_tag="ADL371C"
                     /db_xref="GeneID:4619860"
     mRNA            complement(join(<56220..57063,57121..>57131))
                     /locus_tag="AGOS_ADL371C"
                     /old_locus_tag="ADL371C"
                     /product="ADL371Cp"
                     /transcript_id="NM_209078.2"
                     /db_xref="GeneID:4619860"
     CDS             complement(join(56220..57063,57121..57131))
                     /locus_tag="AGOS_ADL371C"
                     /old_locus_tag="ADL371C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR119W (MUD1); 1-intron"
                     /codon_start=1
                     /product="ADL371Cp"
                     /protein_id="NP_983725.2"
                     /db_xref="GeneID:4619860"
                     /translation="MRQSVYLSNLPASNASRIEYARQLLKSINKDNPYALSAEKTLPE
                     PLPSADVPLPLLDEKYGVVSVSRPRKCRNKCFLGFATPSQADEFLQNFKDRLFIYGHQ
                     VNIEPAKHDAFWYIEREDPRACQRLRKHRAQLADPEAKLRVRSNRRLRRLRSRLRKRG
                     LDAEHITEVVQRIKEKSKPSAENKTVRERTPSSAAVADPKKRVVDVANNPPNKVLLVQ
                     DLPTDITEQELVDIFANDKLLQVRLVQVRQLAFVDYADVQSATAVKNKLGTNYVIKNQ
                     TTIIGYAK"
     gene            complement(<57297..>58673)
                     /locus_tag="AGOS_ADL370C"
                     /old_locus_tag="ADL370C"
                     /db_xref="GeneID:4619861"
     mRNA            complement(<57297..>58673)
                     /locus_tag="AGOS_ADL370C"
                     /old_locus_tag="ADL370C"
                     /product="ADL370Cp"
                     /transcript_id="NM_209079.1"
                     /db_xref="GeneID:4619861"
     CDS             complement(57297..58673)
                     /locus_tag="AGOS_ADL370C"
                     /old_locus_tag="ADL370C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR080W (TEF1) and YBR118W (TEF2)"
                     /codon_start=1
                     /product="ADL370Cp"
                     /protein_id="NP_983726.1"
                     /db_xref="GeneID:4619861"
                     /translation="MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK
                     EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNM
                     ITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDSVKW
                     DESRYQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKA
                     GAVKGKTLLEAIDAIEPPVRPTDKALRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVV
                     TFAPSGVTTEVKSVEMHHEQLEEGVPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKA
                     AESFNATVIVLNHPGQISAGYSPVLDCHTAHIACKFDELLEKNDRRTGKKLEDSPKFL
                     KAGDAAMVKFVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVVKSDKAGKVTK
                     AAQKAGKK"
     gene            complement(<58958..>59779)
                     /locus_tag="AGOS_ADL369C"
                     /old_locus_tag="ADL369C"
                     /db_xref="GeneID:4619862"
     mRNA            complement(<58958..>59779)
                     /locus_tag="AGOS_ADL369C"
                     /old_locus_tag="ADL369C"
                     /product="ADL369Cp"
                     /transcript_id="NM_209080.1"
                     /db_xref="GeneID:4619862"
     CDS             complement(58958..59779)
                     /locus_tag="AGOS_ADL369C"
                     /old_locus_tag="ADL369C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR079W (MRL1)"
                     /codon_start=1
                     /product="ADL369Cp"
                     /protein_id="NP_983727.1"
                     /db_xref="GeneID:4619862"
                     /translation="MPTQLQRPLARLLALALLVLLARAAEDEPPFCAVRNRSTGSYID
                     LSPLASNVSGTPPNWLVRGWQYGANFTLGVCTSPLGDGPAAYYSDTGRRVSIGRVATT
                     PRYTGKKLTLTYEGGDLCPNRVDRKSSLLYFVCDRDIHTIAQVSLLGVLHNCSYLFEV
                     RSVHACAAARAAGDRSVLGIFAAILLVFAAVELARRCCAAPLRRRFRPDFPADRPRWA
                     PAPTGWAARTRAFFARAAEPRQAIKLASSPPGHPASDMEAQNTLLDSLDVRSSGA"
     gene            <60332..>61276
                     /locus_tag="AGOS_ADL368W"
                     /old_locus_tag="ADL368W"
                     /db_xref="GeneID:4619863"
     mRNA            <60332..>61276
                     /locus_tag="AGOS_ADL368W"
                     /old_locus_tag="ADL368W"
                     /product="ADL368Wp"
                     /transcript_id="NM_209081.1"
                     /db_xref="GeneID:4619863"
     CDS             60332..61276
                     /locus_tag="AGOS_ADL368W"
                     /old_locus_tag="ADL368W"
                     /note="NOHBY420; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ADL368Wp"
                     /protein_id="NP_983728.1"
                     /db_xref="GeneID:4619863"
                     /translation="MIDLDTRGAPEAASPLDYDGYETFCNEQCASQRTGNFIPTMVLE
                     RREELRQQQLSILKFDDADFNTHEDQEFAELMKENDDLMCRIEQLAHSTQEHISKADR
                     VLRSTEPGFFSKMFPKLSANSARYFPGMSGLPESATGLTSSAGAPTGLADSGSAFVAG
                     QLQPANRRRRFLKRLTSWLRGSQLGGDFPIRSYSSRHAPSSRKSWKWPSGGSSLARAD
                     DLRLGRNLISSPYDDHLKLCTPIIMKSHSYRRSHSMGTLQSKHFYDKVRRGMLFYNSR
                     KKARPSRPSDLQEKDTRKSGEDYGSASSYKAYGNLITT"
     gene            <62204..>63127
                     /locus_tag="AGOS_ADL367W"
                     /old_locus_tag="ADL367W"
                     /db_xref="GeneID:4619864"
     mRNA            <62204..>63127
                     /locus_tag="AGOS_ADL367W"
                     /old_locus_tag="ADL367W"
                     /product="ADL367Wp"
                     /transcript_id="NM_209082.2"
                     /db_xref="GeneID:4619864"
     CDS             62204..63127
                     /locus_tag="AGOS_ADL367W"
                     /old_locus_tag="ADL367W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR075C (OPY2)"
                     /codon_start=1
                     /product="ADL367Wp"
                     /protein_id="NP_983729.2"
                     /db_xref="GeneID:4619864"
                     /translation="MSCTRCSENRCVPIDALDDGGADSAVSADSKSGKVAVGAIIGGV
                     VGGLLLLVGLGLLTYYHKYWRKRKQRYADTVGSDPPDDEKAMYKAADSAGGNGTPKGD
                     MAAAYQPRNRSSAATMATRASNVLPVAYIPGVTAVGKKFRNRHLFNNGDTRSHITLGS
                     SILGGDDDDFDDDSEIGSQAGDRSSVGVQHAGNLTTAIRAKPKLVQINEEDETEDTES
                     LPPAGSSSTTGALPRKAAVTVEAAPEAAKAVSAALSQDPFHMDGEDDNHDKDKDEGTD
                     SNDEPDDDDDEGSFILDVEVAEPIRKNSLRR"
     gene            <63579..>65621
                     /locus_tag="AGOS_ADL366W"
                     /old_locus_tag="ADL366W"
                     /db_xref="GeneID:4619865"
     mRNA            <63579..>65621
                     /locus_tag="AGOS_ADL366W"
                     /old_locus_tag="ADL366W"
                     /product="ADL366Wp"
                     /transcript_id="NM_209083.1"
                     /db_xref="GeneID:4619865"
     CDS             63579..65621
                     /locus_tag="AGOS_ADL366W"
                     /old_locus_tag="ADL366W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR074C (TKL1) and YBR117C (TKL2)"
                     /codon_start=1
                     /product="ADL366Wp"
                     /protein_id="NP_983730.1"
                     /db_xref="GeneID:4619865"
                     /translation="MTQFSDVDRLAVSTIRLLSVDQVSKANSGHPGAPLGLAPAAHVV
                     WKQMRLNPKSPKWINRDRFVLSNGHACALLYSLLHLFGYDLSIEDLKQFRQVGSKTPG
                     HPEYELPGVEVTTGPLGQGISNAVGLAIAQANLAATYNKPGYELSDNYTYVFLGDGCL
                     QEGVSSEASSLAGHLKLGNLIAFYDDNKITIDGHTEVSFDEDVLKRYEAYGWEVLNVA
                     NGDENLEDIASALEQAKKNKDKPTLIKLTTTIGFGSLNAGSHTVHGAPLKADDVKQLK
                     TKLGFNPDESFIVPQEVYDLYHNSTIQPGAESEKEWNALLEKYAGEYPKEAAELKRRL
                     AGKLPENWESKLPVYKPTDSAVASRKLSEIVLQSIFEDVPELIGGSADLTPSNLTRTT
                     NAVDFQPPQSGLGDYSGRYIRFGVREHGMGAIINGLSAYGANYKVFGATFLNFVSYAA
                     GAVRLAALSGHPVIWIATHDSIGLGEDGPTHQPIETLAHLRAIPNMMVWRPADGNEVS
                     AAYKVALESQDTPSVIALSRQNLPQLDGSSIEKASKGGYILQDVENPDIAIVSTGSEV
                     GIAVEAAKLLAEKNMKVRIVSLPDFHTFSRQPKEYQLSVLPDRVPILSVEVLSTSGWS
                     EYAHQSFGLNRFGASGKGPEVYKFFEFTPEGIASRAEKTVAFYKGKEVLSPLNKAF"
     gene            <65962..>66435
                     /locus_tag="AGOS_ADL365W"
                     /old_locus_tag="ADL365W"
                     /db_xref="GeneID:4619866"
     mRNA            <65962..>66435
                     /locus_tag="AGOS_ADL365W"
                     /old_locus_tag="ADL365W"
                     /product="ADL365Wp"
                     /transcript_id="NM_209084.1"
                     /db_xref="GeneID:4619866"
     CDS             65962..66435
                     /locus_tag="AGOS_ADL365W"
                     /old_locus_tag="ADL365W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR073C (LTP1)"
                     /codon_start=1
                     /product="ADL365Wp"
                     /protein_id="NP_983731.1"
                     /db_xref="GeneID:4619866"
                     /translation="MPDQIAVAFVCLGNICRSPMAEAIFKHTVKKAGLEHRFSNIDSF
                     GTAAYHVGSTPDSRTVSICRKHGVHIDHRGQQIKTKHFAEFDYVICMDESNRRNLERM
                     KPQDSKAQVHMFGHWNTGGKFDTIVEDPYYGGTEGFEYNYQQVCYFSEQFLKREL"
     gene            complement(<66561..>68075)
                     /locus_tag="AGOS_ADL364C"
                     /old_locus_tag="ADL364C"
                     /db_xref="GeneID:4619867"
     mRNA            complement(<66561..>68075)
                     /locus_tag="AGOS_ADL364C"
                     /old_locus_tag="ADL364C"
                     /product="ADL364Cp"
                     /transcript_id="NM_209085.1"
                     /db_xref="GeneID:4619867"
     CDS             complement(66561..68075)
                     /locus_tag="AGOS_ADL364C"
                     /old_locus_tag="ADL364C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR072W (NOT5)"
                     /codon_start=1
                     /product="ADL364Cp"
                     /protein_id="NP_983732.1"
                     /db_xref="GeneID:4619867"
                     /translation="MSQRKLLQEVDKVLKKVKEGLVEFDLIYEKFQATESDNQSYREK
                     LESDLKREIKKLQKHREQIKSWLSKDDVKEKNALLMENRRLIENGMERFKSVEKIMKT
                     KKFSTEALSNPDLIKDPRELKKRDQFIFVEECLEELQKQLESYEAQELAEKVERHQFH
                     ISNLENILRMLQNNELEPDTVEEYQDDIRYYVDNNDDPDFIEYETIYEDMGCELQSEE
                     GKDQPTPVKPKTKLERSPKKKATSPAPINIGTKSVVSTTGTATAPSAPGSQASSASPD
                     SSAKQKKDSSPLPLDLPPPKDFSKEIEEIIEHDLTKLAFQNPLFKDELPYWLQAKRPL
                     IQPYSTMSERMLKQLESSLLNCPDSLDADTPHLYQHPLSLPHPTSIFFPSEPIRFVAA
                     GWNNDNTSTKDIYGKTSMVQIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFN
                     RVNRCWFYKEVEKLPPGMDQKEEVSWRYFDYQKSWLARRCGPDFVFRSEEFERL"
     STS             68110..69682
                     /standard_name="Myf5"
                     /db_xref="UniSTS:507078"
     gene            complement(<70483..>71034)
                     /locus_tag="AGOS_ADL362C"
                     /old_locus_tag="ADL362C"
                     /db_xref="GeneID:4619868"
     mRNA            complement(<70483..>71034)
                     /locus_tag="AGOS_ADL362C"
                     /old_locus_tag="ADL362C"
                     /product="ADL362Cp"
                     /transcript_id="NM_209086.2"
                     /db_xref="GeneID:4619868"
     CDS             complement(70483..71034)
                     /locus_tag="AGOS_ADL362C"
                     /old_locus_tag="ADL362C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YGR161C (RTS3)"
                     /codon_start=1
                     /product="ADL362Cp"
                     /protein_id="NP_983733.2"
                     /db_xref="GeneID:4619868"
                     /translation="MEKEQDAIVMRLLREIDILREENSRLRRNMGHLLNGEPLSPTPP
                     QSRRSSVASLRQQQLFGTSGSMASTPSSSRRSSFSQIDNLKSDLQKKRNSACNYPITL
                     SNNASSPFANAAGMHVGKPGTYEYVEGLSVPAAWPAGPDAGSSVAAANTRGRRRRQSN
                     EPSVGGGGVRLSKVPNRTGYTVL"
     gene            complement(<71679..>72380)
                     /locus_tag="AGOS_ADL361C"
                     /old_locus_tag="ADL361C"
                     /db_xref="GeneID:4619869"
     mRNA            complement(<71679..>72380)
                     /locus_tag="AGOS_ADL361C"
                     /old_locus_tag="ADL361C"
                     /product="ADL361Cp"
                     /transcript_id="NM_209087.2"
                     /db_xref="GeneID:4619869"
     CDS             complement(71679..72380)
                     /locus_tag="AGOS_ADL361C"
                     /old_locus_tag="ADL361C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YER134C"
                     /codon_start=1
                     /product="ADL361Cp"
                     /protein_id="NP_983734.2"
                     /db_xref="GeneID:4619869"
                     /translation="MCRTRSGHFDKPQTSSRRPAGPECQIMCGSVHVTEARSKEKLAS
                     VRPTEPTTMQYPDVAAFDLDYTVWPCFCDTHLTSPFTPVATPAGEVLTVVDAAGYELT
                     LYPDVPRILADLKLHGVTLLTASRTWAPDVAQQLLRTFRIRVGEDFLSLSEVFDGGAW
                     GDHPKIRHITAGLADVYGPSAPDPRDIRVWLFDDESRNRDVERHGVAYLHVRDPQRGP
                     AWDWYQASLRGRQNK"
     gene            complement(<72734..>74671)
                     /locus_tag="AGOS_ADL360C"
                     /old_locus_tag="ADL360C"
                     /db_xref="GeneID:4619870"
     mRNA            complement(<72734..>74671)
                     /locus_tag="AGOS_ADL360C"
                     /old_locus_tag="ADL360C"
                     /product="ADL360Cp"
                     /transcript_id="NM_209088.2"
                     /db_xref="GeneID:4619870"
     CDS             complement(72734..74671)
                     /locus_tag="AGOS_ADL360C"
                     /old_locus_tag="ADL360C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML128C (MSC1)"
                     /codon_start=1
                     /product="ADL360Cp"
                     /protein_id="NP_983735.1"
                     /db_xref="GeneID:4619870"
                     /translation="MRVSHWMIAVSAALAAGATASSAAEQWNVADLKEYLKDSGQEVA
                     HDSLDALRDAASKEWEKHTDGRKSMLDLLWRPKQTPHDWFGSDYTNPVSEWLFNTWPV
                     EELQKLLKHSRVKTDPTWSRDKLVAVSKRNFKKISETLGVSGYYPSESYFKLWDSSEL
                     KEWLEDYGIPYSKAATARDQLLKVVRENIRRASDFYHDERYEVLTSVGFLNDEFSRTG
                     TVDHVDFSSWPLDSLRSWLEVHKLKFDRNMAEDKQYLVALAEKNKKLLMDDVEWLGSI
                     AQKELAEIFKQKDAAMKLSKEAAGKSKNAIKKSGQNAVQYGKDAGNAAMGYGKNVGKD
                     AVNAGRDVANAGKHAGKDAVNAGKDAVNTGKHAGKDAVNAGKKAGKDAVAAGKHAGKD
                     VVDAGRDAIHAGKEAGMDAVEVGREAGDSFVHHGKDLFHAGQESAESLWDSIKGYFNK
                     ADDVINDTFLLDVENWPKRRLKHFLEARGVKYSLLSTRKDLLKSVIKYRNKPVHDLKE
                     TKNKWFPSWTLENLQHWSSEKTEQGKEKYNSAKDHLKAGSNKVQDQSKEANEAIKQKI
                     DDWVETFNSWTTDDLQTYLRSFGIQPPKSYKKDQLVDLALKHSKAFFGSSSDSSESGY
                     FRFVPRIARKWFNYGYSLLVR"
     gene            complement(<74893..>75414)
                     /locus_tag="AGOS_ADL359C"
                     /old_locus_tag="ADL359C"
                     /db_xref="GeneID:4619871"
     mRNA            complement(<74893..>75414)
                     /locus_tag="AGOS_ADL359C"
                     /old_locus_tag="ADL359C"
                     /product="ADL359Cp"
                     /transcript_id="NM_209089.1"
                     /db_xref="GeneID:4619871"
     CDS             complement(74893..75414)
                     /locus_tag="AGOS_ADL359C"
                     /old_locus_tag="ADL359C"
                     /note="NOHBY419; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ADL359Cp"
                     /protein_id="NP_983736.1"
                     /db_xref="GeneID:4619871"
                     /translation="MQHGTRRSPSTCWMPACILITCDYGVQPPWVVFRRTVCSLCGSH
                     RIIARVGLSTSAAVARAHTQVAIVAAPSAEWNPTSAPAHGTTITRGRGGVEQTAGICA
                     RARRSIAPRSASSCCCGILQRYLRRPRFRCYGAGVTRSYTHVTTCGSRHLVRERGARG
                     IWAEDGRTGGWLV"
     gene            <75953..>77710
                     /locus_tag="AGOS_ADL358W"
                     /old_locus_tag="ADL358W"
                     /db_xref="GeneID:4619872"
     mRNA            <75953..>77710
                     /locus_tag="AGOS_ADL358W"
                     /old_locus_tag="ADL358W"
                     /product="ADL358Wp"
                     /transcript_id="NM_209090.1"
                     /db_xref="GeneID:4619872"
     CDS             75953..77710
                     /locus_tag="AGOS_ADL358W"
                     /old_locus_tag="ADL358W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML127W (RSC9)"
                     /codon_start=1
                     /product="ADL358Wp"
                     /protein_id="NP_983737.1"
                     /db_xref="GeneID:4619872"
                     /translation="MFKQGTPGLGGEATSAHNEMEQLTSFQTVAPMPISVMREMSGSS
                     GSKAGHVLQHALAGLTVYQNLPNGSIVGVDDLTRMKMALMSGVDEEVTWSLKKYLVYS
                     NKAPYMVSLRMNRELVDTFNTFVVAMAPILEMFKWPLVEEDFYQFEKGLNAILILRNL
                     AQDSDSTQVLAMNEPLKLFLLTVLEWCNLFNHPNHVMYQENAPLFMELINYVLDLVEA
                     ISSYIAPAKKDDPFFKNLVSILRVTNDRYHVISILRSLSRLLVRSKADQESAADNLDD
                     EILNLIVSYLLVDCDNELVMASLDFLYQYILPGSERITTLLSNPERNSILTTVLPSLL
                     TYNVELPDYDYLSKVEIKLVRRVKPRPPTHVPTLPPDLFQKLLGLNEPMRSTAWLRCC
                     FESAADSEVTQISLWKSYEHIFSEPVKQSGRRLLPAVEFIKNVSNAFVGAAAMVVTDP
                     VTAQKRFVIKGIQPRIKAVSINDGEAAASANAAVTPPTTMGNVTNAGDSANVKDVEDA
                     LKTAEAKQIVLPKLKFPTKLSDVSKASATFLCLLSNDTQGLGLKFCNSVKPSIMHTLA
                     DVPPLNAVLSEFMDNIPTL"
     gene            complement(<77957..>81487)
                     /locus_tag="AGOS_ADL357C"
                     /old_locus_tag="ADL357C"
                     /db_xref="GeneID:4619873"
     mRNA            complement(<77957..>81487)
                     /locus_tag="AGOS_ADL357C"
                     /old_locus_tag="ADL357C"
                     /product="ADL357Cp"
                     /transcript_id="NM_209091.2"
                     /db_xref="GeneID:4619873"
     CDS             complement(77957..81487)
                     /locus_tag="AGOS_ADL357C"
                     /old_locus_tag="ADL357C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML091C (RPM2)"
                     /codon_start=1
                     /product="ADL357Cp"
                     /protein_id="NP_983738.2"
                     /db_xref="GeneID:4619873"
                     /translation="MAFKTFKYKLYSKGYHSAAQKPATSFFDSSYQYLKQNQGLVSLD
                     TAISQPFNGYLNPHPVVVAGVNYTNVQEVLELADEEGNRLREETEEAPAGTLTARPRA
                     LIRRNSDSFQFLTLPGLQKSDFNPRYSQCFYTSAAAPGDAEGLHTAAEPQPDVRFQED
                     LPPWQLDREPCLNEKTFLATSIKEIKTCMENEDYNKVNCIYQALKRNGIVPPVNTFEQ
                     VLCAIKLRDMDADDPEGKMVQLLNCYQDLVSNKLKPTTEIYTIVIGSLLERAATTKVL
                     KEGLGEDFFKIALDLFFASNYTHTRGFNQELLDRILLGANLYPGHIKYSMLTSLVNDS
                     LEYEKTEFYYISMINYARECKDATRLKALYDEFREATKSNDRLRTYQYEVYSMVVAGL
                     VSLDSLEVAVKLLDRLLTQIRSTDGLDSCQTLVLSNFLLAVARNNPKTAYKLWTQFQQ
                     HSWVPEFSYEFYLAMLESSIEDMDVARNVYMYLYGMKPDFRKDPASFKEYLLYPRNKG
                     HVLSALLHQSMQHSDKELINRLLEESICKRLPFKIDLYGPIFAYLKSIEIPPTYLLRF
                     IECHGTLLTSLTGSEQFIFLQALVTYFSSYDLLKSVTEMSFFRDVCASFDITVSDTIP
                     YNGLAACFEALWKAPQKIEHYGNVLELHALLITRIYDPALSQYKISAPVVQELKSKVT
                     ERFQKLASNFRRLHLDSTRCPAEVSQAVKIVRLPTETQNYFTNPGDWDKTYPLSLSIL
                     LSVDLHAGIREFSRLLKDGYCFDFETYKSLIHYRYVDDHVVSKSLELCPSNKSSKEEL
                     CDLLVTCTPARALNELILSNPSFQSEIRPYLSDSSLLEILRHCADIDFFITSVGFPEN
                     FKSIAAAAEFRRTIEYLYVRLLKSKRYTEIISFNKITSVLDLTVLMKACIRTGAYEAY
                     LNLKKQFGREYKAELVAIHAEYLVNIFKFDEAVALVENAAVKTTAARDVSSFAQFIQS
                     FSKEVKTNENVENTLQLANALCSLRSLEEMNDLYESVVSSKQHPLVDGTNIAFAVKLE
                     LLEQMLNNLHDALPFLDLKSEDCKKHVMERLNNYLLFRNRFHLPNARKEDLLQLMTIW
                     SFVAPEAIDNLFNELVETLYASGTSPQKHLYVNDGFVLPCDRSLANTLVDWIKTFYQQ
                     EHNPENLIKVENFQQVLGNFYTGKDIMTFI"
     gene            complement(<82009..>83534)
                     /locus_tag="AGOS_ADL356C"
                     /old_locus_tag="ADL356C"
                     /db_xref="GeneID:4619874"
     mRNA            complement(join(<82009..83301,83433..>83534))
                     /locus_tag="AGOS_ADL356C"
                     /old_locus_tag="ADL356C"
                     /product="ADL356Cp"
                     /transcript_id="NM_209092.2"
                     /db_xref="GeneID:4619874"
     CDS             complement(join(82009..83301,83433..83534))
                     /locus_tag="AGOS_ADL356C"
                     /old_locus_tag="ADL356C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML126C (ERG13); 1-intron"
                     /codon_start=1
                     /product="ADL356Cp"
                     /protein_id="NP_983739.1"
                     /db_xref="GeneID:4619874"
                     /translation="MTDPNQAKKQKIEAQPPRPQNIGIKAIELYIPSQCVNQEALEAY
                     DGVSQGKYTIGLGQTNMSFVNDREDIYSMCLTACSNLMKNYDIKPESIGRLEVGTETL
                     LDKSKSVKSILMQLFGENTDLEGVDTVNACYGGTNALFNSLNWIESSSWDGRDAIVVC
                     GDIAIYDKGAARPTGGAGTVALLIGPDAPIVFDSVRGSYMEHVYDFYKPDFRSEYPYV
                     DGHFSLTCYVKAVDQAYRAYSRKAIAKGLAENPAGPEAVNVATFFDYNVFHVPTCKLV
                     TKSYGRLLYNDFRANPELYPEVSADLATLDYEASLADKNIEKTFVGLAKPLHKARVEP
                     SLVVPTNTGNMYTGSVYAALASLLYYVGNDALQGKRIGLFSYGSGLAASLFSVRVLGD
                     IKHITHNLALDTKLQNRKTETPEDYEKALALREAAHLQKAYTPQGSLDLLQPGTYYLT
                     AVDDRYRRSYAVKE"
     gene            complement(<83949..>84664)
                     /locus_tag="AGOS_ADL356CA"
                     /db_xref="GeneID:9487603"
     mRNA            complement(join(<83949..84605,84659..>84664))
                     /locus_tag="AGOS_ADL356CA"
                     /product="ADL356C-Ap"
                     /transcript_id="NM_001355313.1"
                     /db_xref="GeneID:9487603"
     CDS             complement(join(83949..84605,84659..84664))
                     /locus_tag="AGOS_ADL356CA"
                     /note="NOHBY452; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0D10395g;
                     1-intron"
                     /codon_start=1
                     /product="ADL356C-Ap"
                     /protein_id="NP_001342253.1"
                     /db_xref="GeneID:9487603"
                     /translation="MGNDGGTINRSKNLAVAAVRGANVAADDNVQEYNWQSQWTSCRL
                     SGKPLQLPVVGDCKGNIINKEALLEWLLDRQERGAGKPRPEFRHLRRRADMVELHNLV
                     AEGDAGILRCPVGDATLGQSKGRFVYLASCGDVMPQKLQQQVSQCAVCGKAYDPLDVV
                     LINPRAADEHAALRDRMRVLVERGLSHSGKPLPKKKRSRSPSAPEGPPPAKKAATRVG
                     TD"
     gene            <84793..>85441
                     /locus_tag="AGOS_ADL355W"
                     /old_locus_tag="ADL355W"
                     /db_xref="GeneID:4619875"
     mRNA            join(<84793..84795,84866..>85441)
                     /locus_tag="AGOS_ADL355W"
                     /old_locus_tag="ADL355W"
                     /product="ADL355Wp"
                     /transcript_id="NM_209093.2"
                     /db_xref="GeneID:4619875"
     CDS             join(84793..84795,84866..85441)
                     /locus_tag="AGOS_ADL355W"
                     /old_locus_tag="ADL355W"
                     /note="NOHBY418; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0D00462g;
                     1-intron"
                     /codon_start=1
                     /product="ADL355Wp"
                     /protein_id="NP_983740.2"
                     /db_xref="GeneID:4619875"
                     /translation="MIGACRHGDKCSKRHNSPINSYTIVIYNMYVPPRDYKDLHALTE
                     DFESFYEDVFLEAARFGEVQELIVCENKTDHLNGNVYIRYSTIDAAKAARDALITRWY
                     GERPLYCDLSHVTDFREAVCKSYEEGTCDRGEQCNFIHRRIIGYHIANGLMLSQWKSR
                     HIMPQHRSDEARNTGHVAHSSAAVTAPLPPSA"
     gene            <85668..>86485
                     /locus_tag="AGOS_ADL354W"
                     /old_locus_tag="ADL354W"
                     /db_xref="GeneID:4619876"
     mRNA            join(<85668..85711,85777..>86485)
                     /locus_tag="AGOS_ADL354W"
                     /old_locus_tag="ADL354W"
                     /product="ADL354Wp"
                     /transcript_id="NM_209094.1"
                     /db_xref="GeneID:4619876"
     CDS             join(85668..85711,85777..86485)
                     /locus_tag="AGOS_ADL354W"
                     /old_locus_tag="ADL354W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML092C (PRE8); 1-intron"
                     /codon_start=1
                     /product="ADL354Wp"
                     /protein_id="NP_983741.1"
                     /db_xref="GeneID:4619876"
                     /translation="MADRYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVV
                     IATEKKANTTLTIKDTLDKVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYG
                     EYPPTKILVSQIAKIMQEATQSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWK
                     ATAIGKGATAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGETIELAVVGEEN
                     DDMLGYKGDASAKGPRFRKFTAQEINDRLDAL"
     gene            complement(<86598..>89195)
                     /locus_tag="AGOS_ADL353C"
                     /old_locus_tag="ADL353C"
                     /db_xref="GeneID:4619877"
     mRNA            complement(<86598..>89195)
                     /locus_tag="AGOS_ADL353C"
                     /old_locus_tag="ADL353C"
                     /product="ADL353Cp"
                     /transcript_id="NM_209095.1"
                     /db_xref="GeneID:4619877"
     CDS             complement(86598..89195)
                     /locus_tag="AGOS_ADL353C"
                     /old_locus_tag="ADL353C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML093W (UTP14)"
                     /codon_start=1
                     /product="ADL353Cp"
                     /protein_id="NP_983742.1"
                     /db_xref="GeneID:4619877"
                     /translation="MAKRKSKSGAGASRRRAQNALELAERELASDSSADEGIPRSQRR
                     RNSAIVNPQRGSDDENGSEEFEDEELDSDEALGSDDDYDVMNSKFSQSIRDKKKNNQS
                     VEELDEEGGYTSIDEEELLPLSAVWDMDDTATAGAEKHVASQLKLNDDNLSDDSESES
                     ESDSDSSDEAEDEEDPFDEVPNEEVDLATVSSTLQKHTTKQYKRLDTYAGGVEDEYAL
                     PSLQGPGKLDITKLLDVVDDPEAVEQATLLKGNLKSLDVPLPMRIQQRHERKAAYEIS
                     KEEMSKWASIVQQNRQSEHLSFPMDSSASHTEASAFTRNSEKPLTEVEVKVTEVLKKS
                     NLLDPVKENTFNDLAEAKLSVEDMKKRTAELRLMRELMFREERKAKRIKKIKSKAYRR
                     IKKKEMLKNQELVDSDESDTDRDVARARERMSLKHNTKSKWARDMVKHGITKDKETRD
                     DLENMLKQGERLREKIMGHAEGSESDTDVSDLERDDASPEQDTPYRGDIGKTGVLNMA
                     FMKNAEAREREENRQNLAALRAVENGEDIKLFEDGLTKDGSNVASNKGRRVYSAADLE
                     AKEKDAQFNEEVLAEHADDESRSLEKRLEKANKRSSGSQNKLSAKTTQSSTKKQDSKT
                     EDPSALENPWLDGGDDSTLIKKSSKIKVVDANSSQFTKSAHKIDKEKQKLSRSKKDEK
                     DNGDDLLLDIESSNKLDIIDPYDESGDEADGNSFKQQDAINEAFAGDDVVAKFQEEKK
                     RVAIDEDDKEEDVTLPGWGEWAGAGAQPAKKRKFTKKIKGVVSKEKRRDKNLKNVIIN
                     EKVNKKNVKYQSSAVPFPFESREQYERSLRMPLGEQWVSRATHQKAVKPRILTKPSVV
                     IDPLKAPFK"
     gene            complement(<89387..>89917)
                     /locus_tag="AGOS_ADL352C"
                     /old_locus_tag="ADL352C"
                     /db_xref="GeneID:4619878"
     mRNA            complement(join(<89387..89844,89899..>89917))
                     /locus_tag="AGOS_ADL352C"
                     /old_locus_tag="ADL352C"
                     /product="ADL352Cp"
                     /transcript_id="NM_209096.2"
                     /db_xref="GeneID:4619878"
     CDS             complement(join(89387..89844,89899..89917))
                     /locus_tag="AGOS_ADL352C"
                     /old_locus_tag="ADL352C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML094W (GIM5); 1-intron"
                     /codon_start=1
                     /product="ADL352Cp"
                     /protein_id="NP_983743.2"
                     /db_xref="GeneID:4619878"
                     /translation="MASPQTIDLTTLTPAQLAQVKQQFDQELQHFTKSLQALSMARAK
                     FNECIADVKVVSEKKNSEQRLLVPLAGSLYVPGKVVNNQKFMVDIGTGYYVEKDASQA
                     IEFYQKKVNKLNKEAVQIQDIIKEKTQSSLAIEAQMRKAAIKQHEEIAKQKQQAAQ"
     gene            <90030..>90629
                     /locus_tag="AGOS_ADL351W"
                     /old_locus_tag="ADL351W"
                     /db_xref="GeneID:4619879"
     mRNA            <90030..>90629
                     /locus_tag="AGOS_ADL351W"
                     /old_locus_tag="ADL351W"
                     /product="ADL351Wp"
                     /transcript_id="NM_209097.1"
                     /db_xref="GeneID:4619879"
     CDS             90030..90629
                     /locus_tag="AGOS_ADL351W"
                     /old_locus_tag="ADL351W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML095C (RAD10)"
                     /codon_start=1
                     /product="ADL351Wp"
                     /protein_id="NP_983744.1"
                     /db_xref="GeneID:4619879"
                     /translation="MGADDATSFEKILANVQRRRQEYNGATSASRPEPRAAPAVALDT
                     GPTGSSRVTNAFNQERPTPAAAETDLPKRPRSGQGRTILVSTSQKGNPLLKGLASTNW
                     TYVKSSGTEKVYYDYQVQGRKVVFLSLKYHKLRPEYIDQKLRPFGKTQGNILLCVVDI
                     EDSEDILKELNKTTMFNGFTMLLAFNFEQAAKYLVFLNK"
     gene            complement(<90632..>92158)
                     /locus_tag="AGOS_ADL350C"
                     /old_locus_tag="ADL350C"
                     /db_xref="GeneID:4619880"
     mRNA            complement(<90632..>92158)
                     /locus_tag="AGOS_ADL350C"
                     /old_locus_tag="ADL350C"
                     /product="ADL350Cp"
                     /transcript_id="NM_209098.2"
                     /db_xref="GeneID:4619880"
     CDS             complement(90632..92158)
                     /locus_tag="AGOS_ADL350C"
                     /old_locus_tag="ADL350C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML096W"
                     /codon_start=1
                     /product="ADL350Cp"
                     /protein_id="NP_983745.2"
                     /db_xref="GeneID:4619880"
                     /translation="MCGILVHYSEVEADSDRFVEFPERCEPPEVQKHCDGASQEFLRL
                     VPYIMARGPDYASYRLEAGMGLAWFSSVLSLRQPLTPQSMAVGDRYILQFNGELFNED
                     IQHNDTQYIADLLASWPVTAVIRQMYGEFAYTIFDRQDGLLYFGRDNVGKRSLCYRLD
                     GRELHVASVSGKSQGFLNCDAGVIYTFDVHQKTLRMEERICASPFTVSAHCESAGLEG
                     DLDTLYEILQRSTRQSLESIQPLHSENAKHASVLFSGGVDCSVVAALICEQWSSHKDA
                     VLELLNVAFENPRTGKMPEDAPDRKLAIESAAQLQKLFPEMDIRLVEVDVPYNEYLEV
                     RPSVVDLIYPKQTEMDLSIAIAFYFAARGRGFIHRDRHREPYNRRGLVLFSGLGADEL
                     YGGYHKFANKSTEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYPFLDEKVIKAS
                     VALPISYKNDKMILRKLARERLHLSGISDMPKRAIQFGARSAKMTKDSSKNGTDIIVQ
                     "
     gene            <92278..>93516
                     /locus_tag="AGOS_ADL349W"
                     /old_locus_tag="ADL349W"
                     /db_xref="GeneID:4619881"
     mRNA            <92278..>93516
                     /locus_tag="AGOS_ADL349W"
                     /old_locus_tag="ADL349W"
                     /product="ADL349Wp"
                     /transcript_id="NM_209099.1"
                     /db_xref="GeneID:4619881"
     CDS             92278..93516
                     /locus_tag="AGOS_ADL349W"
                     /old_locus_tag="ADL349W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML097C (VPS9)"
                     /codon_start=1
                     /product="ADL349Wp"
                     /protein_id="NP_983746.1"
                     /db_xref="GeneID:4619881"
                     /translation="MQPDELSTCKSQEESNPSDSRELEHTEEDEDDENFYDFRLFISQ
                     LRDSRAEPILKYTKSFLQGFVSNRTMWSASEQVKLLNDYKLFVYDKYAQYEPFRSLGP
                     TKLRNAKEGMEKLLMGKLYMRCFSPCIGLPAERLDPEHAADLEQDEQLKAKIAEYRFL
                     APEHLEIPDTLSPKLSRFVDLSVAELAKINQYKAPRDKIVCILNACKIIFGLLKHSRL
                     EHGGADVFVPLLIYTVLKSDVSALASNLRYIERFRLPAFLHGESAYYLSSLQGAVGYI
                     LHLDPEKLHIPDPVAYNALYDANRLSLPAPPLEEAPRAPADYILRPLDGAASTVFSLF
                     TDFLSPKNEKPPDADVDEIDDPTTTELIRKLEHQEHREMLQNLQGMFPDLDPGLIHDV
                     CIATRYRMGACVDSLLSISD"
     gene            <93705..>95345
                     /locus_tag="AGOS_ADL348W"
                     /old_locus_tag="ADL348W"
                     /db_xref="GeneID:4619882"
     mRNA            <93705..>95345
                     /locus_tag="AGOS_ADL348W"
                     /old_locus_tag="ADL348W"
                     /product="ADL348Wp"
                     /transcript_id="NM_209100.2"
                     /db_xref="GeneID:4619882"
     CDS             93705..95345
                     /locus_tag="AGOS_ADL348W"
                     /old_locus_tag="ADL348W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML130C (ERO1)"
                     /codon_start=1
                     /product="ADL348Wp"
                     /protein_id="NP_983747.2"
                     /db_xref="GeneID:4619882"
                     /translation="MQLNKLMLGFMLCASALADDGQQAAEPHTSANFCKIDKDQQVGS
                     TCDITFHELNEINEQIRPQLARLVKTDFFRYFKLDLYKECPFWSDNNGYCVNRACAVD
                     VVDDWESVPDIWQPEVLGGLDEDSVKSEGGESDECSFLNELCGRRREFARPEPLSIDY
                     CDVTDFTNKDSVLVDLVANPERFTGYGGEQSAQIWSAIYKENCFTLGEQGFCLAKDVF
                     YRLISGLHASIATHLSNDYLDTKTGKWGPNLELFMARVGNHPDRVANIYFNFAVVAKA
                     LWKIQPYLERVEFCNVYDTNVKDMISNVVSRLDSRVFNEDLLFQDDISMRMKDDFRRR
                     FKNVTKIMDCVHCDRCRMWGKVQTTGYATSLKILFEMDAGDEKARQRVVDKLTKYELI
                     GLFNTFDRISKSVNAINNFERMYHSQMETNTSSIAAFFQNNFFRLGFTETEDQETSNA
                     TADMPLPEDSASDNEPYFADLKIPARRSKKQTKEESTSALQQELQGVYHALQFIWNSY
                     VNLPRNLLILVLDVANTWFNNFIGVPTQINILGDDASD"
     gene            complement(<95414..>95890)
                     /locus_tag="AGOS_ADL347C"
                     /old_locus_tag="ADL347C"
                     /db_xref="GeneID:4619883"
     mRNA            complement(<95414..>95890)
                     /locus_tag="AGOS_ADL347C"
                     /old_locus_tag="ADL347C"
                     /product="ADL347Cp"
                     /transcript_id="NM_209101.1"
                     /db_xref="GeneID:4619883"
     CDS             complement(95414..95890)
                     /locus_tag="AGOS_ADL347C"
                     /old_locus_tag="ADL347C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML098W (TAF13)"
                     /codon_start=1
                     /product="ADL347Cp"
                     /protein_id="NP_983748.1"
                     /db_xref="GeneID:4619883"
                     /translation="MSRKLKKTNLFSKDVAPLMYAYGDSPQPLPETVQCVDELVTSYL
                     TDICANAYRCAQTVHRTKIKVEDFKFVLRNDPVNLGRAEELIMMNKVIADARKQFDNS
                     EGKSLKRVNKDEDLEDIPEEDGEDMGGMGPGSELAVEETSKRGRKPKKRKNAKGSV"
     gene            <96588..>100745
                     /locus_tag="AGOS_ADL346W"
                     /old_locus_tag="ADL346W"
                     /db_xref="GeneID:4619884"
     mRNA            <96588..>100745
                     /locus_tag="AGOS_ADL346W"
                     /old_locus_tag="ADL346W"
                     /product="ADL346Wp"
                     /transcript_id="NM_209102.2"
                     /db_xref="GeneID:4619884"
     CDS             96588..100745
                     /locus_tag="AGOS_ADL346W"
                     /old_locus_tag="ADL346W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR115C (LYS2)"
                     /codon_start=1
                     /product="ADL346Wp"
                     /protein_id="NP_983749.2"
                     /db_xref="GeneID:4619884"
                     /translation="MCAVLEPSMIRWLSEVDNIVVSSLPSDYIPSGPAGVKAESCEVE
                     LPGSFGVIDEEDSYIRLLSAFATLVCRMSGESDVAMYSKANRLLKLAVPPGVAFQQLR
                     ASVTEAVEGTLALPAVDFDELSALEREKKQLDYYPQYFKVGVVTAADKTKLDQFRYHK
                     FELLLRQVTSSRFEMVYDSERFSPDRIGELGEQLVQFLTLVEAKDDADVYAISLVTSG
                     ASRVLPDPTTDLGWGQFRGAIHDIFQHHAETRPDRLCVVETGVGQVAARTFTYSAINC
                     ASNIVAHYLLARGIRRGDVVMIYSTRGVDLLVSVLGVLKSGAVFSVIDPAYPPARQNV
                     YLGVAKPAGLIVIQAAGQLDEAVEAFIRDNLSLKARLPALALQTDGAILGGTLPDFHL
                     DTLVPFASLKNTRTDVVVGPDSNPTLSFTSGSEGIPKGVLGRHFSLTYYFDWMAKRFG
                     LSEDDKFTMLSGIAHDPIQRDMFTPIYLGAQLLVPQEDDIGTPGRLATWMATHGATVT
                     HLTPAMGQVLTADATTPFPSLKRAFFVGDVLTKRDCARLQSLAENVAIVNMYGSTETQ
                     RAVSYFEVPSCSSNPSYLDNLKSIIPAGRGMHNVQLLIVNRHDRTKLCGIGEVGEIYV
                     RAGGLSEGYRGLPEINKEKFIDNWFVDAGHWGGLDLSGDEPWRNYWLGVRDRLYRTGD
                     LGRYLPNGDCECCGRADDQVKIRGFRIELGEIDTNISQYPLCRENITLLRKDQNGEST
                     LISYLVPRSDQKALASFISAVPESIATESIAGSLIKYHKLINDIRGFLKKRLAGYAIP
                     TLIMVMERLPLNPNGKIDKNKLQFPEPTELDRASEHFASETLGLSSFSPLEQEIRKIW
                     LDLLPTRPAITSSDESFFDLGGTSILATRMAIVLRNRLNISLALSTIFRYPTVKELAK
                     EISRVRGTISDDKSSNSGTTEYYADAKHVSEAELASKYESRLSLLPSGATSAPVYVFL
                     TGVTGFLGCHILADLLNRSRKPYDITVYAHVRASDESSALQRIKSVCTAYGLWKNAYA
                     PRIKVVLGNLAEKQFGLPKKAWHDLQEGIDVIIHNAALVHWVYPYSKLREANVLSTVN
                     VLNLAAAGKAKYFTFVSSTSALDTKHYLELSNAAIESGGSGVPEDDDLMGGSLGLKGG
                     YGQSKWAAEFIIKRAGERGLRGCILRPGYVTGSPSTGASNADDFLLRFLRGCVQLGKI
                     PDIEGTVNMVPVDYVARLATAASFSSSGNTHMMVVNVNAKPRISFRDYLLALKEYGYQ
                     VTSVPYDEWSKALESSSDEENPLYPLLYLVLDDLPKKLRSPELDTTNAKFVLEEDFAR
                     TNIEPIIITSVSLEVVGSYISFLHKLGFLEEPAKGSRPLPNISLSDEQISLIAAVATA
                     RSSTAKP"
     gene            complement(<100809..>103049)
                     /locus_tag="AGOS_ADL345C"
                     /old_locus_tag="ADL345C"
                     /db_xref="GeneID:4619885"
     mRNA            complement(<100809..>103049)
                     /locus_tag="AGOS_ADL345C"
                     /old_locus_tag="ADL345C"
                     /product="ADL345Cp"
                     /transcript_id="NM_209103.2"
                     /db_xref="GeneID:4619885"
     CDS             complement(100809..103049)
                     /locus_tag="AGOS_ADL345C"
                     /old_locus_tag="ADL345C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR114W (RAD16)"
                     /codon_start=1
                     /product="ADL345Cp"
                     /protein_id="NP_983750.2"
                     /db_xref="GeneID:4619885"
                     /translation="MTGEEGGFIRRRPRRAAARRSAVREEISSEDEPLSGQARTGSAA
                     WDPVVVESSDGEEPLEEESEEDEPLGKRRRAKPRGGKPSAKKVPAKKARAPNVSRYDR
                     MTQLLFEHHRELADVFPALRDAPAYKPIRAAQPAGLTVPLLPFQLEGLHWMALQENNE
                     RYRGGVLADEMGMGKTVQMISLLLHANKGPTLVVAPTVALIQWKNEIDKYTGGALRSL
                     VFHGPGRSAVSEELAAADVVLTTYAVLESVYRKQTQGFRRKAGVVREQSPLHAVDFYR
                     VVLDEAHNIKDRSSGTARSVNALRAVRRWCLTGTPLQNRIGEMYSLIRFLDIEPFTRY
                     FCTKCSCSEKTWRFSDNLHCDSCDHVGMQHTNFFNHFMLKNIQRHGMEGPGLESFENI
                     QLLLRNIMLRRTKVERADDLGLPPRIVTVRRDVFDEEERDLYRSLYSDSKRQYNTYVE
                     SGVVLNNYANIFTLLTRMRQLADHPDLVLKRLPGNEIVGVIVCQLCVDEAEDAIESKC
                     RHKFCRLCIREYIDSFVGRSADLTCPVCHIALSIDLAQPALEIDEEMFKKQSIVNRLG
                     LQGNWRSSTKIEALLEELYNLRSSTRTIKSIVFSQFTSMLDLVEWRLKRAGFQTAKLQ
                     GSMTPTQRAETINYFMDNVHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQS
                     GDRVHRIGQHRPVKITRFCIEDSIESRIIELQEKKANMIHATLGQDEGAVNRLTPADL
                     QFLFNN"
     gene            <104044..>106776
                     /locus_tag="AGOS_ADL344W"
                     /old_locus_tag="ADL344W"
                     /db_xref="GeneID:4619886"
     mRNA            <104044..>106776
                     /locus_tag="AGOS_ADL344W"
                     /old_locus_tag="ADL344W"
                     /product="ADL344Wp"
                     /transcript_id="NM_209104.2"
                     /db_xref="GeneID:4619886"
     CDS             104044..106776
                     /locus_tag="AGOS_ADL344W"
                     /old_locus_tag="ADL344W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR112C (CYC8)"
                     /codon_start=1
                     /product="ADL344Wp"
                     /protein_id="NP_983751.2"
                     /db_xref="GeneID:4619886"
                     /translation="MNNPLGQHGGGAVGLRAAQALAAGTGPHGANGGGSPSGGVAAIA
                     ADGAGGGAAVDPLSQSAAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSL
                     AHLYRSRDVFQRAAELYQRALAVNPELGDVWATLGHCYLMLDDLQRAYAAYQQALYHL
                     SNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKVNEIYFRLGIIYKHQGK
                     WNQALECFRYILPQPPAPLQEWDVWFQLGSVLESMGEWQGAREAYEHVLSQNDRHAKV
                     LQQLGCLYGMNNVQFYDPQTALNLLLKSLEADSTDATTWYHLGRIHMVRNDYTAAYDA
                     FQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYET
                     CNNQLSDALDAYKQAVRLDPNNVHIRERLEALTAQLANPGAQQPQQQPQQQQMQQPRG
                     PAPIMLQPTLQQQDQTNPLNNKPAFYRSSPHGVAVAGTESAGHTPMSGRPQPLQQLNN
                     NGSILEPSLLPQKRPMEGGMDTLVNAISQQELQQHQKKHMPSQNHPSLALATGQPQQL
                     PPDAAPIIPPEKKGAPLPQFQKTEPEHAAKRLKHEQNNVEEQPVRSRTIPSITHPASM
                     DHSGPGDQNHILSGPSVHATHVLPPVAVAAKGSERSQPVANGSTIKDLHATNTLPPVT
                     GPIVNSDKLGSKAPPDTSKEAAHATAQAGFHDKVSPGQPDVGEKPKDSREVKSANTAS
                     TGAPVRNLPPLATAASPECSSTHTEISAAPSESITAAASENLEDQEPNLKTNSASSAV
                     DLAERQKSSTEVATDYHPAAETAPTASNKLRSTDPPAPPDLHQPPAAESAEPTAIKPS
                     ADAIEKLQEEARMRQEEELEALQKKAAHNGVGTSTDLPKESVIRKVEEDENYDD"
     gene            complement(<106928..>107227)
                     /locus_tag="AGOS_ADL343C"
                     /old_locus_tag="ADL343C"
                     /db_xref="GeneID:4619887"
     mRNA            complement(<106928..>107227)
                     /locus_tag="AGOS_ADL343C"
                     /old_locus_tag="ADL343C"
                     /product="ADL343Cp"
                     /transcript_id="NM_209105.1"
                     /db_xref="GeneID:4619887"
     CDS             complement(106928..107227)
                     /locus_tag="AGOS_ADL343C"
                     /old_locus_tag="ADL343C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR111W-A (SUS1)"
                     /codon_start=1
                     /product="ADL343Cp"
                     /protein_id="NP_983752.1"
                     /db_xref="GeneID:4619887"
                     /translation="MTAKDKEALELRAQIQQHLVESGNYERISNKLAQRLLDEGWIDQ
                     VKKLTRETMEDDNTTNFSEVLKRVEPEAVSLVSANTKNEIMQQIKAFLCDILDTQ"
     gene            <107387..>108088
                     /locus_tag="AGOS_ADL342W"
                     /old_locus_tag="ADL342W"
                     /db_xref="GeneID:4619888"
     mRNA            <107387..>108088
                     /locus_tag="AGOS_ADL342W"
                     /old_locus_tag="ADL342W"
                     /product="ADL342Wp"
                     /transcript_id="NM_209106.1"
                     /db_xref="GeneID:4619888"
     CDS             107387..108088
                     /locus_tag="AGOS_ADL342W"
                     /old_locus_tag="ADL342W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR111C (YSA1)"
                     /codon_start=1
                     /product="ADL342Wp"
                     /protein_id="NP_983753.1"
                     /db_xref="GeneID:4619888"
                     /translation="MTPLAQGIRLQLLYRTQYQVRRMAGSTKRGPEQAKLLERRAVTD
                     TSEFKWIGLEKLKYADPLGRERDWEGAVRTTRASTGVDGVGILAIVREPGQPDRILLQ
                     KQFRPPVGGVCIEMPAGLIDEGETLEEAVARELREETGYSGRIVTTSAILFNDPGFTN
                     TNLRMVTVEIDATAPENRNPQPELEDDEFIECFMVPLRDFPEEMGRLDAAGYKLDARV
                     DNVAHGIKIARMYGL"
     gene            complement(108169..108250)
                     /locus_tag="AGOS_t0061"
                     /db_xref="GeneID:4619889"
     tRNA            complement(108169..108250)
                     /locus_tag="AGOS_t0061"
                     /product="tRNA-Ser"
                     /codon_recognized="UCA"
                     /db_xref="GeneID:4619889"
     gene            complement(<108386..>109666)
                     /locus_tag="AGOS_ADL341C"
                     /old_locus_tag="ADL341C"
                     /db_xref="GeneID:4620010"
     mRNA            complement(<108386..>109666)
                     /locus_tag="AGOS_ADL341C"
                     /old_locus_tag="ADL341C"
                     /product="ADL341Cp"
                     /transcript_id="NM_209107.1"
                     /db_xref="GeneID:4620010"
     CDS             complement(108386..109666)
                     /locus_tag="AGOS_ADL341C"
                     /old_locus_tag="ADL341C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR070W (MED1)"
                     /codon_start=1
                     /product="ADL341Cp"
                     /protein_id="NP_983754.1"
                     /db_xref="GeneID:4620010"
                     /translation="MPDAYVESLGKMIAILVNYKPGSITLENITRLCQTMGLESFVDQ
                     VSANISRLSIASKIIVIDIDYEVTDGKVIDVKLVLASNFDKFDYFNGEANILHRSLTT
                     YSDLHEFHHNLKFLTLLDACSSIDIESNVSQFDLFEYYSMLPQYMQSYLDDNGAQLTV
                     QTNLNDRFGIYLLDHSEKKVAKLTFAATQDPNQRYYEYKYSSETKEWINQSAESYTTG
                     ITLVFELLGDPPTYLPKDSLPPEHPDEGFTSASASELQRRFAFKCQNPRVTLVNDFTV
                     DVYPASTFQLLNDNICLCFDILRRQKWWHTVLYPISQLLLHQGQDSAVGDAPAPAAQP
                     PLHRRRSSNKGCRRASAAESATLGDENMHQLTLTEIMNKSVIPEDDAMMDDRIELYVN
                     ENYVYLGTQEGCSFYNDPIERWEAFVESLRQMLT"
     gene            <110227..>111108
                     /locus_tag="AGOS_ADL340W"
                     /old_locus_tag="ADL340W"
                     /db_xref="GeneID:4619890"
     mRNA            <110227..>111108
                     /locus_tag="AGOS_ADL340W"
                     /old_locus_tag="ADL340W"
                     /product="ADL340Wp"
                     /transcript_id="NM_209108.2"
                     /db_xref="GeneID:4619890"
     CDS             110227..111108
                     /locus_tag="AGOS_ADL340W"
                     /old_locus_tag="ADL340W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR069C (SPE3)"
                     /codon_start=1
                     /product="ADL340Wp"
                     /protein_id="NP_983755.2"
                     /db_xref="GeneID:4619890"
                     /translation="MSDEITHPTIKDGWFREISDTMWPGQAMTLRVEKVLHHEKSKYQ
                     DVLVFKSTNHGNVLVLDNVVQCSERDEFAYQEMITHLAMNLHANPKKVLVIGGGDGGV
                     LREVLKHESVEEAWLCDIDEAVIRVSKQYLPEMSRSYEHPKVKTHIGDGFQFLRDYPN
                     TFDVIITDSSDPEGPAEALFEQPYFSLLNQALTENGVITTQAESLFIHMEIIKQLKGT
                     CSQLFPNVGYAYASVPTYPSGQIGFMVCSKNADIELSKPLRTISDEQERELYKYYSKK
                     MHEACFVLPTFAAKELN"
     gene            <111251..>112561
                     /locus_tag="AGOS_ADL339W"
                     /old_locus_tag="ADL339W"
                     /db_xref="GeneID:4619891"
     mRNA            <111251..>112561
                     /locus_tag="AGOS_ADL339W"
                     /old_locus_tag="ADL339W"
                     /product="ADL339Wp"
                     /transcript_id="NM_209109.2"
                     /db_xref="GeneID:4619891"
     CDS             111251..112561
                     /locus_tag="AGOS_ADL339W"
                     /old_locus_tag="ADL339W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR068C (HOS1)"
                     /codon_start=1
                     /product="ADL339Wp"
                     /protein_id="NP_983756.2"
                     /db_xref="GeneID:4619891"
                     /translation="MKLIISSSCYQAQICDLLPCNDNCKSQLIHGMLGAYGLLQHFDK
                     VITAPYATKHTLNKFHSMQYLSFALDPRFNRSTEDCEDWAQVGQVARRYREAHGSSPR
                     ELWHNTKAELYSKFVSRTGYQIADEGSDNDERAAMASAALAKYGLHDDCPVMDYLPMY
                     IHTVAGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRRQ
                     GFLRVSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPGFFPGTGACKNCTDNSVLNV
                     PLLHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQLSIHGLTRN
                     ILKLVQAHKFKKIALLGGGGYNGRLQSRFYAYLTSMLLAQCKGIPTEIGDDEDELIRD
                     HELIEMYEQEDYKFWYYEYEGLNRKNLINDNTEEYMQKLLASFS"
     gene            complement(<112558..>113973)
                     /locus_tag="AGOS_ADL338C"
                     /old_locus_tag="ADL338C"
                     /db_xref="GeneID:4619892"
     mRNA            complement(<112558..>113973)
                     /locus_tag="AGOS_ADL338C"
                     /old_locus_tag="ADL338C"
                     /product="ADL338Cp"
                     /transcript_id="NM_209110.2"
                     /db_xref="GeneID:4619892"
     CDS             complement(112558..113973)
                     /locus_tag="AGOS_ADL338C"
                     /old_locus_tag="ADL338C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR110W (ALG1)"
                     /codon_start=1
                     /product="ADL338Cp"
                     /protein_id="NP_983757.2"
                     /db_xref="GeneID:4619892"
                     /translation="MDTSSVTMHTERACCHQAQRAVAAMLDKAPSWLIWTAVLYVGLP
                     FMLYWAVPYLFYHNKTKSRRIAIYVLGDLGHSPRICYHARSFSAAGWEVELCGYLEEQ
                     PPKDLLDDPRVTIRALPGASNAGKSLGQTARKVVLQTCHIVRQLWELRGCDYILIQNP
                     PSIPLLPIVAIFKVLTRTRLILDWHNFAYTVLQLRVGRFLHPLVLVSYAVEFLFSRMA
                     DYHITVTAAMKDYLVQSFLLPARRIAVMYDRPGEQFRPLPAGERGAALAEPFIRGYIP
                     AGFDVQRGDTILVTSTSFTLDEDINVLFGALKIYESAAAKFDTTLPRILLFVTGKGPL
                     KGKYMEEVRNYKWERCTIHFLWLSAEDYPRLLQLCDFGVSLHTSTSGLDLPMKVLDMF
                     GSGLPAFVMDYPAIGELVQDRVNGLRFTTRRELEQCLIFAIKDEHTRKVLKENALLES
                     KNRWHQSWASAMSELQVVRQS"
     gene            <114168..>114611
                     /locus_tag="AGOS_ADL337W"
                     /old_locus_tag="ADL337W"
                     /db_xref="GeneID:4619893"
     mRNA            <114168..>114611
                     /locus_tag="AGOS_ADL337W"
                     /old_locus_tag="ADL337W"
                     /product="ADL337Wp"
                     /transcript_id="NM_209111.1"
                     /db_xref="GeneID:4619893"
     CDS             114168..114611
                     /locus_tag="AGOS_ADL337W"
                     /old_locus_tag="ADL337W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR109C (CMD1)"
                     /codon_start=1
                     /product="ADL337Wp"
                     /protein_id="NP_983758.1"
                     /db_xref="GeneID:4619893"
                     /translation="MSQNLTEEQIAEFKEAFALFDKDNSGSISSSELATVMRSLGLSP
                     SEAEVADLMNEIDVDGNHNIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLIS
                     AAELKHVLTSIGEKLTDAEVDEMLREVSDGSGEINIKQFAALLSK"
     gene            complement(<114923..>117052)
                     /locus_tag="AGOS_ADL336C"
                     /old_locus_tag="ADL336C"
                     /db_xref="GeneID:4619895"
     mRNA            complement(<114923..>117052)
                     /locus_tag="AGOS_ADL336C"
                     /old_locus_tag="ADL336C"
                     /product="ADL336Cp"
                     /transcript_id="NM_209113.3"
                     /db_xref="GeneID:4619895"
     CDS             complement(114923..117052)
                     /locus_tag="AGOS_ADL336C"
                     /old_locus_tag="ADL336C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR108W (AIM3)"
                     /codon_start=1
                     /product="ADL336Cp"
                     /protein_id="NP_983760.2"
                     /db_xref="GeneID:4619895"
                     /translation="MGTDAIKKGLAAAGRSTIDGAVAVSKKGIKASKTHYEKSKAMRG
                     GKSASSSAGTSSQSYETQTRLAQLPDPRQFPPPPLRPEQRPQSGSAGAIGGSTGSSVS
                     SAAVSAGRASAVAAVVAPAALAVRTGPGFASAMDTAQGALNPAQPAVVPPVHGSAVSG
                     RSGNGNAPNISMPVHRPLPMRPDSGAPGAQLAINAPHVAPMHQNTPSYAIQGYSDYGM
                     QERGATQGAVSTEPAPPPIPVRNYETAAAPAANPSRLPLELPPYPLMPCDDASYSTGM
                     GAQPAPSQLLPWPHVPGANASDGIIAPGQSASVGQAAPAILPSRPQVPGSDFGSQPVQ
                     EITTTSTSQHQIQVKPYTWGAPKGDREANKINVPQVEINVLPPPPKHRDRDRSKSSTP
                     AHIQQSTTGPKPSIPARRSPSAFASPATTGSGAGGPPSDQLETKCTQQTGHMQSASTS
                     FSSLPQTSPRNEGVASIAKTREESIGPTKGISGQYNYEISVSFEPPPKPHRRGDGPQS
                     RASPFASSRDNSTSVPDSAGSPSRGSIRHSALNNTDPPPPYTDTAHARAGSDSPAPSA
                     SKQRSSAGRSLPPLSADRSLPPPARQAAGAMASRLSEEASGVTLRRITSPEGSQTGDG
                     ASVKKKPPIVPKKKESLAGNKKAPPPVPKKKAILAQGLQRDAATSSDAAEVLSSSGID
                     TSAQDDNPFRRYLKNVVPQENDRVHHR"
     gene            <117217..>117948
                     /locus_tag="AGOS_ADL335W"
                     /old_locus_tag="ADL335W"
                     /db_xref="GeneID:4619896"
     mRNA            <117217..>117948
                     /locus_tag="AGOS_ADL335W"
                     /old_locus_tag="ADL335W"
                     /product="ADL335Wp"
                     /transcript_id="NM_209114.1"
                     /db_xref="GeneID:4619896"
     CDS             117217..117948
                     /locus_tag="AGOS_ADL335W"
                     /old_locus_tag="ADL335W"
                     /note="NOHBY416; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ADL335Wp"
                     /protein_id="NP_983761.1"
                     /db_xref="GeneID:4619896"
                     /translation="MENFIENEELLGVDSRGPGQGRARDPELVAGSIKWAFYYSKARV
                     DEHQLATKLKEMLKTSTDVEVSVRKDVAEIKGTPHNTMKRTWYLFVYGGDVLALSDAS
                     VINGDTSSAWDELGLYPFKVPFSSELMASAADALVPHCRPAVQVSFCASVQTKYLDRF
                     DVEADARALLTQDAQCPVSRALLGALADQVGVTSALGISSVRLASDVYICSGYTRFLG
                     TCSRRGTAAIAPAVRSAVCRGASAA"
     gene            complement(<117952..>118506)
                     /locus_tag="AGOS_ADL334C"
                     /old_locus_tag="ADL334C"
                     /db_xref="GeneID:4619897"
     mRNA            complement(<117952..>118506)
                     /locus_tag="AGOS_ADL334C"
                     /old_locus_tag="ADL334C"
                     /product="ADL334Cp"
                     /transcript_id="NM_209115.1"
                     /db_xref="GeneID:4619897"
     CDS             complement(117952..118506)
                     /locus_tag="AGOS_ADL334C"
                     /old_locus_tag="ADL334C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR067W (ISA2)"
                     /codon_start=1
                     /product="ADL334Cp"
                     /protein_id="NP_983762.1"
                     /db_xref="GeneID:4619897"
                     /translation="MFKRILARPPAGLPRPLAFYSAARLRGLRWQSSANVLAGDGAGP
                     LVTPTRVVNGDPSLRLNITQRAAQRLGEIYRSSGEVLRVGVESGGCHGFQYNLALQPR
                     PESQPSGADASEFDEFEDRKDIVYVLPEEQGEVVIDHASHEILNNTTLTYTTELIGST
                     FRIIGGKMTSSCGCGSSFDFDGQS"
     gene            complement(<118623..>119582)
                     /locus_tag="AGOS_ADL333C"
                     /old_locus_tag="ADL333C"
                     /db_xref="GeneID:4619898"
     mRNA            complement(<118623..>119582)
                     /locus_tag="AGOS_ADL333C"
                     /old_locus_tag="ADL333C"
                     /product="ADL333Cp"
                     /transcript_id="NM_209116.1"
                     /db_xref="GeneID:4619898"
     CDS             complement(118623..119582)
                     /locus_tag="AGOS_ADL333C"
                     /old_locus_tag="ADL333C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR066W (UBA3)"
                     /codon_start=1
                     /product="ADL333Cp"
                     /protein_id="NP_983763.1"
                     /db_xref="GeneID:4619898"
                     /translation="MRAREDSLARCRVLVLGAGGLGCELLKNLALLGIPELHVIDMDT
                     VELTNLNRQFLFRETDIGHPKAAVAARYINGLALPSVVPGRGVRVEPHVGDLTQQPSA
                     FWEGFTAVISGLDAIEPRRHANALLVRLTLSSNYAKCIPLIDGGSEGFAGHCKTILPG
                     ISACYECSLDTLAPPGLAFPLCTIANKPRLPQHIVMYVLTVEWPTAPFQAGCSFDDPE
                     AVAWLAQRCATRAAAFGMNAAAFTTAYVLGVAKRIVPSVASTNAIVAAACCSELLKLV
                     HDLTDPENMNNFLQYNGAEGCFAYSFTHQRLPSCPVCSQGDGC"
     gene            complement(<119667..>120236)
                     /locus_tag="AGOS_ADL332C"
                     /old_locus_tag="ADL332C"
                     /db_xref="GeneID:4619899"
     mRNA            complement(<119667..>120236)
                     /locus_tag="AGOS_ADL332C"
                     /old_locus_tag="ADL332C"
                     /product="ADL332Cp"
                     /transcript_id="NM_209117.2"
                     /db_xref="GeneID:4619899"
     CDS             complement(119667..120236)
                     /locus_tag="AGOS_ADL332C"
                     /old_locus_tag="ADL332C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR106W (PHO88)"
                     /codon_start=1
                     /product="ADL332Cp"
                     /protein_id="NP_983764.2"
                     /db_xref="GeneID:4619899"
                     /translation="MNPQISNLAIMLVLMQISRRLNMEDPTVILYIRILYVTSTVLAY
                     LVYQVTRKRIVAKNDLTTLKYVTPANPLSGQPEEQLKVTTVRDYDLEQLDSSIKSIYT
                     GVLMMGFMHLYLKYTNPLLMQFISPLKTALEHAEVRIHLFGKPATGELKRPFKQAGLF
                     GMGAAAGPKTDKQSIEAAEKAGTGGVKAE"
     gene            complement(<120467..>121717)
                     /locus_tag="AGOS_ADL331C"
                     /old_locus_tag="ADL331C"
                     /db_xref="GeneID:4619900"
     mRNA            complement(<120467..>121717)
                     /locus_tag="AGOS_ADL331C"
                     /old_locus_tag="ADL331C"
                     /product="ADL331Cp"
                     /transcript_id="NM_209118.1"
                     /db_xref="GeneID:4619900"
     CDS             complement(120467..121717)
                     /locus_tag="AGOS_ADL331C"
                     /old_locus_tag="ADL331C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR065W (ROX1)"
                     /codon_start=1
                     /product="ADL331Cp"
                     /protein_id="NP_983765.1"
                     /db_xref="GeneID:4619900"
                     /translation="MADEDGEAGEAGAGALGYKQKQHIPRPRNAFILFRSHQQKLLTD
                     YWKQSGQDIPHNCEVSKIISYQWKKLTAEEKKEWHDKAELEKQEHAKKYPGYKYKPKR
                     KKNRNKLALEFELQNLVRMYPHGAAAGASAPAGALPPLGREEPVHLQQPAGASAGSQT
                     PSTYLMQLAPWENRYPLEQAPGPPAQPLARGAASPAPAPAQPAFGSPHAAKAYAPEVW
                     KPYYRQPQQPQALTQQPQALPQQQLPQQLPQQLPQQPQQLTQQQQQLTQQPQALQQQQ
                     ALQQQQALPQRLPQHYPPAQRQQPYRYPQPYRYPPQQQQYYRLPNLQQDAYLDHGFPQ
                     HALSANPSSAGSNPSPMPAMGAPVQTARYPMPIHHLPGSSNTSSATTAPNLLPHSSSN
                     SNIAATVAMNNLGTSHPDDISHGK"
     gene            <122426..>123256
                     /locus_tag="AGOS_ADL330W"
                     /old_locus_tag="ADL330W"
                     /db_xref="GeneID:4619901"
     mRNA            <122426..>123256
                     /locus_tag="AGOS_ADL330W"
                     /old_locus_tag="ADL330W"
                     /product="ADL330Wp"
                     /transcript_id="NM_209119.2"
                     /db_xref="GeneID:4619901"
     CDS             122426..123256
                     /locus_tag="AGOS_ADL330W"
                     /old_locus_tag="ADL330W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR105C (VID24)"
                     /codon_start=1
                     /product="ADL330Wp"
                     /protein_id="NP_983766.2"
                     /db_xref="GeneID:4619901"
                     /translation="MINETRSAKGTAPATPAGTGLFRCGSGESLASAWTADTSAGCSP
                     CARKYMAGLGGGGGGGEAAPRATTTTNWLRPLMAFQGYQISGYKKYQVHVLLQTVALP
                     AEGCAAATTPHVTGFLTIRGLTNQHPEITTFFESFAVNDTVGFLSSSMPPELAEYKSS
                     DRVDLEHWLNFPSFKELCMAGGGTTVADIMDGHYTHRDYLARRFVFMRWKEKFLVPDE
                     EVGAVEGASYDGYYYIVHDQVTGSVLGFYYHKDAEKFQQLELTPVYPDRQGVCCFEFA
                     "
     gene            <123386..>123764
                     /locus_tag="AGOS_ADL329W"
                     /old_locus_tag="ADL329W"
                     /db_xref="GeneID:4619902"
     mRNA            join(<123386..123426,123479..>123764)
                     /locus_tag="AGOS_ADL329W"
                     /old_locus_tag="ADL329W"
                     /product="ADL329Wp"
                     /transcript_id="NM_209120.2"
                     /db_xref="GeneID:4619902"
     CDS             join(123386..123426,123479..123764)
                     /locus_tag="AGOS_ADL329W"
                     /old_locus_tag="ADL329W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR063C; 1-intron"
                     /codon_start=1
                     /product="ADL329Wp"
                     /protein_id="NP_983767.2"
                     /db_xref="GeneID:4619902"
                     /translation="MALHNVRRADLTAQYTHVLAPDTAYTGASQGVVSQSMPMLAMFM
                     RNKFLAWFSLLTAWHTYLTADPNAVRDREGTEVGPIMKLGMAVVAVVVCYTGMVLPQP
                     APGAKR"
     gene            complement(<123785..>124240)
                     /locus_tag="AGOS_ADL328C"
                     /old_locus_tag="ADL328C"
                     /db_xref="GeneID:4619903"
     mRNA            complement(<123785..>124240)
                     /locus_tag="AGOS_ADL328C"
                     /old_locus_tag="ADL328C"
                     /product="ADL328Cp"
                     /transcript_id="NM_209121.2"
                     /db_xref="GeneID:4619903"
     CDS             complement(123785..124240)
                     /locus_tag="AGOS_ADL328C"
                     /old_locus_tag="ADL328C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR062W (FCY1)"
                     /codon_start=1
                     /product="ADL328Cp"
                     /protein_id="NP_983768.2"
                     /db_xref="GeneID:4619903"
                     /translation="MAQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGR
                     NMRFQRASATLHGETAALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVV
                     GENDTFLGAEAHLRARGVEVAVLQDARCRALMQQFVAARPQDWNEDIGL"
     gene            <124325..>125242
                     /locus_tag="AGOS_ADL327W"
                     /old_locus_tag="ADL327W"
                     /db_xref="GeneID:4619904"
     mRNA            <124325..>125242
                     /locus_tag="AGOS_ADL327W"
                     /old_locus_tag="ADL327W"
                     /product="ADL327Wp"
                     /transcript_id="NM_209122.1"
                     /db_xref="GeneID:4619904"
     CDS             124325..125242
                     /locus_tag="AGOS_ADL327W"
                     /old_locus_tag="ADL327W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR061C (JID1)"
                     /codon_start=1
                     /product="ADL327Wp"
                     /protein_id="NP_983769.1"
                     /db_xref="GeneID:4619904"
                     /translation="MAKRANWSLDGQQSSGGGAASWICACTDKISIAKALTRSLSVML
                     SRPTALLRTGARWRVSLTASGRSTVRCASTVAGWQGGLSWPQGKQPTPYEVLGLVKTG
                     VDARQLKKRYHELAKLYHPDTAGAAQQGLGEHERLRRFKLVNEAYALLSDASRRRMYD
                     MYATGWAHGPAPMAPAMAHGAYHERYAYYNAGTWEDMQDLNSDRQQVQFSAWGMVVWA
                     LCMLAGFQVMAFLIRLEERTSKSAHTHEEAEHALLLAHLNYGLDQDRVSRVRRFLWFR
                     SWGLYRTKAELDEAARTNEALVRQLEGGK"
     gene            <125440..>126219
                     /locus_tag="AGOS_ADL326W"
                     /old_locus_tag="ADL326W"
                     /db_xref="GeneID:4619905"
     mRNA            <125440..>126219
                     /locus_tag="AGOS_ADL326W"
                     /old_locus_tag="ADL326W"
                     /product="ADL326Wp"
                     /transcript_id="NM_209123.1"
                     /db_xref="GeneID:4619905"
     CDS             125440..126219
                     /locus_tag="AGOS_ADL326W"
                     /old_locus_tag="ADL326W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR060C (ARO7)"
                     /codon_start=1
                     /product="ADL326Wp"
                     /protein_id="NP_983770.1"
                     /db_xref="GeneID:4619905"
                     /translation="MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYH
                     ANHERLPLPDFDGSFLDWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPK
                     LLAPYAPQINYNDRIKAIYLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHF
                     GKFVAEAKFQLEPEKYTALIKNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPLD
                     RNCSKRVTPEYLAKIYKEYVIPITKEVEVEYLLRRLEGEDL"
     gene            complement(<126627..>127595)
                     /locus_tag="AGOS_ADL325C"
                     /old_locus_tag="ADL325C"
                     /db_xref="GeneID:4619906"
     mRNA            complement(<126627..>127595)
                     /locus_tag="AGOS_ADL325C"
                     /old_locus_tag="ADL325C"
                     /product="ADL325Cp"
                     /transcript_id="NM_209124.1"
                     /db_xref="GeneID:4619906"
     CDS             complement(126627..127595)
                     /locus_tag="AGOS_ADL325C"
                     /old_locus_tag="ADL325C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR057W (BRR1)"
                     /codon_start=1
                     /product="ADL325Cp"
                     /protein_id="NP_983771.1"
                     /db_xref="GeneID:4619906"
                     /translation="MGHTSGPVDPVFGQCQVFDCSAAEVNPEVVKYLAHVRDEALHTV
                     GVVPSASNLRKRKIEISYDDEEVVKRPSEGEKAIELPFDMDEVISWFDQVKEDALSER
                     EAFEGYDEETLNTLLVGIRDYISRMSSRDESTNNLIKLLEGVQPVVTNEALELDEKWA
                     AKLVARLGRRKFTTLDNLKLRLNTQLPIPTRAKAWKIHIPINEPSHEFFHRMNSTQLF
                     DLLRYLTDNIVEHYQTDSATDYGQWLVYLLLHLPRQLTANEISEVRGLSKKVRALIID
                     HEILKLPMLLPSEIEDVSPIPRGVNPLHLALAVVAVIYGQRDILFL"
     gene            <127723..>128109
                     /locus_tag="AGOS_ADL324W"
                     /old_locus_tag="ADL324W"
                     /db_xref="GeneID:4619907"
     mRNA            <127723..>128109
                     /locus_tag="AGOS_ADL324W"
                     /old_locus_tag="ADL324W"
                     /product="ADL324Wp"
                     /transcript_id="NM_209125.1"
                     /db_xref="GeneID:4619907"
     CDS             127723..128109
                     /locus_tag="AGOS_ADL324W"
                     /old_locus_tag="ADL324W"
                     /note="NOHBY415; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B08547g"
                     /codon_start=1
                     /product="ADL324Wp"
                     /protein_id="NP_983772.1"
                     /db_xref="GeneID:4619907"
                     /translation="MPKRLRTEEYSCNQEDERSDSQVIVCNDPPCSGARISMHIYPSH
                     VAEHHDNVCAACNKNMITERMLQLHLQELHDPFNSNKALECYEADCMQQFQTHSKRRE
                     HLITVHEYPMNARLDIVYTGYNDTTT"
     gene            complement(<128102..>129127)
                     /locus_tag="AGOS_ADL323C"
                     /old_locus_tag="ADL323C"
                     /db_xref="GeneID:4619908"
     mRNA            complement(<128102..>129127)
                     /locus_tag="AGOS_ADL323C"
                     /old_locus_tag="ADL323C"
                     /product="ADL323Cp"
                     /transcript_id="NM_209126.1"
                     /db_xref="GeneID:4619908"
     CDS             complement(128102..129127)
                     /locus_tag="AGOS_ADL323C"
                     /old_locus_tag="ADL323C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR056W (TFB4)"
                     /codon_start=1
                     /product="ADL323Cp"
                     /protein_id="NP_983773.1"
                     /db_xref="GeneID:4619908"
                     /translation="MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREV
                     GKKGQLMQVLKSTIVFLNAHLSFNNSNQVSVIAACSRGIKYLYPQADDKEGSTKKKKS
                     EDRSIINRNMYRGFRNVDEAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTY
                     INRITHETEGVSLKSRLLVITCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGG
                     VKESTFLQQATDATNGNYLHVANTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTS
                     CYLTGKVVAIGFVCSVCLCVLSIIPPGNKCPACDSEFDEKVVAKLSRKPVITGTLRKK
                     KKKKVTK"
     gene            complement(<129301..>130806)
                     /locus_tag="AGOS_ADL322C"
                     /old_locus_tag="ADL322C"
                     /db_xref="GeneID:4619909"
     mRNA            complement(<129301..>130806)
                     /locus_tag="AGOS_ADL322C"
                     /old_locus_tag="ADL322C"
                     /product="ADL322Cp"
                     /transcript_id="NM_209127.2"
                     /db_xref="GeneID:4619909"
     CDS             complement(129301..130806)
                     /locus_tag="AGOS_ADL322C"
                     /old_locus_tag="ADL322C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR103W (SIF2)"
                     /codon_start=1
                     /product="ADL322Cp"
                     /protein_id="NP_983774.2"
                     /db_xref="GeneID:4619909"
                     /translation="MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEH
                     IPLGTLVKLVQKGILYTESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPELV
                     AQGRFALAHEREEPEAEPEVTRLESDDSFIKTLQCVQTFPPGYVSQWNPKHEGVFAYG
                     ERDSRAAVVTYSVADGLWNISETVVLPHANTGQQNEVTCLEWAPGGQSLLTGVESGEL
                     RLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFK
                     EAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEH
                     NKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWS
                     LASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNHNGYHGT
                     ARSAEVARIPVVGDHRSAREGNYVTQISWSQESTQLSVSYSLGDINILSVD"
     gene            <131171..>133264
                     /locus_tag="AGOS_ADL321W"
                     /old_locus_tag="ADL321W"
                     /db_xref="GeneID:4619910"
     mRNA            <131171..>133264
                     /locus_tag="AGOS_ADL321W"
                     /old_locus_tag="ADL321W"
                     /product="ADL321Wp"
                     /transcript_id="NM_209128.2"
                     /db_xref="GeneID:4619910"
     CDS             131171..133264
                     /locus_tag="AGOS_ADL321W"
                     /old_locus_tag="ADL321W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR102C (EXO84)"
                     /codon_start=1
                     /product="ADL321Wp"
                     /protein_id="NP_983775.2"
                     /db_xref="GeneID:4619910"
                     /translation="MVDFSLRKARNNWSKLSSPGKTRQQGSPTKLKSNAYEDFVSPRD
                     TLQLPEIGMKDRRKVGTSMQRRLSVHNAKYIPPPIDYASAPALPTAVELPVRDNSLLS
                     SELMKPNHRRPPVDIYGGRSLREILSNPQFQAKRFVHEKLGDATALEIDHFASNLNHL
                     SQEIEQEIKSNINKSYNELMQVNKELAVASTELKDLRSKVQQLQVVMGQFTAMAEKRL
                     LLEKEHFRQSNTSVMTTKSGSTGSGLLPPVKSGAAKKDRSSVIILEKIWTNELSSLFR
                     SVEGAQKYIAPAPGRRILLESNDWMEINIATLKPLHATRIFLLNDMILVAVCRSDKKG
                     ELVANQCCSLRELTVAEESNYTLSFHFGNKHHSLYRSRTPTGYTALLNEIKSAKDELR
                     DIYQAEEDNARKLRDSFTYLQSTQQSPSRDISSPARGHSRQRSLGTLQNTPSRASTYQ
                     ENLLQNISMSMHTRSRSGGVNQTAVKLNLVYEELEELSVPVTRMNFGLAIKKLHSIEN
                     ILKGITAEAEGEVMLLNLLRMKCNQTRTLITQKLTHVINTEYSDANKLESSTKSLILL
                     GMPAEALQLFLHNRSNFIQDLVLQVGVHDNSNSYITQVAVIRCQTIKKVAIQFQKLFE
                     GTTAKYSSVLVSWCNDEVDKHFFLMKKQLINDDQLTPQAIKISRKQIDELKSVGMDFV
                     YKLDDFLKIHSNKIY"
     gene            complement(<133335..>135383)
                     /locus_tag="AGOS_ADL320C"
                     /old_locus_tag="ADL320C"
                     /db_xref="GeneID:4619911"
     mRNA            complement(<133335..>135383)
                     /locus_tag="AGOS_ADL320C"
                     /old_locus_tag="ADL320C"
                     /product="ADL320Cp"
                     /transcript_id="NM_209129.1"
                     /db_xref="GeneID:4619911"
     CDS             complement(133335..135383)
                     /locus_tag="AGOS_ADL320C"
                     /old_locus_tag="ADL320C"
                     /note="NOHBY414; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0B07414g"
                     /codon_start=1
                     /product="ADL320Cp"
                     /protein_id="NP_983776.1"
                     /db_xref="GeneID:4619911"
                     /translation="MFKKISIDVDIHPLSDKVVLPHEVLANWAGLSTGDVFEQSKPLT
                     LLLTARRQGATGAIGTCVVGIREFSLDDKEAILLPWLVAQRLELGNDLSEVTIEYRVF
                     SELPNGTSMQLEPLGVVFWSRLLAEPGHGMDDSVDAPLPAWLQSDDEHVRAFLEARWN
                     NTLTSVMAGDCLLVSTAENGAAAEELYKFKVLRLEPAEVVCVVNTDLRLDVVRSVRAP
                     TAAGSEVEHVREVVGQSGRTATVQLGDVVHVLPGTNEMYQIDTRGERAVVEILCNDED
                     ESFHIVGGTSDLVTEEFYEITSVASAAKESHNGKNRGNCIPIDSSIRFLRSCFSSAPK
                     GSTFSFTVRPAAEPSVACITSADEVCCEYCGNCILKDTYMMHELHCQRRTKICDVCGK
                     KYINTRVKPTAHWHCPKQDCGGVGDTEQSHITHDRYCHEEQLCEGCQHSFANAIELGR
                     HKALDCPMSFHYCRFCQLKVLHGESTVESRYFGLSGHEYHCGVKTVDCYKCQKPVRRL
                     ELASHLALHDHERKVRGKNTLILLCGNVNCRRAVSSFSNDHNLCDTCFGPFYSTEEDL
                     NGKRFRIRLERRYFIQMSRGCGSTYCKNSACISSGLASFPDTLSLMKYVQQLLLETDY
                     YLCVDEATTRRKLLADTFLEVSDAYASPWVYRAVDTGAKDVASVEQWLKENALAKSEL
                     "
     gene            <135633..>136502
                     /locus_tag="AGOS_ADL319W"
                     /old_locus_tag="ADL319W"
                     /db_xref="GeneID:4619912"
     mRNA            <135633..>136502
                     /locus_tag="AGOS_ADL319W"
                     /old_locus_tag="ADL319W"
                     /product="ADL319Wp"
                     /transcript_id="NM_209130.1"
                     /db_xref="GeneID:4619912"
     CDS             135633..136502
                     /locus_tag="AGOS_ADL319W"
                     /old_locus_tag="ADL319W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR101C (FES1)"
                     /codon_start=1
                     /product="ADL319Wp"
                     /protein_id="NP_983777.1"
                     /db_xref="GeneID:4619912"
                     /translation="MDKLLHWSIANAQGDKEAAAKAGAPDPKLLQQLFGGGPDEPALM
                     RDAMAVIMNPEATVDNKLVAFDNFEMLIENLDNANNIENMRLWAPLISILESEEEQLR
                     ECALSVVGTAVQNNEKSQSNFLKHDGAMKKIIELARKDSESEQVRTKAFYALSNIVRH
                     NKDASALFVDNGGLEIMAPVLKHQNTGEKMKIRALALLTSVLTSLSADEKFSDRIRED
                     KILEASLEHLAPSANPYLIDRVLNLLVLMKGSGAKFDTDELSKIRKSFASLYPVKDQL
                     NEDDYNAVKEMLG"
     gene            complement(<136547..>138691)
                     /locus_tag="AGOS_ADL318C"
                     /old_locus_tag="ADL318C"
                     /db_xref="GeneID:4619913"
     mRNA            complement(<136547..>138691)
                     /locus_tag="AGOS_ADL318C"
                     /old_locus_tag="ADL318C"
                     /product="ADL318Cp"
                     /transcript_id="NM_209131.2"
                     /db_xref="GeneID:4619913"
     CDS             complement(136547..138691)
                     /locus_tag="AGOS_ADL318C"
                     /old_locus_tag="ADL318C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR100W and YBR098W (MMS4); YBR100W and YBR098W represent
                     one ORF in this genome"
                     /codon_start=1
                     /product="ADL318Cp"
                     /protein_id="NP_983778.2"
                     /db_xref="GeneID:4619913"
                     /translation="MKSIELIDIESIASDRAGITREDGVIELLSEADEALGRRPYPSS
                     PTIRSTEANIDESIGNRQLWLQSIELNGEFQEDDSEEVEETIGKKPDDALVCSDACSA
                     PDVSIQELLQTFTPPKPHAGRVMKAGAGPVRGSSRQTSSKLQTKDVLQDILVELDDNL
                     SSWDTPSTSGIRSPETVATLAAKWANKTEKTSGKPLYGRPRSSGNRGNILLKRTLANR
                     NNILSSELGGESSPSLQALTTPLPAKSNDGDKNQTTNVMTTGGFRLGTMEKQTLNGSA
                     CVDRIQQVPVSSPESVSFLEGLSDIPISKPVQLTQRCIAATNTGYTKDNCASTPRSAA
                     AVEYLEPIDTDTSILSTAGEALPHSPVKPSKVSRERSKRDYIVHSKAFTAEESKAKIR
                     QLMSNTALKKQFNEVNKVTREKQSLLAEIVLSINEQVHQYLLEQKVPIAEVLGPTTVI
                     HNFESVPIIRFKRKCTSMYDLNNDIYYPCETTMCNEPICLLFYNAVDFFTKYKNQKQR
                     LYSEVQDLKRAGNKVIIILNEYSRLEKSLAELENRCMRSRVEQQLTGDKSPRRKTVKE
                     VQLTALEMNSKDLGRKVNEMIIKCDIDIFPINSAASFANWISNLVWVVAKMRYDPMMK
                     NVNWSHINVKIGKTPTEVLSKTLQQINGVTEIRAGRVTSTYPSFQQIFTDFEKGYLVA
                     GKDGNPLMTKVAEKAMNALLMSEDPEEQIYIN"
     gene            complement(<138862..>141879)
                     /locus_tag="AGOS_ADL317C"
                     /old_locus_tag="ADL317C"
                     /db_xref="GeneID:4619914"
     mRNA            complement(<138862..>141879)
                     /locus_tag="AGOS_ADL317C"
                     /old_locus_tag="ADL317C"
                     /product="ADL317Cp"
                     /transcript_id="NM_209132.2"
                     /db_xref="GeneID:4619914"
     CDS             complement(138862..141879)
                     /locus_tag="AGOS_ADL317C"
                     /old_locus_tag="ADL317C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR055W (SEC8)"
                     /codon_start=1
                     /product="ADL317Cp"
                     /protein_id="NP_983779.2"
                     /db_xref="GeneID:4619914"
                     /translation="MNKLRLSSKRNRSLSTTNSPDVDEHKHYDSLAKLQNDLSRIESS
                     WNKVITKDANPLELALQFLDDTSVGLGHRYGEFHQLKSQIANNLQEAANEHYQTFANS
                     IASYGQTVKYLNDSRGNISQVKGKVEGVMASLTVEDPELDELNNESMKHAKMIETLNA
                     IEHVLLIPGRVEKFISERQFSSALESLVQGFTLAQNHHLWQISALSRTKQQLEAQENT
                     LFDTALEELVELVYSKQKSVFSDLNFLDHVATEEGFNTLESHLHQVISIDIMEHSSKM
                     NRQLQEFLKRLEARKAEGNSSVQLTVQNETDYDRIFSLLCVLNNMNKLSSALEQVVAK
                     NKEELHLIVTKAVDNVRAKFPNILKMVDAIKDRSNFGISDSNFLSIVLRKLFWEIFTK
                     FLMAAQGHRVIYEIRESMHTSSNSKYPAQKVWDEILAEIGNLLKSYTSDPTIYTSTHS
                     RHRRSSAATSHLPQKKNLFNLQNNLVDSNATRNHANALKSLLQDMFPGFTSNSNLDLD
                     EIYLEDDRFEEEDTLIPLSVFNMKVILESFLVFVEGTKNVIPAQFAEETVSSLVFFQE
                     YMNNVFLPRLDRTINYFYEQQVEPNNPFALETINDSSVILKTAIDFRNLFIRLLYVMN
                     TSYNYREGISDILLSLLHRFYTYYYNLFQNLLTSANSRFTKKLVATWLSDEELISITE
                     NILCDDDTYVPQETTALLKYCPDYDKKSGVVSKNDFFSSSTIDTITYFLGTLTWLREW
                     LPQLKQEVNEDDYTVDVNNIDKLRSNWSFFEMVDLEKMDKMGSLKFLLTGRSLEKFNS
                     IVKGFLELEYKLLSCLRYDVRAKCIYNITEMLHTSKWNPDATSIELNPYITALTSEIG
                     LLENKLSQRSNDQQRQVVFVGLSYLINIGFLACSHSIRVLNTNGVKKIIRNVNVLQQT
                     CRNISSTPEKEDMSLTLNYFAMCSMNENTVVEYYNEGKLSQYTLEEVKNILRLQFSEE
                     LYRKLRHKSGTRVVSISSNKRYEDAVNRLVTPT"
     gene            complement(<142079..>146314)
                     /locus_tag="AGOS_ADL316C"
                     /old_locus_tag="ADL316C"
                     /db_xref="GeneID:4619915"
     mRNA            complement(<142079..>146314)
                     /locus_tag="AGOS_ADL316C"
                     /old_locus_tag="ADL316C"
                     /product="ADL316Cp"
                     /transcript_id="NM_209133.2"
                     /db_xref="GeneID:4619915"
     CDS             complement(142079..146314)
                     /locus_tag="AGOS_ADL316C"
                     /old_locus_tag="ADL316C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR097W (VPS15)"
                     /codon_start=1
                     /product="ADL316Cp"
                     /protein_id="NP_983780.2"
                     /db_xref="GeneID:4619915"
                     /translation="MGAQLSLLAQTSPSIALSSYIDILDDVHYVTHLNSSRFLKTCKA
                     LDPNGEIIIKVFIKPTENYSLQEQYEQIRNESLRLAQLPNVLNYSKIIETDRAGYLIR
                     QHLKMNLYDRLSSRPFLQEIELKFLAFQLLQALEDLHSKGLTHGDLKTENILVTSWGW
                     LIVTDVSSFFKPVYLPDDNPGEFSFYFDTSGRRSCYVAPERFNSALYKHSNNDTRPTK
                     EMDVFSAGCCIAEMFSEGHSTFNLSELFKYKTGEHAAEDIISTSIKNTHLRSLISDMI
                     QLRPEKRLTVPEILLKYRDSFFPSYFYTFTYEYFRDLAVLNGHSSALNSTCSSDTLAD
                     RVDNIDGMVTKVYQDYSKICSSLHYPVVHSRNRDQESRKLITGRVKLPVLGEVELQQY
                     KPDSPQLQEESALLFLTFLLHAVRNLVSSGNKLKCLELITALSQYVSDGNKLDRVLPF
                     VCAMFFDTTPTVQGLAIQSLTQILSIVSTLTSINDNVFVDYILPRLKQVLQSSKNNPY
                     VRMILADSIGNIADSAVRFQEISQILRPPSNTEVSNSRKIRRRLVRNFEEITVALLTD
                     VESSVKLALLENILPVCNLFGREKTNDIILSHLITYLNDKNSLVRIKLVQAITGIVIL
                     LGPITLEQYVLPLLIQTITDSEELVVVNILQSLKWLCEVGMMRRRYFYEIAEIVTVLL
                     LHPNAWIRQFSLLLILEMSSKLSKAEVYCILYPIIRPYFEFDVTFSWESMFASCKKPV
                     SRNVYNLLCTWSLRATKTLFWKQVPSKSVDSFGNNSIEFITKDYTAKNYGFNSGMKVS
                     SASVSLPSNKEIPLTTEDKNWLDKLRAVGLHESETWKLAALRTYVFRVSKMLARKPEL
                     QDELDTRKAHSTFSNSFIMPRNIFFDVDIVDENRVENSHLNTENKCSSDSLSTTLGTN
                     SHRYLPLSIGVNGSLILSKKASPTIRSNLDNVYVQLEPTSEYPISFAHAPRKTAQESK
                     FVISNSYDGDVSTIKQYLRNVNIKPYLKSYREFGPYFNQSSGTKRQSSGTAFKGKLHF
                     HLTENRPASIVKIVTSEYKPYCISASDQGVLKLWDLTKLRDGEVYDPPIHYDLGSSIV
                     DLRFLPNYDVFAAATRDGSVSFLRVCFKERNSMEAYSHFEVIRKYTLKDENEYATNIQ
                     LSASDSKPYALFTTNYSRIILLDIRTTELIATMQNNQRHGAILSCTAASDLSWFILGT
                     SKGILDLWDSRFRVLVKSWTFAENFPITHIEPYPSLTRRAENNIVLVGGSRRSLVSVW
                     DISKAVCREVVLTADSKCLSTDFIAVEKGIEDLAVHIDPFSTTVSAIHVSGHRVYIAD
                     RETGSILMVNFRNKAQNCIVVGHSEQNISFSSSQLSSTLGLTIRSVSDSAAMHSLGVY
                     FHTDIINSFTIAKDTPEPLLISGDNSGVINIYR"
     gene            complement(<146549..>147853)
                     /locus_tag="AGOS_ADL315C"
                     /old_locus_tag="ADL315C"
                     /db_xref="GeneID:4619916"
     mRNA            complement(<146549..>147853)
                     /locus_tag="AGOS_ADL315C"
                     /old_locus_tag="ADL315C"
                     /product="ADL315Cp"
                     /transcript_id="NM_209134.1"
                     /db_xref="GeneID:4619916"
     CDS             complement(146549..147853)
                     /locus_tag="AGOS_ADL315C"
                     /old_locus_tag="ADL315C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR054W (SMK1)"
                     /codon_start=1
                     /product="ADL315Cp"
                     /protein_id="NP_983781.1"
                     /db_xref="GeneID:4619916"
                     /translation="MPLLQQNPPIQPPYSRASQKLKSLLSSYGENTSTTTAAKEMNGI
                     APMNLIEKSVVHPPRTIYTKANFSIPGHYEVLQMLGKGSYGTVVSAIDNLNANYPIRI
                     AIKKITNIFQREVLLKRAIRELKFMHYFKGHKNIVSLINLEIVNEKPYDGLYCYQELI
                     DYDLARVIHSNVQFSEFHIKHFTYQILCGVKYIHSADVIHRDLKPGNILCSISGQLKI
                     CDFGLARGISPLFTNTKTSNHITNYVATRWYRAPELILSHKRYNKSIDMWAIGCILAE
                     FYGRKPIFMGQDSMHQISEIVKVLGTPSRDTIIKYGSSRAYDIFCPPKPQYAKIPWAE
                     IYPFAGPDALDLIERLLDWDPDRRLTVEEAIEHDFVKSVRDVNDEPCCPHGPFNFSYE
                     AEFKSMSNLREVLYAEVKQFQEECATKDVVPSLPIPQQIYPI"
     gene            complement(<148112..>148816)
                     /locus_tag="AGOS_ADL314C"
                     /old_locus_tag="ADL314C"
                     /db_xref="GeneID:4619917"
     mRNA            complement(<148112..>148816)
                     /locus_tag="AGOS_ADL314C"
                     /old_locus_tag="ADL314C"
                     /product="ADL314Cp"
                     /transcript_id="NM_209135.1"
                     /db_xref="GeneID:4619917"
     CDS             complement(148112..148816)
                     /locus_tag="AGOS_ADL314C"
                     /old_locus_tag="ADL314C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR096W"
                     /codon_start=1
                     /product="ADL314Cp"
                     /protein_id="NP_983782.1"
                     /db_xref="GeneID:4619917"
                     /translation="MANHWWTAARTLFALFLASSYKSLPGAYFVRFAYYLTKNLLLPK
                     VLVGRTGSTANMRALKKDHHGAFRRSVIHTYCSPFECDFYLHKNNATYFEELDFSRTD
                     LMTSVFQQLFLRARAWPYLPVANVFTGFRKEIAPFQRYTIDSCVLCWDDKWIYVLSRF
                     MLPGVELPCAVSITTYVFKDGRRTITPREALEACELYNEDVEHIAQENLKTVLDHNSF
                     TPTDRLYKLTHCYTVL"
     gene            <149359..>150459
                     /locus_tag="AGOS_ADL313W"
                     /old_locus_tag="ADL313W"
                     /db_xref="GeneID:4619918"
     mRNA            <149359..>150459
                     /locus_tag="AGOS_ADL313W"
                     /old_locus_tag="ADL313W"
                     /product="ADL313Wp"
                     /transcript_id="NM_209136.1"
                     /db_xref="GeneID:4619918"
     CDS             149359..150459
                     /locus_tag="AGOS_ADL313W"
                     /old_locus_tag="ADL313W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR095C (RXT2)"
                     /codon_start=1
                     /product="ADL313Wp"
                     /protein_id="NP_983783.1"
                     /db_xref="GeneID:4619918"
                     /translation="MTDTSEHVLTEEEERHQILNFTKYVLSQRTGNFPELNHTEDGTV
                     FPSIRGETTNRGYKLYQDAKGVSWRRLRVDTLEKKVFYSGSDHKLLARKRMKFSTTPQ
                     FHRNDGDNDTSDTEESDDPEDLHDLVDVRKVLSPISSLADVATHPAVSRTFQSKVLRD
                     LALDMILMVEKEQESVISYSRLLEVFLGDFPDALHEEQLGLPGYDHKLKLPEEDGASP
                     PIAYQKEAPDTAEDLHQPKEENTGYKAEEGEEQEDPFFAIPKLHGIQELSPPANDTGA
                     TDQLETTRQLAQIALQRNQEFIRNLQKIRNCIVKTNRIRERILVWGKEMAGIPEDDVT
                     VPSALHIVKRGLISATTNHMDEEAEEDDIEEE"
     gene            complement(<150586..>152742)
                     /locus_tag="AGOS_ADL312C"
                     /old_locus_tag="ADL312C"
                     /db_xref="GeneID:4619919"
     mRNA            complement(<150586..>152742)
                     /locus_tag="AGOS_ADL312C"
                     /old_locus_tag="ADL312C"
                     /product="ADL312Cp"
                     /transcript_id="NM_209137.2"
                     /db_xref="GeneID:4619919"
     CDS             complement(150586..152742)
                     /locus_tag="AGOS_ADL312C"
                     /old_locus_tag="ADL312C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR094W (PBY1)"
                     /codon_start=1
                     /product="ADL312Cp"
                     /protein_id="NP_983784.2"
                     /db_xref="GeneID:4619919"
                     /translation="MRVLLTNDDGPPHDAYSPYVRHFVDHVARHTGWELTICVPDRQR
                     SWVGKAHFPNANPRASFIYTAVEAGDNGFDGPHAVPLRGSRLTRLAGCAAAQREVPAG
                     HVEWCLLENSTPATCADIGLNHLVDGEFDLVVSGPNVGRNTSSAYITSSGTVGAAMNA
                     VITNQVPAIALSWAYFDGAAVVSDALFRDASERSVELIQWLYSHWDPRVELYSINVPL
                     KEGLRSARTLYTSIFPTQWCSVYSGVRVVPVGGAVGADGEAPAQDSVALEFQWSPNFA
                     KAREAALSASGELYDGKVIEEGHISVTPLLANFQVVEEILGEPIMGDRDRTCAAITIP
                     STDYIYGPLTAALKRHLPELAIMDALPDLQSGQHSKVFHYGDYEQIDVDQLFSSSHYY
                     ANAYIYRKALIRKHFLSHTIHSYVVKRPESVLKRAYLESFNIEIDYAEFLDDALDENW
                     ELRQELEQETKWWILKPSMADKGQGIRIFKTIDDLQAIFDSFEEEETEDEESTRVVSS
                     QLRNFIVQEYLPNPLLLPRMDNRKFHIRCYIVCNGDLQVYVYSRMLALFAPTPFVLPA
                     ANHEVTDIQSISCHLTNTCLQTDSGVAENAVREFDSLDDLTDVDKEKVKSQINDITKE
                     LFLAAVNLNRLHFQPLPNAFETFGVDFLVDENLNVKLLEVNAFPDFKQTGDDLKGLID
                     HLFDNIVSHCVNPMFGNPVNSDPTFVEVLKHSSHDW"
     gene            <152827..>153135
                     /locus_tag="AGOS_ADL311W"
                     /old_locus_tag="ADL311W"
                     /db_xref="GeneID:4619920"
     mRNA            <152827..>153135
                     /locus_tag="AGOS_ADL311W"
                     /old_locus_tag="ADL311W"
                     /product="ADL311Wp"
                     /transcript_id="NM_209138.2"
                     /db_xref="GeneID:4619920"
     CDS             152827..153135
                     /locus_tag="AGOS_ADL311W"
                     /old_locus_tag="ADL311W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR091C (TIM12)"
                     /codon_start=1
                     /product="ADL311Wp"
                     /protein_id="NP_983785.2"
                     /db_xref="GeneID:4619920"
                     /translation="MSLFVNPYGAQELNQARLDVAEVQFDAMTTTFNTLLAACREKCV
                     PHDGYGEPDLTRAELSCADRCIAKAHAANRAIGTYVQARGLAPHRALPHYAAFAPRDR
                     "
     gene            <153373..>153821
                     /locus_tag="AGOS_ADL310W"
                     /old_locus_tag="ADL310W"
                     /db_xref="GeneID:4619921"
     mRNA            join(<153373..153382,153532..>153821)
                     /locus_tag="AGOS_ADL310W"
                     /old_locus_tag="ADL310W"
                     /product="ADL310Wp"
                     /note="5'UTR intron"
                     /transcript_id="NM_209139.2"
                     /db_xref="GeneID:4619921"
     CDS             153537..153821
                     /locus_tag="AGOS_ADL310W"
                     /old_locus_tag="ADL310W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR052C (NHP6A) and YBR089C-A (NHP6B); 1-intron"
                     /codon_start=1
                     /product="ADL310Wp"
                     /protein_id="NP_983786.1"
                     /db_xref="GeneID:4619921"
                     /translation="MAAAATTKKRTQRKKKDPNAPKRAMSAYMFFANENRDIVRAENP
                     GISFGQVGRVLGEKWKALSDDEKQPYEAKAEADKKRYESEKELYNATKAA"
     gene            <154073..>154852
                     /locus_tag="AGOS_ADL309W"
                     /old_locus_tag="ADL309W"
                     /db_xref="GeneID:4619922"
     mRNA            <154073..>154852
                     /locus_tag="AGOS_ADL309W"
                     /old_locus_tag="ADL309W"
                     /product="ADL309Wp"
                     /transcript_id="NM_209140.2"
                     /db_xref="GeneID:4619922"
     CDS             154073..154852
                     /locus_tag="AGOS_ADL309W"
                     /old_locus_tag="ADL309W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR088C (POL30)"
                     /codon_start=1
                     /product="ADL309Wp"
                     /protein_id="NP_983787.2"
                     /db_xref="GeneID:4619922"
                     /translation="MLEAKFQQSSFFKKIIDGLKDCVQLVNFNCSEKGIAAQAVDDSR
                     VLLVSLVVTPEAFEEYRSDRAVTLGVDLNSLGKILRCGANEDSLTLVAEDSPDTMLVL
                     FEDTKRERISEYSLKLMEIDADFLEIDQIDYDTTVHMPSAEFAKIIRDLNQLSDSLNV
                     VVTKETIKFISEGDFGSGSVIVKPRTDVERPEDSVKVELEKPVDLTFGSKYLLDIIKA
                     AALSVSITIKLSADTPALFQFNLDGAGHLQYFLAPKFNEEE"
     gene            complement(<154881..>155402)
                     /locus_tag="AGOS_ADL308C"
                     /old_locus_tag="ADL308C"
                     /db_xref="GeneID:4619923"
     mRNA            complement(<154881..>155402)
                     /locus_tag="AGOS_ADL308C"
                     /old_locus_tag="ADL308C"
                     /product="ADL308Cp"
                     /transcript_id="NM_209141.1"
                     /db_xref="GeneID:4619923"
     CDS             complement(154881..155402)
                     /locus_tag="AGOS_ADL308C"
                     /old_locus_tag="ADL308C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR051W (MAK3)"
                     /codon_start=1
                     /product="ADL308Cp"
                     /protein_id="NP_983788.1"
                     /db_xref="GeneID:4619923"
                     /translation="MITYRPFDINSDLQFATIKKLIDRDLSEPYSIYVYRYFLNQWPS
                     LAYLAYDTEAATAEEPVGCIVCKAEAHRGVRQRGYIAMLVVNDAYRGRGIAKRLITLA
                     IEQMAAQGCDEIMLETECSNGAALHLYEALGFVRMKRMFRYYLNQGDAFKLILPLTAR
                     SYMRSTFLDARAD"
     gene            <155777..>158995
                     /locus_tag="AGOS_ADL307W"
                     /old_locus_tag="ADL307W"
                     /db_xref="GeneID:4619924"
     mRNA            <155777..>158995
                     /locus_tag="AGOS_ADL307W"
                     /old_locus_tag="ADL307W"
                     /product="ADL307Wp"
                     /transcript_id="NM_209142.1"
                     /db_xref="GeneID:4619924"
     CDS             155777..158995
                     /locus_tag="AGOS_ADL307W"
                     /old_locus_tag="ADL307W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR049C (ATG11)"
                     /codon_start=1
                     /product="ADL307Wp"
                     /protein_id="NP_983789.1"
                     /db_xref="GeneID:4619924"
                     /translation="MGHVEGNLQLVNAISGRSIGTHVQYFMTMEDLKRFVIQQWHIPG
                     PEIFILQPYGGKFKRGHFQDMVSEAKKAVARGRVRETSVLYVFDRRLFDGGEEALAQA
                     TRHDSTTLVRPLVSPLEDAEAEVGERAAASLLTTNLGWLSALEIDVRYFHACIEGWVQ
                     QLANMKECLSVLLQYLELYSFDIEKLYHASAEAVDGVRQRCASNDWRQKNQELLETID
                     AVASRGKLVQFVDLEEMSEAEERLRELERLLSKKLSLFRGALDENHAIRQEIANHIKE
                     VGTRYQDNISNYELEAQILGNFKDMVKKVKEDTRTILDLDTTKVSPDLMTSAVSLFKE
                     MKSTAIPALYTVGLSLFTQASKCMETKASLQREMLVILADIAVAQVNIVDAKNSLLQQ
                     VNQDISALHTTEQQLLRVSELPVVYGLYLIELYRRQHWITGLDRYYSEHTKEIQSVLQ
                     RELVFREKWSSDFSSYSEIFQWQDDKPQLAKLFSNASPLEVGRPCIDIGTIQTYIEML
                     ARCDVAEDSQTLLKKTLSEVSRFQFIVKSPLAGSVSKDSTDSMNEVIEGYKNRINKLE
                     LLLHSTQFSNTSSWPTGVLNSNSLNVFHNNIASINEKLLLSDYKSRDSIMSGKSNEKE
                     LQSQLVELQKQLEEAKNEAKRVQQQLKTTKTQLLNGEDERTAYKETLSILNAELSKLI
                     LNQEEQKQELVIAAKDFQEKLDVSMRQVNDLLKQVNFWKSKCGDLDKIKQDLLANMAT
                     KETDFNNRCTDYERNIVELQRQLSEKCDATNERSVTSTSADVPGETKEYIESLKEVNR
                     RLEEDMFAVFAGNIVLLENIGLLLSRGPDNKLQIIRVKGLRKNIDDSIIKDSSPVINS
                     HMVKSTVFQDVKNLFDELQLSQGVNDQLHFVSELERFYEEDLFQTSVIKRFTDVENLA
                     KKLRKENKAKKSVIERHNKDKITFRDLKVGDLALFLPTRGVAGSLTSSVASSLASSFS
                     SVDLSTPPPPLPTASQSLIKVTPHKPHRNKSTPWAVFTASELGVRYFLKDSEELVKGK
                     DWFVGKIQSMEKYTVNGDSRNPFKLPEGMVWYEVVASCTKEL"
     gene            complement(<159107..>160969)
                     /locus_tag="AGOS_ADL306C"
                     /old_locus_tag="ADL306C"
                     /db_xref="GeneID:4619925"
     mRNA            complement(<159107..>160969)
                     /locus_tag="AGOS_ADL306C"
                     /old_locus_tag="ADL306C"
                     /product="ADL306Cp"
                     /transcript_id="NM_209143.2"
                     /db_xref="GeneID:4619925"
     CDS             complement(159107..160969)
                     /locus_tag="AGOS_ADL306C"
                     /old_locus_tag="ADL306C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR048W (TAH18)"
                     /codon_start=1
                     /product="ADL306Cp"
                     /protein_id="NP_983790.1"
                     /db_xref="GeneID:4619925"
                     /translation="MAATRIAILYGSETGTAQDFANILSHQLRRFHYKHTVCSIGEYS
                     AQNILACQYLFVICSTTGQGALPQNARQSPQGKVEGTLWSVLKRSSLPPTLLDHLQVA
                     FLGLGDSSYSKFNFAIRKLHNRIVGQLGAREIFPRLEADAIGLAGSNAGNGNGIELVY
                     SEFEKRVLSFLNDQFPFMTVNGEQVPREPIATDIYLKPEYYLEASGNDKGTASVPCTF
                     EGDSSVKYGTVVTNKRITATDHFQDVRQLVFSSQDGENYYPGDTVSIYPYNTDADVQA
                     FIDTQQHWASIADVPLQIKTPTSARGICDGGLVSPLTLRNLLKYHCDIVSIPMRSFFM
                     KTWTFAVDHERLPDGKDQLQQQRDKLREFAESEDMQDIYDYCNRPRRSILEVVQDFMS
                     LRLPWEYILDYLPHIKPRFFSISSQPCNKDIELTIAIVRYKTILRRIRRGLCTNYISD
                     LSEGSIIRYKVQYNDLLPAGKQDRPVIMISPGVGLAPMKCLIYAQLFNPMLLFFGNRY
                     KDKDFLYADTLQKWADENRIKLFVCFSRSPDDSPGLKYVQDAVWENAREVARLITEEN
                     AVVYVCGSSGKMPVQVRLTLCEVLKKWGNFPDDKASEEYLKDMENSDRYLQETW"
     gene            complement(<161176..>162555)
                     /locus_tag="AGOS_ADL305C"
                     /old_locus_tag="ADL305C"
                     /db_xref="GeneID:4619926"
     mRNA            complement(<161176..>162555)
                     /locus_tag="AGOS_ADL305C"
                     /old_locus_tag="ADL305C"
                     /product="ADL305Cp"
                     /transcript_id="NM_209144.2"
                     /db_xref="GeneID:4619926"
     CDS             complement(161176..162555)
                     /locus_tag="AGOS_ADL305C"
                     /old_locus_tag="ADL305C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR047W (MSF1)"
                     /codon_start=1
                     /product="ADL305Cp"
                     /protein_id="NP_983791.2"
                     /db_xref="GeneID:4619926"
                     /translation="MALQVGRILRPLVRSYSSKVGKSIVVNCRTFETDDSHTNVTPTI
                     LSLTERSLHLQKAHPIGILRDMIEQRLNSVDNAYETYNEFRPAVSVAENFDSLGFPAD
                     HPGRSRSDTYYINKEHLLRTHTSAHEMECFGNIRNGATEKPGFLISADVYRRDEIDRT
                     HYPGFHQMEGARMWKRDLSAAPGQEPAHLAQLRADIAKVEEQLRHEQTRLQVEDSTTL
                     EGNPKQDYMTEAEVDLCAQHLKRSVELVVAQVFNKKLQSVGNPGEVLQVRWIKAYFPW
                     TAPSWEIEVWWKGEWLELCGCGLVREQVYLNAGFAPNTHVGWAFGLGLDRIAMLLFDI
                     PDIRLFWTLDERFHSQFRPGEITTFKPYSKYPASTRDVAFWLPEDKQSVEFHENDIME
                     LVRNTAGDLVESVKLLDKFVHPKTGRTSLCYRINYQSMDRTVTNAEVNVLQEQVSREL
                     VRLYNVQLR"
     gene            <162919..>163581
                     /locus_tag="AGOS_ADL304W"
                     /old_locus_tag="ADL304W"
                     /db_xref="GeneID:4619927"
     mRNA            <162919..>163581
                     /locus_tag="AGOS_ADL304W"
                     /old_locus_tag="ADL304W"
                     /product="mitochondrial 54S ribosomal protein YmL47"
                     /transcript_id="NM_209145.1"
                     /db_xref="GeneID:4619927"
     CDS             162919..163581
                     /locus_tag="AGOS_ADL304W"
                     /old_locus_tag="ADL304W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL038W (MRPL16)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL47"
                     /protein_id="NP_983792.1"
                     /db_xref="GeneID:4619927"
                     /translation="MLSVMVPRWTHVATGVSPVRLCKRFSHQYAPRLSQQDKKHKGRV
                     PVRTGGSIKGNTLEFARYGMRLKTEGVRLTALQLTEADNSIMRTVRQLTNGKLWRRLC
                     TNVAVGVKGNETRMGKGKGGFDHWMARVPTGKIIFEMDGDNLHEKVAREAFRKAGTKL
                     PGTYEFVKRDSLVRVGLHSFKNPADDPKVNYFEKLAKEPTKEYLNKLRSKENMYRLYR
                     GR"
     gene            complement(<163703..>164770)
                     /locus_tag="AGOS_ADL303C"
                     /old_locus_tag="ADL303C"
                     /db_xref="GeneID:4619928"
     mRNA            complement(<163703..>164770)
                     /locus_tag="AGOS_ADL303C"
                     /old_locus_tag="ADL303C"
                     /product="ADL303Cp"
                     /transcript_id="NM_209146.1"
                     /db_xref="GeneID:4619928"
     CDS             complement(163703..164770)
                     /locus_tag="AGOS_ADL303C"
                     /old_locus_tag="ADL303C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR087W (RFC5)"
                     /codon_start=1
                     /product="ADL303Cp"
                     /protein_id="NP_983793.1"
                     /db_xref="GeneID:4619928"
                     /translation="MSLWVDKHRPKSLTSLSHTASLTKQLEALAGSAKDLPHILLYGP
                     NGSGKKTRCMGLLASIFGAGVYKLKIDVRQFVTPSNKKLELNVVSSPYHIEITPSDMG
                     HNDRIVIQELLKEIAQMEQVDFQSGSEGLARRYKSVIINEAESLTRDAQAALRRTMEK
                     YSRNIRVIMLCDSLSSIIAPIKSRCMLVRVPAPAPAEMVAIMERVCTQEGVTASEHKL
                     YEIAEFADGNLRLALLTLESMCIQHNLKLTDTSTTVTPDWMLVVCRLANKVLKERTVG
                     SLVECRGILYDLLSHCIPPDIILHELAFALLKMVSSDPVKLAVIDLASVFDERLALGN
                     KAIYHLEGFLAKVMCSIDCHV"
     gene            <165193..>168066
                     /locus_tag="AGOS_ADL302W"
                     /old_locus_tag="ADL302W"
                     /db_xref="GeneID:4619929"
     mRNA            <165193..>168066
                     /locus_tag="AGOS_ADL302W"
                     /old_locus_tag="ADL302W"
                     /product="ADL302Wp"
                     /transcript_id="NM_209147.1"
                     /db_xref="GeneID:4619929"
     CDS             165193..168066
                     /locus_tag="AGOS_ADL302W"
                     /old_locus_tag="ADL302W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL037W (APL3)"
                     /codon_start=1
                     /product="ADL302Wp"
                     /protein_id="NP_983794.1"
                     /db_xref="GeneID:4619929"
                     /translation="MPSKPMNNSMRGLQLFIADLKSAQLQQTQQKRIQSELVNIKTNF
                     GTSGLNGYQRKKYIAKLVYIYITTNTAKVGEVLFGLEQCLVLLKSSVYSEKAIGYQAL
                     ELLMHHKEAQESVLFPVIEQVKLDLTSADTDTVALALNFLGIAGGCSRTVGNQLFYDV
                     FKILKSPLAPSLLRSKAALAFLMLVRKSPEVLTDQDDATLAEWVRCIFALLDDEKNYG
                     LILAGVPLIEYFARHVAYDQCIKLVPKLIQILYSCVVVAKDNPNEFPEEYRFAKMPNP
                     WLVSNISKLLNVLITPSDSHGRFTSLNIDQQSLGRLRLCVTKVIEFNGIQGTLSNATQ
                     HAILFTLINLACKLDPTADALNNSVAVLTSLLGSKDTNIRYLTLDALTKMSFSSGGRV
                     KDTLRKDYLPRLLQILQEERDASIVCKVLDLLYALASEENVEYIVEQLLHFLASSTKR
                     PLSIRNDLCVKVAALIENSSKSPEWVALSLLKLLSLTPVESNSTKGDMICQRVCYLVV
                     NEERLRKVTCMNLVNYLLAPAPSTCILKASAFIFGEYANLLLENISIGDLFNVFAEKY
                     FQSDNTTRAMILTTLIKLYRFNPAIGSAAIKFYQLELTSLDLELQTRAYQYLKIIQLD
                     KLKKHDMKLLDTIFSEMPPFPRKKALFAPDNATGEFSEDSELPSFTDNIPSSKSNSRA
                     PTPAPTPPPSRNIKTTYTSVTLSDGWESGFKRMLLHQQGVFYKNSLLKVLYRIIQNPS
                     QPSISIVSLTTVNNAELPITGFYPEVIPFRTSGNPSYITNVTEMSNFTIEPGQRTNFS
                     FELQTRYSFPVIEAPIVTFNFRYGGHNRDIGLKLGYGITSTISSKDNVSTMAQFIQRW
                     KTISDALGHHGEAQDVLDPESSTQLEVNLQRMGFAIVEQESVPHTVFATGIVHTKSSG
                     NFGCLLKLMITDSAVKLTCKTTSDGSLAQELVECVVQAFHSTT"
     gene            complement(<168129..>168935)
                     /locus_tag="AGOS_ADL301C"
                     /old_locus_tag="ADL301C"
                     /db_xref="GeneID:4619930"
     mRNA            complement(<168129..>168935)
                     /locus_tag="AGOS_ADL301C"
                     /old_locus_tag="ADL301C"
                     /product="ADL301Cp"
                     /transcript_id="NM_209148.1"
                     /db_xref="GeneID:4619930"
     CDS             complement(168129..168935)
                     /locus_tag="AGOS_ADL301C"
                     /old_locus_tag="ADL301C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL036C"
                     /codon_start=1
                     /product="ADL301Cp"
                     /protein_id="NP_983795.1"
                     /db_xref="GeneID:4619930"
                     /translation="MLGRAVGRGGKVAALRWSSKMTSQDSSRKKELCAAYSVVDERVS
                     RSMEECGRRRSEVLLLAVSKLKPASDVAILYEEMGLRHFGENYVQELVGKAAELPGDI
                     QWHFIGALQSNKCKDLAKVVNLHAVETIDSLKKARKLEEARAKFQPDAPAILCSIEVN
                     TSGEAQKAGVSDEAELCELVEFFLSEDAKHVRLRGLMTIGSWDASHAADGENPEFAAL
                     AKWKRVLDGKYGLNLELSMGMSADFAAAMRQGSSEVRIGTDIFGARPARK"
     gene            <169672..>172452
                     /locus_tag="AGOS_ADL300W"
                     /old_locus_tag="ADL300W"
                     /db_xref="GeneID:4619931"
     mRNA            <169672..>172452
                     /locus_tag="AGOS_ADL300W"
                     /old_locus_tag="ADL300W"
                     /product="ADL300Wp"
                     /transcript_id="NM_209149.1"
                     /db_xref="GeneID:4619931"
     CDS             169672..172452
                     /locus_tag="AGOS_ADL300W"
                     /old_locus_tag="ADL300W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR086C (IST2)"
                     /codon_start=1
                     /product="ADL300Wp"
                     /protein_id="NP_983796.1"
                     /db_xref="GeneID:4619931"
                     /translation="MSELAELDPNFVINAPAERRALEKLMERLDKLGVASRVRPGTSS
                     NSVYVFVRDSSGQLVPELKGMAVEEIIPLYGGEQRKRLEHLAKEMMYRRLFPSTGDLT
                     ELATLTRNPEMALYFAFQKTYTLWLLPLAAVGAAFRFFAKATPWEFNMFYAIALLVWG
                     MAFATFWNHSTERWYSEKLGFKNIVPLSEPKSVVMKKLCFTPIAITFMVCMVCFQFVC
                     FMLEIYITQIYNGPLGFLLALIPTVLLSAYVPVLTAVYNVFVNKLVKWENAANPERSR
                     VEKNYALSFLTSYVPLLITLFVYLPMGHMLNPQMNLIAKYSQRYGIPVIGRHFMINTE
                     RYRTQFFYFTVTNQLVAMAVDNILPIVMGVILPRIKGHTKSDSELNRARALTAEQYPK
                     DIELVEHVRTCMLGPWGPFKLHDNVSKLVIQFGYVVMFSTIWPLAPLICVIFNIVISK
                     FDIWRALKKHTPSSNPNTYKSKNLGLALTSLSPWNPILEFTVWVASVVSPALIIMYRH
                     SNLPGFARPLEKHSTWFIHSPIRYDWKLIFIYVAVAEHLGLLLHFVLSKIAGAPASND
                     SDVSPSLLKRELATANKHFDNSAAIPEAEDITQRIKSNYTTKREISQEYATRASGVDD
                     TRTSVRNFEEEQAPRIVTTTEHNISHRKQAMPAAIAQVAPKTAAPVHERSTFDRKPSC
                     SSLGSSGSLYSSVAGATLPHKIPTSKNYDERQGYPTPTQSNSMTSTKISIGNGDHSHS
                     AHSRNGGAIPGSAYTQQPTIVTNGSGEHYEGNGISTRVPQTVIVSETQNGNGNGGSRH
                     YPAQEIVIDRIIVAAPEDLEASNVVVAPPNDTQFVNDKALELPVLKAPPPPEEDDYII
                     APHLKTPPGDMRSASLPSSKQSVVQRRKSSSRKTLSILMRATTGKDGSSSEHKHKHKV
                     KNTLNLLKKRFD"
     gene            complement(<172734..>174671)
                     /locus_tag="AGOS_ADL299C"
                     /old_locus_tag="ADL299C"
                     /db_xref="GeneID:4619932"
     mRNA            complement(<172734..>174671)
                     /locus_tag="AGOS_ADL299C"
                     /old_locus_tag="ADL299C"
                     /product="ADL299Cp"
                     /transcript_id="NM_209150.2"
                     /db_xref="GeneID:4619932"
     CDS             complement(172734..174671)
                     /locus_tag="AGOS_ADL299C"
                     /old_locus_tag="ADL299C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL035C (POL12)"
                     /codon_start=1
                     /product="ADL299Cp"
                     /protein_id="NP_983797.2"
                     /db_xref="GeneID:4619932"
                     /translation="MVLKDELLARFGPEAKDETVVTTLESYMKLYALSIDELYIKWEQ
                     FAYHSLDGGVKLDANGLDNFKGFIQRQIEKANMAQGNAADVSHGAGHGSGAKLPRPLR
                     ATGGSSLFGYGSSPRSSNVRKMKLDVLHSDRDSPGPPSSPVGHTSVFSDAGPGFGTPT
                     SAGDSRDTDKIVDTLNPDLPIADGADFDSDHQVRSIPFYDTKKYKYRTMRQRLLGAAD
                     VLDEQIEHFTSVVQKDLGISSAELGDPTIQSQSSIICVGRIVPDNPGDERINMESVSI
                     ETSRAAGIGRRIRLNLKSIKEYSLFPGQIVAMRGRNANGEFFKVEELLQFPYLNSPVS
                     SAEEIQEAQLALDGGQMKVLVTSGPYTPSTSIDFNHLEEFILRVNEHIRPHVLIMFGP
                     FLDVTHPLVETGQIPTFPNLKSQPRTLDELFTKILCPILRKINPRIQVVLIPSMRDAI
                     SRHTSYPQDSFSRKELQLPKNFKCYANPATFRVNELFFGCSNNDIFKDMKEVPNGPIN
                     LSKNRIDRVSEHILEQRRFYPAFPGGAKTRTIDDSKEHVSGADLEVPYLGLTEFIGGF
                     IPDIVIIPSELKHFARVVKNVMVINPGAFVRARGSRGTYAQLSISAPDLEDGILTLVE
                     GQENVYLHNAWKRTRIDILSA"
     gene            complement(<174829..>179256)
                     /locus_tag="AGOS_ADL298C"
                     /old_locus_tag="ADL298C"
                     /db_xref="GeneID:4619933"
     mRNA            complement(<174829..>179256)
                     /locus_tag="AGOS_ADL298C"
                     /old_locus_tag="ADL298C"
                     /product="ADL298Cp"
                     /transcript_id="NM_209151.2"
                     /db_xref="GeneID:4619933"
     CDS             complement(174829..179256)
                     /locus_tag="AGOS_ADL298C"
                     /old_locus_tag="ADL298C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL034C (STU1)"
                     /codon_start=1
                     /product="ADL298Cp"
                     /protein_id="NP_983798.2"
                     /db_xref="GeneID:4619933"
                     /translation="MEEPRVHNLEKLMDEGVAGIEQLQILTAFKTHVKKELVRDDSIE
                     RYFDALVRFLGQPVEDRKVQQLGHSSLCYLIKRVAMQQPGRFQGARIRDLVRVVLLQE
                     QLQERKVWGSAVKSLEAIYLCKPQAFEAELASICAATRGSDRTKCLLFMDELIQLQQM
                     NNRNPMEVVNRFVDLWVDVLNESDPGCSKRDIELIHDILKKYFNEAMLQQFAERVVNT
                     RSLKHFMHTEHAAPSSAQTTSSMPSGPFDVDEELTRVMEELPPNVVNSNIGEARDYLS
                     FEHVVKDLEHITVAFQAIKETEHNWKQRQEGIITLRKIVNGNVSRQFPDEFIQACRDL
                     NIADCISKAALSLRTTLSSHSCHLIKEMAFKLGPLLEPLLDVLFVPLRSLLSATKKIS
                     SQTAFATAAILLCTAPYHNRLFQQCIALSRDKNVSPRTFAAVFLRIYIIRFHRRLEHS
                     SVLVEEWLHKGLTDPQTQVREAMRVTLWYWYVPNAQSAKKVLDSMPHQMKRIIEGSIP
                     TYLNIEYHVTASVSSNESSRRSSFGVRRYPSYAAPTQSSNLQKLAANSLGGSANVRSL
                     SENTNRHLTTYTSLAKKSLATRHESLSPRVASSGLISSAGAANLSSENLELTEELTSN
                     HSNTLLKKYLNTNEPAVIRKSEGEPTGDLESMYSHLSSTTLQEKQQGLLFLKNLLLLK
                     APLDIAKLNPLLVQLSIQSPKSFKDLLTLASFHPLIPLANLIELFAINDLPTNVLLDE
                     FSSTDLLETVIHSFQTFFPDHHDQLFLYYVKYRSVIFNYCFGIMIDLLSGDFAFSEGS
                     TLFREVCTRIIEACGNDFNMEKYYTLISILYRADKSQFVELLRDAPVSSKFKIANELQ
                     RCDSTFNLHSIMSRESTAESHHSDPNQQYKDGAHGGDARDANGTSNSSSDSDNEPDLE
                     STKHLLEMTMVNPIGLGCVENVLQSHIHAYKQDQQHQDPIAEKSLSTVAEVNDEDGDG
                     STTTQMKLMGANTTEPSNESDKDKTSDIVAESMRGTDDPNYAKLCAIDSALIDSEDEP
                     ELNNFGGLKGLTEMTKVVSIYEKLDGDEDVEMVDDEKFKDPVEQENQETGLDEIFRDE
                     KHDQSVKFNDIPRIIDVNKSWDRYDGESIEDTSGNTSHGTDENRPASFGTVSELVRKE
                     MEKSPTLPLNEEDSKLLSDGINEIELKHKDDPFVRDSEDCENGTPQDRSNFLSCKQHI
                     DILGALPDNSLTAFELGLLEILDVSDMDANRILETVNTIQNSRLRSADVSRIVGAIVS
                     HCTDPLLHWLTDSNGLQRLWSMLTALSTADGFSDSYKCVVLYTALLIANSQLSSSHLS
                     TDELSDAWAFALRELSKLSSYNNETYIACCELRETLIEHYSSSYLPQLLESAIKELNV
                     AEDRVRITFLLQTLSDALDHMNTLLSLEVLGSMSSLLQQFVTNDFTEWRYHSIKLLAQ
                     IYGILVARNSPASYIRSMFSILRQPEFDLVKSYYTMDHN"
     gene            <181007..>181276
                     /locus_tag="AGOS_ADL297W"
                     /old_locus_tag="ADL297W"
                     /db_xref="GeneID:4619934"
     mRNA            <181007..>181276
                     /locus_tag="AGOS_ADL297W"
                     /old_locus_tag="ADL297W"
                     /product="ADL297Wp"
                     /transcript_id="NM_209152.1"
                     /db_xref="GeneID:4619934"
     CDS             181007..181276
                     /locus_tag="AGOS_ADL297W"
                     /old_locus_tag="ADL297W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR085C-A"
                     /codon_start=1
                     /product="ADL297Wp"
                     /protein_id="NP_983799.1"
                     /db_xref="GeneID:4619934"
                     /translation="MQTLYKLKNQSQFQSSESTGSTGSFLASAPVELTTVNGYNDFLK
                     SHKSKRTSTLFNDDCSRGYVMMDDKVLATITGEARDYLLELFGSP"
     gene            complement(<181341..>182246)
                     /locus_tag="AGOS_ADL296C"
                     /old_locus_tag="ADL296C"
                     /db_xref="GeneID:4619935"
     mRNA            complement(<181341..>182246)
                     /locus_tag="AGOS_ADL296C"
                     /old_locus_tag="ADL296C"
                     /product="ADL296Cp"
                     /transcript_id="NM_209153.1"
                     /db_xref="GeneID:4619935"
     CDS             complement(181341..182246)
                     /locus_tag="AGOS_ADL296C"
                     /old_locus_tag="ADL296C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL033C (RIB1)"
                     /codon_start=1
                     /product="ADL296Cp"
                     /protein_id="NP_983800.1"
                     /db_xref="GeneID:4619935"
                     /translation="MTEYTVPEVTCVARARIPTVQGTDVFLHLYHNSIDSKEHLAIVF
                     GENIRSRSLFRYRKDDTQQARMVRGAYVGQLYPGRTEADADRRQGLELRFDETGQLVV
                     ERATTWTREPTLVRLHSECYTGETAWSARCDCGEQFDQAGKLMAAATEGEVVGGAGHG
                     VIVYLRQEGRGIGLGEKLKAYNLQDLGADTVQANELLNHPADARDFSLGRAILLDLGI
                     EDIRLLTNNPDKVQQVHCPPALRCIERVPMVPLSWTQPTQGVRSRELDGYLRAKVERM
                     GHMLQRPLVLHTSAAAELPRANTHI"
     gene            <182496..>183287
                     /locus_tag="AGOS_ADL295W"
                     /old_locus_tag="ADL295W"
                     /db_xref="GeneID:4619936"
     mRNA            <182496..>183287
                     /locus_tag="AGOS_ADL295W"
                     /old_locus_tag="ADL295W"
                     /product="ADL295Wp"
                     /transcript_id="NM_209154.1"
                     /db_xref="GeneID:4619936"
     CDS             182496..183287
                     /locus_tag="AGOS_ADL295W"
                     /old_locus_tag="ADL295W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL111C (RRP42)"
                     /codon_start=1
                     /product="ADL295Wp"
                     /protein_id="NP_983801.1"
                     /db_xref="GeneID:4619936"
                     /translation="MMLSVTEQLYLIDSLKAIPPIRADGRAAAQFRPLDVAVDFLPNS
                     NGSARIITSDGSEALVSVKSKVVDHTVTSELIVVDVDITGQREDSPEVSSMASLVRRI
                     LAANVDAGALRLTKKYSFQLSVDVLVLCSQSYPVSLISFSIYAALKTTQLPKLVSGYD
                     DLEVEELPLFHDHDLEPLAVEVPLLFTVAVVGDNVLVDPSAEEAGVSSAGLLLTWHGG
                     RVAAPLRSIGISEHFCSGFQIAHLLKAIELVKAHAPAVARALYNL"
     gene            complement(<183331..>187449)
                     /locus_tag="AGOS_ADL294C"
                     /old_locus_tag="ADL294C"
                     /db_xref="GeneID:4619937"
     mRNA            complement(<183331..>187449)
                     /locus_tag="AGOS_ADL294C"
                     /old_locus_tag="ADL294C"
                     /product="ADL294Cp"
                     /transcript_id="NM_209155.2"
                     /db_xref="GeneID:4619937"
     CDS             complement(183331..187449)
                     /locus_tag="AGOS_ADL294C"
                     /old_locus_tag="ADL294C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL112W (TRM3)"
                     /codon_start=1
                     /product="ADL294Cp"
                     /protein_id="NP_983802.2"
                     /db_xref="GeneID:4619937"
                     /translation="MLQDRDRNMPSHEPRSSSSSITSDRVADLLSCADFRTCYEELSV
                     LSSADRESALAPCCGSLVGAVRSWPGSENEASTAEALGRLCGLARGAWKQFGEALQVE
                     IEALFPEQTSAASIEPADAARCDACVSFLVGFGAANERRAVAVSGDAIAPWSAVLGRL
                     LTLHAGSEEYGAQAAAALRHNVDSIVTCACENDELDGRLWALVLRAPEPTPRTWAFPE
                     RMKLLLRFLARGKLTPRLREEMCGEAYSGAVLRALGSSVHEERKVGLSVLKLTLHLLP
                     EGAGFGARHAVEHTALLEMWRRFVTCYEIVALDTALNQLEAASADVLTLFESDLERGW
                     PQVVILTGLHATMESVRKFCLELMFRVRDRSAFDIAALPVLLGAALQAPNFVVAGGRC
                     VFGEKLSAFVRDVLLAAGVDECADARLSDGVLAVLRTFERDAYSFDAARIYVSHGVLL
                     ALRAHNGCVLTDEHLRLVRLVLSAAGEEPVFDSTLQALWLEISLFAGPSSTLPCLFGV
                     LGSHAARYGYGLLVPLLSQYRTFLAPYDKTALAGCNEVLVYLAYGVEPESVTQEFLVG
                     IAKAGKSKAFQAHYESFIQQLANLSLKEACSECDILVSDGCVDQMIYTQIDLRPVFGE
                     LLYQFNLGRLQFFVAVFRRAVAANNVKLVLTADDLAALYAHLKSQFKVGAVRLKDSSY
                     AAFFQLAREVLTQRLNAQEGASDVVDVILSLAESNVSADNDNYMANLQITNVLQYIMD
                     NGIALCIDLCAVFVEKLVAITDSIWQSLLGERLVLNQKDLHLGIIKTLFHAVVLKDAT
                     DDSELSSVLRDCGQDFIRQAASRRSLLPCLTLSIKTFLLGQPSDADRYMWLTELLISV
                     FVHTHENVNVFKLKPVVAELFDKHFTLVEAENGLYQHIYGIEEISTKVHVISALIGAP
                     AGFRRGVVEQLLQNDSNLLKPNKRTNGPEEIERLGKWQLLLLSMKSIENDMLILYVSD
                     HILPNLFEEPSPLVRIYSEWIVAHSLFCSYYNRDVDKLEGTLIAAAKNQTRPAVVVSA
                     QKILYLTLVALKRICVPFRLLNMFISVLVPNCASNKPLIRHFSNSLILSLWPEFRAIL
                     TGDTVCGIMENLFSEAKKTQSKGQYRAGDANIWDLHDDFNLTSIFGGVVMKVTDHCVP
                     YISSAYFTRYLDSTTSIPVGVDESKKWLSKRKRQIQEERSVETKRDSPLQTKSGTWET
                     VLDFDSNTPQDAVKRSDLIVVASLVDKPPNLGGICRLSDVLGVGLMTVHDLRVKSHPQ
                     FKNVAVTADRWMPIEEVAVADIASFMRQKKLEGYTLIGLEQTDKSVRLDAAFHFPRKS
                     LILLGTEAEGIPGYLLVELDMCLEIKQHGVIRSMNIQTATAVVVHSYAVQHM"
     gene            <187682..>189415
                     /locus_tag="AGOS_ADL293W"
                     /old_locus_tag="ADL293W"
                     /db_xref="GeneID:4619938"
     mRNA            <187682..>189415
                     /locus_tag="AGOS_ADL293W"
                     /old_locus_tag="ADL293W"
                     /product="ADL293Wp"
                     /transcript_id="NM_209156.1"
                     /db_xref="GeneID:4619938"
     CDS             187682..189415
                     /locus_tag="AGOS_ADL293W"
                     /old_locus_tag="ADL293W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL113C (ATG20)"
                     /codon_start=1
                     /product="ADL293Wp"
                     /protein_id="NP_983803.1"
                     /db_xref="GeneID:4619938"
                     /translation="MTEQSEHSNGGVCASSIQPARNGGLCGHGGVGGVGEAEGDPVHT
                     QIIQEDNPFVEHGQSYVAPHSGGGRTSSGSSSSASLQEGLLAPPLAKSSAGEQGRVRI
                     LEASKVSEGQGRSYITYTISYRDRVVRRRYSEFESLRKILIKLFPMTLIPPIPEKQSL
                     TSYGKSIAGSNANYVLPSEAAGCDLAVSVINGSVNLNDQKMIRHRIRMLTSFLNRLLQ
                     NEEVTKTSIIGDFLDPNNANWNDVITTSATISSLPKSVLQCNPLDPTNTTPAHASLPI
                     PPLSSAPQLMGKDGVGTSTKPSAEDMEFSRIEYEYKKYEQLLHTGVYKYNRRITRTMH
                     ELKQDLADLSEAFAEFAVEQSKGGDLAELLSYLSNANDEAAAVLDDLVGKIYYNINEP
                     LSEAVHIAGAARELIQYRRLKFAQRDMLKKSLLGKEGHLKRLQEQEDDAKAIDQLVDQ
                     HLGEGTRINLQRPSEASPNTYKRKLFSRFNKLANIVKETVTYQEQDPKVNIKTVQEDI
                     EQIKESLDVSASDLDVITATIRDVQLPAFSRNRDKELYDILKNYSKYMKEYAAKNLEI
                     WKDLRKQEENA"
     gene            complement(<189551..>190540)
                     /locus_tag="AGOS_ADL292C"
                     /old_locus_tag="ADL292C"
                     /db_xref="GeneID:4619939"
     mRNA            complement(<189551..>190540)
                     /locus_tag="AGOS_ADL292C"
                     /old_locus_tag="ADL292C"
                     /product="ADL292Cp"
                     /transcript_id="NM_209157.1"
                     /db_xref="GeneID:4619939"
     CDS             complement(189551..190540)
                     /locus_tag="AGOS_ADL292C"
                     /old_locus_tag="ADL292C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL114W"
                     /codon_start=1
                     /product="ADL292Cp"
                     /protein_id="NP_983804.1"
                     /db_xref="GeneID:4619939"
                     /translation="MKVSTRRNDVDSRGRMSRLPVRRDIAAALYTSLIPRWRSVAEKV
                     VESAMPIVGVQLDPKRDIALVTGGAGGLGKEIVRELRRRQIVTVILDVVPPPDLESLT
                     GVHFYACDISLPGRIRVIHENIIRDVGHVTILINNAAITSDLPLDRVDNDKIEQIIRV
                     NLLGPYTLIREFLPSMIAIDRGYIVNIASVLGFVTPARLTAYGASKGGLIALHESLVD
                     ELEQYTWKDSSNPGYVPLLKSRGVIRSLLVCPGKLTTKMFDNARSPSKIIAPDLDPEY
                     LAKQIVNAMECNRSGTLKLPYYTNMMCYFKSLNWPWFRLFRLTAGVDAIIAAK"
     gene            <190758..>191732
                     /locus_tag="AGOS_ADL291W"
                     /old_locus_tag="ADL291W"
                     /db_xref="GeneID:4619940"
     mRNA            <190758..>191732
                     /locus_tag="AGOS_ADL291W"
                     /old_locus_tag="ADL291W"
                     /product="ADL291Wp"
                     /transcript_id="NM_209158.2"
                     /db_xref="GeneID:4619940"
     CDS             190758..191732
                     /locus_tag="AGOS_ADL291W"
                     /old_locus_tag="ADL291W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL115C (IWR1)"
                     /codon_start=1
                     /product="ADL291Wp"
                     /protein_id="NP_983805.2"
                     /db_xref="GeneID:4619940"
                     /translation="MDQAPEVIRVKRRRDEDSMQALLLEESRLNKKGKYVFKLARTVE
                     LQGSNEETPLLKLAASERNVYVLEQQKQTQKCLPEEISEMLEEYLRLETKATASEHKR
                     PSKRRASQLPVAQLPSMEFVYDIYIRENLPEDEFVWDKNTVGYIRIVEDNGALVPEQD
                     ASADTQQLSDDEDSNEEDYYRNDYPEDEDDDRSILFGSDLEQEAPMANPLQSPVSEIA
                     ELITEAGSEDIYDPLFESLGAEPNLLSSLNSNNYVDLDVDALSSASDREDASNGRTFG
                     TDNDDLHTDSSFERHNLFPGEEDDPMAIHRDKVLGKLQRILNGANGRV"
     gene            <191996..>192571
                     /locus_tag="AGOS_ADL290W"
                     /old_locus_tag="ADL290W"
                     /db_xref="GeneID:4619941"
     mRNA            <191996..>192571
                     /locus_tag="AGOS_ADL290W"
                     /old_locus_tag="ADL290W"
                     /product="60S ribosomal protein L9"
                     /transcript_id="NM_209159.1"
                     /db_xref="GeneID:4619941"
     CDS             191996..192571
                     /locus_tag="AGOS_ADL290W"
                     /old_locus_tag="ADL290W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YNL067W (RPL9B) and Syntenic homolog of Saccharomyces
                     cerevisiae YGL147C (RPL9A)"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="NP_983806.1"
                     /db_xref="GeneID:4619941"
                     /translation="MKYIQTDQVLDIPEGVTVNIKSRVIKVTGPRGTLEKNLKHIDVT
                     FTKVSNKQITITVHNGDRKHVAALRTVKSLISNMITGVTKGYKYKMRYVYAHFPINVN
                     VVEKDGEKFIEIRNYLGDKRVRAVPVREGVSVEFSTNQKDEIVLSGTSIENVSQNAAD
                     IQQICRARNKDIRKFLDGIYVSEKGVIAEEA"
     gene            complement(<192733..>194913)
                     /locus_tag="AGOS_ADL289C"
                     /old_locus_tag="ADL289C"
                     /db_xref="GeneID:4619942"
     mRNA            complement(<192733..>194913)
                     /locus_tag="AGOS_ADL289C"
                     /old_locus_tag="ADL289C"
                     /product="ADL289Cp"
                     /transcript_id="NM_209160.1"
                     /db_xref="GeneID:4619942"
     CDS             complement(192733..194913)
                     /locus_tag="AGOS_ADL289C"
                     /old_locus_tag="ADL289C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL116W (NUP84)"
                     /codon_start=1
                     /product="ADL289Cp"
                     /protein_id="NP_983807.1"
                     /db_xref="GeneID:4619942"
                     /translation="MSGTRTSSQQILKEFASVVTEFQRSLIAGTDNQDPLQLVQEFRS
                     IAGEAALVCAEETEDQRDRTQFVNFELEAKLWYLVELLVSFRTSDAPMDDIELHDYNS
                     NAVFKKAQLQEDPELYVVWLIIAWIQENLTVSPRPAELPTTKWSNTLLAGGLKSSDLD
                     CPLREEGVQIHPKDNQDDHCFYKYMYELILAGKYEEVRRECEYSDNLTLGMIMCGLED
                     YVDPRIDLELAGDYEGHQGIKKRALWRRAVYALSRNPNLDKYEAAIYAFLSGTIPQDI
                     DEQQLDWERMLLVYLNQIWNIKIENYLLEKERINKEELIEQMPSQPLSLSAVLNIVAS
                     KHVEESEHPIRVLMGAVILNTISPAVKSFIDMLLDAVKGVDQENDLLSEPYILRILTH
                     LVIFLDKACPGVIEEGDKSKLVTTYVSLLNLYEQYDLVPVYISCLDEQDIMEAYSFFL
                     SNLVGDSSRERQLELCYFFQLPTANILKRTAQRIFNDTEPHYNLADTVTMNSEVTDID
                     LHLISAVDWLMKGRLHVDAVESIIALCRRFLANGKVNSLSTFFEQHNMDDLIKNYELD
                     QLSAKEEYPEDRFVQEIGQYTKLITGFRQYKNWENSSHTVSSSKNTSALLQQFQAFAS
                     TLRGLVTEFLVELTEHTDMPSEDRDMLYNIRSLYTPYLLIELHNSYTSTAEKLGVPSF
                     LQEAVNLSTMVANETDKIYLLFQNSGKLKEYLHLVAKAVALIGH"
     gene            complement(<195137..>197914)
                     /locus_tag="AGOS_ADL288C"
                     /old_locus_tag="ADL288C"
                     /db_xref="GeneID:4619943"
     mRNA            complement(<195137..>197914)
                     /locus_tag="AGOS_ADL288C"
                     /old_locus_tag="ADL288C"
                     /product="ADL288Cp"
                     /transcript_id="NM_209161.1"
                     /db_xref="GeneID:4619943"
     CDS             complement(195137..197914)
                     /locus_tag="AGOS_ADL288C"
                     /old_locus_tag="ADL288C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL117W (CYK3)"
                     /codon_start=1
                     /product="ADL288Cp"
                     /protein_id="NP_983808.1"
                     /db_xref="GeneID:4619943"
                     /translation="MQESLPKAPFKVKAVYSWSGEHEQDLGFLESDIIEVTKVKGNWL
                     YGRLLRNKKSGYFPVNYVQVLYEVPNGYIERSPAEPRTQRPPTPPTVSAPAVLLPAMP
                     TRSPKSMEKGDLYGHGPHSPALTPAESPRRRMHLEPGMRAGSRLPITHLPKSHSTNML
                     VPRIEYPVRAPRLRSGKLTPGPEPAKRASSSECSSNTGTTFSRRARSKSDLPPLPPIP
                     PIPNVTLNVDTEYALDFGHPHTAELATDAPNNNDNHNKLRERHGVYNGEYPTTRSYND
                     LAIARSPQRHTPRNDGYSSSYGSNYEGYEGYSSGYSDGYAQNQISQSRFLEDSLGMSE
                     DSYCLMSDFSATSAGSFARHRFARSFADSTEEDNYPSSPRDISSPSKVSGVFRKFLGS
                     GYQLTGNHSSINIKGGLPKLPDLHNLNIADDEGSHWLQAQCHLHRSNTLSAKEKRERE
                     RRVLYENSDVVLRPQDYINEEINTNDVYHSHKPGLVDIELKSMDLENVDYRTRRRCQQ
                     TGPFTVESFAHYNFRSGYRSPIEQLRGIFTFCTEFFRLIDDGGKTDFNSTPTNLDSVL
                     HSLCCTPYELTWIFKKMANSLGIQCDLVVGLLKTPNADNMTFRFNHCWLRVLVADEMR
                     FVDVILGNVTNPLHEYINNKKQVQGEDFYFLIQPLHLIYTHVPYLYEEQHIVPAIDRC
                     IAMCLPVVFPSFFKNDLRLYKYSLGLCELLDSEIFECSIKVPSDVELVSSVVPEGSAA
                     ARCRNLNLSLVQYKLHKRDRIALIKAVLPPGLSAGTLHIHSGIRGLHDDAMPPLSMIV
                     PLTHSGTSKEYEFVARFPCPDAQKIDMYIKEPQNKYLFSGTEYTFQIICSPADGLTHD
                     PYDAQAAAPNVIVVQSPSGKIYRLKKAESDVEFGVCEARLKVHEPGVWLALITSEAGA
                     GWCTFAKWICV"
     gene            complement(<198440..>199570)
                     /locus_tag="AGOS_ADL287C"
                     /old_locus_tag="ADL287C"
                     /db_xref="GeneID:4619944"
     mRNA            complement(<198440..>199570)
                     /locus_tag="AGOS_ADL287C"
                     /old_locus_tag="ADL287C"
                     /product="ADL287Cp"
                     /transcript_id="NM_209162.2"
                     /db_xref="GeneID:4619944"
     CDS             complement(198440..199570)
                     /locus_tag="AGOS_ADL287C"
                     /old_locus_tag="ADL287C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL148W (ARO2)"
                     /codon_start=1
                     /product="ADL287Cp"
                     /protein_id="NP_983809.2"
                     /db_xref="GeneID:4619944"
                     /translation="MSSFGQVFRVTTYGESHCKSVGCIVEGVPPGLSLTEEDIQPQLT
                     RRRPGQSKLSTPRNEKDRVEIQSGTEFGRTLGTPIGMLVKNEDQRPHDYGDMDDFPRP
                     SHADFTYIEKYGIKASSGGGRSSARETIGRVAAGAIADKFLQQACGVEIVAFVSQIGS
                     VRMNRDPFDPKFLQLLNTITREQVDATGPIRCPDASVAGAMVEEIERHRGDKDSIGGV
                     VTCVVRNVPTGLGEPCFDKLEAKLAHAMLSIPASKGFEIGSGFAGVALPGSKHNDPFF
                     FDEDSNRLRTRTNNSGGVQGGISNGEHIYFSVPFKSAATISQAQATATYAGADGVLAA
                     KGRHDPSVTPRATPIVEAMTALVLADAFLLQKAREAARAIVS"
     gene            <200120..>202138
                     /locus_tag="AGOS_ADL286W"
                     /old_locus_tag="ADL286W"
                     /db_xref="GeneID:4619945"
     mRNA            <200120..>202138
                     /locus_tag="AGOS_ADL286W"
                     /old_locus_tag="ADL286W"
                     /product="ADL286Wp"
                     /transcript_id="NM_209163.1"
                     /db_xref="GeneID:4619945"
     CDS             200120..202138
                     /locus_tag="AGOS_ADL286W"
                     /old_locus_tag="ADL286W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL145W (TIP20)"
                     /codon_start=1
                     /product="ADL286Wp"
                     /protein_id="NP_983810.1"
                     /db_xref="GeneID:4619945"
                     /translation="MNSVEDLLQLQPKIDALEKERDDIARKVQAVARTEGEQVDDFEA
                     LNSKLAGIAEEISGARTLEDVQRLRDNYGELAILDRAETLLREREAGERRAQNACTLA
                     AVTEKLGRAAELDYCDLEALHAELEPLARSADAAPQVEQFNELLTERARVPRRDLEHE
                     LLERRCDTELFVSTDDSVHELREKAGLLFQLSQLLLPEPRADQLWNFVCMANNFRIKF
                     IYHFTSPSAESEQQSIENYFKFLDKYLSENLYKYMDIFEDESKGITRTLIHKQFINHI
                     LEPVREKVNVTMTKIAASNSASDVKMLVLLISEIFITDNALKKSHYYDGVGLVSLIDE
                     AALEVWQNFEVESAVSQFEKLTTPGASLMSPKNGADFGKLLENMYRYLEPFFSIDYRN
                     LFSVKYQLVDEIFIQLPLKYRSFLLSKNILQNELTAEQQFENTCVKLHSLLLISNILV
                     RFSHDFTFIEMTQQINKITDSDYEYIFDEVWESYDEAVIVLRDSIVHRWVKGLSSSLR
                     NYFKYNEWDSIATAPEQCSAELVGALAWMKKMTDIFDKYWYPQHIIAQIKVALLENII
                     KFMLNYVVKLNKFSENGLRQLTFDYEALRATLGLPLEHSSVAEELALFEYFNILSMKY
                     TNNKITSKFLDAEYVSSHHTRNFRELRESLQVSHLTSDEIADALYRTL"
     gene            complement(<202161..>204095)
                     /locus_tag="AGOS_ADL285C"
                     /old_locus_tag="ADL285C"
                     /db_xref="GeneID:4619946"
     mRNA            complement(<202161..>204095)
                     /locus_tag="AGOS_ADL285C"
                     /old_locus_tag="ADL285C"
                     /product="ADL285Cp"
                     /transcript_id="NM_209164.1"
                     /db_xref="GeneID:4619946"
     CDS             complement(202161..204095)
                     /locus_tag="AGOS_ADL285C"
                     /old_locus_tag="ADL285C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL144C (ROG1) and YDL109C"
                     /codon_start=1
                     /product="ADL285Cp"
                     /protein_id="NP_983811.1"
                     /db_xref="GeneID:4619946"
                     /translation="MGTEPAREVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLS
                     SLWLKVKNVSSLTYRAAYLMGPYMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHE
                     FLAELSLHRLQKRYVWLLDVVSQIIFTTNSVVPFEVTIASAKPALEDTATLAPQAGSF
                     NRRLTVNRQTTLDLWNLPQQVFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQ
                     YYPNEHIVVKGFGDNVCKTEKGIKYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQ
                     TFAIAYIAINYPWFFEKVDPVNFVALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLG
                     LQAHQGDDQPLLCSLPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSALLYLDYDSIL
                     KQLDTQEYQVDKQDFFTKTLINPLVKAINVLMPQTQSSSSIPKVSMFDSAMSVLLPPL
                     PEKSYLMNPSGDPSVILHDKMYSEADIPEVGQPPEKNIWSSLLLNIGNNEEYKQLEEE
                     IAKKWHKGMTWRKVIVHLKPDAHNNIIVRRRFANAYGWPVIDHLVQNHFNGSDYPYTE
                     GETEEAALDELIEQEKKWINRPHNETFFDVGPTGMISSVGEILENIKNSAFQKTASAS
                     SLKPSDSFDDDEIFRLNGLY"
     gene            complement(<204330..>205523)
                     /locus_tag="AGOS_ADL284C"
                     /old_locus_tag="ADL284C"
                     /db_xref="GeneID:4619947"
     mRNA            complement(<204330..>205523)
                     /locus_tag="AGOS_ADL284C"
                     /old_locus_tag="ADL284C"
                     /product="ADL284Cp"
                     /transcript_id="NM_209165.2"
                     /db_xref="GeneID:4619947"
     CDS             complement(204330..205523)
                     /locus_tag="AGOS_ADL284C"
                     /old_locus_tag="ADL284C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL143C (MRF1)"
                     /codon_start=1
                     /product="ADL284Cp"
                     /protein_id="NP_983812.2"
                     /db_xref="GeneID:4619947"
                     /translation="MALRFGRLLLLGRALPVSVRCYSQAEGFRELHPSLIKRATGYAA
                     ELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQDNVHMYRELQDMIAQDASLRT
                     EAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELRPGVGGIEAMIFTQDLLNM
                     YIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRLKFESGVHRVQRIPATE
                     SKGRTHTSTAAVVVLPKMAEEAESDAYERTFKPGEIRIDVMRASGKGGQHVNTTDSAV
                     RITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLERKEREARERSARKDQVSSTD
                     RSDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDSEQKAKLLLKE
                     MESTT"
     gene            <205622..>206594
                     /locus_tag="AGOS_ADL283W"
                     /old_locus_tag="ADL283W"
                     /db_xref="GeneID:4619948"
     mRNA            join(<205622..205646,205699..>206594)
                     /locus_tag="AGOS_ADL283W"
                     /old_locus_tag="ADL283W"
                     /product="ADL283Wp"
                     /transcript_id="NM_209166.1"
                     /db_xref="GeneID:4619948"
     CDS             join(205622..205646,205699..206594)
                     /locus_tag="AGOS_ADL283W"
                     /old_locus_tag="ADL283W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL108W (KIN28); 1-intron"
                     /codon_start=1
                     /product="ADL283Wp"
                     /protein_id="NP_983813.1"
                     /db_xref="GeneID:4619948"
                     /translation="MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKD
                     GLDMSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQ
                     ADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFM
                     TSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFR
                     ALGTPTDKDWPEVSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHK
                     RWDTTRCLLSQYFVELPEATPPTELPKLNK"
     gene            <206760..>207878
                     /locus_tag="AGOS_ADL282W"
                     /old_locus_tag="ADL282W"
                     /db_xref="GeneID:4619949"
     mRNA            <206760..>207878
                     /locus_tag="AGOS_ADL282W"
                     /old_locus_tag="ADL282W"
                     /product="ADL282Wp"
                     /transcript_id="NM_209167.1"
                     /db_xref="GeneID:4619949"
     CDS             206760..207878
                     /locus_tag="AGOS_ADL282W"
                     /old_locus_tag="ADL282W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL107W (MSS2)"
                     /codon_start=1
                     /product="ADL282Wp"
                     /protein_id="NP_983814.1"
                     /db_xref="GeneID:4619949"
                     /translation="MLTPMTNPLRLIGAGCRFLSTNNRPPLHKIFPSKKLVNRMLFDL
                     DSRLTFRKLLPVYEQVYTQLDSSTGDLVVPRGVRAHDVMIMKKVLEKTRRRTKSSNRH
                     LLALENELLYMAAQMGHKDAAALLAFDTLCNPASQTAADMEYAKLMVKDFYRSGHPLT
                     LKLTGDLSLANGDNTTAEEYYMKFLKKEADTFLAGEVYGQLGRISFLRSHFAQAEERF
                     LQAIKLTPLEYSVQSYFYLGQLYMNSDPLKARSLLESAASQGFKESFKTLGHLEMNYF
                     CDLTKAREWFKLGMELGELECMIGCFDCAITLGDLALAHRASKSLEALAKTDKIYQAL
                     YTQFADYRHEKLSLLEEYKAEKALDVSGSIYAAENREK"
     gene            complement(<207899..>209686)
                     /locus_tag="AGOS_ADL281C"
                     /old_locus_tag="ADL281C"
                     /db_xref="GeneID:4619950"
     mRNA            complement(<207899..>209686)
                     /locus_tag="AGOS_ADL281C"
                     /old_locus_tag="ADL281C"
                     /product="ADL281Cp"
                     /transcript_id="NM_209168.1"
                     /db_xref="GeneID:4619950"
     CDS             complement(207899..209686)
                     /locus_tag="AGOS_ADL281C"
                     /old_locus_tag="ADL281C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL142C (GPI10)"
                     /codon_start=1
                     /product="ADL281Cp"
                     /protein_id="NP_983815.1"
                     /db_xref="GeneID:4619950"
                     /translation="MKERSILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGY
                     GGLTWEWQHGLRSYAFPMLFEMSYYVAWILGVATRMALQGLAHATALCGAVVPSGAAG
                     VAAMKAVWELPEAAQELVEYYGVLYGPRVVMAAVAACGEFYSVLLVRKLYLRVADKGD
                     DQKGDAAPVSRLALMLTMTNFFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSL
                     GFSASLAVAAFACLQRPTNVLIWAVLGLFLVLNLVRSRRWQLLLTLVAKVAAAGALAV
                     CANIAIDYYFYGGVLLPLLRFIEFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFF
                     VGALLTHNFRRGNAGLLGSPIMQIKCVVVLNIALYSCIDHKEFRFLYPLQPLFLSLSA
                     LEMHTWLQHHHARGTAWLKRVQSLLYVLPVLSITAALVLNTAHEAGVVSVMDYLHSAV
                     PSAESIGFIMPCHSTPWQSHLHRNDLGKLWAISCQPPLDLLHQEDAGDQLLTYMDESD
                     HLYENIPEFIHKNFPPVFRRDLRSPGRQYAYEWPEFLVVFEHMDEAFMKEYLKDSNYV
                     EVKRFFNTLSHWDSRRAGDVIVYHKSPWY"
     gene            <209800..>212601
                     /locus_tag="AGOS_ADL280W"
                     /old_locus_tag="ADL280W"
                     /db_xref="GeneID:4619951"
     mRNA            <209800..>212601
                     /locus_tag="AGOS_ADL280W"
                     /old_locus_tag="ADL280W"
                     /product="ADL280Wp"
                     /transcript_id="NM_209169.1"
                     /db_xref="GeneID:4619951"
     CDS             209800..212601
                     /locus_tag="AGOS_ADL280W"
                     /old_locus_tag="ADL280W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL141W (HUL5)"
                     /codon_start=1
                     /product="ADL280Wp"
                     /protein_id="NP_983816.1"
                     /db_xref="GeneID:4619951"
                     /translation="MLNFSGSTKRRNVNLGSSKKINKSELIEKARLERERRAQEKRIQ
                     ESTLCIQRCARRWTARRRVLGSLDGVAAREYGTQILVAFGAGILHYARGDAVAAVVEA
                     CSVDSATAYWRCTELLEQVARGGETGLVRQLLDKLNAAGARPLTDAGAAPGGRLQRIE
                     RLVGARLRVLEAMRGELTRRDMNALLAVVPSGGEMRGDEAVQWAALYGVEQARVRVRA
                     NLLCYLRELAQRLSPEVVLQQGPCSVDTIYYLTYLFAERLGRDPDAIYAVLCACIDQH
                     KSFEFDSGSFFFQYVEGIYSYRTASLLAGYLRTHSVPTASQYAKVFLDRAPSPRQAEV
                     LLLGIVADADAMQRLVQECKTSGAVTSASFSLLTECLDIYLSYVNDTVLLGPKSNFPL
                     EDLVVFCNLVRDAISQALRAEHDYEVNKMRRALSLLQKLYIRDRRTNFLSAAKGDDFW
                     VIADTTVKNCDITSLLLYFDEFYREQLDLFLAQGRARHEVPSGDLVAWENDIKVKFFS
                     EKSSKHASWGSLALRKFELVLRAPFLLPFRERVAYFETLIHHDRRRLQGRHTGPALRL
                     PDLYFPSSRRQRAIISRNNILEDAYEAYNPLGEDFKDQLAVTFINEFGPEAGIDGGGI
                     TKEFLTSVSDEGFNKDKYRLFKANSVYELYPSDAATSPQQLQYLHFLGKVLGKCLYEK
                     VLIDVHFADFFLHKLLSTSKNMACSFDNLPSFDRELYDNLNKLFDMSTAELQLLDLRM
                     EIVDENTMKIVELVPGGSQIPVTTTNVRQYALAVASYRMNSQLARATFYFQTGMAVII
                     PPHWIAIFSSSELSKLISGGGRDIDLADLRANVTYGGYVESDPTIQHLWQLLLEFTPE
                     QRCKFIKFATSVPRAPLLGFQMLNPKFGIRNAGTDYNRLPTASTCVNLLKLPDYQDKD
                     LLREKLLYAINSEARFDLS"
     gene            <212848..>214329
                     /locus_tag="AGOS_ADL279W"
                     /old_locus_tag="ADL279W"
                     /db_xref="GeneID:4619952"
     mRNA            <212848..>214329
                     /locus_tag="AGOS_ADL279W"
                     /old_locus_tag="ADL279W"
                     /product="ADL279Wp"
                     /transcript_id="NM_209170.1"
                     /db_xref="GeneID:4619952"
     CDS             212848..214329
                     /locus_tag="AGOS_ADL279W"
                     /old_locus_tag="ADL279W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR171C (EAR1)"
                     /codon_start=1
                     /product="ADL279Wp"
                     /protein_id="NP_983817.1"
                     /db_xref="GeneID:4619952"
                     /translation="MFNIAIWFLVRGARGMPVTLQRVARRSATVFPDDNELDMDFVLF
                     TFSLVFMLLCYGMMVLIYLGLRYVVRRCFTRRIALSSSDSSRANSGDVPTVLDDELEV
                     RHKLAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPADVFDPVINDQTLR
                     YIEEEGAQAWEFQPSPSLPPDFVKVENRTELTFMNSNSDVSVATNLPIPLANKVYYFE
                     CKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSNGARRLNNS
                     FKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKYLY
                     PIVGANVPCKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAYEDYDRDVLLESSY
                     EDEVSEGETNSFVEHLHDGHLLPPPPGFEFSTTPTSNCDQFTLNTLPTEPPGYMSDVN
                     AGSKHNGRGVGRSENVQSDAPNAELLNANTFANQFINDSSPKR"
     gene            complement(<214634..>216277)
                     /locus_tag="AGOS_ADL278C"
                     /old_locus_tag="ADL278C"
                     /db_xref="GeneID:4619953"
     mRNA            complement(<214634..>216277)
                     /locus_tag="AGOS_ADL278C"
                     /old_locus_tag="ADL278C"
                     /product="ADL278Cp"
                     /transcript_id="NM_209171.2"
                     /db_xref="GeneID:4619953"
     CDS             complement(214634..216277)
                     /locus_tag="AGOS_ADL278C"
                     /old_locus_tag="ADL278C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR205C (GEP3)"
                     /codon_start=1
                     /product="ADL278Cp"
                     /protein_id="NP_983818.2"
                     /db_xref="GeneID:4619953"
                     /translation="MLRRSLSVVFGRRTIACKSCGIELQNKIKDGPGYFVTPQKAIRP
                     AAKQLELAKQLLYGERLRIEKQLTGPDRNTLEKWKELVPPSCKRCMDALHHNRYDTAE
                     FPEHTLEDVGKGVPRDAVVYHIAPLWQFPMGLDRRVLQSSKKVCVLFSKIDMVVQRPS
                     HMPQDVGAFFQSLLYHDLHVKITNFRFFSALKQWNIQTVRNALSKESYLLGGPNAGKS
                     SLINALMRTVVYESRRLVSSKQSSATPADLPPKAHLDIHSAGVSTIPNFTRQPQQYDI
                     KGKIIHDVPGYRTSKSHTFDFNSMIQKDYLLRLRKSDSKTYLTKKYTSINGTESGRCY
                     TVGGLFYYVPPAQTINQVTRYMPGDPQKFQSIDKGLEVVRDVYSDRWDKETGSHPLAE
                     YIHVNPALGDKNSFVRHVIPPFQGTIEIVMRDVGYLRVVATGSFKFLGLHEIWVPKGI
                     EVSVREPLTDVFRTTIEAYRDSGSVANVAQMIIKRPYISSTYPMAHNETDPLAKMREM
                     YLERTASNLSARRLMNRDPLELISQKQKERVNLYWHYCW"
     gene            <216506..>218590
                     /locus_tag="AGOS_ADL277W"
                     /old_locus_tag="ADL277W"
                     /db_xref="GeneID:4619954"
     mRNA            <216506..>218590
                     /locus_tag="AGOS_ADL277W"
                     /old_locus_tag="ADL277W"
                     /product="ADL277Wp"
                     /transcript_id="NM_209172.1"
                     /db_xref="GeneID:4619954"
     CDS             216506..218590
                     /locus_tag="AGOS_ADL277W"
                     /old_locus_tag="ADL277W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR206W (NOC2)"
                     /codon_start=1
                     /product="ADL277Wp"
                     /protein_id="NP_983819.1"
                     /db_xref="GeneID:4619954"
                     /translation="MGKVSKATKKFQSKHLKHTLDHRKQLKQHNQKIKGRRGNKSEDE
                     KRALALSKEEQKIKKSTKEEVFKDMSVEKFFEGGFELPKADKKLKQAAQKPDDDGDES
                     SEEEDMEQNMAELAEKDPDFYKYLQENDKELLGFGASNPLDAMSDDEDEEGQSTRGND
                     DAEEGDEKVVVSYKLVSQWRKGLAENPTPKLIRNVCSAFKAAVNANQDAAADLYKFAV
                     TDEKAFHELMFVALKDIPQAVQKLAAYKVNKGVRTLPSNSTVSRLSSIMKSHAGSLLT
                     LLHDITNTDTAVLVLHSTDQLMPYFLSYRKVLKDIVSAIVEVWSTTQDVETQAAAFAF
                     ITNAAREFKKSLLELVLKTTYSSFIKFCRKTNVHTMHLINFQKNSAAALFGIDATVSY
                     NIGFEYIRQLAIHLRNSINATTKKTAKSSPADAYKIVYNWQFCHSLDFWSRVLALQCS
                     PENDRTQDSPLRQLIYPLVQVTLGTLRLIPTAQFFPLRFYLTRSLLRISQHTGVYIPI
                     YPLLSEILSSTAFTKAAKKSTLTAFDFDHNIKCNKAYLGTKIYQNGLIEQFVELLAEF
                     YVIYAKNISFPELISPAVVALRRYIKSSKNMKFNKMLSVVIEKLNQNADFILDKRAGV
                     DFGPKNKAEVDRFLADLPLDATPLGKYVSVQREIKEERARIMRESLEEDDKKSDDEGD
                     LSIPDAPSSEED"
     gene            <218754..>219461
                     /locus_tag="AGOS_ADL276W"
                     /old_locus_tag="ADL276W"
                     /db_xref="GeneID:4619955"
     mRNA            <218754..>219461
                     /locus_tag="AGOS_ADL276W"
                     /old_locus_tag="ADL276W"
                     /product="ADL276Wp"
                     /transcript_id="NM_209173.1"
                     /db_xref="GeneID:4619955"
     CDS             218754..219461
                     /locus_tag="AGOS_ADL276W"
                     /old_locus_tag="ADL276W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL121C (MEI5)"
                     /codon_start=1
                     /product="ADL276Wp"
                     /protein_id="NP_983820.1"
                     /db_xref="GeneID:4619955"
                     /translation="MSDSAGLHGSTAMQDPDSTLVEERLAATPKVINKVSKKGFKPPF
                     SVKLKRGAICRDGAGTDLGEELRLRERALDAELRQRATQETLLRRAVKIAESYEQLRQ
                     NDSLIEKWRGVCQAAMAYILNSMMLKIGRMGGYKEFKRKEVERMKRQVEYQTNDGVED
                     QIAELLESDEFLRLPLDEQEEIRERMQERREEAERARERELAKLDAELAATEGEEMTM
                     EELATRLKVDYNMVYPP"
     gene            complement(<219552..>222977)
                     /locus_tag="AGOS_ADL275C"
                     /old_locus_tag="ADL275C"
                     /db_xref="GeneID:4619956"
     mRNA            complement(<219552..>222977)
                     /locus_tag="AGOS_ADL275C"
                     /old_locus_tag="ADL275C"
                     /product="ADL275Cp"
                     /transcript_id="NM_209174.2"
                     /db_xref="GeneID:4619956"
     CDS             complement(219552..222977)
                     /locus_tag="AGOS_ADL275C"
                     /old_locus_tag="ADL275C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR207C (RET1)"
                     /codon_start=1
                     /product="ADL275Cp"
                     /protein_id="NP_983821.2"
                     /db_xref="GeneID:4619956"
                     /translation="MAAVEHAHSAHKMDDTFEQLLKPVYKGKKLADAINTAEDKWHLL
                     PAFLKVKGLVKQHLDSFNYFVDVDLKKIIKANEMVLSDVDPEFYLKYVDIRVGRRSNS
                     SKIDMTPPHECRLRDMTYSAPIFVDIEYTRGRSIVLHKDVEIGKMPIMLRSNKCILNG
                     ASEEVMAKLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKAIVQASVTSS
                     THERKSKTYVVTKNDKIYLKHNSIAEEVPIVIVLKACGIVSDLEIMQLVCGNDSSYQD
                     IFAINFEEASKMNIYTQQQALEYIGTKVKTIRRQKLTVLQEGIEAIATTVIAHLTVEA
                     LDFREKALYVAMMTRRVIMAIHNPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKKFNN
                     DFKASIDKVLKKPNRAEMYDALLSINVHSNNITSGLNRAISTGNWSLKRFKMERAGVT
                     HVLSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTPEGEACGLVKN
                     LALMTHITTDDEEEPIKNLCYLLGVEDITLLDSASIHLNYGVYLNGTIIGTTRFPARF
                     VNQFRLLRRTGKVSEFISIYTNSHQKAVHIATDGGRICRPLIIVRNGKSMVTAGHLRR
                     LLEGELQFDDFLKLGLVEYLDVNEENDSYIALYEKDIEEGTTHLEIEPFTVLGAVAGL
                     IPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKSKTIELID
                     YDKLPAGQNATVAVMSYSGYDIEDALVINKSSIDRGFGRCETRKKTTTILKRYPNHTQ
                     DIIGGMRVDENGEPIWQHQSLGPDGLGEVGMKVTSGQIYINKSIPTNASDSVLNQVQS
                     QYREAPIIYRAPEPSHIDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGVC
                     GIIVQQEDMPFNDQGICPDIIMNPHGFPSRMTVGKMLELVSGKAGVLNGTLEYGTCFG
                     GSQLADMSEILVNNGFNYSGKDMLYSGITGECLQAYVFFGPIYYQKLKHMVLDKMHAR
                     ARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMLSSDAFEVDVCN
                     KCGLMGYSGWCTSCKSAEHIIKMTIPYAAKLLFQELLSMNIAPRLKLEDVFQS"
     gene            <223319..>224863
                     /locus_tag="AGOS_ADL274W"
                     /old_locus_tag="ADL274W"
                     /db_xref="GeneID:4619957"
     mRNA            <223319..>224863
                     /locus_tag="AGOS_ADL274W"
                     /old_locus_tag="ADL274W"
                     /product="ADL274Wp"
                     /transcript_id="NM_209175.1"
                     /db_xref="GeneID:4619957"
     CDS             223319..224863
                     /locus_tag="AGOS_ADL274W"
                     /old_locus_tag="ADL274W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL122C (TFB2)"
                     /codon_start=1
                     /product="ADL274Wp"
                     /protein_id="NP_983822.1"
                     /db_xref="GeneID:4619957"
                     /translation="MEPTPGIIHDGHNLFKNTVNEYLQELPQPVQSRLYQSPATCLAI
                     YRLLSPMAKFFIMSMIFQDEEVSLRDLDRWVKPDAKFQLHDAIKSMKLLHLITEGRSG
                     QPLMVQLNSIFKESFKNALTGGEVKNSFGNVVEEENDPVTMAMLDSYAADKWETILHF
                     MVGTPLTKSPGKNVLSLLRHSKLMEVDESSKELKITNEGFQFLLQDANAQIWTLLLQY
                     LTMAETFQMDPVDVLNLIFMIGALELGKAYSVVGLSETQKTMLQDLRDYGLVFQKQSN
                     LSKFYPTRLATMLTSDVVSIRSASGAVNSVLRQRAEGVDGKVLNGTALGDDDLQAGGE
                     GALDGALIVETNFKLYSYSNSPLQIAILSLFIHLKTRFQNMVTGQITRESIRRALHNG
                     ITADQIIAYMETHAHPQMRRLAGDNLEKKLELDPNCRDTLQVLPPTVVDQIKLWQLEL
                     DRIISYDGYLFRDFDNLQEYQVLAQYARDIGVLLWSDDKKKMFFVSKEGNAQVIDFHK
                     RKFRKK"
     gene            complement(<225517..>227388)
                     /locus_tag="AGOS_ADL273C"
                     /old_locus_tag="ADL273C"
                     /db_xref="GeneID:4619958"
     mRNA            complement(<225517..>227388)
                     /locus_tag="AGOS_ADL273C"
                     /old_locus_tag="ADL273C"
                     /product="ADL273Cp"
                     /transcript_id="NM_209176.2"
                     /db_xref="GeneID:4619958"
     CDS             complement(225517..227388)
                     /locus_tag="AGOS_ADL273C"
                     /old_locus_tag="ADL273C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR204W (DED1) and YPL119C (DBP1)"
                     /codon_start=1
                     /product="ADL273Cp"
                     /protein_id="NP_983823.2"
                     /db_xref="GeneID:4619958"
                     /translation="MSELVNKMENLSVGDSAQKKSAYVPPHVKRRMKEGGSEPSSRNT
                     ENFGNGGRFGGSEHNGFGGGRGSWFGGNARGGGPRSSDRGGSSRFGKWVDGKHVPMKR
                     NEKLEVQLFGTPEDPNFQSSGINFDNYDDIPVDASGEDVPDPITEFTSPPLDELLLEN
                     IKLARFTKPTPVQKYSVPIVAKGRDLMACAQTGSGKTGGFLFPVLSQSFSNGPASTPD
                     ESGYYMRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVYGGADIRQQIRELE
                     RGCDLIVATPGRLNDLLERGKISLCSVKYLVLDEADRMLDMGFEPQIRHIVEGCDMPT
                     VENRQTLMFSATFPTDIQHLAADFLKDYIFLSVGRVGSTSENITQKVLHVEDIDKRSV
                     LLDLLAASDGGLTLVFVETKRMADALTDFLIMQNLSATAIHGDRTQAERERALAFFRT
                     GRANVLVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLATAFFNR
                     GNKNVVKELVDILEEANQEVPSFLSQIAKEMSYGGGGGKSSRGGRGGYSRGNSTRDFR
                     RHGGGGGSEWSSANRASSGWGNANRTGSGWGGSSGFGGSTESWSNASKTVGSNNSWW"
     gene            <227863..>229557
                     /locus_tag="AGOS_ADL272W"
                     /old_locus_tag="ADL272W"
                     /db_xref="GeneID:4619959"
     mRNA            <227863..>229557
                     /locus_tag="AGOS_ADL272W"
                     /old_locus_tag="ADL272W"
                     /product="ADL272Wp"
                     /transcript_id="NM_209177.1"
                     /db_xref="GeneID:4619959"
     CDS             227863..229557
                     /locus_tag="AGOS_ADL272W"
                     /old_locus_tag="ADL272W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YDR508C (GNP1) and YCL025C (AGP1)"
                     /codon_start=1
                     /product="ADL272Wp"
                     /protein_id="NP_983824.1"
                     /db_xref="GeneID:4619959"
                     /translation="MNMGAKEDCSDAEKLSSEGSEPASLRQSIKPRHVFMISMATGIG
                     TGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKF
                     IDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWNSNLSPSLFVSAFYILICIVNFF
                     GSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSGPIGFQYLKTPGAFNTNYNV
                     FKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIRRACRQVSIRMFVFYLLSISV
                     VGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHGVRIVPHIINAVILIAVVSVANSAMY
                     SSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVGLISFIAEYRDQEAVFVWLL
                     SISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNTGVIGSYIATAINVVVII
                     VQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTNDWTPWIRTHCVDINT
                     DRDVYAPSDDLSTKGVVKLAPAVQSARSIASSALSESPPEPISQKAHQPERPSSGS"
     gene            <229871..>230953
                     /locus_tag="AGOS_ADL271W"
                     /old_locus_tag="ADL271W"
                     /db_xref="GeneID:4619960"
     mRNA            <229871..>230953
                     /locus_tag="AGOS_ADL271W"
                     /old_locus_tag="ADL271W"
                     /product="ADL271Wp"
                     /transcript_id="NM_209178.1"
                     /db_xref="GeneID:4619960"
     CDS             229871..230953
                     /locus_tag="AGOS_ADL271W"
                     /old_locus_tag="ADL271W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL118W (MRP51)"
                     /codon_start=1
                     /product="ADL271Wp"
                     /protein_id="NP_983825.1"
                     /db_xref="GeneID:4619960"
                     /translation="MSSSNLSSILRNSRIAQVPKPKGPLFSPDKKYVPTHQLIENKAS
                     TMHRQEWGMKSSIPSRSKSRYLIFDELDTQQRLTSFEAIGQYQWNRIRIQELGVVPER
                     ATAGNSFQTSADANAPSNPLFSGFSSRLSARTPLSSFFGLTSKSDAKQWKAAEKKVAA
                     LRPAFKKWLQDHHPHLIIHKDQMDPADFRKRAVEFITEIATRSSGAGGSWKVVGNGGL
                     TYGLKGRLQQSPLGIKQNTVVEGRILQTNGMEKSVAAAGFVGNGMLGTNLRKVDYAMG
                     DLVRTARFPFEVKQARLLENGRLLMDMSLIEPKNTARKYGYGAKENKNRTYIFQRGAV
                     NERKISSEESAQQAEELLNILTNFEN"
     gene            complement(<231019..>231681)
                     /locus_tag="AGOS_ADL270C"
                     /old_locus_tag="ADL270C"
                     /db_xref="GeneID:4619961"
     mRNA            complement(<231019..>231681)
                     /locus_tag="AGOS_ADL270C"
                     /old_locus_tag="ADL270C"
                     /product="ADL270Cp"
                     /transcript_id="NM_209179.2"
                     /db_xref="GeneID:4619961"
     CDS             complement(231019..231681)
                     /locus_tag="AGOS_ADL270C"
                     /old_locus_tag="ADL270C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR202W (HIS3)"
                     /codon_start=1
                     /product="ADL270Cp"
                     /protein_id="NP_983826.2"
                     /db_xref="GeneID:4619961"
                     /translation="MSETQRAFVKRITHETQVQIALALNGGPLEIGQSILGGAKTTVA
                     HQASSSQVINVQTGVGFLDHMIHALAKHSGWSLIVECVGDLHIDDHHTTEDCGLALGQ
                     ALREAIGQVRGVKRFGTGFAPLDEALSRAVVDLSNRPYAVVDLGLRREKIGDLSTEMI
                     PHFLQSFAESARVTLHVDCLRGTNDHHRSESAFKAVAVALRDALTRTGTDDVPSTKGV
                     LM"
     gene            <231840..>233033
                     /locus_tag="AGOS_ADL269W"
                     /old_locus_tag="ADL269W"
                     /db_xref="GeneID:4619962"
     mRNA            <231840..>233033
                     /locus_tag="AGOS_ADL269W"
                     /old_locus_tag="ADL269W"
                     /product="ADL269Wp"
                     /transcript_id="NM_209180.1"
                     /db_xref="GeneID:4619962"
     CDS             231840..233033
                     /locus_tag="AGOS_ADL269W"
                     /old_locus_tag="ADL269W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR201C (MRM1)"
                     /codon_start=1
                     /product="ADL269Wp"
                     /protein_id="NP_983827.1"
                     /db_xref="GeneID:4619962"
                     /translation="MNRSFIRSLTSKVKSAVKVPHSEHLHGQNKFERNFPVFQRKKAW
                     ERDGMDKDEWFRKKYAHVHAREASRKRDAHTETSKTPQVRKRAAAPVGDAQPRRSSFK
                     SRHAFDPLTPDPLLDRIYGRNSILLALQSNRREYFVRLLHSGNLDPQIAKLAGQLGIK
                     VQSAQRHQLNMMTNNAVHNGLVLEAKPLYPQEINALGAVDHEAGTFELIDQWSNNGTA
                     QKVPFLQSAKKRYPVGLYLDEVVDPHNVGAILRSAYFLGADFVAVSHRNSAPLSAAVS
                     KTSSGALEVLPIYSVDKPLQFFERSRDEHDWVFVASHLTQGPGISSHVKNRVLPIEDM
                     ADLAQSSPVMLVVGNEGTGIRSNLQQRSDFFVQVPFGRADEPQLVDSLNVSVAAALLL
                     RSLLS"
     gene            complement(<233154..>234038)
                     /locus_tag="AGOS_ADL268C"
                     /old_locus_tag="ADL268C"
                     /db_xref="GeneID:4619963"
     mRNA            complement(<233154..>234038)
                     /locus_tag="AGOS_ADL268C"
                     /old_locus_tag="ADL268C"
                     /product="ADL268Cp"
                     /transcript_id="NM_209181.1"
                     /db_xref="GeneID:4619963"
     CDS             complement(233154..234038)
                     /locus_tag="AGOS_ADL268C"
                     /old_locus_tag="ADL268C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL117C (IDI1)"
                     /codon_start=1
                     /product="ADL268Cp"
                     /protein_id="NP_983828.1"
                     /db_xref="GeneID:4619963"
                     /translation="MSVVVQGKVVMQRVGKERMSPYAVLVKSLTQEEVLEQFPEIIPI
                     NNRPNTHSSASSGDEHKDSVFTGHDEEQIKLMNENCIIVDWDDEPIGAGTKKLCHLME
                     NIDKGLLHRAFSVFVFSADGRLLLQQRATEKITFPDLWTNTCCSHPLCVDAEVGLKGT
                     LEAKVQGAWTAAVRKLEHELGIPPAQTLKRGKFHFLNRIHYMAPSNGPWGEHEIDYIL
                     FYRVSDGCTLTVDPNPNEVRNSRWVTQHELKEMFANPELKFTPWFKLICQSYLFEWWG
                     QLSDLSRVENDTQIHRMV"
     gene            <234560..>235933
                     /locus_tag="AGOS_ADL267W"
                     /old_locus_tag="ADL267W"
                     /db_xref="GeneID:4619964"
     mRNA            <234560..>235933
                     /locus_tag="AGOS_ADL267W"
                     /old_locus_tag="ADL267W"
                     /product="ADL267Wp"
                     /transcript_id="NM_209182.2"
                     /db_xref="GeneID:4619964"
     CDS             234560..235933
                     /locus_tag="AGOS_ADL267W"
                     /old_locus_tag="ADL267W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR198C (BFR1)"
                     /codon_start=1
                     /product="ADL267Wp"
                     /protein_id="NP_983829.2"
                     /db_xref="GeneID:4619964"
                     /translation="MSSRSNVKRPDSSVRDRKLEPLYAQLKKVDQEVTAVRKQIDEMQ
                     VGEGSQESKQKLHEQLKEIIRAQSDLKGKRQQIHDRIKQLDAQIKRKTGEVAERVGRK
                     SAYSSGEEIRERLAQIDEEISSGGLSLVEEKLRVKEMQALNKLAKDLQQVEPVKRSIE
                     EDRAAIAELKAKLNSLNPKEVSAQFESTQAKLNQLQSKNQVVYDQRSRLFTKRSALYS
                     KRDEIFAQIKKIRGDFDNEFKAYKKKLDDDRIKREEEERISRVLEDKEEKMGKLQEKL
                     IHAHKPAFAYEISAIETALFSLDPTFVKPATNTIDFPGSQPAKPIKKVEADDLVPIVK
                     KREEFFPSSAVSKNKKKQASAAAAAAGNGKFSLEPTLIVVLADLDVSVPMTKDDVPAT
                     VDQLKAKYEDFLARQDEQTSKNVAEAEAALDKLELEYKAKEDQVRKELEEKRAKDQAA
                     KEASASQ"
     gene            complement(<236093..>237451)
                     /locus_tag="AGOS_ADL266C"
                     /old_locus_tag="ADL266C"
                     /db_xref="GeneID:4619965"
     mRNA            complement(<236093..>237451)
                     /locus_tag="AGOS_ADL266C"
                     /old_locus_tag="ADL266C"
                     /product="ADL266Cp"
                     /transcript_id="NM_209183.1"
                     /db_xref="GeneID:4619965"
     CDS             complement(236093..237451)
                     /locus_tag="AGOS_ADL266C"
                     /old_locus_tag="ADL266C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR197W (MCA1)"
                     /codon_start=1
                     /product="ADL266Cp"
                     /protein_id="NP_983830.1"
                     /db_xref="GeneID:4619965"
                     /translation="MYPGAGRPTYHKQQEQKGPYGQPQYQQQYAPPYPERYQQPYYQP
                     PPHDGYSRPSMPPPSHNYAAAQYERPSCPPPGYAPHQGGFPAPGPPLQGRPRDLMRSD
                     IQMNHSMDYSNIQGPASYTRPEFVAPPPQERQFLDPGNRSVEYQYSQCTGNRKALLIG
                     INYFNSSAELRGCINDVQNIKNFLISRYGYREENMVILTDDQHDPVRIPTKANILRAM
                     HWLVQGAQPNDSLFLHYSGHGGETEDLDGDEQDGKDSTLYPVDFETNGHIVDDEIHDI
                     LVKPLAPGVRLTALIDACHSGSALDLPYMYSTKGIIKEPNVWKDIGSNSMQAAMAYVT
                     GNTGDMFTSLKSLASTVSRKATGSGGVDTERVRQTKFSPADVIMFSGSKDNQTSADAV
                     ENGVATGAMSYSFVKVMSQQPQQTYLSLLQNMRTELKGKYTQKPQLSCSHPLDVNLQF
                     VL"
     gene            <238360..>240408
                     /locus_tag="AGOS_ADL265W"
                     /old_locus_tag="ADL265W"
                     /db_xref="GeneID:4619966"
     mRNA            <238360..>240408
                     /locus_tag="AGOS_ADL265W"
                     /old_locus_tag="ADL265W"
                     /product="ADL265Wp"
                     /transcript_id="NM_209184.2"
                     /db_xref="GeneID:4619966"
     CDS             238360..240408
                     /locus_tag="AGOS_ADL265W"
                     /old_locus_tag="ADL265W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL116W (HOS3)"
                     /codon_start=1
                     /product="ADL265Wp"
                     /protein_id="NP_983831.2"
                     /db_xref="GeneID:4619966"
                     /translation="MAQPEPLQQFERQFEEFVKNNPNVLSAARSASRIPESAKAVIIL
                     SPLSLQHQFPRYWVSKSYKKSIVERPERLLASSLGIAAAITMYPALFTLKSSHHRQTS
                     LLSPHVLRVHGNDWPKAILRLCKQSDDRIQKRQLEVPDEWNVGDIYLCRGTIDALQGS
                     IGALESGVDSIFDGPSAASTPNRAFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAAS
                     RYGVTHAAILDFDLHHGDGTQDICWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYF
                     SLHDINSFPTEQGYAHKTSIKDASVCIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYR
                     AIFAKADEFLRVSQKRMASEGKNYKGLIIISAGFDASEHEQLSMQRHGVHVPTSFYCA
                     FTKDALKLAQMHTQGKLLSLLEGGYSDAALVSGVFSHLIGMQNQNWIPEWGSAQVIKE
                     VCRGCRPNWKAYKTKRSRDVIRNWAEEVIKLGRSMIPEFQETFFADTATAEPPAARMT
                     RSKHNEIIAKVDDSALALRSDTPSPPERKPLGATKATPHVRYASGTVQPLHTDSEDDD
                     KDDYVYDEALNRTFNRTVEDITVDDISKHLETLEIIQEPVPSRQHQLVLDPEPQHDPA
                     ASANASSKYRVPQLEATQRARRMKSSKPPNIEDSDISMISHFSAADKRRTTQGSRNKW
                     "
     gene            <240761..>241930
                     /locus_tag="AGOS_ADL265WA"
                     /db_xref="GeneID:9487604"
     mRNA            <240761..>241930
                     /locus_tag="AGOS_ADL265WA"
                     /product="ADL265W-Ap"
                     /transcript_id="NM_001355312.1"
                     /db_xref="GeneID:9487604"
     CDS             240761..241930
                     /locus_tag="AGOS_ADL265WA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR099W (KTR1)"
                     /codon_start=1
                     /product="ADL265W-Ap"
                     /protein_id="NP_001342254.1"
                     /db_xref="GeneID:9487604"
                     /translation="MRINVRIAKILGAVGILLVTASVLIYGTGISYNPSMRTLHGSGN
                     NKGNIYRTVTEQEVAPMKREKATFVTLARNSDLYTLLESIMSVEDRFNHKFKYDWVFL
                     NDEEFTDTFKALTSALVSGNTYYGKVPKEHWSFPEWIDQDRAARVRQMMAEKNVIYGD
                     SINYRFMCRYESGLFYRHELLQPYDYYWRVEPEVRFFCDVDYDVFRFMRDNNKKYGFT
                     ISIHEYPATIETLWEETRKFMEKHPEHVHPNNMMDFISDDNGLSYNMCHFWSNFEIGS
                     LEFLRSKAYSDYFDSLDQAGGFFYERWGDAPVHSIAAALFLDRNEIHHFNDIGYFHPP
                     FQQCPIDETFRKEHRCACNADKDFTWNSFSCGSKFYDVNKMKKPAGWYDYVSRNP"
     gene            complement(<241979..>242968)
                     /locus_tag="AGOS_ADL264C"
                     /old_locus_tag="ADL264C"
                     /db_xref="GeneID:4619967"
     mRNA            complement(<241979..>242968)
                     /locus_tag="AGOS_ADL264C"
                     /old_locus_tag="ADL264C"
                     /product="ADL264Cp"
                     /transcript_id="NM_209185.1"
                     /db_xref="GeneID:4619967"
     CDS             complement(241979..242968)
                     /locus_tag="AGOS_ADL264C"
                     /old_locus_tag="ADL264C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR100C (CRC1)"
                     /codon_start=1
                     /product="ADL264Cp"
                     /protein_id="NP_983832.1"
                     /db_xref="GeneID:4619967"
                     /translation="MGCGVLAERRDHVPRSRDRMAEQESVVAIEEPSVHVGTPKSNAL
                     YENAKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSA
                     VNMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISA
                     IPTTLVMAPTERVKVVLQTQSNHSLGSAAKHILATGGVRSLFRGSLATLARDGPGSAL
                     YFASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSSNTRQ
                     TMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVELTHSLFKKYNI"
     gene            <243305..>244186
                     /locus_tag="AGOS_ADL263W"
                     /old_locus_tag="ADL263W"
                     /db_xref="GeneID:4619968"
     mRNA            <243305..>244186
                     /locus_tag="AGOS_ADL263W"
                     /old_locus_tag="ADL263W"
                     /product="ADL263Wp"
                     /transcript_id="NM_209186.2"
                     /db_xref="GeneID:4619968"
     CDS             243305..244186
                     /locus_tag="AGOS_ADL263W"
                     /old_locus_tag="ADL263W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL097C (PHO23)"
                     /codon_start=1
                     /product="ADL263Wp"
                     /protein_id="NP_983833.2"
                     /db_xref="GeneID:4619968"
                     /translation="MAQKAQKHAGVANCPTRSRCSTVAIKMSTPANLFPGLNDIVDVI
                     EEFPLEVARYMTLLREIDAKCVHTVPELNAQIGRFLAGSRQPGSPQLQTINRLFQDLM
                     PSLEEKMHVSSIAFETLDRLVARVELAYEVALKNQEIPDKLRLGNDNHPAMHLHHELM
                     KKIESKQQSKSQQALRSESRREAMAAKKMHVDPPAPAPASYAPLPLPPAALAAKRRAD
                     LPPPARKRKKPRDDYSARPKTNEYGEALYCYCNQVAYGEMVGCDGENCQLEWFHLPCI
                     NLETLPKGKWYCDDCKR"
     gene            <244445..>245318
                     /locus_tag="AGOS_ADL262W"
                     /old_locus_tag="ADL262W"
                     /db_xref="GeneID:4619969"
     mRNA            join(<244445..244459,244521..>245318)
                     /locus_tag="AGOS_ADL262W"
                     /old_locus_tag="ADL262W"
                     /product="ADL262Wp"
                     /transcript_id="NM_209187.2"
                     /db_xref="GeneID:4619969"
     CDS             join(244445..244459,244521..245318)
                     /locus_tag="AGOS_ADL262W"
                     /old_locus_tag="ADL262W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR101W (RAS1) and YNL098C (RAS2); 1-intron"
                     /codon_start=1
                     /product="ADL262Wp"
                     /protein_id="NP_983834.2"
                     /db_xref="GeneID:4619969"
                     /translation="MAMIKNSIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIE
                     DSYRKQVVIDGQVSILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMT
                     YYQQILRVKDVEYVPIFVVGNKSDLEGERQVSFEEGAELARHFNASFLETSAKQAINV
                     EESFYGLARLVRDDGIHAGKRLESSPEDPANAAGAEPSAGYSKDDNALDPEAVQGTLA
                     NSSVGSRAPGAVDHKGETSAVSGSLRSSRAQQQSLNTDGVAAKKSTGCCVIL"
     gene            complement(<245598..>245999)
                     /locus_tag="AGOS_ADL261C"
                     /old_locus_tag="ADL261C"
                     /db_xref="GeneID:4619970"
     mRNA            complement(<245598..>245999)
                     /locus_tag="AGOS_ADL261C"
                     /old_locus_tag="ADL261C"
                     /product="ADL261Cp"
                     /transcript_id="NM_209188.1"
                     /db_xref="GeneID:4619970"
     CDS             complement(245598..245999)
                     /locus_tag="AGOS_ADL261C"
                     /old_locus_tag="ADL261C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR103C (OST2)"
                     /codon_start=1
                     /product="ADL261Cp"
                     /protein_id="NP_983835.1"
                     /db_xref="GeneID:4619970"
                     /translation="MVRAVKKKVAGMQAAGPVVGNVLEQFREALQITWRAYSRDLKSD
                     QRLLLIDTLCGGLVTIGLVQVLFIAVIRDTFPFNAFLAGFISCVGQFVLLISLRLQLR
                     EQFAGISSQRAFGEFVLASLVLHFICLHFIN"
     gene            <246209..>246886
                     /locus_tag="AGOS_ADL260W"
                     /old_locus_tag="ADL260W"
                     /db_xref="GeneID:4619971"
     mRNA            <246209..>246886
                     /locus_tag="AGOS_ADL260W"
                     /old_locus_tag="ADL260W"
                     /product="ADL260Wp"
                     /transcript_id="NM_209189.1"
                     /db_xref="GeneID:4619971"
     CDS             246209..246886
                     /locus_tag="AGOS_ADL260W"
                     /old_locus_tag="ADL260W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL099C (OCA1)"
                     /codon_start=1
                     /product="ADL260Wp"
                     /protein_id="NP_983836.1"
                     /db_xref="GeneID:4619971"
                     /translation="MTDNCREDDDNLGTSGDNALSAPTQLLVTPPAPHQTIVPPLNFC
                     PVERYLYRSGQPSTVNFPFLLNLNLRTIIWLANEEPQDALLAFCDMHDIRLRFAAINP
                     EGGEDDNPWDGLTEHSIVSALQTIVHRDNYPLLVCCGMGRHRTGTVIGCLRRIMGWNL
                     ASVSEEYRRFTGSRGGRILVELLIEAFDTKSVTIDKANAPEWLATAVSASEASYVPAT
                     TYSIHEM"
     gene            <247089..>247703
                     /locus_tag="AGOS_ADL259W"
                     /old_locus_tag="ADL259W"
                     /db_xref="GeneID:4619972"
     mRNA            <247089..>247703
                     /locus_tag="AGOS_ADL259W"
                     /old_locus_tag="ADL259W"
                     /product="ADL259Wp"
                     /transcript_id="NM_209190.1"
                     /db_xref="GeneID:4619972"
     CDS             247089..247703
                     /locus_tag="AGOS_ADL259W"
                     /old_locus_tag="ADL259W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR104W (PIN2)"
                     /codon_start=1
                     /product="ADL259Wp"
                     /protein_id="NP_983837.1"
                     /db_xref="GeneID:4619972"
                     /translation="MSDFAFCPSKLMRRSAFDSTKETLRSFKSWDTCMDNRVCKIVAI
                     VGIVLASIVAIWIVGSLLRCFMRGVSGICDFLCWPCCCYRRHRQRRREEKQRAQVYAP
                     PPQVVYQPVVTPEAARYYGKDEYYSERKKGFSSSSNESYDLEAQKAGGSRGRYGKRGA
                     VHDEDVNQYEERLWGTQRKTPPAQRQAPYPVDSSASPYGHYNRI"
     gene            <248121..>249725
                     /locus_tag="AGOS_ADL258W"
                     /old_locus_tag="ADL258W"
                     /db_xref="GeneID:4619973"
     mRNA            <248121..>249725
                     /locus_tag="AGOS_ADL258W"
                     /old_locus_tag="ADL258W"
                     /product="ADL258Wp"
                     /transcript_id="NM_209191.1"
                     /db_xref="GeneID:4619973"
     CDS             248121..249725
                     /locus_tag="AGOS_ADL258W"
                     /old_locus_tag="ADL258W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL065W (AQR1), YIL121W (QDR2) and YIL120W (QDR1); Tandem
                     gene duplication in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ADL258Wp"
                     /protein_id="NP_983838.1"
                     /db_xref="GeneID:4619973"
                     /translation="MLTRISSTDSSPRAKEDVPQLKLLKEADDGLVDSSSSSPEPDEK
                     IGEACVSTSEISKIPHSMLRYSQKWMMVALLTSAGFWSSLGSPAVYPALRNLQREFGV
                     SEDLVNIAVVVYLLFQGVAPTVCSGLADTYGRRPVILMGMLIFIVSSIGIACSNSFAL
                     VIALRCIQSSGISPIIAINSGVVGDFTLKSERGTFIGAVSGLTLLGQAFGSLIGASLT
                     AAYNWRAVFWFMTIGCGVCFLANFLFLPETHRCIVGNLSLKPKRNINFSPVLLLPVIR
                     RQFSLQHPHYSSLDDTVAGLDIVAALKIIACPEILLTLLPAGLQFSLWTLSLTSLSQA
                     LQSDPYNYPLTTVGLCYLPSGICGLLGSFLTGKLIDIWYRYFADRFQRRSANSSGPSA
                     PFNVLEARIVAGLPQNFISVMAFIIFGWSIQGGWHISVPLVASGVGTFCVMSTLSTSS
                     TLLIDLYPNRASTASSCYNFIRCTLSALFLAVFARMKASMTIGGTFTFLCSLIFVGNC
                     ALIFPMKYGMTWRDRRLRRAAEASCN"
     gene            complement(<249961..>251193)
                     /locus_tag="AGOS_ADL257C"
                     /old_locus_tag="ADL257C"
                     /db_xref="GeneID:4619974"
     mRNA            complement(<249961..>251193)
                     /locus_tag="AGOS_ADL257C"
                     /old_locus_tag="ADL257C"
                     /product="ADL257Cp"
                     /transcript_id="NM_209192.1"
                     /db_xref="GeneID:4619974"
     CDS             complement(249961..251193)
                     /locus_tag="AGOS_ADL257C"
                     /old_locus_tag="ADL257C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL064C (YDJ1)"
                     /codon_start=1
                     /product="ADL257Cp"
                     /protein_id="NP_983839.1"
                     /db_xref="GeneID:4619974"
                     /translation="MVKDTKLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAA
                     DKFKQITGAYEILSDSQKREMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGG
                     GGASRPRGPQKGRDIRHDISCTLENLYKGRAAKLALNKTVLCKRCEGRGGKAGSVKKC
                     TSCNGQGVKFVTRHMGPMIQRFQTTCEVCNGEGDVIPAADRCKDCDGKKIASERKILE
                     VNIQPGMKHGQKIVFQGEADQQPGQIPGDVVFVVNEQEHPRFVRNGDNLHYEAEIDLL
                     TAIAGGQFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGSYGDLLIKFNV
                     KFPKSHFADEEALKKLEAILPPKTLPRIPPNAEVEECVLADFEPAKHDSRSGNGRGQS
                     YDSDEEEAHTEGVQCASQ"
     gene            <251491..>252366
                     /locus_tag="AGOS_ADL256W"
                     /old_locus_tag="ADL256W"
                     /db_xref="GeneID:4619975"
     mRNA            <251491..>252366
                     /locus_tag="AGOS_ADL256W"
                     /old_locus_tag="ADL256W"
                     /product="ADL256Wp"
                     /transcript_id="NM_209193.1"
                     /db_xref="GeneID:4619975"
     CDS             251491..252366
                     /locus_tag="AGOS_ADL256W"
                     /old_locus_tag="ADL256W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL063W (MTQ1)"
                     /codon_start=1
                     /product="ADL256Wp"
                     /protein_id="NP_983840.1"
                     /db_xref="GeneID:4619975"
                     /translation="MPRIAPSLMRTACAESRLLPLLLPESRTLEQARTELRWMRAELC
                     GAAAVARGCRQRYRGVPLQYVLGTQPFGPLEVRCRRGVLIPRWETEEWACELARRFAA
                     RGRSLRAADLCTGTGCVGLLLAHSVRGARVTAVDVSEAAVAAARQNAAALRVPLEVVR
                     ADVRQPGGLLRDGVEVVTCNPPYIPTDALPRECTRSVCRYEPQLALAGDLEFYDNLVD
                     VWLARTDSFVYEVGYAEQSRHVLARIAADPALRGVWRVGFREDARGQPRVVYGYRTAA
                     AGLDAVFEGYGRLMH"
     gene            complement(<252414..>253793)
                     /locus_tag="AGOS_ADL255C"
                     /old_locus_tag="ADL255C"
                     /db_xref="GeneID:4619976"
     mRNA            complement(<252414..>253793)
                     /locus_tag="AGOS_ADL255C"
                     /old_locus_tag="ADL255C"
                     /product="ADL255Cp"
                     /transcript_id="NM_209194.1"
                     /db_xref="GeneID:4619976"
     CDS             complement(252414..253793)
                     /locus_tag="AGOS_ADL255C"
                     /old_locus_tag="ADL255C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL062C (GCD10)"
                     /codon_start=1
                     /product="ADL255Cp"
                     /protein_id="NP_983841.1"
                     /db_xref="GeneID:4619976"
                     /translation="MDPLRQLVLNQHILVRLPSDNLKIVELKPNGVISLGKFGACHVN
                     DIIGYPLGTTFEIWYEGDETEVVRGSTVVIGKVRVLENRAEAQVGSEGATPQPAELTQ
                     VESSKTNMELLDLGHKVQKLDHKEIERMKQDVTAGDSIISMMIQSHETFHKKTIHSQE
                     KYLKRKKQKFAKFFTAEYLGSSGLLRYLIEKGDMQRIMDLSEESLGMALNLANIRSNG
                     TYLCMDETGGLIVYAMLERMFGGHEAQHGGTIVVVHENEHPNLDLLKFSNYSEEFIGK
                     HVKTVSLLQYFEPPTVEEVEASFTPLDDAQLREMKSNKKGAYYRRLKRYNSDLEVIRL
                     ASQITYDALIVASTLQLSTLVPRLAGKVHGSRPIVCYSQFRETLLELSHTLYDSLHFL
                     APTLLETRCRPYQTVRGKLHPLMTMRGGGGYLLWCHKVIPADNGAGKIDCDNAAAPAC
                     PAAQPDEAP"
     gene            <254051..>255862
                     /locus_tag="AGOS_ADL254W"
                     /old_locus_tag="ADL254W"
                     /db_xref="GeneID:4619977"
     mRNA            <254051..>255862
                     /locus_tag="AGOS_ADL254W"
                     /old_locus_tag="ADL254W"
                     /product="ADL254Wp"
                     /transcript_id="NM_209195.1"
                     /db_xref="GeneID:4619977"
     CDS             254051..255862
                     /locus_tag="AGOS_ADL254W"
                     /old_locus_tag="ADL254W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL061W (NOP2)"
                     /codon_start=1
                     /product="ADL254Wp"
                     /protein_id="NP_983842.1"
                     /db_xref="GeneID:4619977"
                     /translation="MGSRRAKNKQPAPPSLEEFQAKKNKKQQKHEKRSRKNAGEEPIE
                     ERKRSKKAKVDNKEVDVQDEADLPEVNLEQLAKERKSLFDEEEVVEEEDLQDEFDLEQ
                     EYEDDEEVRERPLFSDEEEDAGMEELNAANMEALSMKLDEEEALEAEEAEQELVEAAK
                     LQPRADILPNSEQEELEAQGPPDLTAIRTRMLEIVKVLEDFKHMAAEGRSRSEYIDRL
                     LKDICQYFGYTPFLAEKLFNLFSPAEAMEFFEANEVARPVTIRTNTLKTRRRDLAQNL
                     VNRGVNLQPIGSWTKVGLQIFDSQVPVGATPEYLAGHYILQAASSFLPVIALDPHENE
                     RILDMAAAPGGKTTYISAMMKNTGCVFANDANKARTKSLIANIHRLGCTNTIVCNYDA
                     REFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVNRTEKDFMQIPHLQKQLILSAIDSV
                     DSNSKHGGVIVYSTCSVAVEENEAVVDYALRKRPNVKLVETGLAIGKEGFTSYRGKKF
                     HHTINLTRRYYPHTYNVDGFFVAKFQKTGPSKFDDNQHSAKEKEAAARQEAIDEGIIH
                     DDFASFDDKEDKRYIEKSKKVGLLKKGKNPHATKPKQ"
     gene            complement(<255999..>258254)
                     /locus_tag="AGOS_ADL253C"
                     /old_locus_tag="ADL253C"
                     /db_xref="GeneID:4619978"
     mRNA            complement(<255999..>258254)
                     /locus_tag="AGOS_ADL253C"
                     /old_locus_tag="ADL253C"
                     /product="ADL253Cp"
                     /transcript_id="NM_209196.2"
                     /db_xref="GeneID:4619978"
     CDS             complement(255999..258254)
                     /locus_tag="AGOS_ADL253C"
                     /old_locus_tag="ADL253C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL059C (ARP5)"
                     /codon_start=1
                     /product="ADL253Cp"
                     /protein_id="NP_983843.2"
                     /db_xref="GeneID:4619978"
                     /translation="MRQQGMSRDSSLAPLPVHVVDEPPLVDEPEGFYSAGAEDGGPIA
                     IDFGSYEVRAGYVANKEPALVFPTRLARYRDRKASRTYTFVGRDTGLDASIRTQSRSP
                     FDGPMVTNWDYVDDMLAYTFHHLGVRGGGGVPNAVVLTERLATLQSQRANWYELLYEA
                     YNLQEVTFGIDSLFSFYGERGPGSTGLVVSSGNEDTCVVPVVDGRGVVSEAKRINWGG
                     QQAVDYLTGLLALKYPYFPTKLSGSQFETIYREHCYVAEDFEREIDEILQLPTLEAKN
                     VVVEAPFTEVVQVQKTEEELRLQAEKRRETGKRLQEQARQRRKEKLVQKEEEYEYYLQ
                     IRGQLEGQPKKNILATLQNAGFDDEDDFNKYITSLERSLKRARVLDANENEEEPSSTV
                     PNFDLVNIPDEELNDEQRREKKKQRLMKANYDARMKAKEEKLEQQKREEDARLRNEQW
                     RKDDLKGWIKEKRSQLTGLMKARKEKLKMKEDMKDRKSQAAQKRMKNIASLAEDNTSN
                     NKRSRQQATIDNDPNDTFGANDDDWMIYNDISQNPEALDEALEEEYKVIVEIEKELLE
                     HDPHFTEEDTLDAQYDWRNSTLHLFLRGPRPHDSENIHEQHQMHINVERIRVPEVIFQ
                     PSIGGLDQAGVVELCETVLLKKFDSSRRALSATCEKMAKNVFITGGNTKLPGIRERIV
                     REFTGFLPVGTELKVTLAKDPSLSAWKGMAKFASDPTSYKSSILTKREYEEYGPEYIK
                     EHNLGNAKFMD"
     gene            <258796..>259470
                     /locus_tag="AGOS_ADL252W"
                     /old_locus_tag="ADL252W"
                     /db_xref="GeneID:4619979"
     mRNA            <258796..>259470
                     /locus_tag="AGOS_ADL252W"
                     /old_locus_tag="ADL252W"
                     /product="ADL252Wp"
                     /transcript_id="NM_209197.1"
                     /db_xref="GeneID:4619979"
     CDS             258796..259470
                     /locus_tag="AGOS_ADL252W"
                     /old_locus_tag="ADL252W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL118W (RHO3)"
                     /codon_start=1
                     /product="ADL252Wp"
                     /protein_id="NP_983844.1"
                     /db_xref="GeneID:4619979"
                     /translation="MPLCGSSSSSKHPIERKIVILGDGACGKTSLLNVFTRGYFPKVY
                     EPTVFENYIHDIFVDNQHITLSLWDTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSL
                     ENVKNKWVSEIADHCEGVKLVLVALKCDLRSSDEYGNESAITPGSIQNQKYNGGGGNG
                     LIPYDEGLAMAKQIGALRYLECSAKMNRGVNEAFTEAARCALTATPKGARDSAPEAES
                     SSCTIM"
     gene            complement(<259802..>260512)
                     /locus_tag="AGOS_ADL251C"
                     /old_locus_tag="ADL251C"
                     /db_xref="GeneID:4619980"
     mRNA            complement(<259802..>260512)
                     /locus_tag="AGOS_ADL251C"
                     /old_locus_tag="ADL251C"
                     /product="ADL251Cp"
                     /transcript_id="NM_209198.1"
                     /db_xref="GeneID:4619980"
     CDS             complement(259802..260512)
                     /locus_tag="AGOS_ADL251C"
                     /old_locus_tag="ADL251C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL058C and YIL117C (PRM5)"
                     /codon_start=1
                     /product="ADL251Cp"
                     /protein_id="NP_983845.1"
                     /db_xref="GeneID:4619980"
                     /translation="MDLAPDAPEFTGQFDVGPSPIEYLVPFVTPPSAANNPNIWKSSQ
                     PPGAVFIFVGAVAAGVFLILIIWYLVTEHISRRETRKSQYEGIEELFKDDYTSAKDTF
                     TVGLDMASDPAPPYAEVKPKHVVDSIAAPPSLFGFNALNSPADRYPAQDEERRLEDLR
                     RSMYISPTVEVMNLRRHRKAGYEIPGSSFDAQSMRTFDMFTPALSAAERRRSRKFNRN
                     RYPMNSVAGSILEPIDGV"
     gene            <260969..>261514
                     /locus_tag="AGOS_ADL250W"
                     /old_locus_tag="ADL250W"
                     /db_xref="GeneID:4619981"
     mRNA            <260969..>261514
                     /locus_tag="AGOS_ADL250W"
                     /old_locus_tag="ADL250W"
                     /product="ADL250Wp"
                     /transcript_id="NM_209199.1"
                     /db_xref="GeneID:4619981"
     CDS             260969..261514
                     /locus_tag="AGOS_ADL250W"
                     /old_locus_tag="ADL250W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL056W (OCA2)"
                     /codon_start=1
                     /product="ADL250Wp"
                     /protein_id="NP_983846.1"
                     /db_xref="GeneID:4619981"
                     /translation="MYIPPLNFALVVSRDVSLYRSGYPMPLNYPFIKTRLQAGTVIYV
                     GDKDISEEYKAFLESEQIRYHHIYMQSCRDDNIQESMEQVLRLVLNVDNYPILIHSNK
                     GKHRVGVVVGIIRKLLQGWSVTGIYQEYGIFSGGQKDQADLEYITMFGTKLMVPMDKV
                     PGFVQFIGTTPSTDYSSDLSA"
     gene            <261676..>262839
                     /locus_tag="AGOS_ADL249W"
                     /old_locus_tag="ADL249W"
                     /db_xref="GeneID:4619982"
     mRNA            <261676..>262839
                     /locus_tag="AGOS_ADL249W"
                     /old_locus_tag="ADL249W"
                     /product="ADL249Wp"
                     /transcript_id="NM_209200.1"
                     /db_xref="GeneID:4619982"
     CDS             261676..262839
                     /locus_tag="AGOS_ADL249W"
                     /old_locus_tag="ADL249W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL116W (HIS5)"
                     /codon_start=1
                     /product="ADL249Wp"
                     /protein_id="NP_983847.1"
                     /db_xref="GeneID:4619982"
                     /translation="MDFDIKAVIRPNILKLKPYRCARDDFSEGILLDANENAFGPVVK
                     FSRLPASLHRYPDPHQLELKGLLASYRNAASAFREEGLAPLTAKNICLGVGSDESIDA
                     IIRATCSPREQKVMLLPPTYGMYKVCADINDVGYVEVPLISSDNSFQIDEDRILEQLN
                     LDKSIKVVFITSPGNPTGACIEVGRVEKLLRNWTAGIVVVDEAYIDFSADKPSLSPLV
                     NKHPNLVVLQTLSKASGLAGIRLGFTFASTQIATALNAMKAPYNISQITAIIGIEALQ
                     PEALKLMQKHIDQINTEKRRIIKALATLNHIENDPVGGLDANFILFRVRGGDNSLAKK
                     LYYSLATESGVIIRFRGTDLGCEGCIRITVGTPEENDVLIKEFTEKLQQLTED"
     gene            complement(<262906..>267492)
                     /locus_tag="AGOS_ADL248C"
                     /old_locus_tag="ADL248C"
                     /db_xref="GeneID:4619983"
     mRNA            complement(<262906..>267492)
                     /locus_tag="AGOS_ADL248C"
                     /old_locus_tag="ADL248C"
                     /product="ADL248Cp"
                     /transcript_id="NM_209201.2"
                     /db_xref="GeneID:4619983"
     CDS             complement(262906..267492)
                     /locus_tag="AGOS_ADL248C"
                     /old_locus_tag="ADL248C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL115C (NUP159)"
                     /codon_start=1
                     /product="ADL248Cp"
                     /protein_id="NP_983848.2"
                     /db_xref="GeneID:4619983"
                     /translation="MSVREEFPTKTSEAYGFKPVFSRQLVTSFGENLPFVRYNCLAVS
                     SKHRLFAACGAAEVVIGSLEALRQWGESGDELELVARHAAQDVVGVGFCRDVVVYATR
                     AGELWSREVGSTGQWSQRSVGAGTVGMHCVGAYALLLRASGEVLRVHVGNGQQESIAL
                     DVCDFDARGSEVLYLERGFRLRMANVGGGEERRVELPDDMREEDTQPIAVRYLSREQA
                     LVVVGEETPDDADEVVYAHKMYVVSLQSGDARESFDILPAFGSVKRNPAYYGCTLYNL
                     ASDGRQLHVLASSCSSELTLLDDAEVLQPLQDADRAVLRINPDTDNDTSALGLALDVV
                     TRMRVVEPCAGVDAASELPLAYVLNNLGVLECWALYQSDALKAGKLSLDATLNELIRE
                     AESISSESPEEHIQDISQSPAEPTKSSTFNAISTKSDQPDAAASPENTNIISPSPKPA
                     FGSGRVFGTPAFGHQSMESIAPSGATMVPSHGTTFGQDTNSMQTDANPDKTEDQRHQW
                     PSSTSHPFGVPPPGTTSNNEPHSSKSNAVTGGNTGNAPENPSSGTSTFGKPAFGSVTT
                     PGTIFGTPGFASAKTAVSAFGQPAFGGSAFGKPVFGEGSSAEPASGEEPGKSAFGESA
                     FGKPAFGESAFGKPAFGESAFGKPAFGESAFAKPAFGKPSFGESTATNPKSEESAFGK
                     PAFGANAFGKPAFGESPFNKSIPGSPFAKPFGAGLPASSSPFGNLSSTPFGKISSSPF
                     GQLSASPEAKAVSPFGKTAFSSSASPSTFGTPVFSAAQDTDQKTNKLEFGTGNSIDTS
                     APNSKITSPNSATQGAISSATVFPVGKATAAQHNQENFTPTPITKSHEGRKTSVSKDN
                     ADFIQNTPTKENPALSLLSLSGSLEQTVSTEGMQTAKEQLTDYSGATSEGITSEEEED
                     DDSSNELAASGGEDDSGEDNEESHDVDEGSVVSPSIGNNKLEDSSGISATAKSENKAE
                     ISSMKSITERIKKAANLPASSAIMNITSSPDATPDIKRVVSPFSDFTNKLNPPEANNG
                     QAPFSFSALTKKEQESGTRREGNPEHATLSDQDSSSAKGSSRRGSIIAKENRYSSSGG
                     APQSAQVQKPGTSITRPSDVAISPQNSASLDSSNSLSDISSNRVSDDDQSSQPPSSDE
                     GESESSEVPPSDPTHGSERQLSTITEESVDLPPSANVSPFATDNSVAYNSNRKMQVDS
                     NVQTRPLQLAHKEVDAIPVTVNTFCQAAPATADKELQTDSSPELDSAINAFEGDEQYL
                     SEQYAPRRLEKFYTEAYLADIKYTSKNPTTKAVEKTCHVINAELSTLRSNISNIGKFI
                     DDQSKSPYPKSAESLCNVGGWRIAEAAQLMDIVKRQQATFNDTFNAIKKLDTESQLDY
                     SSLLKSEYMLKDYYLQLNCLNKESDNVLRDLSLPQMKIRNSIRSKLVNLTSRIKELTN
                     MIQMMKLYTVRGNNKNAAIVRKLMNDSMERGSLLEEIQSLRQEVSRLAIANTPVDEVS
                     GALSTRDIDSTAIVKETLTLNVKHQLGEFFKSRI"
     gene            complement(<267638..>268813)
                     /locus_tag="AGOS_ADL247C"
                     /old_locus_tag="ADL247C"
                     /db_xref="GeneID:4619984"
     mRNA            complement(<267638..>268813)
                     /locus_tag="AGOS_ADL247C"
                     /old_locus_tag="ADL247C"
                     /product="ADL247Cp"
                     /transcript_id="NM_209202.2"
                     /db_xref="GeneID:4619984"
     CDS             complement(267638..268813)
                     /locus_tag="AGOS_ADL247C"
                     /old_locus_tag="ADL247C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL055C (POR1) and YIL114C (POR2)"
                     /codon_start=1
                     /product="ADL247Cp"
                     /protein_id="NP_983849.2"
                     /db_xref="GeneID:4619984"
                     /translation="MPRTEISMFSKPSRTPQPSSEAFNGIYLDGMTWQLLLSPGITVE
                     LFIFAETSRCLSLQHLSAVHHDKSARFQPRAAIGQKPTAAISPAPSINSASASIARRT
                     RSPHTVSIMAPPFFSDIAKDINGLLNRDFYHSTPAALDVKTSAPNGVGFTVKGKTSPK
                     DGSVAANVEARVADKATGLTLTQGWSSANVLDTKVELANLTPGLRSELVTSCVPGTSN
                     AAKLNLSFVQPAFTARGFFDLLKGPSFVGDLTLAHEGFVGGAEVGYDIAAATVSRYAV
                     ALGYRTGLYSVALGVNNAQITTASFFQRVNPALEVGAKAALNPAAGSKVNIEFATRYA
                     LDLTAQVKAKIADSGLVALSYKQLLRPGVELGVGASFDALKLAEPVHKLGWSLSFSA"
     gene            <268902..>271415
                     /locus_tag="AGOS_ADL246W"
                     /old_locus_tag="ADL246W"
                     /db_xref="GeneID:4619985"
     mRNA            <268902..>271415
                     /locus_tag="AGOS_ADL246W"
                     /old_locus_tag="ADL246W"
                     /product="ADL246Wp"
                     /transcript_id="NM_209203.1"
                     /db_xref="GeneID:4619985"
     CDS             268902..271415
                     /locus_tag="AGOS_ADL246W"
                     /old_locus_tag="ADL246W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL054W (VAC7)"
                     /codon_start=1
                     /product="ADL246Wp"
                     /protein_id="NP_983850.1"
                     /db_xref="GeneID:4619985"
                     /translation="MGLEDGGRIIVEMETVDTQVQSLLPVQPADGGAARPELAGSRRS
                     SSLQLVEQEGAGDDEEKPRFAAALEPSHPPVISHNPLSPHASMTALRNKKSSLLIHSL
                     PTAVVNEDEGREHEGTPAGVAALAGGEGGMDGGGGEGSSLAPPAFTTRTLEHHHLDKP
                     IAARLDEEARSIVNYIAVEDAVDQDSTRHSKEPSTKADFFAARLASAVGENEISDSEE
                     TFVYESTANSTKNSYEPISSNLVLTQSSLGKPYGIPAKLSTPMLTKNKKLLERLKTTR
                     HSSIAVMPSVISDHATAPQAGPAPHQPQQCASQQQQTSDDLKSIHSNRQRRAQYTQMG
                     QSDIQSVKSFNNQPMHSPGKRLSVLSLTKAVAEARQSRNTSNHSGKLRPTAHNNGNSG
                     TLKMKNNHLYPLRTTASRIFDANGASLRRYSGVPDNINLEDYVEQENGELTPNKFTYR
                     SSSEIDSDDDNVLNEDEGLSYVEEDEDDVQSMFYYHGNPQHAAGHTVNPNQVSSGNDN
                     INHNSDKHSASMNNNNGSHVSLNRKYKSHYGALGKFSHLPHKLNYEQNERIGPDDDLE
                     ALYYFRNNSSNGNAASNGGSKNAGGSSGNNNNHSKHFDFFFHPDELSPLKSKKRRSHT
                     VYSGYYNPHNFYTKRSTWNKFKSFVYLTFIVTSLLALGFISGFLLATNKELHDFQIKT
                     IDNVLASADELVFDIKASSFNPGFFTVGVQDVNLDIFAKTSHLDQTDADGDNRGAAFE
                     TVLLGTVYTLETPLRFQGGFLSRNYGVSMSGVKLLHPGAADTAADADKWRALIRYEFD
                     LIVRGNMKYSIPFFKSEKSVVVQAQTSVDPNRADVRAPT"
     gene            <272127..>273437
                     /locus_tag="AGOS_ADL245W"
                     /old_locus_tag="ADL245W"
                     /db_xref="GeneID:4619986"
     mRNA            <272127..>273437
                     /locus_tag="AGOS_ADL245W"
                     /old_locus_tag="ADL245W"
                     /product="ADL245Wp"
                     /transcript_id="NM_209204.1"
                     /db_xref="GeneID:4619986"
     CDS             272127..273437
                     /locus_tag="AGOS_ADL245W"
                     /old_locus_tag="ADL245W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL053W (MSG5) and YIL113W (SDP1)"
                     /codon_start=1
                     /product="ADL245Wp"
                     /protein_id="NP_983851.1"
                     /db_xref="GeneID:4619986"
                     /translation="MSGSLLDLKSRSPKSLQSKNRKKLSLKISNGSPGPKVMMLEPPA
                     EVAGRGDAQIYTLPALAPAPGQRGRGAEDKGGALKLTVETALRPRGEERIRFRPPPML
                     ARGGVPAYLQDCEELGACTPVPADAPLTRSWVFRRGGAAGGCRVENAGCDGADEDDEG
                     TLHSALRYNDVLNGNAYPGEPLCVLVPGLFLYSEPTIEQVLQFDVVVNVAKEITDFTS
                     QIPEGSGTQYYHFKWSHTSKICSNLEELTALIHTALCDGKRVLVHCQCGVSRSASLIV
                     AYIMRYRSMPLNDAYNYLKNVAKDISPNMSLIFQLMEWGEQLKSKDGHSSCSPASCSL
                     SSLASENLSEQPRSCRPRSAVGPKSAFSSPDISSDLSPENTPRTPMEFLNAPSLSQKY
                     PQTAEQSEPSKHDPLQLGSELCMKCSVVLDTFSQPSAEVVDKNW"
     gene            <273826..>277116
                     /locus_tag="AGOS_ADL244W"
                     /old_locus_tag="ADL244W"
                     /db_xref="GeneID:4619987"
     mRNA            <273826..>277116
                     /locus_tag="AGOS_ADL244W"
                     /old_locus_tag="ADL244W"
                     /product="ADL244Wp"
                     /transcript_id="NM_209205.2"
                     /db_xref="GeneID:4619987"
     CDS             273826..277116
                     /locus_tag="AGOS_ADL244W"
                     /old_locus_tag="ADL244W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL112W (HOS4)"
                     /codon_start=1
                     /product="ADL244Wp"
                     /protein_id="NP_983852.2"
                     /db_xref="GeneID:4619987"
                     /translation="MSDQDKQDGTGQVKKRSLSSYLLNVSARKAELENLAKHEKDGPI
                     SASIGDRNEAANAGGIDDSPNQQGSGGQQASEERPAMPAINAEELEGGTSQELLARGD
                     KNAKAVSEDVSVAAGALETQKPARWQECGGENGTVEKEQDDPREPHGTVMHAEGTAPG
                     GAASVASDAVDDERAQQRSEVLDAVGPWVESQRIDSVTTAGWAKNDEQESSLSEIDSD
                     APTEPASPPKPRLGRLVRGDQLGSAPSNAKWHTRPAAATHDSDSELSDLADLKPVPLS
                     SSILHGESSPTKAQSAVSSSPKKALPHPAHSTYSKSNSSSSKKMKHVAVSKIVKPRKG
                     VYRDAGGRTRLQVACDKGKYDLARKLIEEGYDVNDQDNAGNSPLHEAALNGHLEVVKL
                     LIRHGANVNIQSYEMFKDTPLIDASANGHLDVVRELLQNGADPTIVNAKGLTAIESIE
                     DDSDLDEEEVQIVREIKALLRKSARKHKKEDGDVKSLPQRSKAKEGHSEEDESVQGSA
                     AFDKDFYWTDITSKLGKEKLFRASKEGRLAYVGAYLENGGHADFRSFMESVKFGHEDI
                     ASLFLAFGAQVNAVGRDGQTALMAAVGRGHLNTVKLLLEAGADPTKRDKDGHSVLYYA
                     RHSPLGLVDDKELTKLRDAILENNGVLSEEDKLCLDKDHGKTTPLNVKLEEQEALTQI
                     KSSSNVKEKLPEKPESPLHSTKANPTKERIGSSPTYHLSPKSEKTREQTPMRAHISEH
                     EVVTDDEKGDYSSVKVKKRRIGSPSAAAASDDRSYRPATSEKARTASPHKLKRSVSAV
                     SISSDTAESGTKRSKLEGLSSTHSQQQETPEERDARLKREEQYKLKRLESKRKKEQEF
                     LQKLADDERKREEEKERAEQERRRQQEEERLRKTQQEQLLRDQQEIEKRIAIRDQYPL
                     GLKLVDFQNHTDYNRYLPVPYIVREGARYLLDLHAAVLCKNPEISRGATRAVPVAPEN
                     LPQLWNIYKFLFLYGGYGPGHYLVDFSHLSLEEQLQLEHQEYLRFVRIPLHWLPYDDI
                     PWPSSELRTAVDASMRELQLLAPPHVAPAPLDLSRTPQSVPSAPTPAKFRHRPAIAVW
                     LSGVTSLW"
     gene            <277412..>277976
                     /locus_tag="AGOS_ADL243W"
                     /old_locus_tag="ADL243W"
                     /db_xref="GeneID:4619988"
     mRNA            join(<277412,277525..>277976)
                     /locus_tag="AGOS_ADL243W"
                     /old_locus_tag="ADL243W"
                     /product="ADL243Wp"
                     /transcript_id="NM_209206.1"
                     /db_xref="GeneID:4619988"
     CDS             join(277412,277525..277976)
                     /locus_tag="AGOS_ADL243W"
                     /old_locus_tag="ADL243W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL052W (COX5A) and YIL111W (COX5B); 1-intron"
                     /codon_start=1
                     /product="ADL243Wp"
                     /protein_id="NP_983853.1"
                     /db_xref="GeneID:4619988"
                     /translation="MLRSSISRVVRVSPVRHAQTQAISKAAIADLHSRWEDLPAAEQN
                     DIVAKLSERQKLPWKELTDTEKQAAWYISYGAWGPRRPVHGKGDAAFIAKGVALGVAL
                     TALCFGLVRMGAADAPKTMTKEWQLKSDEYLKSKNANPWGGYSQVQSK"
     gene            <278360..>279478
                     /locus_tag="AGOS_ADL242W"
                     /old_locus_tag="ADL242W"
                     /db_xref="GeneID:4619989"
     mRNA            <278360..>279478
                     /locus_tag="AGOS_ADL242W"
                     /old_locus_tag="ADL242W"
                     /product="ADL242Wp"
                     /transcript_id="NM_209207.1"
                     /db_xref="GeneID:4619989"
     CDS             278360..279478
                     /locus_tag="AGOS_ADL242W"
                     /old_locus_tag="ADL242W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL110W (HPM1)"
                     /codon_start=1
                     /product="ADL242Wp"
                     /protein_id="NP_983854.1"
                     /db_xref="GeneID:4619989"
                     /translation="MSFSFGFANAELSDDELLPNSFEVGNEGAQESSNKIGNPLDAEW
                     LKSTDIPQPTLVHLDKLLESLTNVRVSFEEVHTPQRAIKLFRRELFDVKHQLMSEVDA
                     ESDSPDHKAELDILMGETNEDVRKNVYEGGLKSWECSLDLVDFLGLQDPKSSPCIAEL
                     GCGTALPSQYLFLQYLQQESHLGLTLLLSDYNESVLRLATLPNLIITWAKQVLSQEQW
                     AALQLSRDENIAIMQDELLLTQELLSAFRSDLEQKKIELYFISGTWSRGFLNLLKEIR
                     WSPSSELLLLTSETIYQPETLPVIAELILDLISEARRGGYSARAYAAAKDIYFGVGGS
                     VAEFEQYVTSKTLERSLPLQLTTHKVNAGLKRSIIAIE"
     gene            <279620..>280777
                     /locus_tag="AGOS_ADL241W"
                     /old_locus_tag="ADL241W"
                     /db_xref="GeneID:4619990"
     mRNA            <279620..>280777
                     /locus_tag="AGOS_ADL241W"
                     /old_locus_tag="ADL241W"
                     /product="ADL241Wp"
                     /transcript_id="NM_209208.1"
                     /db_xref="GeneID:4619990"
     CDS             279620..280777
                     /locus_tag="AGOS_ADL241W"
                     /old_locus_tag="ADL241W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL051W (COG5)"
                     /codon_start=1
                     /product="ADL241Wp"
                     /protein_id="NP_983855.1"
                     /db_xref="GeneID:4619990"
                     /translation="MSDSAELQDFEVLLEDNFNHSQFARELIRAINNKFDTTKLDLYT
                     PLKQVNYDIVEVDKRIDRIIKDEPLKLLEQLDKRKLGREKVGTTLKPSLDYLTASFER
                     LQTAVLEPYEDALKLQSALGKIHQTSHLLRDALIYMHMAAQVESLPLQVKDPSRVSHL
                     STLFSQLRINLEQNPNLRSLQLIKKLEEGPLREKRGALLKYVLETLLGYCEDNHKLKH
                     NLPEVQKLLVTLYSLSPREFSAVLDKVALKKIQASHQALTKTITAVRTLNTVMEDVVS
                     NGVALHHLEKTLEEIPLETTTLHAEYISRKKYSSITANYWIQVANAYKREFEISYRRG
                     GPVGKSLSNNAVFIRNTITESMKKGWNIDGLKEYQEALLASISILDNRRKT"
     gene            complement(<280857..>281753)
                     /locus_tag="AGOS_ADL240C"
                     /old_locus_tag="ADL240C"
                     /db_xref="GeneID:4619991"
     mRNA            complement(join(<280857..281562,281731..>281753))
                     /locus_tag="AGOS_ADL240C"
                     /old_locus_tag="ADL240C"
                     /product="ADL240Cp"
                     /transcript_id="NM_209209.1"
                     /db_xref="GeneID:4619991"
     CDS             complement(join(280857..281562,281731..281753))
                     /locus_tag="AGOS_ADL240C"
                     /old_locus_tag="ADL240C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL050C; 1-intron"
                     /codon_start=1
                     /product="ADL240Cp"
                     /protein_id="NP_983856.1"
                     /db_xref="GeneID:4619991"
                     /translation="MIFFTSKSVSREEVFANCSDVSDGEASPVLPSIELEFFDAGPQE
                     VHAADDNQAKEDEFDFPLFSFGMASKVPDDPQNEDASNDNDEPRGRDSTTKLMKVTLR
                     SPSPEVINNQRPRTYYFAEYSAQELMRFQSAAIQYDQIITEASKDAACSRSLHRRRIF
                     DLKYHNDKIEAEIQRALKNKKRRPGKKQRLARKQGTIRNAEREAQAKEIKKMIKKKFH
                     KRGGKKNKKKDSVAADVKPKFRTE"
     gene            complement(<281872..>284547)
                     /locus_tag="AGOS_ADL239C"
                     /old_locus_tag="ADL239C"
                     /db_xref="GeneID:4619992"
     mRNA            complement(<281872..>284547)
                     /locus_tag="AGOS_ADL239C"
                     /old_locus_tag="ADL239C"
                     /product="ADL239Cp"
                     /transcript_id="NM_209210.1"
                     /db_xref="GeneID:4619992"
     CDS             complement(281872..284547)
                     /locus_tag="AGOS_ADL239C"
                     /old_locus_tag="ADL239C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL109C (SEC24) and YNL049C (SFB2)"
                     /codon_start=1
                     /product="ADL239Cp"
                     /protein_id="NP_983857.1"
                     /db_xref="GeneID:4619992"
                     /translation="MSGHKKRVYPEAQYQYGAQPAAPSQGFPPGPAMSPPMQAQQFLT
                     PAQQQLHQQIDQATSSMGNMNLHNVPVVDPSTFYQAGVASPPVAPHAVAGTQYNEQPY
                     GHMSIGKPMNQLYPIDLFQELPPPITDLSLPPPPLLVPAERIVVPSEEANASPDYLRC
                     TLNAIPKTNGLLKKSKLPLAMVIRPYLHLEDSIDPPPLNMDGCIVRCRRCRSYINPFV
                     TFLEGGRRWRCNFCNLANDVPQAFDMDMQGVPINRYDRNEIQRAVVEYLAPKEYAVRQ
                     PPPSCYAFVFDVSQNAIKNGLLATAARTLLESLDSLPNYDERTRITILAVDHTIHYFS
                     VPLDEEGDHIRMMDVVDLDEPFLPMPDTMFVSLKDCRNNLEKLLSQIPDIFQSNILPK
                     FALGPALKAAHNLIKGIGGKIIVVSATLPNIGIGKLNKRNEASVANTSKEASQLLSCG
                     DSFYKNFTIDCNKTQVTIDMFLASDDYVDFASVSNLGRYTGGQTHFYPGFTALNMIDV
                     TKFSKEFSKHITMDLSMEAVMRARGSTGLRMSRFYGHFFNRSSDLCAFPTFPRDQSYV
                     FEISIDEQIVRDYVYLQIAVLLSQNTGQRRIRVITVCIPTTDSLAEVYASADQLAMTV
                     YHSQKAIEKVMSSGFEDAREYLDRSVQEVLATYKKEIAMSNTAGGAPLRLCANLRMWP
                     LLMHSLTKHMAFRSGIIPADHRAAALNALESLPLPYFIKNIYPSVYSLHDMPDEAGLP
                     NENGEIVLPQPINATSSLFERYGLYLLDTGMDMFLWLGGDAVPELVMDVFGTQDIMQI
                     QVGKGELPILENSEFNERVRNVIVKLREHDDIITYPTLHIVRGASPSEPMNHASAREV
                     ASLRLWATSQLVEDKVQSSFTYREFLQSMKTKTSK"
     gene            <285308..>287368
                     /locus_tag="AGOS_ADL238W"
                     /old_locus_tag="ADL238W"
                     /db_xref="GeneID:4619993"
     mRNA            <285308..>287368
                     /locus_tag="AGOS_ADL238W"
                     /old_locus_tag="ADL238W"
                     /product="ADL238Wp"
                     /transcript_id="NM_209211.2"
                     /db_xref="GeneID:4619993"
     CDS             285308..287368
                     /locus_tag="AGOS_ADL238W"
                     /old_locus_tag="ADL238W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL108W"
                     /codon_start=1
                     /product="ADL238Wp"
                     /protein_id="NP_983858.2"
                     /db_xref="GeneID:4619993"
                     /translation="MASIELFNLVDGYEVYSPALVIHGRCRSEKASSIQVHHPELPFL
                     TYQVHCQTFKALVHLVPGANVLTFTTDENEHITVTCTYAPQAEAPPIHLCILVAKDSP
                     MVFDSPAVQRQREGGCGMDLAIKKLRCGARLMQAFTNEQMLRNGFGHRCFQFAEEVTT
                     DTLFREPKERRTIKIHIVRSKLSTAEIRDPNLAQQNPNGSNTGGLFNVALEALQEYGG
                     PFGDSSQPVQAAVIFMDTHWDPQAKLITAHAALGGGAGHIRLAIFGSHGLYSWPPSLE
                     LVPYYMSDPTPSSIMEVANDCNECGTHWECLTVTLGAFMHEIGHLLGCPHQEHGVMLR
                     DYVTLNRSFMTMEGYSSRTNSCGAPAPIRPAEECTWHRLDLLRFLYHPSFANPTNYSD
                     PSFKGVGVLSNFPFPRPTLYPCGNRQAVVSAQGGIYCIELISGDLARAHIEYLPLSLG
                     GQGPQTDVLLSLDDLRARIPQQHLVDCKGIFKVAVHAVNSESAEFDDFPSKIYAQEIS
                     MAPYGYPALVTGIKGTMLGNPEGGGDAGIISIFPREVEAVRVYHGYALDGIRFYFRSP
                     QQINDDAAGSHDYFRKLKNSLKGPSRNRSASALFGRETNNYSDFVLSPDESLLGFNVR
                     SGCWIDAVQIITSQGRTSPLFGNTSGGGLGTLVPPTGYEVLALHGRVGQWVDAMGIIY
                     GNGG"
     gene            complement(<287522..>289792)
                     /locus_tag="AGOS_ADL237C"
                     /old_locus_tag="ADL237C"
                     /db_xref="GeneID:4619994"
     mRNA            complement(<287522..>289792)
                     /locus_tag="AGOS_ADL237C"
                     /old_locus_tag="ADL237C"
                     /product="ADL237Cp"
                     /transcript_id="NM_209212.1"
                     /db_xref="GeneID:4619994"
     CDS             complement(287522..289792)
                     /locus_tag="AGOS_ADL237C"
                     /old_locus_tag="ADL237C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL107C (PFK26)"
                     /codon_start=1
                     /product="ADL237Cp"
                     /protein_id="NP_983859.1"
                     /db_xref="GeneID:4619994"
                     /translation="MFKSVTYSEDKHLTDTDSEVEPHDTSKHRGRRHGAAGSGEESKH
                     VRLDVEGVPGLVQPEDAEEPGELPAFKRRPLSDTPLASQWASPTSSGESSTESTPVLS
                     PSHSSGDLQGLDNKTEARASGNGGLPRVRRKAPTTMDVPGLTRSKTSPDGMISKHDPG
                     SKLVVVMVGLPATGKSFITNKLSRFLNYSFYYCKVFNVGNTRREYGKQHELMEQDSRF
                     FDPSNDEAKALREKWAMDTLNELLDYLLDGPGSVAIFDATNSTQERRRKIYDKIKSRN
                     SQLNVLFLESICSDRQTVEKNIRLKLLGPDYKGKDPELSLRDFKDRLANYVRAYEAVE
                     DSEGFQYIKMIDVGKKVISYNIQGFLASQTVYYLLNFNLAERQIWITRNGESEYNVLG
                     RIGGDSKLTPRGRKYARALAQFIDSKRREFNEHEYEQFCKLNDEGTPTDEFVPTSFYV
                     WTSMLRRAEDTAADFNEDIFPIKQMRMLDELSAGDCEGMTYEEIHQKYPEEFEERLID
                     KLRYRYRGIGGESYMDVINRLRPVITELERITDNVLIITHRVVARVLLGYFLNLSRDI
                     IANLDVPLHSVYCLEPKPYGITWSLYEYCDETDTFSKVPQTQLNTMKVKEVGLVHNER
                     RYSLVPAAPPTNNSDDIPLQSRNSSGISLPPYSSSSSSTTPSISSGGISVTSRMVPPL
                     RQPPAYQTHPSFLARSKSDDPLTKRLLNPNKHSIELQKLHEKLSVLRANDHISSGDDE
                     DNDNNDINGSEIGGTP"
     gene            <290422..>291364
                     /locus_tag="AGOS_ADL236W"
                     /old_locus_tag="ADL236W"
                     /db_xref="GeneID:4619995"
     mRNA            join(<290422..290441,290494..>291364)
                     /locus_tag="AGOS_ADL236W"
                     /old_locus_tag="ADL236W"
                     /product="ADL236Wp"
                     /transcript_id="NM_209213.1"
                     /db_xref="GeneID:4619995"
     CDS             join(290422..290441,290494..291364)
                     /locus_tag="AGOS_ADL236W"
                     /old_locus_tag="ADL236W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL106W (MOB1); 1-intron"
                     /codon_start=1
                     /product="ADL236Wp"
                     /protein_id="NP_983860.1"
                     /db_xref="GeneID:4619995"
                     /translation="MSFLQNFHLSPGQTIRSTRGFKWNTAKQQDGGGYGAGSGHLTAG
                     GGTGTLLGAHAITSTAVEASPGGLFTTPQKPTMSQPITDFNYTPSHQKPYIVQSPGTV
                     VTSHKDIKQIVETTLGSEGVLNQAVKLPKGENLDEWIAVHCVDFYNQINMLYGSITEF
                     CSPQTCPRMIATNEYEYLWNVYPGNPPVSVAAPKYVEYLMNWCQQQFDNEDLFPAKTN
                     VPLKNGFNDKIAKPILKRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFSEEFH
                     MLKPSDYGPLLELVEEFKDR"
     gene            <291551..>293299
                     /locus_tag="AGOS_ADL235W"
                     /old_locus_tag="ADL235W"
                     /db_xref="GeneID:4619996"
     mRNA            <291551..>293299
                     /locus_tag="AGOS_ADL235W"
                     /old_locus_tag="ADL235W"
                     /product="ADL235Wp"
                     /transcript_id="NM_209214.1"
                     /db_xref="GeneID:4619996"
     CDS             291551..293299
                     /locus_tag="AGOS_ADL235W"
                     /old_locus_tag="ADL235W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL048W (ALG11)"
                     /codon_start=1
                     /product="ADL235Wp"
                     /protein_id="NP_983861.1"
                     /db_xref="GeneID:4619996"
                     /translation="MESCWLTMESYQAALVVCIVSGLILAVAGYGNVRRLACEFLLKP
                     PKRFRDDICEALLRGPENDQKPVLVDFGWRHGAVRRQMLLASAKASAYSNERHGSKIH
                     ISPDDIARGRSFADALDVHRRSGRILFGFFHPFCNAGGGGEKVLWKAVETTLKQSLNN
                     IVVVYTGDCDTTGARILSNVEHRFGSQLDSERIVFIFLRHRKWVESRTWPRMTLLGQA
                     LGSIVLSIEAALCCPPDVWCDTMGYPFGYPFVSWLCRIPIITYTHYPVVSIDMLDKLR
                     MMPEFRNSPTLWAKFLYWRIFMRCYTFAGSFVDLAVTNSTWTYNHINAIWSRTGNVSI
                     IYPPCSTENLVIENAHDMWDRKHQAVVIAQFRPEKRHALILRSFSNFVKKTGSNMKLL
                     MLGSTRGQEDRDYVKKLEQLAYSELAIPKESLEFITDCKYEKMKKYLQESSFGINAMW
                     NEHFGIAVVEYAASGLITLAHASAGPLLDIIVPWDIEGDKQLERGSDKNRTGFFFKDR
                     SDPDFCKITAEFPTLEELFVRADQLTDEERLAISQRAKRCVLHKFSDLKFSEDWAQVV
                     DRTIQLLHTLRNDKVE"
     gene            complement(<293563..>295773)
                     /locus_tag="AGOS_ADL234C"
                     /old_locus_tag="ADL234C"
                     /db_xref="GeneID:4619997"
     mRNA            complement(<293563..>295773)
                     /locus_tag="AGOS_ADL234C"
                     /old_locus_tag="ADL234C"
                     /product="ADL234Cp"
                     /transcript_id="NM_209215.1"
                     /db_xref="GeneID:4619997"
     CDS             complement(293563..295773)
                     /locus_tag="AGOS_ADL234C"
                     /old_locus_tag="ADL234C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL105C (SLM1) and YNL047C (SLM2)"
                     /codon_start=1
                     /product="ADL234Cp"
                     /protein_id="NP_983862.1"
                     /db_xref="GeneID:4619997"
                     /translation="MPPAGPARRVNASWAQFRTVTNIRAPRNTTPQLLLPLPQSRLAA
                     PAPGAAATDPAVGPPQARQSCTRRNPGRALIKGGAYGRRVRTRGLRWRRRAAIVCRGE
                     QKNWRAGAQESENTVLDQDKTQSNLTWTGHTGWAMSYNNTMTSNGTEMRSPVYLGPEQ
                     AAGRPAAAKAVDTVLQEGFGAGQGVVQGTVNSQTLESLRQHTRNASTFSSTSAGLGRT
                     RASLQRQRAGQTDPRSPLVTLMPVNANPTEVLAGRFASWRAVIKAIIVYLTETASIQD
                     ELVRQHLRLSHAVSFPFFSVENVRQPSTPEEKAIQQFFLPLGSGSIQDLPTILTGYHA
                     QMASMASKASKELTNEVIPRLEDMRRDLLVKIKEIKSLQSDFKNSCAKEVSETKQMLR
                     TFHESVEQARYGTPKSDPYLTRILLDKQLKRQLAEENFLHQAFNNLQASGKELEKVVV
                     MEIQSALTVYARILGREAQLVFDSVITKLDMGFLSRDPVFEWDDFIARDPNFVEPSVP
                     MRSLKDITYKHQYDPLTYKLQCGFLERRSKFLKSYSRGFYVLTPSFLHEFKTCDRKKD
                     VSPVMSLSLSDCTVAEHSKRDSSDFKFILHAKQNGIIHRGHNWVFRVDSYDTMMEWFN
                     NIKKLTSISNPTEKAKWITEHLNLDVNGRPKRHSLLRDNQSTTTTRTSSNLDSPNNAV
                     QYMPNYDGHTNTNTTLSSPGTSYILESPGGATIQIPLSNKKEANNSLLPPKPVS"
     gene            <296204..>298075
                     /locus_tag="AGOS_ADL233W"
                     /old_locus_tag="ADL233W"
                     /db_xref="GeneID:4619998"
     mRNA            <296204..>298075
                     /locus_tag="AGOS_ADL233W"
                     /old_locus_tag="ADL233W"
                     /product="ADL233Wp"
                     /transcript_id="NM_209216.2"
                     /db_xref="GeneID:4619998"
     CDS             296204..298075
                     /locus_tag="AGOS_ADL233W"
                     /old_locus_tag="ADL233W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL045W (LAP2)"
                     /codon_start=1
                     /product="ADL233Wp"
                     /protein_id="NP_983863.2"
                     /db_xref="GeneID:4619998"
                     /translation="MKLPAVLEERRAAATDRSTLSNYEDFAVRHTNLELEVAFDERQI
                     RAEVCYDLEQTGKGVAEVHLDTSYVQLECILVDGKRVPWELRERQEPLGSQLVITPEG
                     GLPARFQLTCRSVTTARSTAVQWLGGAQTAGKPYVYTQLESVHARSLVPCFDTPACKS
                     PFTVRVRSPLRAVVAGQEQPGSGKDGVYVFEQPVPIPIYLLGLAAGDIACAPLGPRSN
                     VYCEPALLEAAAGEFGGEIERFLDAAEELLPRYIWGNYNLLVCPSSYPYGGMEVAGTS
                     FISPSVIAYDRSNNDLIVHEMAHSWSGNLITNANWGHFWLNEGWTVYLERRITGALHG
                     EDTRQFSSLLGMAELEVAIRASNGASFALVEDVSESVNPDNVVSLAAYEKGSALLLHL
                     ERELGGTAAFDPFIKHYFGKFGGQSLTTWQFLDILFDFFADKREKLERIDWKTWLFAP
                     GMPPKLTYSTSLADDVYDLAEQWLEKAVQLRLPEEFAAEFSGSVLAAFTTAQQILFLN
                     TIIQGGVSPDNTFDWTQHPVAAAALLSVYADTLGKSRNQEIIYRRYNFQLTAGMEDAY
                     PEITTWLGSTGRMKHVRPIYRRLASIDKALAASTFQEHREKYHPICRAAIQADLGLS"
     gene            <298270..>298852
                     /locus_tag="AGOS_ADL232W"
                     /old_locus_tag="ADL232W"
                     /db_xref="GeneID:4619999"
     mRNA            join(<298270..298293,298346..>298852)
                     /locus_tag="AGOS_ADL232W"
                     /old_locus_tag="ADL232W"
                     /product="ADL232Wp"
                     /transcript_id="NM_209217.1"
                     /db_xref="GeneID:4619999"
     CDS             join(298270..298293,298346..298852)
                     /locus_tag="AGOS_ADL232W"
                     /old_locus_tag="ADL232W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL044W (YIP3); 1-intron"
                     /codon_start=1
                     /product="ADL232Wp"
                     /protein_id="NP_983864.1"
                     /db_xref="GeneID:4619999"
                     /translation="MNYLSNISQASRLADSINVDRIKTELGSIPSRLSTMRPPREFFN
                     VRRFSKPQNFGEVQSRVGYNLRYYSTNYTAIVILLFIYTLLTNLLLFFVIVFVVAGFT
                     GINRLQGADLSTPFGPITTSQLYTGLIGIATVLGIFASPFSTLMWLVGISAVTIFSHA
                     SFLEKPIETVFEEETV"
     gene            <299206..>300303
                     /locus_tag="AGOS_ADL231W"
                     /old_locus_tag="ADL231W"
                     /db_xref="GeneID:4620000"
     mRNA            <299206..>300303
                     /locus_tag="AGOS_ADL231W"
                     /old_locus_tag="ADL231W"
                     /product="ADL231Wp"
                     /transcript_id="NM_209218.2"
                     /db_xref="GeneID:4620000"
     CDS             299206..300303
                     /locus_tag="AGOS_ADL231W"
                     /old_locus_tag="ADL231W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL042W (BOP3)"
                     /codon_start=1
                     /product="ADL231Wp"
                     /protein_id="NP_983865.2"
                     /db_xref="GeneID:4620000"
                     /translation="MHDALSRDTAAEESQEISRKSSVSSQKEAVPAISSLLGPQVANW
                     PYSETSLIHALELKVEQEKTKQQYYKLENVNRSIDLVKTALEAQVPGHFIPLLFKYMV
                     NEDAKHDVLGEIGNWGPAGPTRNAAGAMPVAEARTKAPVGYRFPPETHILAPEEGTPV
                     RAVARSPTVKNERRKTRSPARSSTADDRDRALSKLAQDNEGERKLRSAFLAPAPLHGS
                     RGHRRNISLPSLQLYHRQTPLQQATGSPEKKPLRTVLNFGSWQSYNPHLQKTISSQQG
                     VRKHRRARSASTFGVIDLNQAPQSRPTDADTRSRRSTRPQSPRSTPESGKPPASNTYD
                     LECENFNLPSEPGTHETPMRKPNFANDLLNS"
     gene            complement(<300366..>301826)
                     /locus_tag="AGOS_ADL230C"
                     /old_locus_tag="ADL230C"
                     /db_xref="GeneID:4620001"
     mRNA            complement(<300366..>301826)
                     /locus_tag="AGOS_ADL230C"
                     /old_locus_tag="ADL230C"
                     /product="ADL230Cp"
                     /transcript_id="NM_209219.1"
                     /db_xref="GeneID:4620001"
     CDS             complement(300366..301826)
                     /locus_tag="AGOS_ADL230C"
                     /old_locus_tag="ADL230C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL104C (SHQ1)"
                     /codon_start=1
                     /product="ADL230Cp"
                     /protein_id="NP_983866.1"
                     /db_xref="GeneID:4620001"
                     /translation="MLTPKFKLTQDEEYIYVDISISSIRFNASGLELVVDDTLFVFHL
                     SPYYLRLRFPHALVDDERCKAEYKAADESIFIKIPKLNKGEVFEDLDLPTKLLARHGE
                     VLAADAVAQAQDSGPRGPLIQEISSTETQPDKSTEDTLASGEEFNWEIKQVPHVEGVS
                     ALQTRYGFDNQYDSVIGVSISNGNDINELDDPEHTGPNERVLERIRKENLKFDPEYYI
                     SEYMTCKYGSGEDLDINGIKSLLQYVPPFPKMYLKWYKHAEDKSASFPVEFSPKEDEL
                     MRNELPKKSYLIQDTTQLYVAILSLLFAHTFEQVENEGIHNTESAWTIGKLTPQIACL
                     DLQLLPGEVIQEFPVVRAAVVAGTRRALAYPLHRNFDLVCKCWNYVYYLLRAGKRLIL
                     RALLDIYELYRLHEVYYVYNKVFLGDLCSWFVSNGNENVTRSLAFELKKELGTLTKTA
                     IDFDCLTGCDESGELTSENLTLAEMELLAEAEYQQT"
     gene            <301968..>303248
                     /locus_tag="AGOS_ADL229W"
                     /old_locus_tag="ADL229W"
                     /db_xref="GeneID:4620002"
     mRNA            <301968..>303248
                     /locus_tag="AGOS_ADL229W"
                     /old_locus_tag="ADL229W"
                     /product="ADL229Wp"
                     /transcript_id="NM_209220.1"
                     /db_xref="GeneID:4620002"
     CDS             301968..303248
                     /locus_tag="AGOS_ADL229W"
                     /old_locus_tag="ADL229W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL103W (DPH1)"
                     /codon_start=1
                     /product="ADL229Wp"
                     /protein_id="NP_983867.1"
                     /db_xref="GeneID:4620002"
                     /translation="MSTADEVTKKPRRRFVGVSRGENKVSTKQVSGDEAKELVRSAKS
                     NTGARRAINQIPDEILNDENLQEAIKLLPSNYNFEIHKTVWNIRKHNAKRVALQMPEG
                     LLIYSLVISDILEQFCNCETVVMGDVSYGACCIDDFTARALGCDFIVHYAHSCLVPVD
                     VTSIKILYVFVTIGIDEDHLMKTLQKNFAKGTSLAVFGTIQFNPAIHSIREKLLYSES
                     HMLYITPPQIKPLSKGEVLGCTSQRLPKEQFAAMVYVGDGRFHLESAMIHNPDIPAFR
                     YDPYSRKFTRETYDQHQLVEVRSSAIEKARNSQCFGLILGALGRQGNLATVANLEKKL
                     RAAGKKVVRIILSEIFPQKLAMFDHIDAFVQVACPRLSIDWGYAFNKPLLTPYETNVM
                     LGQDRMFNEKYYPMDYYEVNGYGRGKQPTHDNVI"
     gene            complement(<303288..>305708)
                     /locus_tag="AGOS_ADL228C"
                     /old_locus_tag="ADL228C"
                     /db_xref="GeneID:4620003"
     mRNA            complement(<303288..>305708)
                     /locus_tag="AGOS_ADL228C"
                     /old_locus_tag="ADL228C"
                     /product="ADL228Cp"
                     /transcript_id="NM_209221.2"
                     /db_xref="GeneID:4620003"
     CDS             complement(303288..305708)
                     /locus_tag="AGOS_ADL228C"
                     /old_locus_tag="ADL228C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL041C (COG6)"
                     /codon_start=1
                     /product="ADL228Cp"
                     /protein_id="NP_983868.2"
                     /db_xref="GeneID:4620003"
                     /translation="MDFLDYQAYGVPLTGTDDELLPEPASNLSLLAASGPSVSELNTS
                     IQGDSTPPLLNTDSNFNFEGKDNLHERMEMYSELTVKLLPIQPGLVRDIFEDVTPQSS
                     DFQHLLKKGNNVTSAVLVKRLSHVLNDMNHPNYQSDLQLKKALMILQDNQGVLGLDGS
                     KLVRPDFLGSLSRKTLRSQLEKELLKDHLATLENFQPIARRIMRLRQPVKNIQEISEK
                     VLDAQEAQNKSPLQDPLVSEVREKLEMLKLKKRVLVGIRESLTLNQLEDEQLRNGEIE
                     DSYLDVLDKMMEIKERSTYLIAMNYEKAGKALLGNINQYLQLANKRIYNYLLGFLYDY
                     ESNTKTFGERNFEGDNVGLSLFQRCLVYLSNDLEYFNDFMKKVTSMRSKKLLDEFLIP
                     FVIDNNEGRSIILSAHDPARYLGDVLAHVHSLLANEGDFLKSLFKYQEERMADMTQSI
                     FQKNKDILQSLHVNMLNDIMSTLSNSVRIRLEQIVRFEEEATVTFDISQLLSLYKLMF
                     TKQGMLDDNKLVKVFDDLAVLAKTKTMNYYTEFLSEAVKEEPEVTDLLPPKWLSKYLS
                     DLTALFDKINGSSEQTGIVDKNFFTKLVKTPCESTFLKQAELCFPLAKKDRRVKFDLL
                     VLEINGLDMIVSRLGPYRTNIFSDEYGSEVYDSLKRSLDTLLGQLEVHQTRNILESTG
                     LELYYNLFNMIFPVASVQDPLDYDMYLSAQENQIMKLETIETNIAQKLSDYLPKALLD
                     VQDTWLLYLASPKFADDIASRSFHVFANFYVVFKSVLLNIFPDDHQRINSIFIYSEEE
                     VKMLLGIN"
     gene            complement(<306217..>308226)
                     /locus_tag="AGOS_ADL227C"
                     /old_locus_tag="ADL227C"
                     /db_xref="GeneID:4620004"
     mRNA            complement(<306217..>308226)
                     /locus_tag="AGOS_ADL227C"
                     /old_locus_tag="ADL227C"
                     /product="ADL227Cp"
                     /transcript_id="NM_209222.1"
                     /db_xref="GeneID:4620004"
     CDS             complement(306217..308226)
                     /locus_tag="AGOS_ADL227C"
                     /old_locus_tag="ADL227C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL101C (XBP1)"
                     /codon_start=1
                     /product="ADL227Cp"
                     /protein_id="NP_983869.1"
                     /db_xref="GeneID:4620004"
                     /translation="MARQVNYPCTALERAGRVELTGHAVDDYQRCFFLQLGRQEGGGL
                     LERANRAMSVRTASYRTNSAVQFYDVGAPDAARLAGAAGARKERRTLECFEYQIPDIT
                     QGGEAGDGRGWDGLAVEAGSVIKVLEPRGAAAPDISFLTKNQQFKLHKMHYSEQAGHV
                     INPNNVILWDYKTGYVFFTGIWRLYQDVMRGMCNLPRVGTRGEEENSQQRQWQCYKEL
                     EYSLKACLYEPYGSKVRPEAGHRRQRLSSSRTPHTSASNCSSASINTHTSSAVASGSS
                     YTDVHWNQVDPTWKQRLCRLYQQEKNLDFTPEFQDCYKRIRGGYIKIQGTWLPMEICK
                     RLCIRFCFPIRYFLVPIFGEGFLQECHNWYFTHRLKQDLCSSTLSPPIADVALAAVET
                     SYTLVTGKAMDYASISPRSTSIPQTVLPTVKQESSDTELLDASQNLLDISRRTSLQSD
                     HYVSPNTPPSMLAAPTYSRAFVRQGSERYSLDLNPSCQLKGAHRDGRPVAGYKERSCS
                     WSSSTSPLGSVQRQESLPPISTLINSLPNFNLEAAEMPNSLALEYKKERQELQASFSS
                     YPRTNYPSQLPLNHICSNFNGGKAPDSLQKPTAYHSFSHLLGMQEQSAHSPDTPQLRA
                     RKIPTDAPAGVGYSSVAPDWATLCAASEALCSYTEGVSIGYNERA"
     gene            complement(<309113..>309742)
                     /locus_tag="AGOS_ADL226C"
                     /old_locus_tag="ADL226C"
                     /db_xref="GeneID:4620005"
     mRNA            complement(<309113..>309742)
                     /locus_tag="AGOS_ADL226C"
                     /old_locus_tag="ADL226C"
                     /product="ADL226Cp"
                     /transcript_id="NM_209223.1"
                     /db_xref="GeneID:4620005"
     CDS             complement(309113..309742)
                     /locus_tag="AGOS_ADL226C"
                     /old_locus_tag="ADL226C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL036W (NCE103)"
                     /codon_start=1
                     /product="ADL226Cp"
                     /protein_id="NP_983870.1"
                     /db_xref="GeneID:4620005"
                     /translation="MTQGPLFSLSPASTLDDLLEANQRWRRQQEQRKPALFRSHAAGQ
                     TPHTLFLACCDSRYSEACLGVEPGEAFTYRTIANIMDPADPGFRAALEFALHVLQVSR
                     IVLCGHTNCGGVSTCLTGTRRALATPQCSSLHAHLDSLDALCSANKPALASLPPAVQA
                     EQLVIANVRAQYRALSQDAAVRAAVQQRHLTLHALLYHVDTGALTVVAP"
     gene            <310366..>312186
                     /locus_tag="AGOS_ADL225W"
                     /old_locus_tag="ADL225W"
                     /db_xref="GeneID:4620011"
     mRNA            <310366..>312186
                     /locus_tag="AGOS_ADL225W"
                     /old_locus_tag="ADL225W"
                     /product="ADL225Wp"
                     /transcript_id="NM_209224.2"
                     /db_xref="GeneID:4620011"
     CDS             310366..312186
                     /locus_tag="AGOS_ADL225W"
                     /old_locus_tag="ADL225W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL099W (SGA1)"
                     /codon_start=1
                     /product="ADL225Wp"
                     /protein_id="NP_983871.2"
                     /db_xref="GeneID:4620011"
                     /translation="MDKIQTTYTGRRSRSQWVRSPWTLTVVSLAIIWFFHDAFLSFGA
                     ANAGSGGETAAAAIWDFFRSAETVTVVDFNNRAAAPAGSLQRRLRLRDITPGTISRGD
                     FGKWVQEEAVISKERLLANIADMNLNNNLHSALGVAEGAPLASPSRVRPNYFYQWVRD
                     GAITINTITNTILDHPGDFNITLAGTVIKYLKNVYVLQRLDNPSGRFDEDLSGLGEPK
                     FMVDNTAFNSPWGRPQNDGPALRAITTMNFLQRLNSQGMSLEYVLKRYRLEYGQESLE
                     VPFQNEQELFDKVLYYDLMFIIKNWEKEGFDLWEEVVGIHFFTALCQLKALKMAEYLL
                     TKGVLHPDEALLSILRETIGRMTTYISRDGGFINPHINFIVSTPRLLGQRSGLDIGTL
                     IGSILTHDELGSDDVPAVAIPFNVDHPAILNVLYELTTRMLKLYPINHDRVNLNMGVG
                     LGRYPEDVYNGYDTSEGNPWFLATSTAAELLYKLIYRHHIASQDLVVDLDGDNWQSAF
                     WNLIFDGLRPTSNGGSSTLVIPYGSQAFNQTMGAVFNYADSFLDKIRLHVSDCGEMSE
                     QFNKYTGFLEGARDLSWSYGSFLNSLRWRSAAYQLLSSQE"
     gene            complement(<312332..>312829)
                     /locus_tag="AGOS_ADL224C"
                     /old_locus_tag="ADL224C"
                     /db_xref="GeneID:4620012"
     mRNA            complement(<312332..>312829)
                     /locus_tag="AGOS_ADL224C"
                     /old_locus_tag="ADL224C"
                     /product="ADL224Cp"
                     /transcript_id="NM_209225.1"
                     /db_xref="GeneID:4620012"
     CDS             complement(312332..312829)
                     /locus_tag="AGOS_ADL224C"
                     /old_locus_tag="ADL224C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL098C (FMC1)"
                     /codon_start=1
                     /product="ADL224Cp"
                     /protein_id="NP_983872.1"
                     /db_xref="GeneID:4620012"
                     /translation="MSAYTSLVSGYRGLLRTLVRCGRRSRLEQAQQDAKKQIAVHTYR
                     RMQLVREQQQVADPAERARINAQLAALAKNVQALKAAETGRSHELLFYPRAAELRALL
                     LAPAEGPALERRAEHLAEVSGFVVNQHQYAELVERYNPGLRMSQEEKVKRTAAKVGLR
                     VPDAE"
     gene            <313343..>314431
                     /locus_tag="AGOS_ADL223W"
                     /old_locus_tag="ADL223W"
                     /db_xref="GeneID:4620013"
     mRNA            <313343..>314431
                     /locus_tag="AGOS_ADL223W"
                     /old_locus_tag="ADL223W"
                     /product="ADL223Wp"
                     /transcript_id="NM_209226.1"
                     /db_xref="GeneID:4620013"
     CDS             313343..314431
                     /locus_tag="AGOS_ADL223W"
                     /old_locus_tag="ADL223W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL037C (IDH1)"
                     /codon_start=1
                     /product="ADL223Wp"
                     /protein_id="NP_983873.1"
                     /db_xref="GeneID:4620013"
                     /translation="MFRNTLSHITKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEV
                     TDSVVQIFEAENVPVDWESVELSALEENHEGVQKAVESLKRNKVGLKGIWHTPADQTG
                     HGSLNVAFRKQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPGV
                     VESLKIMTKAKSERIARFAFDFALKNNRKAVCAVHKANIMKLGDGLFRNTVSEIGAKE
                     YPEVNVSSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFG
                     REYAVFEPGCRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAE
                     GKRTTKDIGGTATTTEFTNAVIDKLATL"
     gene            <314729..>316279
                     /locus_tag="AGOS_ADL222W"
                     /old_locus_tag="ADL222W"
                     /db_xref="GeneID:4620014"
     mRNA            <314729..>316279
                     /locus_tag="AGOS_ADL222W"
                     /old_locus_tag="ADL222W"
                     /product="ADL222Wp"
                     /transcript_id="NM_209227.1"
                     /db_xref="GeneID:4620014"
     CDS             314729..316279
                     /locus_tag="AGOS_ADL222W"
                     /old_locus_tag="ADL222W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL097W (FYV10)"
                     /codon_start=1
                     /product="ADL222Wp"
                     /protein_id="NP_983874.1"
                     /db_xref="GeneID:4620014"
                     /translation="MSVMNEPTVDFHLKLNEQQFHIPNELLKRNLKQCQKLIDKEATA
                     LEKSFEELDRLVRNPQNDESSMALLNEIIQKVERLERKLTKRVNVELQLLQRIDARIK
                     YYQQLDQIKQSGDRNRLLEWYQSYTNLLISDYLTRNSMYEGEDDISCSSTPPPARLKR
                     KLSSASSQLTTATSNNDPDRSHVNPGVEYLKQQGLDLLLDYDILLTTNRISKQLTINH
                     ELGPLLDWIKENATYLKHTSSMLEFEARFQEYIEYVKVEDYSKAITCFQTHLVKFLYS
                     NPLDLQQAAGLLVFIKACKSNISSYVPTPRHEEIVKQQTLLQSKEDFWSFFFLKLPKS
                     SKKDHKTNIEVKNNELAASVDIKRYMELLDDRRWEKLNEMFLKAYYSMYGISYHDPLL
                     IYLSLGISSLKTKDCLHERRAFVSPNNELSEFLSSEVLRNACPVCSPEFAPIAQKLPY
                     AHQVQSRLFENPVMLPSGNVYDAEKLKALAQTLRKRKLVVMGEDEVLDPIAGHTYALT
                     DFITMYPT"
     gene            complement(<316328..>317284)
                     /locus_tag="AGOS_ADL221C"
                     /old_locus_tag="ADL221C"
                     /db_xref="GeneID:4620015"
     mRNA            complement(<316328..>317284)
                     /locus_tag="AGOS_ADL221C"
                     /old_locus_tag="ADL221C"
                     /product="ADL221Cp"
                     /transcript_id="NM_209228.1"
                     /db_xref="GeneID:4620015"
     CDS             complement(316328..317284)
                     /locus_tag="AGOS_ADL221C"
                     /old_locus_tag="ADL221C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL096C"
                     /codon_start=1
                     /product="ADL221Cp"
                     /protein_id="NP_983875.1"
                     /db_xref="GeneID:4620015"
                     /translation="MARKLKGKASAKGLKGALARYQESEQTKAKVKRKLEHESSKGKS
                     SKQVNRNRKLQQEHEKKFVPFLPDSTLLLVGEGDFSFAKSILDCGYIKAENLIITSYD
                     SGVKELELKYPKSFRENYDYLVSESVRIFFNIDATKLVSSFKLSKKNPWQKVMGPEWK
                     AKPLENVLFNFPHTGHGIKDQDRNIREHQELLFGYFDSCKQLFKLANKKVGDDHLSGY
                     EVGKEQSSDDMGRIILSLFAGDPYDSWQPKVLAKENGLKLERSHKFQWDTFPGYRHRR
                     TNNEQDTTKPAAEREARIFIFEKNDGKRHNQSKRRSNDSDSE"
     gene            complement(<317449..>317940)
                     /locus_tag="AGOS_ADL220C"
                     /old_locus_tag="ADL220C"
                     /db_xref="GeneID:4620016"
     mRNA            complement(<317449..>317940)
                     /locus_tag="AGOS_ADL220C"
                     /old_locus_tag="ADL220C"
                     /product="ADL220Cp"
                     /transcript_id="NM_209229.1"
                     /db_xref="GeneID:4620016"
     CDS             complement(317449..317940)
                     /locus_tag="AGOS_ADL220C"
                     /old_locus_tag="ADL220C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL038W (GPI15)"
                     /codon_start=1
                     /product="ADL220Cp"
                     /protein_id="NP_983876.1"
                     /db_xref="GeneID:4620016"
                     /translation="MVLDIYKDSAGFYVRFDVKPARFYTQWFVRLLFWTGLQALGYFA
                     LQRLRANSFLLLQNIALGLLTLLLIRAPTIDSLYVFKSYGIQLSTTQGCLLLPEFLNE
                     RLFEVKTFIPSDDLVAMVINEGFEGLAVVFYMCIIAKRSRQLKIVFPVCSVVEQYMLN
                     ASY"
     gene            complement(<318182..>319870)
                     /locus_tag="AGOS_ADL219C"
                     /old_locus_tag="ADL219C"
                     /db_xref="GeneID:4620017"
     mRNA            complement(<318182..>319870)
                     /locus_tag="AGOS_ADL219C"
                     /old_locus_tag="ADL219C"
                     /product="ADL219Cp"
                     /transcript_id="NM_209230.1"
                     /db_xref="GeneID:4620017"
     CDS             complement(318182..319870)
                     /locus_tag="AGOS_ADL219C"
                     /old_locus_tag="ADL219C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL039W (BDP1)"
                     /codon_start=1
                     /product="ADL219Cp"
                     /protein_id="NP_983877.1"
                     /db_xref="GeneID:4620017"
                     /translation="MSSIVNKSGTRFTPKVRQRRPASAAPTQPHSTTTSAGKPSEPQP
                     TRADTSEEGGDGDEPAGPKDPSLVEDDDPLSHTQLTKDLKASQMSTQLPVATMSPQPE
                     AHGRSSRLDSLSHQVSVFKSGFLEQPGAPIPVSDAQRSRRLSTMSNLQTKKQRPPAIP
                     EADVSLQAIKKRRMSARSSTSRKSGSAQRISVVPRAAASESYVVPPAGAPLKKESADD
                     LFQTTASFYERYTISTLKEIPKNIADEDSARYTVNEDSITMADLCKPLFPIGEVSDNF
                     HRAKEAAKAKMEARKKRRELRQMAKRQFKPLSELSAEEQEKLKQERKNAAEALLNAEI
                     PDEMPQQTIQLKLQSDGKLGIDEESTVVDRHKNASYGNAHKERLDSNPFENLCNSSTY
                     GRQKYTDPWTTDELIRFYQALSMWGTDFNLIAQLFPYRTRRQIKAKFVNEERKHPVVI
                     ELALKSKLPPDFEQYCKTIKKEIGTIEEFNNKLEQLQVEHEQYLKQIEIEKQNAREQD
                     LQHQTSKEKERGSEKRFSSRQEQLKAYRKSEIVLGTIDDVKRKRAEELEAAAEQ"
     gene            complement(<320124..>321335)
                     /locus_tag="AGOS_ADL218C"
                     /old_locus_tag="ADL218C"
                     /db_xref="GeneID:4620018"
     mRNA            complement(<320124..>321335)
                     /locus_tag="AGOS_ADL218C"
                     /old_locus_tag="ADL218C"
                     /product="ADL218Cp"
                     /transcript_id="NM_209231.1"
                     /db_xref="GeneID:4620018"
     CDS             complement(320124..321335)
                     /locus_tag="AGOS_ADL218C"
                     /old_locus_tag="ADL218C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL035C"
                     /codon_start=1
                     /product="ADL218Cp"
                     /protein_id="NP_983878.1"
                     /db_xref="GeneID:4620018"
                     /translation="MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWAT
                     GKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGA
                     PALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDS
                     NLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIH
                     ELNDKSEHANEPQPQLFGDVREPWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDEC
                     VDAANAIVLPQAHGDEVVRDVLVPASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWD
                     YSKKETVLEDLPSSGLDDTHSAQHNDQASSLSGQSQPEQQEYRQVQSDGMRRNRSSKH
                     SKKHSARFTPY"
     gene            complement(321428..321501)
                     /locus_tag="AGOS_t0062"
                     /db_xref="GeneID:4620019"
     tRNA            complement(321428..321501)
                     /locus_tag="AGOS_t0062"
                     /product="tRNA-Ile"
                     /codon_recognized="AUU"
                     /db_xref="GeneID:4620019"
     gene            <321941..>324463
                     /locus_tag="AGOS_ADL217W"
                     /old_locus_tag="ADL217W"
                     /db_xref="GeneID:4620187"
     mRNA            <321941..>324463
                     /locus_tag="AGOS_ADL217W"
                     /old_locus_tag="ADL217W"
                     /product="ADL217Wp"
                     /transcript_id="NM_209232.2"
                     /db_xref="GeneID:4620187"
     CDS             321941..324463
                     /locus_tag="AGOS_ADL217W"
                     /old_locus_tag="ADL217W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL095W (PRK1) and YNL020C (ARK1)"
                     /codon_start=1
                     /product="ADL217Wp"
                     /protein_id="NP_983879.2"
                     /db_xref="GeneID:4620187"
                     /translation="MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSP
                     GPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTY
                     EVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIK
                     IENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYR
                     ALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISV
                     MLSEHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERMKHGACTPVHHSASQPALPLAT
                     HQFSTSTPMVTHPQPPANQMSPLPHGIQPITSNMVYMMHNTTPNIKDIPRENPAATIQ
                     KNALYSMSGSEHLSALSSDMHFNRPQLENSHTFSGVGPRSSSNPIKIPRNEIQKFLSG
                     TPPTSAKKPTYVDSETQTGDIITSNKSGSRPFAMSLSPLSSPELFSEQSTGNSLLGRL
                     SRKTIRSPTSDKGSNPLKSKSSVGDDLASLLSSPSRNLSFPAQSSKSSKRNSADLSSR
                     KSPVLNKSRIAMSYSGPEKSSATGLESSSSSLFGSQNGEHRPPSSTDRHKSNSTSFRL
                     VPTKKGQTSIQERVHKLLATSAQEDVSKKASKKTTNSATSAKLEHQKGDEQSISTGSM
                     SKIDAISMDLSSIAAGNVSKSQFTSVENVLKAAANGSVTAGKKPTTSETSKSAVSASA
                     TNTRKAPNSSENATKLPNVVSPTKRANTVETPQRSPADPVSAKVASSMDSKTKDKKQP
                     PTKPPKPAHLRPKLPPKPSHLKSPSVDKKRMSKDASTLISEC"
     gene            complement(<324645..>326753)
                     /locus_tag="AGOS_ADL216C"
                     /old_locus_tag="ADL216C"
                     /db_xref="GeneID:4620020"
     mRNA            complement(<324645..>326753)
                     /locus_tag="AGOS_ADL216C"
                     /old_locus_tag="ADL216C"
                     /product="ADL216Cp"
                     /transcript_id="NM_209233.2"
                     /db_xref="GeneID:4620020"
     CDS             complement(324645..326753)
                     /locus_tag="AGOS_ADL216C"
                     /old_locus_tag="ADL216C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL021W (HDA1)"
                     /codon_start=1
                     /product="ADL216Cp"
                     /protein_id="NP_983880.2"
                     /db_xref="GeneID:4620020"
                     /translation="MEERTQQKRKLEEGSPDGEANGGQASRKAIVQKRPVIVPPVRPK
                     ISYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTL
                     SGIDEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYY
                     NNDSLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVA
                     AQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYG
                     NYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAA
                     DGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEP
                     PDELPQPLKQPKPEAIVTIDMVIKEQSKYWNCFKGRHGNDGINWREGVNDSLTSKNFP
                     LQSAVRQHQFRRLAKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWA
                     QRDSLTGHIDPSTSIIVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEV
                     VTYLWDSYLKTFPHLARVAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPL
                     VPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKPRKKFGRVLRCTCDGMNNIVEE
                     RLEEATDFILDSFEEWSESE"
     gene            <327023..>328477
                     /locus_tag="AGOS_ADL215W"
                     /old_locus_tag="ADL215W"
                     /db_xref="GeneID:4620021"
     mRNA            <327023..>328477
                     /locus_tag="AGOS_ADL215W"
                     /old_locus_tag="ADL215W"
                     /product="ADL215Wp"
                     /transcript_id="NM_209234.1"
                     /db_xref="GeneID:4620021"
     CDS             327023..328477
                     /locus_tag="AGOS_ADL215W"
                     /old_locus_tag="ADL215W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL022C"
                     /codon_start=1
                     /product="ADL215Wp"
                     /protein_id="NP_983881.1"
                     /db_xref="GeneID:4620021"
                     /translation="MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSD
                     VRHVYAIVASFWKYKAYLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKK
                     RIHMGKHPLKAFVLKHQTRLRGEYAKQLVKLGVADLSVLVQDEREDATPVRWIRLNPF
                     RIRGQREEVLQELQKKFPRRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKR
                     GKIIIQDRASCFPAQILAPGRSDVIIDACAAPGNKTTHVAAHIFPEGGADHAQIHAFE
                     RDPQRAKTLRKMIATAGCDNAIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGR
                     QLVDATQETQKGTETDPSADVPEEETFEATKSAVELKNRLAKLSSFQFQIVKHAMSFP
                     SAKKLIYSTCSVHAEENERVVIDLLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEE
                     VFPDQAEELAGGCIRVLPKEDGGIGFFAVCFERE"
     gene            complement(<328533..>329636)
                     /locus_tag="AGOS_ADL214C"
                     /old_locus_tag="ADL214C"
                     /db_xref="GeneID:4620022"
     mRNA            complement(<328533..>329636)
                     /locus_tag="AGOS_ADL214C"
                     /old_locus_tag="ADL214C"
                     /product="ADL214Cp"
                     /transcript_id="NM_209235.1"
                     /db_xref="GeneID:4620022"
     CDS             complement(328533..329636)
                     /locus_tag="AGOS_ADL214C"
                     /old_locus_tag="ADL214C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL094C (LYS12)"
                     /codon_start=1
                     /product="ADL214Cp"
                     /protein_id="NP_983882.1"
                     /db_xref="GeneID:4620022"
                     /translation="MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLE
                     AIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEG
                     YSSPIVALRRQLGLYANIRPVKSVSGTGQPVDLVIVRENTEDLYVQQERTYVDAATGK
                     RVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCR
                     EVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSL
                     GLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQ
                     AVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI"
     gene            <330087..>332813
                     /locus_tag="AGOS_ADL213W"
                     /old_locus_tag="ADL213W"
                     /db_xref="GeneID:4620023"
     mRNA            <330087..>332813
                     /locus_tag="AGOS_ADL213W"
                     /old_locus_tag="ADL213W"
                     /product="ADL213Wp"
                     /transcript_id="NM_209236.2"
                     /db_xref="GeneID:4620023"
     CDS             330087..332813
                     /locus_tag="AGOS_ADL213W"
                     /old_locus_tag="ADL213W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL023C (FAP1)"
                     /codon_start=1
                     /product="ADL213Wp"
                     /protein_id="NP_983883.2"
                     /db_xref="GeneID:4620023"
                     /translation="MLRDMPLDATAELEGIPYYEQTVLELRDGETYQCLICTVEMDAS
                     CPMYACHQCYRVYDYECIRRWALKATSTTVDRTWKCPNCYHVNRKVPPKNRHTCWCGK
                     QVNLDPNYINPNSCGQTCGAPICQHGCSKLCHLGPHEECMVRIDFKCRCGKLTEEIPC
                     YEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHNGPCGPCKEEIAGDIKCYCGLTTRNK
                     MVCSEVSVVARSKVSKYKSWIGAFACDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCP
                     YSPENCTTCPCGKTQLAELGSTRTACTDHISSCGKVCGKQLSCGNHTCPMTCHDGNCM
                     DPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCESLMSCRRHRCAERCCSGRPHSVK
                     RNSRRRRESPDDESEVEAQHVCLKDCNRVLLCGIHMCNYKCHAGKCPPCLESDSNDLI
                     CPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGHSPPSHNCHPLDEPCPPCTITV
                     KKTCRCGKNEIRTFCYNDDVSCSRPCKKPLSYCNHFCQVPCHSDGQCQQTCKQACGLP
                     RKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTKICSEYAGKDDGIGASQHL
                     SCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQRSQSFDDLHLPFTEYVLSVFT
                     KQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHELSSSFGLYSESQDPEPKR
                     SVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREFKANSESAVTKKLVSVHIDDSPESQ
                     HDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYVVRGTEGYIFPTDYLSLS
                     ANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRIGSCESPAADCLGQ"
     gene            <332928..>333683
                     /locus_tag="AGOS_ADL212W"
                     /old_locus_tag="ADL212W"
                     /db_xref="GeneID:4620024"
     mRNA            <332928..>333683
                     /locus_tag="AGOS_ADL212W"
                     /old_locus_tag="ADL212W"
                     /product="ADL212Wp"
                     /transcript_id="NM_209237.1"
                     /db_xref="GeneID:4620024"
     CDS             332928..333683
                     /locus_tag="AGOS_ADL212W"
                     /old_locus_tag="ADL212W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL024C"
                     /codon_start=1
                     /product="ADL212Wp"
                     /protein_id="NP_983884.1"
                     /db_xref="GeneID:4620024"
                     /translation="MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGE
                     SGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLH
                     GKYNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQPIDL
                     VLAADCVYLEKAFPLLEKTLLDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIE
                     IKDFKSYEDYRRQRTYLFQLVRKPARAPHALAP"
     gene            complement(<333761..>334537)
                     /locus_tag="AGOS_ADL211C"
                     /old_locus_tag="ADL211C"
                     /db_xref="GeneID:4620025"
     mRNA            complement(<333761..>334537)
                     /locus_tag="AGOS_ADL211C"
                     /old_locus_tag="ADL211C"
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /transcript_id="NM_209238.2"
                     /db_xref="GeneID:4620025"
     CDS             complement(333761..334537)
                     /locus_tag="AGOS_ADL211C"
                     /old_locus_tag="ADL211C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL093C (RSM25)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /protein_id="NP_983885.2"
                     /db_xref="GeneID:4620025"
                     /translation="MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAR
                     EPKLHDPVSGKYKGELDIMTDRLNRNTETYKTRAGSSDRQTAAVHKPSKLRFIEDKLR
                     SLFFQQHPWELSRPKVLVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHRE
                     MLAAYDQARFEFYRLRMQQELEEQIAYEEATMVGAVFKTTAVEHGLQQEQKVLDKWKE
                     DVVAGLQLMSAKKNSTKQSWAEATEEKEEQDSAEPEELKL"
     gene            <334762..>334980
                     /locus_tag="AGOS_ADL210W"
                     /old_locus_tag="ADL210W"
                     /db_xref="GeneID:4620026"
     mRNA            <334762..>334980
                     /locus_tag="AGOS_ADL210W"
                     /old_locus_tag="ADL210W"
                     /product="ADL210Wp"
                     /transcript_id="NM_209239.1"
                     /db_xref="GeneID:4620026"
     CDS             334762..334980
                     /locus_tag="AGOS_ADL210W"
                     /old_locus_tag="ADL210W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL024C-A (KSH1)"
                     /codon_start=1
                     /product="ADL210Wp"
                     /protein_id="NP_983886.1"
                     /db_xref="GeneID:4620026"
                     /translation="MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIF
                     WKFARIGERASPYVSIACIAMAINQINS"
     gene            complement(<335259..>337373)
                     /locus_tag="AGOS_ADL209C"
                     /old_locus_tag="ADL209C"
                     /db_xref="GeneID:4620027"
     mRNA            complement(<335259..>337373)
                     /locus_tag="AGOS_ADL209C"
                     /old_locus_tag="ADL209C"
                     /product="ADL209Cp"
                     /transcript_id="NM_209240.1"
                     /db_xref="GeneID:4620027"
     CDS             complement(335259..337373)
                     /locus_tag="AGOS_ADL209C"
                     /old_locus_tag="ADL209C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL091C (UTP25)"
                     /codon_start=1
                     /product="ADL209Cp"
                     /protein_id="NP_983887.1"
                     /db_xref="GeneID:4620027"
                     /translation="MGITDSHGIMDGKRGRKQLRNITRIGRAIHVQEDEAKSREEHTV
                     EEAQAGEQTSNRKRGNHPAEDDGGARESQSYGALLTLLSAEHGKQRKKRLRKAEAEAA
                     EAAEAGEDPEEAITAALENSAQDAEDAEDAFDDSGESDEEQDHFDVHFNRVSAADVAQ
                     LDAAFKNGRAQYRVQKEARGEEEILYSKPVASSEGTEGPVRVPARSLRGYAIKQRLRM
                     HNGLTADDPEKPLTPQQKVLLDPMFQYQDILYEYEGYDREREYRELYTLHILNHVYKT
                     RDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKK
                     SKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVC
                     SPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQ
                     RDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAE
                     KSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYI
                     PEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFR
                     RFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLALE
                     RIVGTKRAAVLTHGQNEVYEFK"
     gene            <337560..>339068
                     /locus_tag="AGOS_ADL208W"
                     /old_locus_tag="ADL208W"
                     /db_xref="GeneID:4620028"
     mRNA            <337560..>339068
                     /locus_tag="AGOS_ADL208W"
                     /old_locus_tag="ADL208W"
                     /product="ADL208Wp"
                     /transcript_id="NM_209241.1"
                     /db_xref="GeneID:4620028"
     CDS             337560..339068
                     /locus_tag="AGOS_ADL208W"
                     /old_locus_tag="ADL208W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL090W (ICE2)"
                     /codon_start=1
                     /product="ADL208Wp"
                     /protein_id="NP_983888.1"
                     /db_xref="GeneID:4620028"
                     /translation="MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVT
                     LFILYFVTTTLKITAATRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLV
                     GSDPKGARGGFIFDGNMNESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPC
                     FTLTEGFFTVLAIQVIGETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTP
                     IWPLSVHTATLLGFTLSLVFGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALT
                     AMSEIFQVVHNTWQMQQGTLPKNSLLAYYKNFILNAENLWDVLLKKAFLLHSVELDQA
                     PSSVVVKDALVLVQQQWWNKSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAV
                     VSNLVFRVIVFYSATRIIPALQRATGGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSG
                     ELNNELCIWGCFPWLQSEANRDRWVVDAWGFWNWCNLFFTLLIYAVELIGSR"
     gene            complement(339133..339210)
                     /locus_tag="AGOS_AgSNR66"
                     /old_locus_tag="AgSNR66"
                     /db_xref="GeneID:4620029"
     ncRNA           complement(339133..339210)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR66"
                     /old_locus_tag="AgSNR66"
                     /product="AgSNR66"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR66; start and end coordinates are
                     approximate; Similarity is partial. In synteny."
                     /transcript_id="NR_149411.1"
                     /db_xref="GeneID:4620029"
     gene            complement(339273..339560)
                     /locus_tag="AGOS_AgSNRNME1"
                     /old_locus_tag="AgSNRNME1"
                     /db_xref="GeneID:4620030"
     ncRNA           complement(339273..339560)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNRNME1"
                     /old_locus_tag="AgSNRNME1"
                     /product="AgSNRNME1"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNRNME1; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149436.1"
                     /db_xref="GeneID:4620030"
     gene            <339659..>340741
                     /locus_tag="AGOS_ADL207W"
                     /old_locus_tag="ADL207W"
                     /db_xref="GeneID:4620031"
     mRNA            <339659..>340741
                     /locus_tag="AGOS_ADL207W"
                     /old_locus_tag="ADL207W"
                     /product="ADL207Wp"
                     /transcript_id="NM_209242.1"
                     /db_xref="GeneID:4620031"
     CDS             339659..340741
                     /locus_tag="AGOS_ADL207W"
                     /old_locus_tag="ADL207W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL025C (SSN8)"
                     /codon_start=1
                     /product="ADL207Wp"
                     /protein_id="NP_983889.1"
                     /db_xref="GeneID:4620031"
                     /translation="MPPIVDRVAAMPMICDTRPGVGETASRNMSASYWDSSQRNKWQY
                     SRESLARTRQKLWMLECQLYPQGTNILMEGGGKDAQPVTKNIPITHRDLHYDRDYNLR
                     IYCYFLIMKLGRRLNVRQYALATAHVYLARFCLKASIREVNLYLLVTTCIYLACKVEE
                     CPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLIEELQSYMIVHYPYRAMEQIAAAL
                     RRPPYNLVLSPDDLQNSWSLINDSYITDVHLLYPPHVIAMACLFITVCLRSAAGARDL
                     QETFNRFMADSQVDLHEVMDTIQDFITLYDHWDKYNEPWIKFLLHNLYLRPHAGGTTV
                     SGAAAGSAGPAGSVLTPNGTITGSTS"
     gene            <340998..>342116
                     /locus_tag="AGOS_ADL206W"
                     /old_locus_tag="ADL206W"
                     /db_xref="GeneID:4620032"
     mRNA            <340998..>342116
                     /locus_tag="AGOS_ADL206W"
                     /old_locus_tag="ADL206W"
                     /product="ADL206Wp"
                     /transcript_id="NM_209243.1"
                     /db_xref="GeneID:4620032"
     CDS             340998..342116
                     /locus_tag="AGOS_ADL206W"
                     /old_locus_tag="ADL206W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YHL003C (LAG1)"
                     /codon_start=1
                     /product="ADL206Wp"
                     /protein_id="NP_983890.1"
                     /db_xref="GeneID:4620032"
                     /translation="MSGQVRQRFAKDQHAGSQIEVEYGSKDAAFEADKSVELEEREEL
                     LPIRGQLAVSKVDLYTVYASGALLVALAVGFLRQAAWCDKFLRLQYASVESPGKYDIG
                     IDDAYIVGTFVVVLCLVRSSLLEFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTAS
                     WVTGFYLYYHSPYFLNCDHIYLNWPHDKMAGVFKVYYLVQIASWLQQIIVLNVEEKRK
                     DYWQMFAHHIITVALTTGSYYYYFNRIGHVILIIMDVVDILLSSAKILKYCGFSVACD
                     YMFVVFLGFWVVLRHGVYNYILHHAWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVL
                     LLAGLQLITVIWSFLIVKVFMKVIRGSGAEDVRSDDEE"
     gene            complement(<342339..>343745)
                     /locus_tag="AGOS_ADL205C"
                     /old_locus_tag="ADL205C"
                     /db_xref="GeneID:4620033"
     mRNA            complement(<342339..>343745)
                     /locus_tag="AGOS_ADL205C"
                     /old_locus_tag="ADL205C"
                     /product="ADL205Cp"
                     /transcript_id="NM_209244.1"
                     /db_xref="GeneID:4620033"
     CDS             complement(342339..343745)
                     /locus_tag="AGOS_ADL205C"
                     /old_locus_tag="ADL205C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL088C (AVT7)"
                     /codon_start=1
                     /product="ADL205Cp"
                     /protein_id="NP_983891.1"
                     /db_xref="GeneID:4620033"
                     /translation="MVPTATVGSSTVNLIKTIVGAGLLAVPYAFRADGVCVAAVLVAV
                     AAITSGFGLVVLAKASKALVNPRQSSFFALCQITYPRLAVVFDFAMFTQCFGVGVSYL
                     IIVGDLFPGLLGGTREAWIAASAAVVVPLSHLRRFDSLKYSSVLGLVAIAYLALMIVA
                     AWIEGLTTGYAHYERGEVRWLRPASLREMVSTFSIIVFAFTGSMNMFSIINELGDNSM
                     RNIQRIVYYSIAASTALFILVGMAGYLTFGSNVAQNVILNFDPDAVSTQVGSLALGLM
                     VLLSFPLLFHPGRIAFNNMVHWAHVTYCGYRPLKSEEQPGDAGASICLEVEDEEDRLI
                     LSAEGSESYQSLPRGANSNEDSGSSAEVDRQAVPFDGPRFYIVTWLLLLVLYLVAFKV
                     RSFAYVLALVGATGSTAISFTLPGLFGYRLIGTDSLMKGNMLSRQDHLYRCASLGLVG
                     YGIVVTIVSLMVVIYFGI"
     gene            <343959..>344612
                     /locus_tag="AGOS_ADL204W"
                     /old_locus_tag="ADL204W"
                     /db_xref="GeneID:4620034"
     mRNA            <343959..>344612
                     /locus_tag="AGOS_ADL204W"
                     /old_locus_tag="ADL204W"
                     /product="ADL204Wp"
                     /transcript_id="NM_209245.1"
                     /db_xref="GeneID:4620034"
     CDS             343959..344612
                     /locus_tag="AGOS_ADL204W"
                     /old_locus_tag="ADL204W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL032W (SIW14)"
                     /codon_start=1
                     /product="ADL204Wp"
                     /protein_id="NP_983892.1"
                     /db_xref="GeneID:4620034"
                     /translation="MDGTNGGGTAGAQGGKEGQAMAERRWNDVGRSAGATDGEPGPAG
                     PDRYGGEVVPPENFSPVVGEIYRSSFPRPENFAFLQERVRLRSILVLIPEEYPPENQE
                     FVERAGIQLFQVGMSGNKEPFVNIPRDVLTRALAIALDPANHPILIHCNRGKHRTGCL
                     VGCIRKLQNWSLTMIFDEYRRFAFPKARAMDQQFIEMYEDRELIVEAVRRRWLPIAW"
     gene            complement(<344626..>345054)
                     /locus_tag="AGOS_ADL203C"
                     /old_locus_tag="ADL203C"
                     /db_xref="GeneID:4620035"
     mRNA            complement(<344626..>345054)
                     /locus_tag="AGOS_ADL203C"
                     /old_locus_tag="ADL203C"
                     /product="ADL203Cp"
                     /transcript_id="NM_209246.1"
                     /db_xref="GeneID:4620035"
     CDS             complement(344626..345054)
                     /locus_tag="AGOS_ADL203C"
                     /old_locus_tag="ADL203C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL087C (AIM19)"
                     /codon_start=1
                     /product="ADL203Cp"
                     /protein_id="NP_983893.1"
                     /db_xref="GeneID:4620035"
                     /translation="MWGAIQQIRDLSYTPGIAWLNSAMLLATPVLSPAQPAAAATVPQ
                     AGGWLARAARPKHIGPTAKTSLLFSAAQALGGWIIHDGDLESGSGFLAAWSALYLVVG
                     GRGSVRALRYGRLWPLVLAASSGLGGLAYGERFLSGRFLA"
     gene            complement(<345190..>345600)
                     /locus_tag="AGOS_ADL202C"
                     /old_locus_tag="ADL202C"
                     /db_xref="GeneID:4620036"
     mRNA            complement(<345190..>345600)
                     /locus_tag="AGOS_ADL202C"
                     /old_locus_tag="ADL202C"
                     /product="ADL202Cp"
                     /transcript_id="NM_209247.1"
                     /db_xref="GeneID:4620036"
     CDS             complement(345190..345600)
                     /locus_tag="AGOS_ADL202C"
                     /old_locus_tag="ADL202C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL031C (HHT2)"
                     /codon_start=1
                     /product="ADL202Cp"
                     /protein_id="NP_983894.1"
                     /db_xref="GeneID:4620036"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <346054..>346365
                     /locus_tag="AGOS_ADL201W"
                     /old_locus_tag="ADL201W"
                     /db_xref="GeneID:4620037"
     mRNA            <346054..>346365
                     /locus_tag="AGOS_ADL201W"
                     /old_locus_tag="ADL201W"
                     /product="ADL201Wp"
                     /transcript_id="NM_209248.2"
                     /db_xref="GeneID:4620037"
     CDS             346054..346365
                     /locus_tag="AGOS_ADL201W"
                     /old_locus_tag="ADL201W"
                     /experiment="RACE determination of 5' region of mRNA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL030W (HHF2); Newly annotated start codon"
                     /codon_start=1
                     /product="ADL201Wp"
                     /protein_id="NP_983895.2"
                     /db_xref="GeneID:4620037"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEDVRAVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            complement(<346470..>347505)
                     /locus_tag="AGOS_ADL200C"
                     /old_locus_tag="ADL200C"
                     /db_xref="GeneID:4620038"
     mRNA            complement(join(<346470..347401,347454..>347505))
                     /locus_tag="AGOS_ADL200C"
                     /old_locus_tag="ADL200C"
                     /product="ADL200Cp"
                     /transcript_id="NM_209249.2"
                     /db_xref="GeneID:4620038"
     CDS             complement(join(346470..347401,347454..347505))
                     /locus_tag="AGOS_ADL200C"
                     /old_locus_tag="ADL200C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL084C (SDS3); 1-intron"
                     /codon_start=1
                     /product="ADL200Cp"
                     /protein_id="NP_983896.2"
                     /db_xref="GeneID:4620038"
                     /translation="MSFQGYDQYQPDYSRQELSRKDKRRHNIESKVAKISQNFVVDKD
                     VHYRDRLTHLQTDLTSLHQGNNLQFMRMLRDLEEERDLELIRLRFYEEYRVQRSSIEF
                     QEDIEKTKEEHEKMIKLCKEKLYESFEKKIIKLQEERLLTDVANAHSYSMDHPRTKQA
                     KPTRSLQSAWDSSTSELGGGTGAGGASANESGTETGAERRSLRKRVTNNAAARIINEE
                     SEYVSNRDSSGPYGGSRTGTGSAANAAMAGGSQNNSDSEFLQYISDSNELYTLLFGSE
                     ERDTEKKKLRSTQRLSTKSAPPLQSLTPDEVTEDIALIRQLTGQPPAPFRI"
     gene            <347833..>349110
                     /locus_tag="AGOS_ADL199W"
                     /old_locus_tag="ADL199W"
                     /db_xref="GeneID:4620039"
     mRNA            <347833..>349110
                     /locus_tag="AGOS_ADL199W"
                     /old_locus_tag="ADL199W"
                     /product="ADL199Wp"
                     /transcript_id="NM_209250.2"
                     /db_xref="GeneID:4620039"
     CDS             347833..349110
                     /locus_tag="AGOS_ADL199W"
                     /old_locus_tag="ADL199W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YML005W (TRM12)"
                     /codon_start=1
                     /product="ADL199Wp"
                     /protein_id="NP_983897.2"
                     /db_xref="GeneID:4620039"
                     /translation="MSGDVEHLETQSMAPVEFIVDQARVIKAIKLELEAAGAFRGIET
                     NGGSKIVRSSLDVSADTAARICTTYQVSSREYSAGAPRVPRTLEGFAESYLHAQGFSE
                     VETAALLRAMPQRYTLYPPLVLFSHSGARSFEHDAWGAAFARMDKDAFFAAMLASGCF
                     PTGYTHVAANRPIVATDAMRRPFNIAPLYGELLAQGDAAGAQLWEQPTAADFARSVWC
                     SVVQNGIRQTWSPVFTMFSRGNIKEKKRILDTYPDVAGRDVVDLYAGIGYFTLSYLAR
                     GARSVYCFELNPWSFEGLRRGLAVNAYPGSCYAYNESNESAPARLAGRDLDVRHINLG
                     LLPSSRPGWGIAMGLALAHGCRPITTLHIHENAAASELHALADTVADELRALAATCSP
                     GLHVRPRHLEKIKTFAPDVWHVCLDVDVSRSAE"
     gene            <349510..>351153
                     /locus_tag="AGOS_ADL198W"
                     /old_locus_tag="ADL198W"
                     /db_xref="GeneID:4620040"
     mRNA            <349510..>351153
                     /locus_tag="AGOS_ADL198W"
                     /old_locus_tag="ADL198W"
                     /product="ADL198Wp"
                     /transcript_id="NM_209251.2"
                     /db_xref="GeneID:4620040"
     CDS             349510..351153
                     /locus_tag="AGOS_ADL198W"
                     /old_locus_tag="ADL198W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL027W (CRZ1)"
                     /codon_start=1
                     /product="ADL198Wp"
                     /protein_id="NP_983898.2"
                     /db_xref="GeneID:4620040"
                     /translation="MCFEDYLNAQTVGSDVSPDKARMNSSNKANGGMRMQEKEGSPAY
                     DMESEMTADGVSLFNSFHTNPTTTLTVPQVILSPYDQDESFGTPTQHLGQPFQAPTIN
                     IQTPLEGAVGSPALDMSSPMNLPQYAEGIDVDQLRLPNTPNRDSYLSASMSDQSVSAY
                     NAHSPETAHFLRHQNVAVSPQVSYLRTGNDDFDELLSLHSGTTENSEYFQIHDVDDLN
                     AILDDNVHLFYSPHTGDSFDAHQLPVNDISASPATTPQYAPLINVHRVDGTLPPSSIS
                     VTPSPRTSFNDEDNRPNLDFLSVKGNEEFALTDDDELEDAHEQMRQGRRYKRRSSTKS
                     LRSQSIANTPSQEDKAHTLNKNREKLLELAALHIPNSSSANSLSPTSLGPSTGPAETS
                     SPADHSAPLDEGETALNLSGNTRRKSLQKNPAIYSCNLCDKKFTRPYNLKSHLRTHTD
                     ERPFSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGR
                     HFKTESGRRCIAPLYDEASKERAANNMAPLTENDQFWLS"
     gene            complement(<351433..>352605)
                     /locus_tag="AGOS_ADL197C"
                     /old_locus_tag="ADL197C"
                     /db_xref="GeneID:4620041"
     mRNA            complement(<351433..>352605)
                     /locus_tag="AGOS_ADL197C"
                     /old_locus_tag="ADL197C"
                     /product="ADL197Cp"
                     /transcript_id="NM_209252.1"
                     /db_xref="GeneID:4620041"
     CDS             complement(351433..352605)
                     /locus_tag="AGOS_ADL197C"
                     /old_locus_tag="ADL197C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL326C (PFA3)"
                     /codon_start=1
                     /product="ADL197Cp"
                     /protein_id="NP_983899.1"
                     /db_xref="GeneID:4620041"
                     /translation="MASLSPGMINFAMAVIFPAGMVVMSYMSSSNFLLFTIADLLALP
                     LSSQQGTHRGSKAICQVSGYAMHICSLIPILFPKLLTCGLALYSAVVLWLKVSVIGSF
                     IQGTVLLTLVPLILYAYFSTIAVGPGSPLDFEELRIRDLNDVETGMEFPPDFLAAKTV
                     TLDSTGRHRYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFL
                     LYASVYAFWICIITTWDLVVWFRAHSYERELLNVHLVCLWALSAAATVALTAFCAFNI
                     YLVCKNETTGEYQRRSTLNSDLEMYADCTNGPRTVIENPFDLGSRRRNWAAVMGDTWK
                     EWLLPIRTTASQKARHSFDESGLYFKIDEQAHAKLAESMALQARLITRFNSKRAVQ"
     gene            <352859..>353278
                     /locus_tag="AGOS_ADL196W"
                     /old_locus_tag="ADL196W"
                     /db_xref="GeneID:4620042"
     mRNA            <352859..>353278
                     /locus_tag="AGOS_ADL196W"
                     /old_locus_tag="ADL196W"
                     /product="ADL196Wp"
                     /transcript_id="NM_209253.2"
                     /db_xref="GeneID:4620042"
     CDS             352859..353278
                     /locus_tag="AGOS_ADL196W"
                     /old_locus_tag="ADL196W"
                     /experiment="RACE determination of 5' region of mRNA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL142W (RRP40); Newly annotated start codon"
                     /codon_start=1
                     /product="ADL196Wp"
                     /protein_id="NP_983900.2"
                     /db_xref="GeneID:4620042"
                     /translation="MAFPNASKKNRPTLKVGDLCYARVSSAEKDLEAVLECMDSSTGR
                     DAGFGQLDGGMVAEVSLGFARELLLNEAFPLLPEMARHAQFEVAIGVNGKIWVKAETV
                     RTTLCCIRAIEACQERPQAEFKTTVKRVFKELREGTE"
     gene            complement(<353336..>355915)
                     /locus_tag="AGOS_ADL195C"
                     /old_locus_tag="ADL195C"
                     /db_xref="GeneID:4620043"
     mRNA            complement(<353336..>355915)
                     /locus_tag="AGOS_ADL195C"
                     /old_locus_tag="ADL195C"
                     /product="ADL195Cp"
                     /transcript_id="NM_209254.2"
                     /db_xref="GeneID:4620043"
     CDS             complement(353336..355915)
                     /locus_tag="AGOS_ADL195C"
                     /old_locus_tag="ADL195C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL325C (FIG4)"
                     /codon_start=1
                     /product="ADL195Cp"
                     /protein_id="NP_983901.2"
                     /db_xref="GeneID:4620043"
                     /translation="MQFVDLAGTGAASLAHKSMNSLLPGLPKQRKIKKFTMTKYTIYE
                     TSKRMYIVGSNKRETMFRILEIDLTKPKDVLLVVEDNVFFTRGDVMKILRNIEESEKD
                     GLNKKLTGHGLLGFIRFTDCYYLVVVTNVSHVAVLGGHSIYHIDDTQLVPISTSYKKP
                     DATEARFLATFQNLDLSRTFYFSYTYDVTNTLQTNMLRRKLEGVGREDIVVPSGIPEY
                     NEMFLWNTHLLDEVISCIDTVYDWFQPIIHGFIDQVNVSLGGKSIFVTLIARRSHHFA
                     GARFLKRGVSNHGYVANEVETEQIVSDMVLTSFHAPGNMYYDNDRYTSFVQHRGSIPL
                     FWSQEASNLTAKPPIEINVMDPFYSAAAKHFDSLFQRYGGGPIQILNLVKTKEKNPRE
                     TKLLVEFENCVNYLNHFLPQDKKLQYTSWDMSRASKSHGQVVIEFLERYASQSLETTG
                     IFHNGRNFETTRTQEGVCRTNCIDCLDRTNAAQFVIGKRALGVQLHALGIIDNTYLEY
                     DSDIIDILTELFHDHGDTIALQYGGSHLVNTMETYRKINQWRSHSRDLIESIKRFYSN
                     SFVDAQRQEATNLFLGHYVYQEGQPMLWDMNTDFYLHNVYNIGEPKRSYTHWWNEFHI
                     QSIRGIIKTEIVDSHNDITKEKLAMNVRGYPSSYDNYWNEYYMPRLLVSFQDLFAYNM
                     NSTRRYHEEEKQKDRLLSPFVSKKQSSLNTKLRAITTKNASAKQKPADNSKKKRNQED
                     EFDLCKLELSKVLTRARGLEKKLDSAILDFNGTGGPDATSSSGYIYDNYLPHSACSPA
                     FSSTLSVHNTDREIYERSVRMDAYTLLDDYKTYFDTPISLNCDQRALYERTYRYFEPF
                     SKL"
     gene            <356159..>358258
                     /locus_tag="AGOS_ADL194W"
                     /old_locus_tag="ADL194W"
                     /db_xref="GeneID:4620044"
     mRNA            <356159..>358258
                     /locus_tag="AGOS_ADL194W"
                     /old_locus_tag="ADL194W"
                     /product="ADL194Wp"
                     /transcript_id="NM_209255.1"
                     /db_xref="GeneID:4620044"
     CDS             356159..358258
                     /locus_tag="AGOS_ADL194W"
                     /old_locus_tag="ADL194W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL141W (PPM2)"
                     /codon_start=1
                     /product="ADL194Wp"
                     /protein_id="NP_983902.1"
                     /db_xref="GeneID:4620044"
                     /translation="MSSMPVHIERPAELTAKQRLQLEKKVRSMKYADLAVQGTNTSSI
                     ASKRSVERLYADVLGTKVQGSNGQPREYFKYFVSKPLRRSPCINRGYWLRLMAIRTSL
                     RCIAEGTGQRDILVVNLGCGYDPLPFQLLDHTDDAQSEFDDRMSFVDVDYPDLIAKKL
                     EIVKNTPELQHILGGAAGDAAGPVVYRTAKYMAAACDLNDSAAFGALTESFHPRSDEV
                     VVFIAEVSLAYMRPERADAIIEACGRIPNSHFILLEQLLPAGEHSPFSRTMLSHFKSN
                     DSPLQSVSSYPTISEQEVRFKRLGFKNVNAGDMHQLWRSLDKELVSKVQAVEPFDELE
                     EFYLFCHHYIIAHATNDLSFRFGPKYAFPQVPQSPSKSCSSNSPMELVTAVDTDLLQR
                     KFGASVVVDSDTILFSFGCLHNKLENILVMGDHDGAFKISKGPAPPARMCHTFTKLDD
                     RTIFLVGGRQSPTKPLGDAWLLKLRDGEWHWEMCAPLMYPRFRHNCVNVGKGKALIYG
                     GETDGATFLIYDCESNTYYEPVYPRTFPRKVSAAMCYDFQSNRGYILGGALDNMEVDD
                     TLCTFAFDARTNSIEILETSSHPLYQRYGAKSVVREAGHMLIVGGVSPHMLFNDTTSI
                     IEVELTTNKVNCLQIPSSLWKNHAQLLVGFELQIMSDGTVLIFGGGAVCYGFGAAWNG
                     ILRLGRETIAAIPLRIL"
     gene            complement(<358352..>359749)
                     /locus_tag="AGOS_ADL193C"
                     /old_locus_tag="ADL193C"
                     /db_xref="GeneID:4620045"
     mRNA            complement(<358352..>359749)
                     /locus_tag="AGOS_ADL193C"
                     /old_locus_tag="ADL193C"
                     /product="ADL193Cp"
                     /transcript_id="NM_209256.2"
                     /db_xref="GeneID:4620045"
     CDS             complement(358352..359749)
                     /locus_tag="AGOS_ADL193C"
                     /old_locus_tag="ADL193C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YGR197C (SNG1)"
                     /codon_start=1
                     /product="ADL193Cp"
                     /protein_id="NP_983903.2"
                     /db_xref="GeneID:4620045"
                     /translation="MNVQEDESTDFEDDSRTESVQMYLGEYPENAEREGSGEMLGGKL
                     ARLKTRFMSPRVYLARKRLLVLFLSNMLFLACLVLVVFSLHVGVLVNQQQYLGRLPML
                     MVVQDEDAGMSAELLRAAEHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRY
                     WMALHVRPGATEALRRSLDDPGAPVFNSSEFFKVYYETVRDFNAMGSVRKLMETLEAN
                     FRAYYLDTWLPGELRERANTIDLSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVG
                     MIICLLLTFFQLAMISALHTELSLLLRTSHLLLYRYIVSYASYLLLSLFYSIVPIIYH
                     LDMEKAYGRAGFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNIT
                     PTFYSLHLANDFYKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALF
                     PLALKIVNIKSGKQK"
     gene            <360186..>361412
                     /locus_tag="AGOS_ADL192W"
                     /old_locus_tag="ADL192W"
                     /db_xref="GeneID:4620046"
     mRNA            <360186..>361412
                     /locus_tag="AGOS_ADL192W"
                     /old_locus_tag="ADL192W"
                     /product="ADL192Wp"
                     /transcript_id="NM_209257.2"
                     /db_xref="GeneID:4620046"
     CDS             360186..361412
                     /locus_tag="AGOS_ADL192W"
                     /old_locus_tag="ADL192W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL323W (LEM3)"
                     /codon_start=1
                     /product="ADL192Wp"
                     /protein_id="NP_983904.2"
                     /db_xref="GeneID:4620046"
                     /translation="MAGIKLSNVGLFRRRDKEAERKEEEEDLDASDFEDEPTQPRKQK
                     SRRPKDTRFTQQRIASVNHVATPRTVVPVYLVLAVVFAAAGAVLLLQSRRVDELIMYY
                     HDCERRAPRGRFAEMAAEDYTQAFHKMPEFARAPQWSYEPARDAAEDGVCRLRFQVPY
                     LLEGPIYVSYLIENFYANHRRFVLSFSEEQINGKNATYKDVYDSVGINCRPLVANEEG
                     KLYYPCGLIANSMFNDSFPFSLEGVGRTPNYVLSDRHINWSDDKNRFRNTKYSPKDVV
                     PPPHWRKRFPDGYNEKNMPNIEEWEEFQNWMRTSTLPKFSKLIRRGDGALSAGQYEMS
                     IGLHWPVDGWKGGKKAVYLSTTTSTGGHNDFLGIVYLAGSGICCLIAILILVARFFGG
                     RKIGDPRFLSWNKIKY"
     gene            <361663..>362934
                     /locus_tag="AGOS_ADL191W"
                     /old_locus_tag="ADL191W"
                     /db_xref="GeneID:4620047"
     mRNA            <361663..>362934
                     /locus_tag="AGOS_ADL191W"
                     /old_locus_tag="ADL191W"
                     /product="ADL191Wp"
                     /transcript_id="NM_209258.1"
                     /db_xref="GeneID:4620047"
     CDS             361663..362934
                     /locus_tag="AGOS_ADL191W"
                     /old_locus_tag="ADL191W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL140W (ARG8)"
                     /codon_start=1
                     /product="ADL191Wp"
                     /protein_id="NP_983905.1"
                     /db_xref="GeneID:4620047"
                     /translation="MVNQRVVHLCAKRSFSLTASMQKYFVDVYAKPDLVLTRGRGSRL
                     FDDVNKREYIDFVAGIAVTSLGHSDPAIAEVIAAQSATLVHTSNLFHNSEALKFAEKL
                     VESTKRFGGQQDAEKVYFCNSGTEANEAALKFSRRRALRTDPQKQGFIAFENSFHGRT
                     MGSLSVTSKAKYRLPFGDMVPHVTFLNIHDPVEKLVSFIVENAPKTAAMILEPIQGEG
                     GVHRVPEDKLVALGRLCKKHDIVLIYDEIQCGLGRTGKLWAHSNLPADAHPDIFTTAK
                     ALGNGFPMGATVVNSKVNEVLSVGDHGTTYGGNPLACAVGNHVLDRIAQQPFLDDVKA
                     KANVFTAGLLALQKKYPFIREIRGDGLLIGVEFTVDVSDIISKSRERGLLITAAGPNT
                     LRIIPALTIEEDTIRQGLEILESVVGEISSS"
     gene            complement(<363136..>364152)
                     /locus_tag="AGOS_ADL190C"
                     /old_locus_tag="ADL190C"
                     /db_xref="GeneID:4620048"
     mRNA            complement(<363136..>364152)
                     /locus_tag="AGOS_ADL190C"
                     /old_locus_tag="ADL190C"
                     /product="ADL190Cp"
                     /transcript_id="NM_209259.1"
                     /db_xref="GeneID:4620048"
     CDS             complement(363136..364152)
                     /locus_tag="AGOS_ADL190C"
                     /old_locus_tag="ADL190C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL322C (KRE1)"
                     /codon_start=1
                     /product="ADL190Cp"
                     /protein_id="NP_983906.1"
                     /db_xref="GeneID:4620048"
                     /translation="MLVGRTQLLLLLASSVTAASPEPGRLSVDLVENEVVNGDIEGMM
                     PVNKAPADDVAAAAAAAPAVAPAAAPAQANQPAAAAPAAQANQPAAAAPAAQANEPAA
                     AAQANQPAAAAPAAQANQPAAAAPAAQANQPAAAAPAAQANEPAAAAQANQPAAAAPA
                     AQANQPAAAAPAAQANEPAAAAQANQPAAQATHSKSTTASPTKAKDGSESTGVPDPST
                     ILDYWTHDGVWHTTDSYATIIDHGSFKTTLRQTTSYWFHTTLPDGSVSAYQSAYFQPF
                     SKLYESVDTPKSGEVGMGTLSGSIGVVKPPVYVDNQGGAGTIQNNISLFSLCGTVLLV
                     MSLL"
     gene            <365092..>367659
                     /locus_tag="AGOS_ADL189W"
                     /old_locus_tag="ADL189W"
                     /db_xref="GeneID:4620049"
     mRNA            <365092..>367659
                     /locus_tag="AGOS_ADL189W"
                     /old_locus_tag="ADL189W"
                     /product="ADL189Wp"
                     /transcript_id="NM_209260.2"
                     /db_xref="GeneID:4620049"
     CDS             365092..367659
                     /locus_tag="AGOS_ADL189W"
                     /old_locus_tag="ADL189W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL321W (VNX1)"
                     /codon_start=1
                     /product="ADL189Wp"
                     /protein_id="NP_983907.2"
                     /db_xref="GeneID:4620049"
                     /translation="MSKGAMSPIKSNPDSIRRVFSVEDNSNEIQNDVRKQGYQEGVAL
                     LSKSRAGMSNASTPQLQSAVPALCDHRHNLRGISEDQGQFSGSDWEAEVIPQALGDQE
                     SIRTVESFTLRERQHAINETHPFGIRIWKPALYKKYRSVQQAANEDIHETKYRHISLV
                     LHLSNIVWSATVGIFLFTILYLAGLSVRIFGLLSQSASDYSTIFFKLGRYLLWPFGKV
                     VYIVSDEQYLQEDKDEGVSIQQFYKWISGKGNRLFYHNSGADNHSSMAFERELPYGSI
                     TREFAESNLISDGCPDTDAGDSIPHRRLFGRGQWTIGRIVFYLIFHVFIQPIMMILVL
                     VLWLGVFTIPMSNIIWNLMYHCRRHPLALDFKHVQHTHQYPDDETIGDKNVLLCTFRC
                     AGWHYYKFTVDGTNVIVMNLISIVIFTIFDFYFLKRYLGLQLWITGDFNIFCLCLLSI
                     IPLAFYIGQAVASISAQTSMGLGAVINAFFSTIVEVYLYCVALKQSKGLLVEGSMIGS
                     ILAAVLLLPGMSMCGGALNRKTQRYNPASAGVSSAMLIFSMLVMFVPTIFYDLYGDWD
                     LICEGEVPLEAKERCRFAQPPLKFDSLYLHVLKPVSIICAVVLFLAYMIGLWFTLRTH
                     AAMIWQLPISDQHQDIHAQLQAQQAHSFLQSPKNPVAPHAAISSGNNVAEEPKGHAAP
                     NWSRNKSTWILLCATLFYAIIAEILVDCVDEVLKEIPSLNPKFLGLTVFALIPNTTEF
                     LNAISFAMHGNVALSMEIGSAYALQVCLLQIPALVIYSLVYTSGLDHSLIKIREQMFT
                     LVFPQWDLIACMISGFLFTYLYAEGKSNYFKGSILILLYIVITVVFYYQGFIDDNYW"
     gene            complement(<367905..>368540)
                     /locus_tag="AGOS_ADL188C"
                     /old_locus_tag="ADL188C"
                     /db_xref="GeneID:4620050"
     mRNA            complement(<367905..>368540)
                     /locus_tag="AGOS_ADL188C"
                     /old_locus_tag="ADL188C"
                     /product="ADL188Cp"
                     /transcript_id="NM_209261.2"
                     /db_xref="GeneID:4620050"
     CDS             complement(367905..368540)
                     /locus_tag="AGOS_ADL188C"
                     /old_locus_tag="ADL188C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL139C (CDC33)"
                     /codon_start=1
                     /product="ADL188Cp"
                     /protein_id="NP_983908.2"
                     /db_xref="GeneID:4620050"
                     /translation="MSVEEVTQKAQALSVGDNEERKTVLTDSKDFDLKHPLNSKWTLW
                     YTKPPVGDNESWSDLLRPVTSFTTVEEFWAIQNAIPKPRELPLKSDYHLFRNDIRPEW
                     EDEANSRGGKWSFQFKVRNPPIDDLWLRALLAVIGESIDEDESEINGVVINVRRSGFK
                     IGLWTKSVRQAPLSKVGAKFKAVLQLDDSDTLEFFAHSSANDKNAKPALVL"
     gene            <368856..>369713
                     /locus_tag="AGOS_ADL187W"
                     /old_locus_tag="ADL187W"
                     /db_xref="GeneID:4620051"
     mRNA            <368856..>369713
                     /locus_tag="AGOS_ADL187W"
                     /old_locus_tag="ADL187W"
                     /product="ADL187Wp"
                     /transcript_id="NM_209262.1"
                     /db_xref="GeneID:4620051"
     CDS             368856..369713
                     /locus_tag="AGOS_ADL187W"
                     /old_locus_tag="ADL187W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL320W"
                     /codon_start=1
                     /product="ADL187Wp"
                     /protein_id="NP_983909.1"
                     /db_xref="GeneID:4620051"
                     /translation="MVIQQMFKMVVGGTAVVITACLGALYVYQSKLVYPSWAQGARKH
                     VDTPDLYGLPYQELRLRTRDGVEIRAFDIRNLRSKGTILVLAPNGGNIGYFLSVAELL
                     YRQMGLSVFLYSYRGYGYSEGEPSEQGLKLDADRVMEYMRKDEFYRTQRLVLYGRSLG
                     GANALYIARKYGAQCDALILENTFLSIPKVIPYVFPYLRYVSFLCREVWNSEEEIRLV
                     DETIPILFLSGLKDEIVPPSHMQALYSLSKSSGKKFVTFADGYHNDTIIQNGYWDVVH
                     DFLQKHDVI"
     gene            complement(<369765..>373850)
                     /locus_tag="AGOS_ADL186C"
                     /old_locus_tag="ADL186C"
                     /db_xref="GeneID:4620052"
     mRNA            complement(<369765..>373850)
                     /locus_tag="AGOS_ADL186C"
                     /old_locus_tag="ADL186C"
                     /product="ADL186Cp"
                     /transcript_id="NM_209263.2"
                     /db_xref="GeneID:4620052"
     CDS             complement(369765..373850)
                     /locus_tag="AGOS_ADL186C"
                     /old_locus_tag="ADL186C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL138C (RTC1)"
                     /codon_start=1
                     /product="ADL186Cp"
                     /protein_id="NP_983910.2"
                     /db_xref="GeneID:4620052"
                     /translation="MGARRESGLHSFLNRKTPPTADMQQGSGGTRPQPFSRFTYGSKS
                     AQSSGGMGGQVACSPKGRGSQRSLLSSNFPFMESVFEDRTAAPQRTPTPRDERSEYFG
                     EAEGSSGLRSSLQCNRELASLDKINDAQARMVVVAGKSHLGLYKFDEAYRMQQVHDYM
                     TPGSLGGGTKFSSSMRRNMRKISTISDVKAGFHHHKNYIAICGTSTSVSIYDINRASA
                     KDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKVWDLRSHSYKVNRSDLNFN
                     SGSDSVRDVKWMPTYDFASLGADTSLCSSGRSNKFASVHDSGLLLTFDMRQPNQVERK
                     INAHSGPGLCMHWHPHMDYIISGGRDGKCALWYVGDKVNSMVSVPQGHNSATSYSINT
                     APITTGYLETVINTSHPVSKLKFRPKYVHNMLNSLIATSSMGEDSDVTIYSLARKHIP
                     QNILTTAAPSLGFVWWNEDIVFNIDKQSVISAWDIRYEPTLLDNLPKGIVKWRDMDGS
                     GLVFVAQEKGTYSMDNGGVTDSVGKGAANRMSNTTLNSTNNMGRDQEVFTYSFQQQYK
                     HQDQEAADRESDHDKELEKERETEVDQHYHYLREQEREHHQEYQEWEHEPFGRHDDHQ
                     GNPQTDFYSHAYSDRPMLSKALSTYSSKIASPILSYYGAQTLSHHTSIVSNSPSISGA
                     ALEYPGGIESPIMITLDLPQVFGSVRASRLADRKTSKNKGNAPAVRESAVDIFKYLVR
                     ELELCHVQERNDPKSISVDDRSKSLDDTELKIQLMENIGLSEHNTWATLIRSTTSMDT
                     NDPAGSHTQGHSKLVDMVKLQGSNILSPDNSDMEDDLGDKLDEMGTARLQENVNHLVG
                     LIFLSTHNAETYASVNDLQNFKIWMLIRDSLLNDLKEAADGSTGRRDASGGAANSDKN
                     GIYTTTSTVNHARQDSITSNFSSFEPSDISRSDGEEKLNLGRLSEQNLKATNQNTTAK
                     LDDTRKLASSSSLNSSEPLLLLEGGNQAKEQSIGLSDLKTCLKERYTASNESVLDIEE
                     ESSATVAYSSKQANTECSSSIPIRKTEARTSFIDTIMTNLRSPGLSHLDVDNDAIFGK
                     GKTSTSLGSGASKRSSMHSTDSYHKRPYSSPITYSKITTAAQKAKLGLADHDGLPNRG
                     SISFLANIDAAHADKLLLGKLGLASSPDDGKLLPPWDTGRLIQQLYRYSVETGNIILT
                     VCIILLFQTMYKVTSTRIVKSTLAEFITILHRYEMFEISAHLLKNCPWDDILGAGSGQ
                     STVRLFCENCGKLIVNEHSKTILSKRHQAGESNMTNFGYWYCDSCRKPNSLCVYCEQP
                     MKKLALSFLNCGHGGHFECLQQWFLDEGMSECPSGCSGVLL"
     gene            <374322..>375755
                     /locus_tag="AGOS_ADL185W"
                     /old_locus_tag="ADL185W"
                     /db_xref="GeneID:4620053"
     mRNA            <374322..>375755
                     /locus_tag="AGOS_ADL185W"
                     /old_locus_tag="ADL185W"
                     /product="ADL185Wp"
                     /transcript_id="NM_209264.1"
                     /db_xref="GeneID:4620053"
     CDS             374322..375755
                     /locus_tag="AGOS_ADL185W"
                     /old_locus_tag="ADL185W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL137W (BSC6)"
                     /codon_start=1
                     /product="ADL185Wp"
                     /protein_id="NP_983911.1"
                     /db_xref="GeneID:4620053"
                     /translation="MTSSSGTSASLPLLREEEQVWTAEDHIPGSQGTELRDWASPAPE
                     TAQKGCVKEVEYEGEVVRVYPADYRAVPAIRWQIGAAFVMFLILGINDQSTGSLMPVL
                     TREYAVTKVQVALIFAVQCIAYTIGSVATDALHRALGMRGALLLAAGTCVVTYSALSL
                     KPPTFYWYLPCFFYLGVAFAVIDSGCNVLLGGLDVHNTELLGMLHAAYGVASFITPPL
                     ANSIAKNHYWPRFFLVPLALSLVSFVMCFFAFRHETAAKYRYVCSGGEDADTEEAARE
                     RQFRRVVRNPVILLAAAFLFLYLGSEVSTGSWTLTYLLECKRNEPMAMSYVVTAYWAG
                     LTLGRIASGFVSRHFFANEYRAGLFYACTTLAMHVLFMATGFVAPHGTRYFVVMALFL
                     FLAGIFIGPLFPNCCVVTLQLLPKRLQLNGVSVAVALGSIGGAILPFAVGNILDAVGF
                     DWFPSIAVVIVLMFNVIWWLYPSLVKF"
     gene            <375975..>377324
                     /locus_tag="AGOS_ADL184W"
                     /old_locus_tag="ADL184W"
                     /db_xref="GeneID:4620054"
     mRNA            <375975..>377324
                     /locus_tag="AGOS_ADL184W"
                     /old_locus_tag="ADL184W"
                     /product="ADL184Wp"
                     /transcript_id="NM_209265.1"
                     /db_xref="GeneID:4620054"
     CDS             375975..377324
                     /locus_tag="AGOS_ADL184W"
                     /old_locus_tag="ADL184W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL317W (PFS2)"
                     /codon_start=1
                     /product="ADL184Wp"
                     /protein_id="NP_983912.1"
                     /db_xref="GeneID:4620054"
                     /translation="MNSANDGSVKKYVSQRRTVDMSSPYDRLYFYKKHAIPLRTIQPE
                     STYTADIMPPDAYRDHRRVLNIPTKFTHLSSNKVKHVIPAITWTPEGRRLVVATYSGE
                     FSLWNGSSFNFESIMQAHDSAVTVMQYSHAGDWLISGDADGTIKIWQPNFNMVKVLDR
                     AHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMG
                     LIVSGSKDNLIKLWDPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYD
                     MRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTI
                     PYAHEKSVTSLAYSPVGHILASAAKDRTIRFWARSRPVDPNAFDDPTYNNKKVNAWYF
                     GINNNINAVRPKTEHGIALPPANETNLGTPQPSILGSESIAANNGNVPASGLPGLSF"
     gene            complement(<377596..>378786)
                     /locus_tag="AGOS_ADL183C"
                     /old_locus_tag="ADL183C"
                     /db_xref="GeneID:4620055"
     mRNA            complement(<377596..>378786)
                     /locus_tag="AGOS_ADL183C"
                     /old_locus_tag="ADL183C"
                     /product="ADL183Cp"
                     /transcript_id="NM_209266.1"
                     /db_xref="GeneID:4620055"
     CDS             complement(377596..378786)
                     /locus_tag="AGOS_ADL183C"
                     /old_locus_tag="ADL183C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL136C (PFK27)"
                     /codon_start=1
                     /product="ADL183Cp"
                     /protein_id="NP_983913.1"
                     /db_xref="GeneID:4620055"
                     /translation="MTDREGPLPSNALRSHSTSMNSLFSFQNENSYSSILEYYDGAAE
                     SPPPSLTQEAGEEGSPLTLNYDGRHWNALREAPVLQGTEKFLVVLVGLPAVGKSTISG
                     HLIRFLQNNPRLSHLRCGVFNAGQVRRDLTYSGRSMKLANSSGEDLFNPKNSDKKNMY
                     ARITLERLFRELDADRCDIAIFDATNSTISRRRFIFQQVHEYNTRLGSDINITPIVLQ
                     VTCNDENFIRFNIHNKTFNQDYFDKPYEYAVRDFAQRLKHYYTQYVPFTEDEFTTTIE
                     AYMHIEGRTPGTYRGSLFFFSIINAGLDTDLSAPKVGFAPQISSAVAEVVAAFGDFVD
                     HYAQMYGHKYITHANEFMKNGRNTIPSLGNEPISLTSRPSYLSTLCSIIDDQYFNSLH
                     SLRK"
     gene            complement(<379274..>379873)
                     /locus_tag="AGOS_ADL182C"
                     /old_locus_tag="ADL182C"
                     /db_xref="GeneID:4620056"
     mRNA            complement(<379274..>379873)
                     /locus_tag="AGOS_ADL182C"
                     /old_locus_tag="ADL182C"
                     /product="ADL182Cp"
                     /transcript_id="NM_209267.1"
                     /db_xref="GeneID:4620056"
     CDS             complement(379274..379873)
                     /locus_tag="AGOS_ADL182C"
                     /old_locus_tag="ADL182C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL135C (MED7)"
                     /codon_start=1
                     /product="ADL182Cp"
                     /protein_id="NP_983914.1"
                     /db_xref="GeneID:4620056"
                     /translation="MSDSNNISSLYPPPPPYVKFFTKDNLERLAEYQSSHVTTDPEQI
                     TCELDFLIPPPVPSAGHYRAFGSVWQVKDELPDLETVGLRNLYDDRGQHGNNYQYKIK
                     ELHKLLKSLLLNMLELVSVLSVNPERFPDKVEHIRTILFNIHHLLNEYRPHQSRESLI
                     MLLEEQLEHKKEEIANIHAICDKVQAKLAAMCKQYIADD"
     gene            <380121..>380450
                     /locus_tag="AGOS_ADL181W"
                     /old_locus_tag="ADL181W"
                     /db_xref="GeneID:4620057"
     mRNA            <380121..>380450
                     /locus_tag="AGOS_ADL181W"
                     /old_locus_tag="ADL181W"
                     /product="ADL181Wp"
                     /transcript_id="NM_209268.2"
                     /db_xref="GeneID:4620057"
     CDS             380121..380450
                     /locus_tag="AGOS_ADL181W"
                     /old_locus_tag="ADL181W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL133W (HRT1)"
                     /codon_start=1
                     /product="ADL181Wp"
                     /protein_id="NP_983915.2"
                     /db_xref="GeneID:4620057"
                     /translation="MDVDEPYEATTAPSEGEAPKKKFQIKKWTAVAFWSWDIAVENCA
                     ICRNHIMEPCIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLTRNACPLDNKTW
                     QFAKYGK"
     gene            complement(<380515..>381477)
                     /locus_tag="AGOS_ADL180C"
                     /old_locus_tag="ADL180C"
                     /db_xref="GeneID:4620058"
     mRNA            complement(<380515..>381477)
                     /locus_tag="AGOS_ADL180C"
                     /old_locus_tag="ADL180C"
                     /product="ADL180Cp"
                     /transcript_id="NM_209269.1"
                     /db_xref="GeneID:4620058"
     CDS             complement(380515..381477)
                     /locus_tag="AGOS_ADL180C"
                     /old_locus_tag="ADL180C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL316C (PHA2)"
                     /codon_start=1
                     /product="ADL180Cp"
                     /protein_id="NP_983916.1"
                     /db_xref="GeneID:4620058"
                     /translation="MTRIAYLGPSGTYTHQATIQQFGVEDNEMIPMVSIQKCFSALLK
                     DESISYAVLPAENSTNGQVVFTYDLLRDYMLETPNAARGCMLPGFAIVAEQYVAVEHC
                     LASPLPMTADELKNANIERIYSHPQVWGQVGKYLEELARVTGKALSRCDAGSTSQAVD
                     RCLRDYREDKTVTLAIASALACRISGAHIVQSHISDVADNTTRFLIIQRRKQEPLQIL
                     PGRQPTPSGERIHLVAFTTDRQGAGSLTDVLLVLKRYGIDMRSITSRPFRRCSTSSKW
                     QYVFFVEYSDELDVPWDSFHAEVGAHCREWCHWGTFYRNNRYYS"
     gene            complement(<381671..>382624)
                     /locus_tag="AGOS_ADL179C"
                     /old_locus_tag="ADL179C"
                     /db_xref="GeneID:4620059"
     mRNA            complement(<381671..>382624)
                     /locus_tag="AGOS_ADL179C"
                     /old_locus_tag="ADL179C"
                     /product="ADL179Cp"
                     /transcript_id="NM_209270.2"
                     /db_xref="GeneID:4620059"
     CDS             complement(381671..382624)
                     /locus_tag="AGOS_ADL179C"
                     /old_locus_tag="ADL179C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL315C (ATP11)"
                     /codon_start=1
                     /product="ADL179Cp"
                     /protein_id="NP_983917.2"
                     /db_xref="GeneID:4620059"
                     /translation="MSSLGRSVFNRAFDNCKRAALLNKRGLEPWTPRYWYSSKTVEDR
                     YREKLLETARSKGFKTIEELKANLKDELEARKQKLNRIDPLKELEAYEQRTKMAENNA
                     KAARLRGPVDASTPRAPFKTLDSYLDVEKIRQLSKQEVEFLWRARWMNKDGVLNAVVP
                     VDVFERMSGYARANPAFVLPLQRDATGAGEEQGGQPVEMHYVQWQFVGPKTVHCIITS
                     LAEFKLHKEFARPHSTFQFHLELADQKKVVFMNGQIESDSNVTLQDAQLLLLNVQRFY
                     GAMGDATQAAKQRIKILQDFTAGSVDFKVDDLIALAQSLET"
     gene            <382988..>383776
                     /locus_tag="AGOS_ADL178W"
                     /old_locus_tag="ADL178W"
                     /db_xref="GeneID:4620060"
     mRNA            <382988..>383776
                     /locus_tag="AGOS_ADL178W"
                     /old_locus_tag="ADL178W"
                     /product="ADL178Wp"
                     /transcript_id="NM_209271.1"
                     /db_xref="GeneID:4620060"
     CDS             382988..383776
                     /locus_tag="AGOS_ADL178W"
                     /old_locus_tag="ADL178W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL314W (DAL82)"
                     /codon_start=1
                     /product="ADL178Wp"
                     /protein_id="NP_983918.1"
                     /db_xref="GeneID:4620060"
                     /translation="MMSSAAADDLLLELMDEFQPHLQSHRHKLQTWRRLLREFNRRTG
                     GSIRQERTLRMRFERMKETLESGGEVHVLQPGLLETLVREYNGSRGGNRRVEVGEHEW
                     NGCQPAGFEPLGSDLTSGTNSADEREESEPPPLDTMDVFPATEMRLLVERERYNLLRQ
                     SLVSFDDCSPEAGLSGGSSYCGSTSSHTSLLTPALSMKGVCTDGLHEVGRQLQSQAVL
                     DIICGELQQLRQQQETLEQHIFERLDRLAALLAQKPENAGVRGH"
     gene            complement(<383809..>386526)
                     /locus_tag="AGOS_ADL177C"
                     /old_locus_tag="ADL177C"
                     /db_xref="GeneID:4620061"
     mRNA            complement(<383809..>386526)
                     /locus_tag="AGOS_ADL177C"
                     /old_locus_tag="ADL177C"
                     /product="ADL177Cp"
                     /transcript_id="NM_209272.2"
                     /db_xref="GeneID:4620061"
     CDS             complement(383809..386526)
                     /locus_tag="AGOS_ADL177C"
                     /old_locus_tag="ADL177C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL313C (EMW1)"
                     /codon_start=1
                     /product="ADL177Cp"
                     /protein_id="NP_983919.2"
                     /db_xref="GeneID:4620061"
                     /translation="MDAYSVLLNAHLLLASPVNALADKSGCDAVELSWARNILSSKSY
                     SVVADAFAGVIFDLGEVADEQGLLAALQLTVRQMVAENRGKSLLVAVALLQTFIQNNY
                     TGPVVPLDFERDVLRCGEKGADLKRWLVTLLSVQGQIAYELCTNPAYLVLALLFLEEL
                     TGAQSLFLQSAEDIAVPSISADGTAPLEAVAHWWRFRALLVQISLIAEPVGPQPLIAS
                     SLLDSIELVHAVVRGLPVDTPETLKRQLYVIYYLENVKCALSINTEHLCLPVLQKVQK
                     LTDFQFVLTGARAKRTKFQQKAHAGLIILARSSSASLNEQEGDAASAPGALALNSDLL
                     FEKPHFESIGNEPLEEQLIKKQKLDGTAGLDETRLLPVALRQEDIPIELREVDPNNQP
                     RLSDYDNIQLLLRLYAIRQTSPARDPIVDEELASIIGRVVYQDGQKNWSVFARALWER
                     SVLETTKAKTIERGILQMQSLVEELGLKIQHRYTPESDAEELTPASDRMKYIHQLPFL
                     PRWALDRELAEKYMSMGILRSAVEIYERLELHCDAALCYAAVGDEKQASLILQKRIEN
                     NPNDARAYSILGDIRQDPALWEKSWEVGKYVNAKNSLGKFYYSPPANSGVSRDFNLSL
                     KHLNDSLRLYPLSFDTWYFYGCIGLECGKVDLAAEAFSRCVALDDTHALSWSNLSAAY
                     TEQGKIKEAHSCLKRAIASDSQRNWRIWENYMTVSVKLHEWEDVLLACRHLIELGRDK
                     KGERAIDMPVLEKLSELLTSTDYPGDPQMLSYFQRSCVSLICELLPSVITSSARCWRI
                     VARVELWRKRPYAALECHEKAYRSMAHNPDLEINEGVWNSTVDTCEELVAAYESLGPM
                     EGKHGAGDLVCKDWKYKARSTIKSLLNKGRNSWEGSEGWEKLVQLRNNL"
     gene            <386736..>387621
                     /locus_tag="AGOS_ADL176W"
                     /old_locus_tag="ADL176W"
                     /db_xref="GeneID:4620062"
     mRNA            join(<386736..386742,386801..>387621)
                     /locus_tag="AGOS_ADL176W"
                     /old_locus_tag="ADL176W"
                     /product="ADL176Wp"
                     /transcript_id="NM_209273.1"
                     /db_xref="GeneID:4620062"
     CDS             join(386736..386742,386801..387621)
                     /locus_tag="AGOS_ADL176W"
                     /old_locus_tag="ADL176W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL312W (RFA2); 1-intron"
                     /codon_start=1
                     /product="ADL176Wp"
                     /protein_id="NP_983920.1"
                     /db_xref="GeneID:4620062"
                     /translation="MATYQQPFNEFSTVTGGGFDSQASAGRPGSTGGQSTATLTPVTI
                     KQILEAKQQVQDGPYVVHSMELHNICFVGVVRNVVDNTANVNVTVEDGTGQIEFRQWS
                     NDQKDMERASQGETAEYNSELSQQFQIGNYVKVFATLREFGGKMNIQYALVKPVENFN
                     EVLAHHLAAIKCYALANGRLAPPAAPFNAAAGAQGGQSLFVQDNDYSSAKPATQRILD
                     FCRDQCKDKDANTFSVHTKFIAQSLSMLEDDVRMHCQTLTEQGFIYPTFDENSYFTL"
     gene            <387873..>389297
                     /locus_tag="AGOS_ADL175W"
                     /old_locus_tag="ADL175W"
                     /db_xref="GeneID:4620063"
     mRNA            <387873..>389297
                     /locus_tag="AGOS_ADL175W"
                     /old_locus_tag="ADL175W"
                     /product="ADL175Wp"
                     /transcript_id="NM_209274.1"
                     /db_xref="GeneID:4620063"
     CDS             387873..389297
                     /locus_tag="AGOS_ADL175W"
                     /old_locus_tag="ADL175W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL132W (GAS4)"
                     /codon_start=1
                     /product="ADL175Wp"
                     /protein_id="NP_983921.1"
                     /db_xref="GeneID:4620063"
                     /translation="MVTRTSIRLLYSILFILHARAFIHPIEIRGKHFVDSFTEQPFFI
                     KGLDYQPGGSSRVDGKQDPLSDPQKCARDIMLFQQLGINTIRVYSLNPDLNHDVCMTM
                     LAAAGIYLFLDVNSPLQNQHLNRYEPWSTYSEPYLQHVFKLIEQFSHYNNTLGFFAGN
                     EVVNDGRSAQTSPPYLKALVGDMKQYIARHSPRPIPVGYSAVDDLKFRVSLARYLECY
                     DANNKFNDVDFYGVNSYQWCGQQTFQTSGYDKLVDAYREYSKPVFFSEFGCNEVLPRQ
                     FQEVEALYSKEMYTVFSGGLVYEFNQEANNYGLVDSDAEGNIKLLPDFDTLKKVYGKV
                     HMPTAEDLQRGLEKDRAAAMAVSSKSRCVQQYDNLEITIAVPNLANSMIRNGVQVEPG
                     SYVDLSEDKLRTTYKIFDVSGKEILKGSRVEVVEVFDGSNLAKMRKLRRARYRNGAAT
                     SFPTSAIVLTTIGIIELLFQFSVI"
     gene            complement(<389338..>391407)
                     /locus_tag="AGOS_ADL174C"
                     /old_locus_tag="ADL174C"
                     /db_xref="GeneID:4620064"
     mRNA            complement(<389338..>391407)
                     /locus_tag="AGOS_ADL174C"
                     /old_locus_tag="ADL174C"
                     /product="ADL174Cp"
                     /transcript_id="NM_209275.2"
                     /db_xref="GeneID:4620064"
     CDS             complement(389338..391407)
                     /locus_tag="AGOS_ADL174C"
                     /old_locus_tag="ADL174C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL311C (SKP2)"
                     /codon_start=1
                     /product="ADL174Cp"
                     /protein_id="NP_983922.2"
                     /db_xref="GeneID:4620064"
                     /translation="MRRLQLFKGNRATRCQEDGSCSRTAARRSAQTVGLLDLPPAALE
                     RIAQFLDKQGVRALGMASKALYEGVCHKLLYRNVTIESKKQLLKFNATLASSLRALCV
                     GDSITRGQWHADTVLCIEFVNPESNDSLPSSYGSFNQGTAHTLYGSSVFSGFQRKCYA
                     QRPSRINLDGLSNKHILSMFGHNDPDAHFDCLESEYVQYTYLELMVAALDRLSKLQRV
                     ILSDIAPSFVVPIRFSVLNDGSAAFAKLVENPKRSMTREDLRDFKLSSTWLKEYKKKY
                     RNLPSYRTVELRAARCKAPVNLRPSLLCCFGTFQELILSNFALSNESFDTPFEYLPMQ
                     LIEGSKGVWDLSSPASSLVLDACYVLPGSGIMSGLHSYFAQVSHLALFGIRSLCDILL
                     CRCLPALCELSIDCASKCFLSHEPVESDYYTGAAFEFNAQDNESTVETLVERIAPLTL
                     LAPPPTTAVVILLNHGILNRSMHSYPRKAGTITTEQEKYFTSFGISKFYYSFHYFKSL
                     WDRISNENINLKLINVSFTNVCPLEPQEFWQRFRNYQNDDQATISGIISIHSPAFASI
                     TRNTWDSDFIEHYLSYFNANEEIDITSSPASYQDNGDTAIVDPSMLNNYHDLKMFKDI
                     PDANFWFFLNIVSGFKSVDFHVCDVNVLFGSFDWERMLGPILLGRKPLKIKDCRGNIR
                     FSYDPCG"
     gene            complement(<391567..>392139)
                     /locus_tag="AGOS_ADL173C"
                     /old_locus_tag="ADL173C"
                     /db_xref="GeneID:4620065"
     mRNA            complement(<391567..>392139)
                     /locus_tag="AGOS_ADL173C"
                     /old_locus_tag="ADL173C"
                     /product="ADL173Cp"
                     /transcript_id="NM_209276.1"
                     /db_xref="GeneID:4620065"
     CDS             complement(391567..392139)
                     /locus_tag="AGOS_ADL173C"
                     /old_locus_tag="ADL173C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL310C (ZIM17)"
                     /codon_start=1
                     /product="ADL173Cp"
                     /protein_id="NP_983923.1"
                     /db_xref="GeneID:4620065"
                     /translation="MLRRSMGPLRIAGLLRPSRNCMQYVLGPVFGGHLVAHRFHSGSP
                     QLQNSQKPPIADEFRHIGSIKVDKPMMMIAFTCKKCDTRSSHTMSKQAYTKGTVLIQC
                     PGCKNRHLIADHLKIFRDDSVTVQDILAAKGESVSLTTEDLAFEDIPEQLRPLIGHHA
                     SDAPEELRRKLDNETLHALPAQDGEKQGSS"
     gene            <392313..>393374
                     /locus_tag="AGOS_ADL172W"
                     /old_locus_tag="ADL172W"
                     /db_xref="GeneID:4620066"
     mRNA            <392313..>393374
                     /locus_tag="AGOS_ADL172W"
                     /old_locus_tag="ADL172W"
                     /product="ADL172Wp"
                     /transcript_id="NM_209277.1"
                     /db_xref="GeneID:4620066"
     CDS             392313..393374
                     /locus_tag="AGOS_ADL172W"
                     /old_locus_tag="ADL172W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL309W (STB1)"
                     /codon_start=1
                     /product="ADL172Wp"
                     /protein_id="NP_983924.1"
                     /db_xref="GeneID:4620066"
                     /translation="MSLDMDTRPLSPQKEQEIASKILQRAELAQMTRQLKLGLSRVAS
                     PKKGSSAASCPNAVNKTAVLRGPGPRMKDGLGVCMGAIAGRCSPIKMSRSAPAISRLL
                     LGKAKTGCATTPDEKENEEGQSPAKRHKQGAGAADGRGGPQRGALMDMIKPLPSTPKS
                     HREAAPRRPAVGASAGTLPHGSEDVGADLLMYLATSPYASAAKQHHTSSPRVPMTPSY
                     LHHASSAGDPRPAQAWQHPSPHAVPKMSQNYAAAQAGASPSMLLGQEAFHELGDSPGM
                     SMYMSPQTHRLKGNGGYLLPTASISDPSVLGDTGRPPSSQSLTSHLLRTPNFNMNDYV
                     HNLFSPSPRIDPPGSSGNI"
     gene            <393670..>396069
                     /locus_tag="AGOS_ADL171W"
                     /old_locus_tag="ADL171W"
                     /db_xref="GeneID:4620067"
     mRNA            <393670..>396069
                     /locus_tag="AGOS_ADL171W"
                     /old_locus_tag="ADL171W"
                     /product="ADL171Wp"
                     /transcript_id="NM_209278.1"
                     /db_xref="GeneID:4620067"
     CDS             393670..396069
                     /locus_tag="AGOS_ADL171W"
                     /old_locus_tag="ADL171W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL130W (ALR1)"
                     /codon_start=1
                     /product="ADL171Wp"
                     /protein_id="NP_983925.1"
                     /db_xref="GeneID:4620067"
                     /translation="MSNPKERNDDGRLSPCASVEPSLMSTRTEDHNDLYDHRQHPVAI
                     ARKQSVADDSGPMGRNVLTNPRGSSEKQKSREENSQARLGRIRSGKLVDESQDEYPEH
                     VRPIPRATVSKSSAGWPARAPHSASQQTLYGFPRERADTEKDAGVSGTDGGLKSRRGS
                     RTLSIVDTGLRRKMSRAQSETSSQGGNLHFLSRTFSHKSQDSGLVNVRRNRRMSADSD
                     DSNASRESQETEEDVCFPMQQPEHTRINGIDFDELEEFAQESLRANLTMNINVGVSKG
                     DDVDMKCSGSPGSSTGTSTSISSAAMKYTPKGNFKQKDSSNETAPGISFGNNKVETGE
                     YLPMNDLSSYANESAAYDTMDNGNIPADNYKIPDRFSFFCSEAGETVHAPDIPSLVQD
                     GETFRELFRDGAVTWWLDCSCPTDEEMRCIAKAFGIHPLTAEDIRMQEPREKVELFKS
                     YYFVCFHTFENDPESADFLEPINMYIVVFRNGVLTFHFSPVSHSANVRRRVRQLRDYV
                     DVNSDWICYALIDDITDSFAPVIQTIEYEADVIEDCVFMTGDLDVSRMLQTIGEGRRK
                     TMTLMRLLSGKADVIKMFAKRCQDEANGIGPALTSEINIANLQASGHDPLSARLGSNI
                     QHHHVQRTQPRADIALYLGDIQDHVLTMFQNLLSYEKIFSRSHGNYLAQLQVESFRCN
                     NRVTEMLGKVTMIGTMLVPLNLVTGLFGMNVTVPGEATGELHWFFGILAILVGSAVGL
                     WFLSSWWISKANSPRSLNDTVMSGTRSILNFARRNRNDQCRPEGNKSVISCPSKYARY
                     Y"
     gene            complement(<396251..>397882)
                     /locus_tag="AGOS_ADL170C"
                     /old_locus_tag="ADL170C"
                     /db_xref="GeneID:4620068"
     mRNA            complement(<396251..>397882)
                     /locus_tag="AGOS_ADL170C"
                     /old_locus_tag="ADL170C"
                     /product="ADL170Cp"
                     /transcript_id="NM_209279.2"
                     /db_xref="GeneID:4620068"
     CDS             complement(396251..397882)
                     /locus_tag="AGOS_ADL170C"
                     /old_locus_tag="ADL170C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL308C (KRI1)"
                     /codon_start=1
                     /product="ADL170Cp"
                     /protein_id="NP_983926.2"
                     /db_xref="GeneID:4620068"
                     /translation="MPRKKSAAKKAKEAAKKAELEAQAAVIEDVPEENHTASDEESTS
                     EEEDDYGELITEDVEEGIKNVLEAIRTKDTSELLNPTVRFFEEPEAAVAKLAQAERHK
                     PIYLKDYHRMNLLAGETFAKDGEDFETMDGKPSFAAEQRQERAQILAEINEEVGKAEE
                     DDEDEFLTKKKPSSEVAQKTALPDPSVDDEQFLQAFVEQQAWIPRKGDKTVDLDRGEA
                     FEEDDKEFEDAVEQFETAYNFRYEDPNAAEIVSYARTQATIRRSAASTRKRKRDEEKQ
                     EKDKDRQEREKAIQKKKKETVYQLSDVLDKIRKEYGAEISEPMVQKLTATLLNGSYDD
                     SKWDEVVGELFDEEFYQQEGKPTWDENDEIMGDFYAGNADDDDDAAPTEDHANGEKEK
                     KSKKEGTKEKKAKKQEKKELRNIIEESVEQNKLALIEKVEEERGRTKEKDLDIKFRYR
                     EVSPESFGLTTREIFMADDAALNEYIGLKKFAPYRAKELRNKDKRKVMKAKRLKEWRK
                     KVFNNENGLADEDEALDTQAAPKKEKSRSKHKTSK"
     gene            <398277..>398807
                     /locus_tag="AGOS_ADL169W"
                     /old_locus_tag="ADL169W"
                     /db_xref="GeneID:4620069"
     mRNA            <398277..>398807
                     /locus_tag="AGOS_ADL169W"
                     /old_locus_tag="ADL169W"
                     /product="ADL169Wp"
                     /transcript_id="NM_209280.1"
                     /db_xref="GeneID:4620069"
     CDS             398277..398807
                     /locus_tag="AGOS_ADL169W"
                     /old_locus_tag="ADL169W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL129W (VPS68)"
                     /codon_start=1
                     /product="ADL169Wp"
                     /protein_id="NP_983927.1"
                     /db_xref="GeneID:4620069"
                     /translation="MDQDQNRLFRLPFHLPHRLVTRKGGVYLAGALYVLGIWLFVDCL
                     LYSKYVNPSKLHVTFVDWIPVLCSTSGMLVVSMIDKNRLLEDALASGSFVGSNQRAWQ
                     AQMVLFLGFALLAGGFAGALAVLVLKFLVKGYNTYPVLTMGVNNVLGNLFIMLSCIVL
                     WMAQSVEDEYSYSLTL"
     gene            complement(<398959..>400047)
                     /locus_tag="AGOS_ADL168C"
                     /old_locus_tag="ADL168C"
                     /db_xref="GeneID:4620070"
     mRNA            complement(<398959..>400047)
                     /locus_tag="AGOS_ADL168C"
                     /old_locus_tag="ADL168C"
                     /product="ADL168Cp"
                     /transcript_id="NM_209281.1"
                     /db_xref="GeneID:4620070"
     CDS             complement(398959..400047)
                     /locus_tag="AGOS_ADL168C"
                     /old_locus_tag="ADL168C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL307C (MCK1) and YOL128C (YGK3)"
                     /codon_start=1
                     /product="ADL168Cp"
                     /protein_id="NP_983928.1"
                     /db_xref="GeneID:4620070"
                     /translation="MSQQDQFIADDVTSNQSNVTRQMLVKEYKRIGHGAFGTVVQAYL
                     TPDNEKWYGPFAIKKVPAQTEYKSRELAILRIADHPNVVKLEYFFTHVSPSDGKVYQH
                     LAMECLPETLQHEILRYTQNKLELPLKHIKMYTYQIARGMLYLHALGICHRDIKPSNI
                     LVDPKSGVLKICDFGSAKKLEQNQPSISYICSRFYRAPELIVGCTQYTTQIDIWGLGC
                     VIGEMLIGKAVFQGQEPLLQLHEIAKLLGPPDKKFIFFSNPSYGGPLFSKPLFNGTPQ
                     QRFEKYFGHAGPEGIDLLMKVLCYSPERRLSPRRVLCHAFLDELRNDRYFFPAGSSQP
                     KQMPELFDFSEFELEIIGTLLPSIVGHE"
     gene            <400300..>400899
                     /locus_tag="AGOS_ADL167W"
                     /old_locus_tag="ADL167W"
                     /db_xref="GeneID:4620071"
     mRNA            <400300..>400899
                     /locus_tag="AGOS_ADL167W"
                     /old_locus_tag="ADL167W"
                     /product="mitochondrial 37S ribosomal protein YmS18"
                     /transcript_id="NM_209282.1"
                     /db_xref="GeneID:4620071"
     CDS             400300..400899
                     /locus_tag="AGOS_ADL167W"
                     /old_locus_tag="ADL167W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL306W (MRPS18)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS18"
                     /protein_id="NP_983929.1"
                     /db_xref="GeneID:4620071"
                     /translation="MLGRGGMFSGLRALSTGAAAHNGATQYASLARSGMIVQPGADPR
                     SANRKPDEQVVKYVLNCLFTKNNTHFTYSAVVEDRNFLANNAHLSYNDKFLYYLQLPQ
                     RVRLHLSTGQLGFRKAARGEYEATFQTAAKLFQTLRERQLLDKGVEIIMKDFGKGREA
                     FIAALNGKEGNQVRPAVTRVSDATPLKFGGVRAPRRRRL"
     gene            <401022..>401917
                     /locus_tag="AGOS_ADL166W"
                     /old_locus_tag="ADL166W"
                     /db_xref="GeneID:4620072"
     mRNA            join(<401022..401277,401502..>401917)
                     /locus_tag="AGOS_ADL166W"
                     /old_locus_tag="ADL166W"
                     /product="ADL166Wp"
                     /transcript_id="NM_209283.1"
                     /db_xref="GeneID:4620072"
     CDS             join(401022..401277,401502..401917)
                     /locus_tag="AGOS_ADL166W"
                     /old_locus_tag="ADL166W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL127W (RPL25); 1-intron"
                     /codon_start=1
                     /product="ADL166Wp"
                     /protein_id="NP_983930.1"
                     /db_xref="GeneID:4620072"
                     /translation="MGVCLLKFEFSAWRSVEPGGPSWARTPSSLPRETHPRAGTVGVG
                     DTATHYARAGTVKILNSVEARIQCIIASEEHIHSKTEMAPSAKATAAKKAVVKGTNGK
                     KALKVRTSATFRLPKTLKLARSPKYSSKSVPHYNRLDAYKVIEKPINSETAMKKVEDG
                     NTLVFQVSLKANKHQIKKAVKELYEVDVLAVNTLVRPNGTKKAYVRLTADHDALDIAN
                     KIGYI"
     gene            complement(<402081..>402854)
                     /locus_tag="AGOS_ADL165C"
                     /old_locus_tag="ADL165C"
                     /db_xref="GeneID:4620073"
     mRNA            complement(<402081..>402854)
                     /locus_tag="AGOS_ADL165C"
                     /old_locus_tag="ADL165C"
                     /product="ADL165Cp"
                     /transcript_id="NM_209284.2"
                     /db_xref="GeneID:4620073"
     CDS             complement(402081..402854)
                     /locus_tag="AGOS_ADL165C"
                     /old_locus_tag="ADL165C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL305C (BXI1)"
                     /codon_start=1
                     /product="ADL165Cp"
                     /protein_id="NP_983931.2"
                     /db_xref="GeneID:4620073"
                     /translation="MSKSSKVHIGVRSFWGTLAMEARGWLRGNSAMEYTPPPSYNSID
                     LESQGKSGAIPAGLNPIILSCALWILTTTLAGLVLYYERAGTPAVLGSMIACLVAILC
                     IVFHINKLLKDNSRWLWTCLSYFPVLQLFICTLLFFSNRGLAYWVTVAAFSAVLMGTV
                     LLYCSYQSQEDWDQDTLWEQKNQIPLYAAPLMAIAALHITGLVQLQWIYRAYFIYLSV
                     LLSLTTKHVYLNTDVRSVLSSNGRINAIMLFMFLSLSVI"
     gene            complement(<403018..>404163)
                     /locus_tag="AGOS_ADL164C"
                     /old_locus_tag="ADL164C"
                     /db_xref="GeneID:4620074"
     mRNA            complement(<403018..>404163)
                     /locus_tag="AGOS_ADL164C"
                     /old_locus_tag="ADL164C"
                     /product="ADL164Cp"
                     /transcript_id="NM_209285.1"
                     /db_xref="GeneID:4620074"
     CDS             complement(403018..404163)
                     /locus_tag="AGOS_ADL164C"
                     /old_locus_tag="ADL164C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL126C (MDH2)"
                     /codon_start=1
                     /product="ADL164Cp"
                     /protein_id="NP_983932.1"
                     /db_xref="GeneID:4620074"
                     /translation="MQASTYYVISNMPHTTADSSTQRVRVAVLGAAGGIGQPLSLLLK
                     TQLAQVLGDANASLELALYDVAADALAGVAADLSHVNTPVEVSHHVPSSREDEEALRE
                     ALTGASVVVIPAGVPRKPGMTRDDLININAGIIKTLAKGIAGACDLEKVFVLVISNPV
                     NSLVPVMVRQLIRHAEAKQAPHAGVERRVFGVTQLDMVRASAFVRSLGELGNEVPSVP
                     VIGGHSGETILPLFGPVQQRLQFSLEQRKKLTHRVQYGGDEIVAAKKGAGSATLSMAY
                     AAYVVAERFTNLVLGNVSEIQETLYVSLYDRENKPIAEGAAELLSNIGETPYFAVPVK
                     ISADAGVVRVEHEVWQQLDDYDREHLLPACLEGLRKNIETGETLGSN"
     gene            <404413..>405741
                     /locus_tag="AGOS_ADL163W"
                     /old_locus_tag="ADL163W"
                     /db_xref="GeneID:4620075"
     mRNA            <404413..>405741
                     /locus_tag="AGOS_ADL163W"
                     /old_locus_tag="ADL163W"
                     /product="ADL163Wp"
                     /transcript_id="NM_209286.2"
                     /db_xref="GeneID:4620075"
     CDS             404413..405741
                     /locus_tag="AGOS_ADL163W"
                     /old_locus_tag="ADL163W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL125W (TRM13)"
                     /codon_start=1
                     /product="ADL163Wp"
                     /protein_id="NP_983933.2"
                     /db_xref="GeneID:4620075"
                     /translation="MEASSLVAERPTGGEQDPGHARCAFYLPRKRRSCGMAPKAGARF
                     CAEHQPGDSGTAARVPCPLDPRHTVAKAQLRSHLARCNRTKQDQALRAEREHMPWYEA
                     GVNSAARPAAAAADEATLQAAVMRAIPVLAQIAEAEFRAPLRVAVLSNAQVEHVRFPQ
                     LPSNRKHALQQSSLIQHLREAGLWVAPERPVAYVEFGCGRGELSRYINQAAVLEQLER
                     GGPAAPPAFVLVDRACPRMKFDSKFAEDVAELHARFCPSVPPDERPAPAVTRKKIDIR
                     DLRLAALLSPGLEHIAVSKHLCGVATDLTLRCLAAGPRASLCGALIAMCCRHACNPAE
                     YANPAYVEALLARHAPDMSYDLFFLALMKMASWAVSGRRPGVPDTEVGGHFSGLAIAE
                     RERLGHLARRLVDEGRRQYFADLGYDAELLVYCERDTSREDIALLVRRPA"
     gene            <406043..>407257
                     /locus_tag="AGOS_ADL162W"
                     /old_locus_tag="ADL162W"
                     /db_xref="GeneID:4620076"
     mRNA            <406043..>407257
                     /locus_tag="AGOS_ADL162W"
                     /old_locus_tag="ADL162W"
                     /product="ADL162Wp"
                     /transcript_id="NM_209287.2"
                     /db_xref="GeneID:4620076"
     CDS             406043..407257
                     /locus_tag="AGOS_ADL162W"
                     /old_locus_tag="ADL162W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL304W (YPT11)"
                     /codon_start=1
                     /product="ADL162Wp"
                     /protein_id="NP_983934.2"
                     /db_xref="GeneID:4620076"
                     /translation="MSGKRKLYVRTSSEPTSPQQSHVGVFGETVPLEALRRRVITPSR
                     QQSMVERHVPAVSRARDTGLEYTDGAHASSIKLLLIGNAGVGKTAMILSYSNELPTKS
                     QLWQQSPQLAAPNIDQRTKKRLKTVDARKRYSLNDYEELFARDARSIEDAGREDGDEV
                     VIETKSTIGVDIKTSFVDIDRQLFKVIMWDTAGQERYRNAMVPSLYKGTQGIILSYDI
                     CSRETFRDCLEHWLPEALEHCQVEHTRFYLVGNKVDLYKQRQVTHADVLAFADEAKRR
                     YGFEISGKFELSCKWQHVVERAFSLIIKDLVEHGCYEDNFLDTCTDNNDEDDDNYGAT
                     MRDNEEHDDDEADTCVCDAATNLPGMQARKLTSAQGRRSPESNSRNTNIDITKPIHKD
                     GSPGAAKSSCCS"
     gene            complement(<407254..>408564)
                     /locus_tag="AGOS_ADL161C"
                     /old_locus_tag="ADL161C"
                     /db_xref="GeneID:4620077"
     mRNA            complement(<407254..>408564)
                     /locus_tag="AGOS_ADL161C"
                     /old_locus_tag="ADL161C"
                     /product="ADL161Cp"
                     /transcript_id="NM_209288.1"
                     /db_xref="GeneID:4620077"
     CDS             complement(407254..408564)
                     /locus_tag="AGOS_ADL161C"
                     /old_locus_tag="ADL161C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL124C (TRM11)"
                     /codon_start=1
                     /product="ADL161Cp"
                     /protein_id="NP_983935.1"
                     /db_xref="GeneID:4620077"
                     /translation="MGKKYLLFMVQVHVNFRRAELESLAELHGVKVDFSSYREDSPFM
                     VVELEGDEQARQWIRRAILCRAIYEYWGEGADYAELHASVRGNADVAAYTAACRESTF
                     KFEFESYGGAGNGRFDRVAQIEQFAYLGLEGKIRLKAPQETFTVVERYENVTENIGGE
                     KPVHLYFGRLVQRSDRLQGALEKYDLKKRPYKGTTSFEAELSLVSANIAQVKPMHLMY
                     DPFAGTGSFLVAGSHYGALVVGSDIDGRMIRGKGSQTIGANFRHYGESHRFLDVLTMD
                     FTHNALREGLPVDTILCDPPYGIRESIKVLGAREPERFRGKEDVEIDGVKAYLRPDYI
                     PTKKPCSLDAMLDQLLQFSAERLPIGGRLAFWMPTANDDNVETIVPLHPNLELLYNCV
                     QEFNKWSRRLLVYANRGPDFNGPTNSGAQRTKTKFRDRYFSGFN"
     gene            <409129..>410709
                     /locus_tag="AGOS_ADL160W"
                     /old_locus_tag="ADL160W"
                     /db_xref="GeneID:4620078"
     mRNA            <409129..>410709
                     /locus_tag="AGOS_ADL160W"
                     /old_locus_tag="ADL160W"
                     /product="ADL160Wp"
                     /transcript_id="NM_209289.2"
                     /db_xref="GeneID:4620078"
     CDS             409129..410709
                     /locus_tag="AGOS_ADL160W"
                     /old_locus_tag="ADL160W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL123W (HRP1)"
                     /codon_start=1
                     /product="ADL160Wp"
                     /protein_id="NP_983936.2"
                     /db_xref="GeneID:4620078"
                     /translation="MSFSDEEDFDDIYGDDNKQNSETAVAAGKRKADGEAGAGPTSKE
                     EAARGADNSGASAAETTTTPASSLDQLAALQVLSSNLNQLQQSTNNNSNNNTNSSDST
                     SNDSNKGNVPDQMLARGMPDLSQLQQLQQTMNQLQQQAAPLTQQQQQEAKQVKADLSR
                     DINKMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVD
                     EVVKTQHILDGKVIDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDA
                     QLMLDKDTGRSRGFGFITYDSPDAVDRVCQNKFIEFKGKRIEIKRAEPRQVQKQRTTN
                     ASPTGQPFSLNTSQAPQPPQQQFQMMANPMMANPLFNPQAMADYYAKMQEYYQQSGID
                     YSQMYQQQMQQMQQMMSMMTGGNAPAGGMPAGANGAGGNGDDTNGVPTIGEDSSSTSS
                     GKDNNDKESSNNRHDSYGNRDRERSPDARRGHRNYNDREEGGHGFRRENRDRGFRGRE
                     RRGGGYGRDRRGYHPYSR"
     gene            complement(<410944..>412590)
                     /locus_tag="AGOS_ADL159C"
                     /old_locus_tag="ADL159C"
                     /db_xref="GeneID:4620079"
     mRNA            complement(<410944..>412590)
                     /locus_tag="AGOS_ADL159C"
                     /old_locus_tag="ADL159C"
                     /product="ADL159Cp"
                     /transcript_id="NM_209290.1"
                     /db_xref="GeneID:4620079"
     CDS             complement(410944..412590)
                     /locus_tag="AGOS_ADL159C"
                     /old_locus_tag="ADL159C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL122C (SMF1)"
                     /codon_start=1
                     /product="ADL159Cp"
                     /protein_id="NP_983937.1"
                     /db_xref="GeneID:4620079"
                     /translation="MPAAHETESPPIQTLGQRKRQQNEKVDQKWKTLPEDMSAGSEIP
                     MGSKCHGAEPVPRKSIWQRAREIFLKYMKFVGPGLMISVAYMDPGNYATDVSAGASHK
                     FALLCIVLYSGLIAIFLQSLCIKLGTVTGLDLSRACREYFPRWLNITLYVLSEAAIIA
                     TDIAEVIGGAIALNILLKIPLPAGAVITCTDVLLVLLAYTPGTSSMRLVRVFELGVAT
                     LVLGVTVCLCIDLAYIPSTTSVAKIFRGFIPSREIFQNNGMYAAVGILGATVMPHSLF
                     LGSGIVQPRLLEYDVQHGHYSMDIDSDDDSSLENKTSRQTKESRFLDYRPSIYAIRYA
                     MKYSIIEVSVALLTFALFINCAILIVSGSALYDTPEAIDADLYTIHHLLSNTLAPAAG
                     TIFMLALLFSGQSAGIVCTIAGQIVCEGHIRWTITPWKRRILTRAIALIPTLAVSTAL
                     GKNGLSQALNASQVALSVLLPFLTAPLIYFTCSKRIMSVKVSKPMPDGVPADEEEQTP
                     EYVDMSNGWITSLAAIFIWIFISFLNIYAIVQLGLTSRQT"
     gene            complement(413167..413240)
                     /locus_tag="AGOS_t0063"
                     /db_xref="GeneID:4620080"
     tRNA            complement(413167..413240)
                     /locus_tag="AGOS_t0063"
                     /product="tRNA-Ile"
                     /codon_recognized="AUU"
                     /db_xref="GeneID:4620080"
     gene            complement(<413688..>414469)
                     /locus_tag="AGOS_ADL158C"
                     /old_locus_tag="ADL158C"
                     /db_xref="GeneID:4620188"
     mRNA            complement(join(<413688..414105,414450..>414469))
                     /locus_tag="AGOS_ADL158C"
                     /old_locus_tag="ADL158C"
                     /product="40S ribosomal protein S19"
                     /transcript_id="NM_209291.1"
                     /db_xref="GeneID:4620188"
     CDS             complement(join(413688..414105,414450..414469))
                     /locus_tag="AGOS_ADL158C"
                     /old_locus_tag="ADL158C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL302C (RPS19B) and YOL121C (RPS19A); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S19"
                     /protein_id="NP_983938.1"
                     /db_xref="GeneID:4620188"
                     /translation="MPGVSVRDVPAQEFINAYASFLQRQGKLEVPGYVDIVKTSAGNE
                     MPPQDSEGWFYKRAASVARHIYLRKQVGVGKLNKLYGGAKNRGVRPHKHVDASGSINR
                     RVLQALEKIGVVEISPKGGRRISENGQRDLDRIAAQTLEEDEE"
     gene            complement(<415331..>416149)
                     /locus_tag="AGOS_ADL157C"
                     /old_locus_tag="ADL157C"
                     /db_xref="GeneID:4620081"
     mRNA            complement(join(<415331..415779,416038..>416149))
                     /locus_tag="AGOS_ADL157C"
                     /old_locus_tag="ADL157C"
                     /product="60S ribosomal protein L18"
                     /transcript_id="NM_209292.1"
                     /db_xref="GeneID:4620081"
     CDS             complement(join(415331..415779,416038..416149))
                     /locus_tag="AGOS_ADL157C"
                     /old_locus_tag="ADL157C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL120C (RPL18A) and YNL301C (RPL18B); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L18"
                     /protein_id="NP_983939.1"
                     /db_xref="GeneID:4620081"
                     /translation="MGIDHASKQHKRSGHRTAPKSDNVYLKLLVKLYSFLARRTDAPF
                     NKVILRSLFLSKTNRPPVSISAIARALKQEGSANKTIVVVGTVTADNRLFEFPKATVA
                     ALRFTAGARAAILKAGGEAITFDQLAVRAPKGQNTLIVRGPRASREAVRHFGMGPHKR
                     KAPRILSKGRKFERARGKRRSRGFKV"
     gene            complement(<416499..>417950)
                     /locus_tag="AGOS_ADL156C"
                     /old_locus_tag="ADL156C"
                     /db_xref="GeneID:4620082"
     mRNA            complement(<416499..>417950)
                     /locus_tag="AGOS_ADL156C"
                     /old_locus_tag="ADL156C"
                     /product="ADL156Cp"
                     /transcript_id="NM_209293.2"
                     /db_xref="GeneID:4620082"
     CDS             complement(416499..417950)
                     /locus_tag="AGOS_ADL156C"
                     /old_locus_tag="ADL156C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL119C (MCH4); Tandem gene duplication in this genome"
                     /codon_start=1
                     /product="ADL156Cp"
                     /protein_id="NP_983940.2"
                     /db_xref="GeneID:4620082"
                     /translation="MGRWSVLGNPDHEKAGGRLPLVTDDYMRDGQTRELRMKPPVADE
                     DGAEEVLAADEKAATEATNELDVEEEYPDGGYRAWLTVLGSFVGIFPIWGTANALGAY
                     EGYISNHQLASSGAGEVSWIFALHMIACFVGCVFSGSYFDRNGGQKAIIVGSVLYVFG
                     IFMMSECTKLWHFILAFSLSSGVGAGILTTPLISCVATWFNRRRAVATSLATCGGSIG
                     GIVIPLILRRMYVTIGYKWALKVLALVFLVSLTFAAFLARERVTPRPKPFRSHRDTIR
                     FYLSTSFNWRYFFDKRFLWCTLAFAFAENAICAIATYLSSYIITRGFPPSMPYNALTV
                     VNAAGILGRYIPAYLADRYFGRFNVVIVMVLAAVIVNMAMLLPFGGNITVVWVFLCLY
                     GFLTGSIFSLTPVCIGQICRTADFGKYYSTAYLLNAVVTLPVLPVGGAIIGNGSIENY
                     NKFIIFASAMMLLGAVCYIISRTYCVGLRWYKF"
     gene            complement(<418828..>420288)
                     /locus_tag="AGOS_ADL155C"
                     /old_locus_tag="ADL155C"
                     /db_xref="GeneID:4620083"
     mRNA            complement(<418828..>420288)
                     /locus_tag="AGOS_ADL155C"
                     /old_locus_tag="ADL155C"
                     /product="ADL155Cp"
                     /transcript_id="NM_209294.1"
                     /db_xref="GeneID:4620083"
     CDS             complement(418828..420288)
                     /locus_tag="AGOS_ADL155C"
                     /old_locus_tag="ADL155C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL119C (MCH4); Tandem gene duplication in this genome"
                     /codon_start=1
                     /product="ADL155Cp"
                     /protein_id="NP_983941.1"
                     /db_xref="GeneID:4620083"
                     /translation="MVVIDKDSVQVRHGDEPVALDVSPSSDSGRATAVGDKELFGDGP
                     TTTCAQQTVPLSDEKVEEEERAYLDNSNEYPDGGLRAWLVVFGSFMGLFPVWGMYNTL
                     GAIEGYVSEHQLASNSTLEISWIFSLHLTIGCLCCVFSGSYFDRNGGQKAIIVGGALY
                     VFGIFMMSECTKVWQFVLSFSVSSGIGAGIVTTPLVSCVATWFNRRRAVATSLATCGS
                     SIGGIIMPLILRRMYVTIGFKWAIKVLALVFLVNMSLAVLLARERVTPKAEPFKSFKE
                     GAMFYTRTSLNWRYFLDARFLWCSIAFALGENSICVTATYISSYINKQGHPASMPYTA
                     LTVLNAAALFGRYIPSYFADHHFGRFNVQIVMALLAGVLHLAMWLPFGGNVHVLWAWV
                     CTYGFMSGSVFSLSPVCISQICKTSDFGKYYSTAYLLNALVTLPIMPVAGAVIGNGSI
                     RGYNNFIIFTSMLILCACIGYVISRAYCVGWRLCRF"
     gene            complement(<420726..>421319)
                     /locus_tag="AGOS_ADL154C"
                     /old_locus_tag="ADL154C"
                     /db_xref="GeneID:4620084"
     mRNA            complement(<420726..>421319)
                     /locus_tag="AGOS_ADL154C"
                     /old_locus_tag="ADL154C"
                     /product="ADL154Cp"
                     /transcript_id="NM_209295.1"
                     /db_xref="GeneID:4620084"
     CDS             complement(420726..421319)
                     /locus_tag="AGOS_ADL154C"
                     /old_locus_tag="ADL154C"
                     /note="NOHBY412; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0A07271g"
                     /codon_start=1
                     /product="ADL154Cp"
                     /protein_id="NP_983942.1"
                     /db_xref="GeneID:4620084"
                     /translation="MYLIGPTRGVQSMFSSFRLASRHTTSVLRTFHTSKPIMLQAGDA
                     IPKSIPGLHENSPGNSVDIGAEVASGKHLIVGVPAAFSPACSSSHVPGYIQHLDELKS
                     KGFKQVLVTCVNDSFVTKAWAESLKCPSDVRVIADTQGAFASAGGFLFDGKQTFGNDR
                     SVRYALVVEDGKVVRDFVEPDKTGLKVSAAENVLKEL"
     gene            <421478..>423139
                     /locus_tag="AGOS_ADL153W"
                     /old_locus_tag="ADL153W"
                     /db_xref="GeneID:4620085"
     mRNA            <421478..>423139
                     /locus_tag="AGOS_ADL153W"
                     /old_locus_tag="ADL153W"
                     /product="ADL153Wp"
                     /transcript_id="NM_209296.1"
                     /db_xref="GeneID:4620085"
     CDS             421478..423139
                     /locus_tag="AGOS_ADL153W"
                     /old_locus_tag="ADL153W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL117W (RRI2)"
                     /codon_start=1
                     /product="ADL153Wp"
                     /protein_id="NP_983943.1"
                     /db_xref="GeneID:4620085"
                     /translation="MSEGDAYEDFMMSEDEEMHYAEMEEDSDEMGVYEEETSQGAEEE
                     VPLDPSSSIVEGRYYRAKGLKENSKFREAIEALEGVATSSEPLWAFRALKQIAKCWNF
                     KGAQASEGYQDGVRTALVRLLEHGLRWRQKLGAAYVERSLISTLRMLVPANSQNFVFD
                     EAHEICLPTIEFHLRLLDAVAPLPGDFKDLCTLHMQLRLENLIWRERLRGADCTAILS
                     EAPAPQLTAETLLLLLQCHICRFLRLCQPPAQQFAELVSELQDRAERSLALAQQPHAM
                     VLLAFAQCMRGMQQQPQPHSALRTHFSACLQGLEEIGSNSSFFRDLNLCGFVLADALA
                     YSAGRCSHRVDPFALEQIRILRETPIVHNLQLLYESYVALDLPSFARALDLLAPFRSA
                     LAPLFARLCALARERKLWDAIAPLHSCIALADIQRLLCIGSSSLSRDSLLTLMMQGVM
                     ASSARVPFRLDLTRDYVYFGDEPRVQLRAPAARPGLRHCAHDLGLTSACARPFQGSSA
                     LQLMDCLSEHRNRAASAAADPADAVCRARQPLAAYRTLAALILDE"
     gene            <423744..>424982
                     /locus_tag="AGOS_ADL152W"
                     /old_locus_tag="ADL152W"
                     /db_xref="GeneID:4620086"
     mRNA            <423744..>424982
                     /locus_tag="AGOS_ADL152W"
                     /old_locus_tag="ADL152W"
                     /product="ADL152Wp"
                     /transcript_id="NM_209297.1"
                     /db_xref="GeneID:4620086"
     CDS             423744..424982
                     /locus_tag="AGOS_ADL152W"
                     /old_locus_tag="ADL152W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL116W (MSN1)"
                     /codon_start=1
                     /product="ADL152Wp"
                     /protein_id="NP_983944.1"
                     /db_xref="GeneID:4620086"
                     /translation="MDIQANMELGGLERRVLDLERQISMYERLFQTFSAKLDHHFKKY
                     DLVINAQQQQINVLTDIVSTMLNDQYRYAGILRDKLRGSLDGIVTTSTSIRGMQPNGG
                     MPEQEPKPHDDDAVHAAHRANHHHAAADDGNRDLTNVDAILGEFIPPQVSPDENELHA
                     APAAPVPDAQTPAPKRNGGKKHPKGSVEHKFIISNGLKVPRRAVDPPAKRRREDPQKE
                     YEFRDAEFSALASDGHPLDAQSAPPAPQHHDYDHDDRALPLQRADRPLSTGASPDPSA
                     PSSSRLNSNIKEEQYYTHRGLKKKRKIYVGKFEFLNSPQTVLDIWKEYTEGFNGQPSL
                     KDMETMYQTSWRRDPAVNKRFHRRKVLCKAIERGLERGYDLQDVVRVLEDSRLIDASR
                     NLKQPIGWLCQGVNIPDLFK"
     gene            <425213..>426136
                     /locus_tag="AGOS_ADL151W"
                     /old_locus_tag="ADL151W"
                     /db_xref="GeneID:4620087"
     mRNA            <425213..>426136
                     /locus_tag="AGOS_ADL151W"
                     /old_locus_tag="ADL151W"
                     /product="ADL151Wp"
                     /transcript_id="NM_209298.1"
                     /db_xref="GeneID:4620087"
     CDS             425213..426136
                     /locus_tag="AGOS_ADL151W"
                     /old_locus_tag="ADL151W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR239C (PEX21) and YHR160C (PEX18)"
                     /codon_start=1
                     /product="ADL151Wp"
                     /protein_id="NP_983945.1"
                     /db_xref="GeneID:4620087"
                     /translation="MSLCQGSAMQKLIAKTEGPMAGVGRVGGFNRPSGGLGQSSAEQQ
                     LQARAGERASQNRFMAVLEPQRELGGRMARGDGLQADWVRQFSSMQVEDPLAFSAEYQ
                     RAYAGYEQRQAARPAARVLGYGGSMFMPTMPQQQLQQQVAPQQTAQAALQEAELERYL
                     EREFDVLEGELAPPEVPEALSAPLLDHEQLGFQESAKAIYATLSAPIHKDKFGASKFM
                     GLMRQVSTGDVTLSKSESGYTGLHMTAGGEAVGAEYRAVTDEVVQVPEVAAALPLAGE
                     ERSLASQMEDLLNKVDIAGLSSNEAAMRILS"
     gene            complement(<426233..>427327)
                     /locus_tag="AGOS_ADL150C"
                     /old_locus_tag="ADL150C"
                     /db_xref="GeneID:4620088"
     mRNA            complement(<426233..>427327)
                     /locus_tag="AGOS_ADL150C"
                     /old_locus_tag="ADL150C"
                     /product="ADL150Cp"
                     /transcript_id="NM_209299.2"
                     /db_xref="GeneID:4620088"
     CDS             complement(426233..427327)
                     /locus_tag="AGOS_ADL150C"
                     /old_locus_tag="ADL150C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR159W (TDA11)"
                     /codon_start=1
                     /product="ADL150Cp"
                     /protein_id="NP_983946.2"
                     /db_xref="GeneID:4620088"
                     /translation="MEHNASDAVGTRDAGWQTDMCHRTSGTAEQGGSKNKGRGGRREQ
                     SHIRAYSSASADGYRMHRNHTGGAESPGAEQGTPPRRNSVLKRRSLIQTIMSPEGGAA
                     SPERGRRSVSLYSPASAGSDEGDVGAMLQTLATRELALLEQRKTVEDLRRALRLEERV
                     LVAQARELEELKQRVARALDAGSPRAVLEPGAELPGAPGARESVWAKSMSFLNEFDQI
                     LQEGLEKRLGFDELMPSPATDATTPEADDRRGIWGLVSEFKAGLLGLSDSTPPPDAPA
                     AYLEKQRNRSVGPEPRRTNTGDAVAEHSRDARYARKRDLHEQAYSPADAAAENGVVTG
                     GRLGATPHSSGSIRKRCPPLSTSVEMQNYV"
     gene            <427542..>431177
                     /locus_tag="AGOS_ADL149W"
                     /old_locus_tag="ADL149W"
                     /db_xref="GeneID:4620089"
     mRNA            <427542..>431177
                     /locus_tag="AGOS_ADL149W"
                     /old_locus_tag="ADL149W"
                     /product="ADL149Wp"
                     /transcript_id="NM_209300.2"
                     /db_xref="GeneID:4620089"
     CDS             427542..431177
                     /locus_tag="AGOS_ADL149W"
                     /old_locus_tag="ADL149W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR158C (KEL1) and YGR238C (KEL2)"
                     /codon_start=1
                     /product="ADL149Wp"
                     /protein_id="NP_983947.2"
                     /db_xref="GeneID:4620089"
                     /translation="MAPFKFGKKNGKDKSVVGRATTGPEPVGAAGGPTGGSSRAAGRD
                     ARRPETPWDRVKLVQTPFPRYRHVASAYASDTNEVIVIGGLHDQSVYGDTWILRAQDN
                     GKQFSARTIEITETTPPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMDDDVYLLNVNS
                     HKWTIPHPVGPRPLGRYGHKISIIATSQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRR
                     PDSHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGGDTPQGLINELFVYDPVVNDWSVV
                     ETTGAKPPPLQEHAAVLYRDLMCVVGGKDDQDNYSQDVYFMNMKTFRWFKLPHFQDMV
                     PSPRSGHSVTLLANRKLLIMGGDKFDYARPGDADLMAADHDMRAGTILYTLDLTDLEE
                     HCPGVFDMAGVSPPRRTPSQSTSASSKNTAMTTPMMPRSSFTPATSPAQAKPNGVVNI
                     LSPHQESKKRQPTDSHMYGDQQYKATPQQKTPPLKQSAKPPQQQHRSPHQTATQDLQK
                     STDSQGRKLPQKKYAAQQNPKDYEEAADTTHSTEPLSTAESSQLPSDVTNASTEPADI
                     STPQAHNRPGLKPKSPVPHIIDNERSPRVASMQYTNPLEQGKNKRHSQIIEEYDGELG
                     VAVVGNSPGKDEVRRQSVDGSKPDGWAQPRTFGELAELPGSFTPQQLSDVERSPVLER
                     SIPEAAVTSGRSKEKSDNDDNSLAKEVSTGPVKKQNDQTDFGIPASAEVPVRAATRSP
                     KELGRSATYEGVQRPQQNEGNSPDQVVRSSSVKDTPRSVEDDNLPHAKMKSDGRANNP
                     FLQDTRFASPSKGSSASEDDELEKPAGVTSRDLNDRSGSLRKNTESILSKRGTPDGHV
                     SNEFVQQLFEELRELKLQTERSAAEASNRIRLLEDENLKLRQPGHGPSHRGISGASED
                     VSYSKLQTEVDILKADKAVYADRVAELEEFLDSNILDAERLNRIIESQSKIIESFSDQ
                     ESYKEKFEQIQKKLDALKKENEELRCKNISQMNKLQQDISNHSQAMRDMLKHWRAQGL
                     SDSSEGGAEGVRNLQHHQSIINKLSAQLDAAEKEKSDLNHLHHELLRNYESLQQDYKA
                     LNDELVSKQNEVSYLEQNYKSSLSSVNNASKALELSQRELGKLKNENTKLKEQLEDLT
                     LSPSIDGRSKFANTLTDDPLGSLNDAHYNLRIKDLKAELFIVRQERDSLKDELLQLKK
                     RLFTMDD"
     gene            complement(<431332..>431937)
                     /locus_tag="AGOS_ADL148C"
                     /db_xref="GeneID:4620090"
     mRNA            complement(<431332..>431937)
                     /locus_tag="AGOS_ADL148C"
                     /product="ADL148Cp"
                     /transcript_id="NM_209301.2"
                     /db_xref="GeneID:4620090"
     CDS             complement(431332..431937)
                     /locus_tag="AGOS_ADL148C"
                     /note="NOHBY450; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E15620g"
                     /codon_start=1
                     /product="ADL148Cp"
                     /protein_id="NP_983948.2"
                     /db_xref="GeneID:4620090"
                     /translation="MIVSGCTPNRLPVSLSTGPRSRRPARVIGCPVLIAMRAEIVMAN
                     ELIAQYQISGEVQQLFHIQNGVRTVGEETFEQIRRLARHKRVRASCLEYQLIQPTAKR
                     ACAPEEWSVGSQATVSSLGYGAFGRGCSRMTSAGSILHSGSAGACKSGSHGSILQSEV
                     MQQEESGVLESEATASQIIESEPAAVRSSPPPEMLGSSEFQ"
     gene            <432064..>434211
                     /locus_tag="AGOS_ADL147W"
                     /old_locus_tag="ADL147W"
                     /db_xref="GeneID:4620091"
     mRNA            <432064..>434211
                     /locus_tag="AGOS_ADL147W"
                     /old_locus_tag="ADL147W"
                     /product="ADL147Wp"
                     /transcript_id="NM_209302.2"
                     /db_xref="GeneID:4620091"
     CDS             432064..434211
                     /locus_tag="AGOS_ADL147W"
                     /old_locus_tag="ADL147W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR237C"
                     /codon_start=1
                     /product="ADL147Wp"
                     /protein_id="NP_983949.2"
                     /db_xref="GeneID:4620091"
                     /translation="MLLRRSMLISNTPAISGYKSNVSFQDLTPALVDEQVTKIRKLRG
                     TPSLSSALVHIPPHLNPLYVDTSVDDDEDGEEREYGKGIRRPSLNMDLGYSAQSQQEV
                     TEAYKFIFDGTAGSAVSRRSTHLSPPGSRSASPQNSKSGPPGLRLPPPPRLSILKNKD
                     VAQDAQDFDTSKIDIQQELVIEQLTKQNTESNSPATRGYSTGAFARLQELEDRLMSDG
                     QGGSSRGQENKSARKARRKSYADMSDSELAQLEDSMNPYSATSNIDKFDFSEQSKLYI
                     GPTNPSKNLPRIKTDNPPTSIYPSRPAVPYHAISCSNMHEEYSAYVSQTAAAANGAKP
                     RTVACYLSGRRHSWSAVDAYINMFARSGDHLVIWAYLPMYDREITNLSSKTSERPKSS
                     LDMYQFATEKKTTKPETASDHERACMMVLELDNIAKAKCKSLLDFYTKRCSHLIMKVT
                     VEFIKHESMQGATANLISLYEPDMEFVSTISTTFNVKFRNGHVKLPTYLAKHASIPTV
                     IVSHEFVDTKRAVQTPSGEVTQEPGIQLKRLENIVLSTSVNPYDVQSLNSRGTDLADC
                     SSDEGDDEGSEASASVGAYFPSDQDMRRKRDQFNTLGYIPPKPVYVDTRQLLSIGSSR
                     SSRRSSRHTFTSSEIYQVKSMISDDIPYSTNPIRTVKSAQSASSGTTNSTPLPRPVRR
                     IEPMTPSTPASSNPPTKKKGKLFSKFKQKIGLK"
     gene            <435119..>435364
                     /locus_tag="AGOS_ADL147WA"
                     /db_xref="GeneID:9487884"
     mRNA            <435119..>435364
                     /locus_tag="AGOS_ADL147WA"
                     /product="ADL147W-Ap"
                     /transcript_id="NM_001355311.1"
                     /db_xref="GeneID:9487884"
     CDS             435119..435364
                     /locus_tag="AGOS_ADL147WA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR236C (SPG1)"
                     /codon_start=1
                     /product="ADL147W-Ap"
                     /protein_id="NP_001342255.1"
                     /db_xref="GeneID:9487884"
                     /translation="MIFRLWAPRTDRSENDAEFQRPDRSVPAPAPPSDTHVNFGDLGQ
                     AVPIATWHIGGRNRFANDEQYRKMVDERSALLFSSIM"
     gene            <435644..>436312
                     /locus_tag="AGOS_ADL146W"
                     /old_locus_tag="ADL146W"
                     /db_xref="GeneID:4620092"
     mRNA            <435644..>436312
                     /locus_tag="AGOS_ADL146W"
                     /old_locus_tag="ADL146W"
                     /product="ADL146Wp"
                     /transcript_id="NM_209303.1"
                     /db_xref="GeneID:4620092"
     CDS             435644..436312
                     /locus_tag="AGOS_ADL146W"
                     /old_locus_tag="ADL146W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR235C (MOS2)"
                     /codon_start=1
                     /product="ADL146Wp"
                     /protein_id="NP_983950.1"
                     /db_xref="GeneID:4620092"
                     /translation="MARVDFYRECDIVAEGVVPPQTGAIVSSDAYEASAKNVAEVLGQ
                     NQLLEGISVRTPGWLVNFFQKSRTVVTAGAERAAHQIETVSRRYYEKERRITSTVAAL
                     HSNPREELLPGFGAVAVAYFSGSVLTRKRGIVLRVCAPLALGLGAFSYFLPTTFRNTK
                     SLCYDLEKRAFPQFVAQQDRLAAGTKRAVCGTVHTTVSAYNATHRACRKVTKVFRDWT
                     GLNL"
     gene            complement(<436426..>439053)
                     /locus_tag="AGOS_ADL145C"
                     /old_locus_tag="ADL145C"
                     /db_xref="GeneID:4620093"
     mRNA            complement(<436426..>439053)
                     /locus_tag="AGOS_ADL145C"
                     /old_locus_tag="ADL145C"
                     /product="ADL145Cp"
                     /transcript_id="NM_209304.1"
                     /db_xref="GeneID:4620093"
     CDS             complement(436426..439053)
                     /locus_tag="AGOS_ADL145C"
                     /old_locus_tag="ADL145C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR154W (RTT107)"
                     /codon_start=1
                     /product="ADL145Cp"
                     /protein_id="NP_983951.1"
                     /db_xref="GeneID:4620093"
                     /translation="MTASLKIFKGLHILLIQSPQFAESEITSVVEQLVGHGAAKTTVW
                     GGTDDEKASTKEWIRDNFRANIHCIIAADIDFPFYRSAAFDLMVPVVTPNWCSACVKN
                     GRLMRTTGFSPDPEHFLKECYIYISKHALSTAEYELFSAMISFMGGCCMDFLSTKVTH
                     IITTDPRDPATLALERFGKLSVHSVTPTWIAECFACKQIVSTTPYILDKAMEESSVRS
                     CMVDNWFIDDKDWSWTSSIFLGHTFYLSMELPLKTSCYKFLIQLISAMGGQIARYVDF
                     EDISPDRADSFIDLDLSKDCVYARGKGLHCGNMAWLFYMLSMQQFIAPTAKLVLSPRY
                     PKLFTEKELVLAFTNYLGQQRYYIQRLVDLLGGSSTTELSRKNTHLISLFPHGKKHET
                     ALKWNSCIVVNHLWLEQCYKLRKKLDPNAPEFTRIPVPDELSNAIGQMALETTARNMV
                     SPRKAVSPDIVMHNSQTDVALVVSTTDIDLKDNNESTNDTSVVHEPGKVMNSDDLTAV
                     HSTKTRQEDANEMFSALDEAVSKGKKSCLPKKHIAASVAASTSNEISASAKSNKDSSD
                     VQATKQLPATPTSNPRQTKPKSTSGTQNDTASSQKNTRRKNADDSPSSESSKTKKRKT
                     TVVDAKQLVSPYLEEYSDTTGGRLPYDIKAVFTNCHENITDLDKEILRQLGIILQEEI
                     EEDTNCIIGPKKARTAKFLTSFSFHPLKYALLPKFITEILSLVHSGRNEPISLPLEQY
                     YIPDIDADVIAKTELPTKLFERSGLQAVNLSEDIPGGVEVISSILKAHGMVQINGLPK
                     KFKAKDIAKNTVDNGSPDFVLVATKASAAKKFSKLCEEVDRNAKVLIVEWNWCVKAIF
                     SLEVDYNDPEFVISKTGFA"
     gene            complement(<439411..>439827)
                     /locus_tag="AGOS_ADL144C"
                     /old_locus_tag="ADL144C"
                     /db_xref="GeneID:4620094"
     mRNA            complement(<439411..>439827)
                     /locus_tag="AGOS_ADL144C"
                     /old_locus_tag="ADL144C"
                     /product="ADL144Cp"
                     /transcript_id="NM_209305.1"
                     /db_xref="GeneID:4620094"
     CDS             complement(439411..439827)
                     /locus_tag="AGOS_ADL144C"
                     /old_locus_tag="ADL144C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL245C (CWC25)"
                     /codon_start=1
                     /product="ADL144Cp"
                     /protein_id="NP_983952.1"
                     /db_xref="GeneID:4620094"
                     /translation="MDLNLLKSWNPQLQKNRKKVYEAQQELLKSARKPADDGTSGGGL
                     DWMYEGQPAPQRKVRKRRTRTRKPKQVPKDAQGKLQESLQTARSDAPEGTCSPDETAA
                     ARGGQQGAPVEVSAKSPAKAVAEARGGPGSSGVHGE"
     gene            440031..440103
                     /locus_tag="AGOS_t0064"
                     /db_xref="GeneID:4620095"
     tRNA            440031..440103
                     /locus_tag="AGOS_t0064"
                     /product="tRNA-Ala"
                     /codon_recognized="GCU"
                     /db_xref="GeneID:4620095"
     gene            <440706..>444014
                     /locus_tag="AGOS_ADL143W"
                     /old_locus_tag="ADL143W"
                     /db_xref="GeneID:4620189"
     mRNA            <440706..>444014
                     /locus_tag="AGOS_ADL143W"
                     /old_locus_tag="ADL143W"
                     /product="ADL143Wp"
                     /transcript_id="NM_209306.2"
                     /db_xref="GeneID:4620189"
     CDS             440706..444014
                     /locus_tag="AGOS_ADL143W"
                     /old_locus_tag="ADL143W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR233C (PHO81)"
                     /codon_start=1
                     /product="ADL143Wp"
                     /protein_id="NP_983953.2"
                     /db_xref="GeneID:4620189"
                     /translation="MKFGKYLAGRQLELPEYNGYFIDYKALKKLIKQLSVPAASVPGG
                     SELPDALMLDTEDRSESYQRLQENKASFFFRLERELEKVNDYYLEKEAGLKVVVDIIQ
                     SRYRDYLKRGKLISKKTSSYRHIRDAVKKVERDLTHLEHYVELNRTGFSKVLKKWDKR
                     SHSHTRDFYLATVVSVQPVFTHNKISKWNDAVLTMLFELDEISNEDSVYYQEPVQNKN
                     AYAVDMDSSAKLSGVQSISEWNPAEAVPSSVNGLFDIELEIEGWYMEALHISKLTDPQ
                     RKLDLLGSFAQSKVQAFVDERLPQGTIDKQKVVKDCLTNIFLPLVSSDIDDISLKHFL
                     INAVDMIDLTYCDEEDLVFSRRNVFHEAACCTSDSRVFVLEEALNQCNQFKIDQATMC
                     RLLNARDTHGRTPLHYACDLGKTDFVRLLIKSSLLDTVNIPDTDSKTPLVLAIIKAHA
                     EITRLLLVDAQVNPDPQIDESGKPQFSPLSVACANKNLTAARMILEIGNINLNDVCDS
                     QGLQPLHIVAKNGGDVELIELLVSHGANPNAVDGFNKWTPIFYAVQEGYGSTVQNLLS
                     NGAKLDVVDGDNLSPLFYALWEGHLSVLNILLNCAASRNQQLMINRSPQLLPSNIIAE
                     DQISAIDSLSDIPDFELPPPIIPLRKYGHNFLERKIFVKLLFSPGRDSIMLNKEDEMV
                     LSSPGRITLTPNVSNVIPRNIPLPIQDDEEHVAFQVGNLDNLSIDFELFPSFGTRLIA
                     KTNAMSSVFREVSKQCTNDRRIKLPLFDSRLKNVGELELAFEVIFPYSGKPLEITKYD
                     TYWKSTTGSESGPNGNHLVTSSSLAGKYTTVLVTVLSDGKVISAPDKVVSVSNGAKLL
                     LSDITSRQLELICGQSLDDCPKIETTEQLNTILNERHISLDRLLSCTSPDIQLDLEVF
                     FPTALEINTIPVKVSPTVNINQFIDDVLLTTFNHVRYLNHNRLQPRSIVFTSCNPRVC
                     SILNWKQPNYPVIYQMNGLRKQNGQFTKATPHHLEYLAQNPDSVSFADPCSRCIREAV
                     NFSCNNNLLGIVIPLDLLSIYSQLEQHIRNRGLLLIGSHNPAARFQAVVPAGLEINAV
                     KTATELQFQGAINM"
     gene            complement(<444066..>444755)
                     /locus_tag="AGOS_ADL142C"
                     /old_locus_tag="ADL142C"
                     /db_xref="GeneID:4620096"
     mRNA            complement(<444066..>444755)
                     /locus_tag="AGOS_ADL142C"
                     /old_locus_tag="ADL142C"
                     /product="ADL142Cp"
                     /transcript_id="NM_209307.2"
                     /db_xref="GeneID:4620096"
     CDS             complement(444066..444755)
                     /locus_tag="AGOS_ADL142C"
                     /old_locus_tag="ADL142C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR232W (NAS6)"
                     /codon_start=1
                     /product="ADL142Cp"
                     /protein_id="NP_983954.2"
                     /db_xref="GeneID:4620096"
                     /translation="MGDNSLHEACMNGDYARAVALLSDNPGLVRSKDADSRYPLHWAV
                     SYQHVKIVELLLSYMLQVDLDTLVDDALWSPVHVAAAVGNRELFGKLLAHAVQPSLDA
                     ATSQGTTALHLACSKQHYAVVEDLITHGASVRKKDKKQQLPLHRACAIGSARLVKLLC
                     DARSPVNAKDANGWPPLFHALSEGHADIALLLVNDYGAEWENVESAAGETALQVAVDD
                     NVRDYFVKNIN"
     gene            <445035..>445958
                     /locus_tag="AGOS_ADL141W"
                     /old_locus_tag="ADL141W"
                     /db_xref="GeneID:4620097"
     mRNA            <445035..>445958
                     /locus_tag="AGOS_ADL141W"
                     /old_locus_tag="ADL141W"
                     /product="ADL141Wp"
                     /transcript_id="NM_209308.1"
                     /db_xref="GeneID:4620097"
     CDS             445035..445958
                     /locus_tag="AGOS_ADL141W"
                     /old_locus_tag="ADL141W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR231C (PHB2)"
                     /codon_start=1
                     /product="ADL141Wp"
                     /protein_id="NP_983955.1"
                     /db_xref="GeneID:4620097"
                     /translation="MNRYPGDFQRFARVVQQQMNRAGYGPNQRRGGRGPGGLLPGAGL
                     LLLGGGALFLNASLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRS
                     KPRTVSSLTGTNDLQMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKA
                     VVAQFNASQLITQRESVSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQ
                     VAQQDAQRASFYVEKAKQEKQSMIVKAQGEAKSAELIGEAIKKSKDYVELKRLDTARE
                     IAGILAASPNRVILDNEALLLNTITDSRDKK"
     gene            complement(<446026..>446553)
                     /locus_tag="AGOS_ADL140C"
                     /old_locus_tag="ADL140C"
                     /db_xref="GeneID:4620098"
     mRNA            complement(<446026..>446553)
                     /locus_tag="AGOS_ADL140C"
                     /old_locus_tag="ADL140C"
                     /product="ADL140Cp"
                     /transcript_id="NM_209309.2"
                     /db_xref="GeneID:4620098"
     CDS             complement(446026..446553)
                     /locus_tag="AGOS_ADL140C"
                     /old_locus_tag="ADL140C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR230W (BNS1) and YHR152W (SPO12)"
                     /codon_start=1
                     /product="ADL140Cp"
                     /protein_id="NP_983956.2"
                     /db_xref="GeneID:4620098"
                     /translation="MASRRSSDAGVKAMEVESEGHERVESSTAQQRESEREQSPQAAK
                     VRKVAAAVEREVTAVAPRQASRPARGVPTAARAAQPGEKFQPLHQKPASALNVHAKGV
                     GSVHKSLHKAMFKKALPSQQLKDKFASPTDSMLSPCTQKLNQHKSRLFKAAVKPTRLN
                     FAQAKADSDEELEDV"
     gene            <447128..>449101
                     /locus_tag="AGOS_ADL139W"
                     /old_locus_tag="ADL139W"
                     /db_xref="GeneID:4620099"
     mRNA            <447128..>449101
                     /locus_tag="AGOS_ADL139W"
                     /old_locus_tag="ADL139W"
                     /product="ADL139Wp"
                     /transcript_id="NM_209310.2"
                     /db_xref="GeneID:4620099"
     CDS             447128..449101
                     /locus_tag="AGOS_ADL139W"
                     /old_locus_tag="ADL139W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR229C (SMI1)"
                     /codon_start=1
                     /product="ADL139Wp"
                     /protein_id="NP_983957.2"
                     /db_xref="GeneID:4620099"
                     /translation="MESLKRAWNQLVYTFSTEDRYAEYTPQGSTNVVGGEPFDTSNAS
                     RIQLNEFVDGAEVGGNDGVSECLLAWRHIDSWCSEHNPDLYATLSSPCTNNDIMWAEK
                     DLAITFPAAVRASLRTHDGQEDVESMQGASGLIYGLKLMGLEEVVIMTRTWRNVAANL
                     QRQMARMEQQQRAKSSSELPQTVTPQAVKQKGYGKVDNQDYHANPHLQKDISQNYNKQ
                     FKLDKLPKQGSIPPLAIQPVYAHPGWIPLVTDHAGNHIGVDLAPGPKGKYAQVILFGR
                     EFDTKFVVADNWGDFLLGFVNDLEKGNWLLVDNTDDYLNGEGDLVFVDHATRGPILNY
                     LAVLKKRSWEKWQSTKPTQPLTSASVASFSTSSSVVNRPTPADAAGQARKTQGYSPMV
                     PGASSNESVSFIPDSDVIMEESNLTQTDASSKGTTKPATPNPMTAPTVIRVSTPGSPS
                     AAAEAPEPPKKATPPKAAKETKTPTVTKESTPASDANVDTELDSKNTETNEDTRATNT
                     AHSMAPTVSSAITDLTAIDEPVATAGKPKDTEKTDDAKDVHEANKQDLTKANEAEAEE
                     NAVEPKDNEVSADSKVKARAESKSDHDSKTNNIPEKKVPQVTAKALPESDRGQASDAA
                     STKSDKKAKPAEDPKEHDLKIEKLNEDFETVAL"
     gene            complement(<449426..>450955)
                     /locus_tag="AGOS_ADL138C"
                     /old_locus_tag="ADL138C"
                     /db_xref="GeneID:4620100"
     mRNA            complement(<449426..>450955)
                     /locus_tag="AGOS_ADL138C"
                     /old_locus_tag="ADL138C"
                     /product="ADL138Cp"
                     /transcript_id="NM_209311.2"
                     /db_xref="GeneID:4620100"
     CDS             complement(449426..450955)
                     /locus_tag="AGOS_ADL138C"
                     /old_locus_tag="ADL138C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR227W (DIE2)"
                     /codon_start=1
                     /product="ADL138Cp"
                     /protein_id="NP_983958.2"
                     /db_xref="GeneID:4620100"
                     /translation="MGGEATASEKELQEREDQLSQQIQDEIVMGCVVNLALWPVLLGA
                     AAYVAYKYNCSWVPYPFIDEKFHVGQTVRYLAGRWREWDSKITTPPGLYVIGWAVQRT
                     VGLLVGWNTLSLLRLSNVIGGLVVWPWFVLRPLYFFNALAFWPATLSVFPLLTSYYFL
                     YYTDVWSTILIVGSLTLAVTVPFGERASIWASAICGLLSCLFRQTNIVWNAFVLVVVL
                     ERRTMIHKGFNSLRINNYLKLIIHGIENWNSLVLPYAVNFALFLIFLLYNGSVTLGDK
                     SSHVAGFHLVQMFYCLLFITFFSVPVWFCRSFLLNYVSRTVVYPIWTIFEILGIMMII
                     RFFTVVHPYLLADNRHIAFYLFKKLIGRNRFLKYFVMAPIYHFSTFVYLEAVRPTVFF
                     FHPILPIEVKSPVDLPLQFTHISWSALIICTLLTVVPSPLFEPRYYILPYIFWRIFLL
                     VSPEPFFAVPTEMTYRFGNTRRLAVEFLWFILINAITIVIFATNAFAWETEASLQRII
                     W"
     gene            <451219..>452571
                     /locus_tag="AGOS_ADL137W"
                     /old_locus_tag="ADL137W"
                     /db_xref="GeneID:4620101"
     mRNA            <451219..>452571
                     /locus_tag="AGOS_ADL137W"
                     /old_locus_tag="ADL137W"
                     /product="ADL137Wp"
                     /transcript_id="NM_209312.2"
                     /db_xref="GeneID:4620101"
     CDS             451219..452571
                     /locus_tag="AGOS_ADL137W"
                     /old_locus_tag="ADL137W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR151C (MTC6)"
                     /codon_start=1
                     /product="ADL137Wp"
                     /protein_id="NP_983959.2"
                     /db_xref="GeneID:4620101"
                     /translation="MGSFLLCLLLVQLQWCLCSNVLDDLLQQTNIAFLSQQDVIGVIP
                     VNQIPLVGVELCSMFETVGDGQDTLAAMLQTGVQTLVMDIGYDEDAGGWQMCGRTSLS
                     EGISTVSRQIERLFPTLYANLVVLVLRGGAAEAHYEALRDAIGRVGRWTYSAEKVKAT
                     SPHLNSLLDDQEKRVLVVALDDSLCEALGTVAFGPEDVAYVEGNDTIDCSEHTDSWSF
                     IEREFHWTDVREYVRLGCSPVITGKSVANISELEALVKVAQVWSWGAGEPALTDANSE
                     MQRCASLGYDSATERATWKSTSCRQNLPVLCQAVNDRYSWLVGTRNLRFDQLNMDSCP
                     SGYKPSVPRTPLEQREVERYLSEHHPSDGQYWIYLNSISVEKCWVVGGPETPCPYVAL
                     VSTRNFAAMIVTSSILVLLLLVLIILLDLVRVPIQDNRRSWKRALGSYSKAETEGVPM
                     "
     gene            complement(<452713..>454380)
                     /locus_tag="AGOS_ADL136C"
                     /old_locus_tag="ADL136C"
                     /db_xref="GeneID:4620102"
     mRNA            complement(<452713..>454380)
                     /locus_tag="AGOS_ADL136C"
                     /old_locus_tag="ADL136C"
                     /product="ADL136Cp"
                     /transcript_id="NM_209313.1"
                     /db_xref="GeneID:4620102"
     CDS             complement(452713..454380)
                     /locus_tag="AGOS_ADL136C"
                     /old_locus_tag="ADL136C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR150W (PEX28)"
                     /codon_start=1
                     /product="ADL136Cp"
                     /protein_id="NP_983960.1"
                     /db_xref="GeneID:4620102"
                     /translation="MTWGGGPMKEDDRAKALESVAIGSKKRRSLLGEFLARKYERIME
                     AEERVADDEKARPCVTNRELVTNIACSLFDATWERLRTGKDQQRKTIDDDFDEFALRH
                     ELESSADSFWQEETSDNGAGMSDEEDTEEQRAAKLRAVSQVQEQEHFIDILLDKMISA
                     VLPEDLPEREQFTQRVQEPGRRRSHPISLIIMSRNLKIMTTKLGLIFEFQDSLVRLAT
                     WRNPSGTALSLILFSFACFNPMLVIILPMLYVLFGLMIPGYLHRHPLRRNFYLTKHSY
                     GKSLLATVATGGKPASWQSHDDVQEFDYNNLHTDTEEWERALHIKQTMEFIVNLRDLQ
                     NLMTASVKGIECAEKFVYGDAGFKNEHHSTVLFLSGLLVVMGLWIIAPYINWSLTSAA
                     GAWAALILIHPRVLPMVTAYINDDQLEKGKVVIENVERYDILLDEKPEERYLELFEIY
                     KQRLTSDEWDFYLLSSYAFDPTDKYRKSQRPPPGVTNIDEVVPPSMWSFDRNSKWEVD
                     YDVKGWAQERGLSLEINGEFLVDDSFKRRRLTRKVVRYANPARKPTV"
     gene            complement(<454604..>456526)
                     /locus_tag="AGOS_ADL135C"
                     /old_locus_tag="ADL135C"
                     /db_xref="GeneID:4620103"
     mRNA            complement(join(<454604..455202,455260..>456526))
                     /locus_tag="AGOS_ADL135C"
                     /old_locus_tag="ADL135C"
                     /product="ADL135Cp"
                     /transcript_id="NM_209314.2"
                     /db_xref="GeneID:4620103"
     CDS             complement(join(454604..455202,455260..456526))
                     /locus_tag="AGOS_ADL135C"
                     /old_locus_tag="ADL135C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR225W (AMA1); 1-intron"
                     /codon_start=1
                     /product="ADL135Cp"
                     /protein_id="NP_983961.2"
                     /db_xref="GeneID:4620103"
                     /translation="MDRQAGPMARSYKRTLSSGSGRAVTVKRTKLQGDGGAGRGVGGC
                     GPRTMPDRFIPNETSIKAYRASPNLRHFDLTINELVDPESQRRLPSPEFFTSQDLQLA
                     QLILTPDASPLAAKEVKTRLNEEFKRHREYIADALGFQSPKRVYRFDRLPKTLEVSPN
                     HSVVDPLLSTLPPRDAAQYIHKQEFPNFEQSKRFVPCDLRPTRRTRSHIPYRVLDAPA
                     LRNDFYSNLVDWSPATNNVVVGLNCSVYLWSDTLGPINVLHHGYLQKKGDIVTCVSFA
                     PKDDYLVVATKLGRLLVFDQSYKPKVMVDGSRQPLVETRINNNRGICCVKWFENAKNE
                     FLLGNDIGEVHRFRLEHKKFEHFEIITMGEAERRLRVGKDLNGHVSGVERVKQKSYNI
                     KETLVKYVYETLELCLENVYTFQSQTQQVCGLDICEDTGFVAVGGNDNSCSLWDISQA
                     SGPPKLLFQLPHFAAVKAVSFCPWSRSLLATGGGSKDRTIRFWHAPSGTLLKEIKTPG
                     QITSLIWSTRRKQIVATFGFSDLESPTLFISYSYPSMEPIMKITTPSALRVLSAVSSP
                     DFSSICIATNDETVRFYEMWDSNESTIIEAQATGLYGSKIIEHEEGIEPDTDPIR"
     gene            <457078..>458283
                     /locus_tag="AGOS_ADL134W"
                     /old_locus_tag="ADL134W"
                     /db_xref="GeneID:4620104"
     mRNA            <457078..>458283
                     /locus_tag="AGOS_ADL134W"
                     /old_locus_tag="ADL134W"
                     /product="ADL134Wp"
                     /transcript_id="NM_209315.1"
                     /db_xref="GeneID:4620104"
     CDS             457078..458283
                     /locus_tag="AGOS_ADL134W"
                     /old_locus_tag="ADL134W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR223C (HSV2)"
                     /codon_start=1
                     /product="ADL134Wp"
                     /protein_id="NP_983962.1"
                     /db_xref="GeneID:4620104"
                     /translation="MKTRNPIVVQRKNGPPRFLHVNFNQDQECFSCATEKGFEIYNTD
                     PIQCSVKRRFSHNGMSGIGYTRMLYRTNYIGLVGGGASPRFSTNKIAIWDDIQQRDSV
                     SIRFNSPVHELFLSRQYIVVVLAQSIDVYTFSGSPSRVCPVISNIHNGIADFVTCSKM
                     RRASGPQDVEHALSQKHVIAGILAYPSGIRPGQIHIADLSNIQTPSVADASATHLPTS
                     IIKAHKNPIHLVKLSPQGTMVATCSVEGTLIRVFSIASGSLIHEFRRGLDRALIYDMQ
                     WNGKGDKLAVVSDKFTLHIFQINEDLDKRHLLKGWFPKVKYLQGVWSMCSTKLDRSLL
                     THDEDTCKVGWIGDEALSLLWQKSGMWEKYVIMEKLREYKVDETLHSGAPDGRRQLYD
                     LVRESWRQL"
     gene            complement(<458278..>459027)
                     /locus_tag="AGOS_ADL133C"
                     /old_locus_tag="ADL133C"
                     /db_xref="GeneID:4620105"
     mRNA            complement(<458278..>459027)
                     /locus_tag="AGOS_ADL133C"
                     /old_locus_tag="ADL133C"
                     /product="ADL133Cp"
                     /transcript_id="NM_209316.2"
                     /db_xref="GeneID:4620105"
     CDS             complement(458278..459027)
                     /locus_tag="AGOS_ADL133C"
                     /old_locus_tag="ADL133C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR222W (PET54)"
                     /codon_start=1
                     /product="ADL133Cp"
                     /protein_id="NP_983963.2"
                     /db_xref="GeneID:4620105"
                     /translation="MSAGRAKVLVEEVLRRLKTGEIAGARQGGTGKREPAVAVYRSLN
                     PALGKRDIVGALPAVQLSEEPREHEALAFQVMKLRDPRFFMFRDEYLLRFPTETGLAA
                     FRRLARDAWVDDVRLQLETTVAPQTLETGALYAKLVQRAYESEAGYRSALAEGPGRAV
                     APLRTLNWAKVREVEARSALVWDLPEWCDGKRLAQEFWWYSIKNGFQLYCGQGRRLTY
                     VAFADPADAMRFKRNLHGSHWCGKQVLVEKL"
     gene            459232..459287
                     /locus_tag="AGOS_AgSNR7"
                     /old_locus_tag="AgSNR7"
                     /db_xref="GeneID:4620106"
     ncRNA           459232..459287
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR7"
                     /old_locus_tag="AgSNR7"
                     /product="AgSNR7"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR7-S and S.c. SNR7-L; start and end
                     coordinates are approximate; Similarity is partial. In
                     synteny."
                     /transcript_id="NR_149416.1"
                     /db_xref="GeneID:4620106"
     gene            <459595..>461586
                     /locus_tag="AGOS_ADL132W"
                     /old_locus_tag="ADL132W"
                     /db_xref="GeneID:4620107"
     mRNA            <459595..>461586
                     /locus_tag="AGOS_ADL132W"
                     /old_locus_tag="ADL132W"
                     /product="ADL132Wp"
                     /transcript_id="NM_209317.2"
                     /db_xref="GeneID:4620107"
     CDS             459595..461586
                     /locus_tag="AGOS_ADL132W"
                     /old_locus_tag="ADL132W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR149C (SKG6) and YGR221C (TOS2)"
                     /codon_start=1
                     /product="ADL132Wp"
                     /protein_id="NP_983964.2"
                     /db_xref="GeneID:4620107"
                     /translation="MAVTTDGLQRRSDSEDCSGSSCEKPVDSMSGNSLLIGVVVPVVV
                     ILIGMAIVMFKVWKKGKKEALEDDDPRFYGESEFLPDFHETSDVYPMQDKPPVMPASG
                     NGLESLKPPGYAMQRTVSSQGSSYASSPVDPFQLPEVDDRDSLRTYARNLQTEPAGYA
                     LASAPKAPLLTSSPPPPTVRPYLESNGSFVTSTSRFDVDTALTQPHMDAMSVLQYSKQ
                     LANDPTVNYSQYNPTAPPPARSAIPDVAKSRTPVQQTRETSPVLTAPLVRQETSLISA
                     QVPSEDSFEFEERRSIENLGTDIKVKGSARGPVEAPETASKPGAPGLNKMASDRPTNL
                     RVQTDALPNGGQKAVSPQASKTLKFKMADDDETYATQMSPDDSNSIDRIKSIYQVYLD
                     RNGTARRAPDASEADGQEFYAGFAHDAQAVTQAGVGAKEELSKDTSPNAHTSAAQHKR
                     AVSSIYSDGQRQRDFMNEQDNLSVVPPLPQEFAHPQEKENVEVLPSPSNLPEAMTALS
                     LTSFKKPTQARSPNMTSLQQHSFNRPFNPVDHPEAFQHEDTESQGLLAGENNPPSRIL
                     PHHLRQSVVMTHPMMLGQKPVFKPAGSFRQVSNDRSNSLSSQGKANASNWQANSRVSG
                     LLELSDTMQPASVGIVLPSARSQNDLRKELEKSHNYSVI"
     gene            complement(<461761..>462312)
                     /locus_tag="AGOS_ADL131C"
                     /old_locus_tag="ADL131C"
                     /db_xref="GeneID:4620108"
     mRNA            complement(<461761..>462312)
                     /locus_tag="AGOS_ADL131C"
                     /old_locus_tag="ADL131C"
                     /product="ADL131Cp"
                     /transcript_id="NM_209318.1"
                     /db_xref="GeneID:4620108"
     CDS             complement(461761..462312)
                     /locus_tag="AGOS_ADL131C"
                     /old_locus_tag="ADL131C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR148W (IMP3)"
                     /codon_start=1
                     /product="ADL131Cp"
                     /protein_id="NP_983965.1"
                     /db_xref="GeneID:4620108"
                     /translation="MVRKLKHHEQKLLKKVDFHEWKQDQGHRDTQVMRTYYIQNREDY
                     HKYNRLCGDVRRLAHKLSLLAATDPFRIKHEQLLLEKLYHMGILATKSKISSLENKVT
                     VSAICRRRLPVIMHRLKMAETLQDAVKFIEQGHVRVGPNLITDPAYLVTRNMEDYVTW
                     TDSSKIKKTVLRYRNQLDDFNDA"
     gene            <462675..>463319
                     /locus_tag="AGOS_ADL130W"
                     /old_locus_tag="ADL130W"
                     /db_xref="GeneID:4620109"
     mRNA            <462675..>463319
                     /locus_tag="AGOS_ADL130W"
                     /old_locus_tag="ADL130W"
                     /product="mitochondrial 54S ribosomal protein YmL16"
                     /transcript_id="NM_209319.2"
                     /db_xref="GeneID:4620109"
     CDS             462675..463319
                     /locus_tag="AGOS_ADL130W"
                     /old_locus_tag="ADL130W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR147C (MRPL6)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL16"
                     /protein_id="NP_983966.2"
                     /db_xref="GeneID:4620109"
                     /translation="MSLVFRRLLSASAAVRSHIGAAPLYLLPENKLSVAAVETPRVIR
                     KGKRVMRLTQKVTVEGPLGSASMELPDFVSLDHDAASGQVAVTVHDAANKSQRAMWGT
                     VRSTLGSHVQGVNEGHMAFLKFVGTGYRAALEDDGKFVSVKVGASIRQGLPVPPGVTV
                     KSPAPTLLIIEGCVKQQVNLFAASLRMFHPPEPYKGKGIYMNNETIKLKDKKIK"
     gene            <463559..>464362
                     /locus_tag="AGOS_ADL129W"
                     /old_locus_tag="ADL129W"
                     /db_xref="GeneID:4620110"
     mRNA            <463559..>464362
                     /locus_tag="AGOS_ADL129W"
                     /old_locus_tag="ADL129W"
                     /product="mitochondrial 54S ribosomal protein YmL9"
                     /transcript_id="NM_209320.2"
                     /db_xref="GeneID:4620110"
     CDS             463559..464362
                     /locus_tag="AGOS_ADL129W"
                     /old_locus_tag="ADL129W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR220C (MRPL9)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL9"
                     /protein_id="NP_983967.2"
                     /db_xref="GeneID:4620110"
                     /translation="MLETLIRVQLRFASSRAALVAPSVAQTVHKVAPAVNHSPEKALE
                     RRWLPLRCGVLTRKVGMMPYFDVATGARMAATVLEMNNVEVVLQKTVAANGYWACQVG
                     YGNKHPSKVTRQLLGHFASKEVNPKEKVTEFRVKNEEGLLPVGTLLKPSFFSPGQYVD
                     LRSVSKGKGFQGVMKRYNFKGQKASHGNSLSHRKGGSYGQNQTPGRILPGKKMPGHMG
                     VQRVTIQNVQVLEVQDSKGVIIVKGSVAGPKGAFVKVQDAIKKPPTADI"
     gene            complement(<464577..>467825)
                     /locus_tag="AGOS_ADL128C"
                     /old_locus_tag="ADL128C"
                     /db_xref="GeneID:4620111"
     mRNA            complement(<464577..>467825)
                     /locus_tag="AGOS_ADL128C"
                     /old_locus_tag="ADL128C"
                     /product="ADL128Cp"
                     /transcript_id="NM_209321.2"
                     /db_xref="GeneID:4620111"
     CDS             complement(464577..467825)
                     /locus_tag="AGOS_ADL128C"
                     /old_locus_tag="ADL128C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR218W (CRM1)"
                     /codon_start=1
                     /product="ADL128Cp"
                     /protein_id="NP_983968.2"
                     /db_xref="GeneID:4620111"
                     /translation="MEAILDFSKDLDIQLLDQIVDTFYKGSGTQQRQAQDVLTKFQDH
                     PESWQRADKILQFSANPQTKFIGLSILDRLITTKWKMLPQDHRVGIRNFIVGMIISLC
                     QDDAVFQSQKNLINKSDLTLVQILKQEWPQNWPDFIPELVSSSQSSINVCENNMVILK
                     LLSEEVFDFSTEQMTQAKALHLKNSMSQEFEQIFKLCYQVLDSGSSTSLVVAALQSLL
                     RYLHWIPYRYIYDTNLLTLLSTKFLVSPDTRAVTLKCLTEVSQLAIPENDNNIKQQTV
                     MFFQNALQQIAINVVPVTADLKSTYATANGKDQSFLQDFAMFLTTYLARHRPILESDE
                     SLRELLLTAHQYLIQLSKIEERELFKTTLDYWNNLMSSLYQEIQTVPFNEMNPLLQLS
                     LDVNPSSGGAPNPQFLKKYPLKKHMYDNICSQLRWVIIESMVRPEEVLIVENDEGEIV
                     REFVKESDTIQLYKSEREVLVYLTHLDVVDTEEIMLDKLGRQIDGSEWSWHNINTLCW
                     AIGSISGTMDEETEKRFVVTVIKDLLALTEQKRGKDNKAVVASNIMYVVGQYPRFLKA
                     HWKFLKTVVLKLFEFMHETHEGVQDMACDTFIKIVQKCKRHFVIQQPTEKEPFIQAII
                     RDIQKTTEDLQPQQVHTFYRACGLIISDEKNTAEKEKLLRELMQLPNMAWDTIVAQSA
                     ANPDLLLDPETVKIIANIIKTNVSVCSSTEADFYSQLGHIYYNMLQLYRAVSSMISAQ
                     VAKEGLIATKTPKVRGLRTIKKEVLKLVEIYIAHAKNLDEVVKSLIQPLLNAVLEDYM
                     NNVPDARDAEVLNCMTTVVNKVGHMIPEGVILILQSVFECTLDMINKDFTEYPEHRVE
                     FYKLLKEINAKSFNALLQLPPAAFKLFVDAICWAFKHNNRDVEVNGLQIALDLIDNVD
                     KASPSPFSNAFYENFYFTFTSEAFYVLTDSDHKSGFSKQSLLLMRLISLVQDNRIPVL
                     LYKSGEAPAGTTNQVYLANYMVNMLGNAFPHLTQEQVTSFINALIKQYQDPKKFSGTL
                     RDFLVQIKEYGGDPTDYLFAEDKELALAEQNKLEQERASKIGGLLKPSELDD"
     gene            complement(<468881..>469835)
                     /locus_tag="AGOS_ADL127C"
                     /old_locus_tag="ADL127C"
                     /db_xref="GeneID:4620112"
     mRNA            complement(join(<468881..469641,469832..>469835))
                     /locus_tag="AGOS_ADL127C"
                     /old_locus_tag="ADL127C"
                     /product="60S ribosomal protein L2"
                     /transcript_id="NM_209322.1"
                     /db_xref="GeneID:4620112"
     CDS             complement(join(468881..469641,469832..469835))
                     /locus_tag="AGOS_ADL127C"
                     /old_locus_tag="ADL127C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR031C-A (RPL2A) and YIL018W (RPL2B); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L2"
                     /protein_id="NP_983969.1"
                     /db_xref="GeneID:4620112"
                     /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGV
                     VKQIVHDAGRGAPLAKVVFRDPYKYKLREETFIANEGVHTGQFIYAGKNASLNVGNIL
                     PLGSVPEGTIVSNVEERPGDRGALARTSGNYVIVIGHNPDENKTRIRLPSGAKKIVSS
                     DARGVIGVIAGGGRVDKPLLKAGRAFHKYKVKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRGAVSGQKAGLIAARRTGLLRGSQKTQD"
     gene            complement(<470424..>471824)
                     /locus_tag="AGOS_ADL126C"
                     /old_locus_tag="ADL126C"
                     /db_xref="GeneID:4620113"
     mRNA            complement(<470424..>471824)
                     /locus_tag="AGOS_ADL126C"
                     /old_locus_tag="ADL126C"
                     /product="ADL126Cp"
                     /transcript_id="NM_209323.1"
                     /db_xref="GeneID:4620113"
     CDS             complement(470424..471824)
                     /locus_tag="AGOS_ADL126C"
                     /old_locus_tag="ADL126C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR032C (RRT5)"
                     /codon_start=1
                     /product="ADL126Cp"
                     /protein_id="NP_983970.1"
                     /db_xref="GeneID:4620113"
                     /translation="MSDQPAQSDLPDQGALPPQEAAQPQAVREDPQPQQCAQQVLFEQ
                     QGAQHRVYISNLSQDATEEALTEFLKDFHPVSVLIPSQSVRGFQKTSVRPLGIAYVEF
                     KDADTAAKVILELNGVTFMDRELRLRYHIPFKSEKEKLARGPNKFRQIQRRLSELRRR
                     NSDAGATVTTDNGPQVDAAAVPREMSKVTIYVGRLPGRTTDKDLRTYFHEYLPQEIIV
                     FKHRQFRGWRIRRHVTAAVITFPDHERQESALESLSNLPFNGRTVRMAPAFEDKLAEI
                     RAEVQRMAVEQQLPQPASNLGIYIGNNLIAMQPLQTRKADQQSLQSQHSPQNAAEDQT
                     ITAPPPSQQQLPQLQPIAPPLSLQPLNPVENTQPVQGLDLSIPREHEEVVRGQPLLRL
                     QKLQMIQRLQRLHRQKQRQQIQQEPAAQPAAQPAAQPATEAAVAPQLVPEQEAHQAAA
                     QAEPQQVLERPIAAGA"
     gene            complement(<472217..>472921)
                     /locus_tag="AGOS_ADL125C"
                     /old_locus_tag="ADL125C"
                     /db_xref="GeneID:4620114"
     mRNA            complement(join(<472217..472408,472912..>472921))
                     /locus_tag="AGOS_ADL125C"
                     /old_locus_tag="ADL125C"
                     /product="60S ribosomal protein L29"
                     /note="5'UTR intron"
                     /transcript_id="NM_209324.2"
                     /db_xref="GeneID:4620114"
     CDS             complement(472217..472405)
                     /locus_tag="AGOS_ADL125C"
                     /old_locus_tag="ADL125C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR032C-A (RPL29); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L29"
                     /protein_id="NP_983971.1"
                     /db_xref="GeneID:4620114"
                     /translation="MAKSKNHTAHNQTKKAHRNGIKKPRTNKYPSLKGVDAKFKRNHK
                     YALHGTAKALAAKRAAKN"
     gene            complement(<473167..>473547)
                     /locus_tag="AGOS_ADL124C"
                     /old_locus_tag="ADL124C"
                     /db_xref="GeneID:4620115"
     mRNA            complement(<473167..>473547)
                     /locus_tag="AGOS_ADL124C"
                     /old_locus_tag="ADL124C"
                     /product="ADL124Cp"
                     /transcript_id="NM_209325.1"
                     /db_xref="GeneID:4620115"
     CDS             complement(473167..473547)
                     /locus_tag="AGOS_ADL124C"
                     /old_locus_tag="ADL124C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR033C (QCR6)"
                     /codon_start=1
                     /product="ADL124Cp"
                     /protein_id="NP_983972.1"
                     /db_xref="GeneID:4620115"
                     /translation="MISSITEYLEELKEAFVPTVAKAEDDVEDVEEEEEEEDEDEDED
                     EDEDEEEEAGDQLDELREECRNAADAKPLVHHYMECVERVQHAQQQPGYADLDYQEDC
                     VEEFFHLQHHLDSCAAPKLFDKLK"
     gene            complement(<473852..>475042)
                     /locus_tag="AGOS_ADL123C"
                     /old_locus_tag="ADL123C"
                     /db_xref="GeneID:4620116"
     mRNA            complement(<473852..>475042)
                     /locus_tag="AGOS_ADL123C"
                     /old_locus_tag="ADL123C"
                     /product="ADL123Cp"
                     /transcript_id="NM_209326.3"
                     /db_xref="GeneID:4620116"
     CDS             complement(473852..475042)
                     /locus_tag="AGOS_ADL123C"
                     /old_locus_tag="ADL123C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR034C (PHO4)"
                     /codon_start=1
                     /product="ADL123Cp"
                     /protein_id="NP_983973.3"
                     /db_xref="GeneID:4620116"
                     /translation="MRTTGWNDTAGGEGRTILEQVGEYLSEQGRRPGGSTAGEWDEAE
                     QTEHERERRDKGDQMAGPGSHFLDFSLLDEGNEVGDKERLRQRAAVFSPVMSPMLHIY
                     GSVSNTPLLTADKAHASQNTPHLQGAGAGSALQGQGMSPLSSPALGAGAATAPAAFSL
                     PEAAAGIVSRKCAAGSARPAKKTPHSTPYLGATPGKVVKQSPLVDAKKSNGSTVSSGS
                     SSKYKNHTWDDMFCLPTSSMGIGGHSSLGSTPDDSLRAPLDGSDDLHDARKPAPGLPR
                     FILPSNNPQRQLPPPPSDSVIHASQSPVIKPNYAGKPPGFVSARSVRTLSGGDANTGD
                     EFIKKEVHKVAEQGRRNRLNNALAELNDLLPPELKESAQVPSKATTVELACKYIRQLT
                     GQQN"
     gene            complement(<475462..>476406)
                     /locus_tag="AGOS_ADL122C"
                     /old_locus_tag="ADL122C"
                     /db_xref="GeneID:4620117"
     mRNA            complement(<475462..>476406)
                     /locus_tag="AGOS_ADL122C"
                     /old_locus_tag="ADL122C"
                     /product="ADL122Cp"
                     /transcript_id="NM_209327.1"
                     /db_xref="GeneID:4620117"
     CDS             complement(475462..476406)
                     /locus_tag="AGOS_ADL122C"
                     /old_locus_tag="ADL122C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL019W (FAF1)"
                     /codon_start=1
                     /product="ADL122Cp"
                     /protein_id="NP_983974.1"
                     /db_xref="GeneID:4620117"
                     /translation="MSDNEEYMQQLEAQRRAFEAQFGSLEDMGYVDKTRAAQSNDTST
                     SASESDSDPESEGDARSGQSESDEQSEMDGASASSDDEAAHTPRVISFRAPSDAYSGP
                     SPRELRRIRSGKAPGLETEPAPKSAAADRDEKQLLEQDIELQRFLQESHIFAALNSQP
                     SGADLTLRTIDNPAYAGGEVIGKARARTLEMRLNALSATNGAARTLETVPMNIRKGMV
                     SKHRSRIREHEQLARDSGTVLAKVRRGEFRKIDATYKKDIERRIGTTIKAADRARKKH
                     RDRAPRIHAVGKSTRNGLVISPKEIAAVAASEPKRRKR"
     gene            <476581..>477372
                     /locus_tag="AGOS_ADL121W"
                     /old_locus_tag="ADL121W"
                     /db_xref="GeneID:4620118"
     mRNA            <476581..>477372
                     /locus_tag="AGOS_ADL121W"
                     /old_locus_tag="ADL121W"
                     /product="ADL121Wp"
                     /transcript_id="NM_209328.1"
                     /db_xref="GeneID:4620118"
     CDS             476581..477372
                     /locus_tag="AGOS_ADL121W"
                     /old_locus_tag="ADL121W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL020C (HIS6)"
                     /codon_start=1
                     /product="ADL121Wp"
                     /protein_id="NP_983975.1"
                     /db_xref="GeneID:4620118"
                     /translation="MTRFVGCIDLHDGKVKQIVGGTLSSKPDGEAPVTNFVSDKSPSH
                     YAHLYASNDVQGSHVIRLGQSNDEAALMALQAAPGFLQLGGGVTKDNCQYWLQWASKV
                     IVTSALFDSDGSFQLQRLREISGLCGRARLVVDLSCRRASDGASWTVMMNKWQTPTTL
                     ALNEETLALLSEYCSEFLIHAADVEGLCRGIDEELVAQLGLWAAQLRGDVRVVYAGGA
                     NSVADLGLVKRLSGGRVDLTYGSALDIFGGSLVRFQDCCAWNRQQ"
     gene            complement(<477467..>478402)
                     /locus_tag="AGOS_ADL120C"
                     /old_locus_tag="ADL120C"
                     /db_xref="GeneID:4620119"
     mRNA            complement(<477467..>478402)
                     /locus_tag="AGOS_ADL120C"
                     /old_locus_tag="ADL120C"
                     /product="ADL120Cp"
                     /transcript_id="NM_209329.1"
                     /db_xref="GeneID:4620119"
     CDS             complement(477467..478402)
                     /locus_tag="AGOS_ADL120C"
                     /old_locus_tag="ADL120C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL021W (RPB3)"
                     /codon_start=1
                     /product="ADL120Cp"
                     /protein_id="NP_983976.1"
                     /db_xref="GeneID:4620119"
                     /translation="MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTL
                     AIDSVEIESNTSVLADEFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLH
                     AVGESESTTNVYAKDLQIVSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAK
                     KGIAKEHAKWSPAAAIEFEYDPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQ
                     FDYSAKPNTFYMNVESVGSIPSDQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPT
                     GDAAPMEVDQDPYSATSGRFNEYNDNAHAAYDDAW"
     gene            <478499..>479056
                     /locus_tag="AGOS_ADL119W"
                     /old_locus_tag="ADL119W"
                     /db_xref="GeneID:4620120"
     mRNA            <478499..>479056
                     /locus_tag="AGOS_ADL119W"
                     /old_locus_tag="ADL119W"
                     /product="ADL119Wp"
                     /transcript_id="NM_209330.2"
                     /db_xref="GeneID:4620120"
     CDS             478499..479056
                     /locus_tag="AGOS_ADL119W"
                     /old_locus_tag="ADL119W"
                     /note="NOHBY409; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0D16192g"
                     /codon_start=1
                     /product="ADL119Wp"
                     /protein_id="NP_983977.2"
                     /db_xref="GeneID:4620120"
                     /translation="MTTARSGRSWQRHSACRRLCSTRPAAAAGGCVVRGSLRCGLAQW
                     PSWHAHRGCVFVKAKASAGMLPLSHEQAIAMERKAITIPDVRFEQTFRAALAKESARQ
                     RQLRAQKEGEAAADGEAGISALVVAKVVVRDVLLMPLVQGALWTGLLITMKPWLRLCM
                     LGGRRAGQAFYRALVGDVRPRMRAA"
     gene            complement(<479109..>480365)
                     /locus_tag="AGOS_ADL118C"
                     /old_locus_tag="ADL118C"
                     /db_xref="GeneID:4620121"
     mRNA            complement(<479109..>480365)
                     /locus_tag="AGOS_ADL118C"
                     /old_locus_tag="ADL118C"
                     /product="ADL118Cp"
                     /transcript_id="NM_209331.2"
                     /db_xref="GeneID:4620121"
     CDS             complement(479109..480365)
                     /locus_tag="AGOS_ADL118C"
                     /old_locus_tag="ADL118C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL022W (TIM44)"
                     /codon_start=1
                     /product="ADL118Cp"
                     /protein_id="NP_983978.1"
                     /db_xref="GeneID:4620121"
                     /translation="MHRYSAVKQAQKSQPQRVLAARGFSATRWAGNGPKSPLQVFRET
                     FKEEWKKSQELQDNIKALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGET
                     LEHITVQAWESEIGKTTRKTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGG
                     FMEKERRREKRERDLATGKRATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVV
                     GRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEF
                     TKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIRQQELFADGRILDIR
                     GVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHESNIMLSSYAMVLTRD
                     PEKVDDKETEGWKILEFVRGGSRSFT"
     gene            <480891..>481412
                     /locus_tag="AGOS_ADL117W"
                     /old_locus_tag="ADL117W"
                     /db_xref="GeneID:4620122"
     mRNA            <480891..>481412
                     /locus_tag="AGOS_ADL117W"
                     /old_locus_tag="ADL117W"
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /transcript_id="NM_209332.1"
                     /db_xref="GeneID:4620122"
     CDS             480891..481412
                     /locus_tag="AGOS_ADL117W"
                     /old_locus_tag="ADL117W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER050C (RSM18)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /protein_id="NP_983979.1"
                     /db_xref="GeneID:4620122"
                     /translation="MQTGCCGCILKKEAMLSSVRSGLLLSSSRAFSKCSRTLVAQQDL
                     GLLGSAPKNDQVKKVPPEMMKKFATGSLYDPFDFSMARLHLEKKHRKNARKVDIFEEL
                     NLDPLDLYTSPAILSRFVGNTGKILHRDVTGLSVRSQKRMSRAVRRCQAIGLMSKTHK
                     DVSLLSHSVMSER"
     gene            complement(<481477..>482784)
                     /locus_tag="AGOS_ADL116C"
                     /old_locus_tag="ADL116C"
                     /db_xref="GeneID:4620123"
     mRNA            complement(<481477..>482784)
                     /locus_tag="AGOS_ADL116C"
                     /old_locus_tag="ADL116C"
                     /product="ADL116Cp"
                     /transcript_id="NM_209333.1"
                     /db_xref="GeneID:4620123"
     CDS             complement(481477..482784)
                     /locus_tag="AGOS_ADL116C"
                     /old_locus_tag="ADL116C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL042C (PKP1)"
                     /codon_start=1
                     /product="ADL116Cp"
                     /protein_id="NP_983980.1"
                     /db_xref="GeneID:4620123"
                     /translation="MNRLPVSVPLARAGRAMFTGRWAAKVEACAKVMGSQMLNRSCRL
                     VRDTSCSRCLSTMPARSAGGSLSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLT
                     EYVPPLSDNERFMLSIKVLNMLLTYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLE
                     SLLAIELPYGLHDHAAMREKLITFLDDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIH
                     LRDRLSMKLLVTHYLRLVEQSSGADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRI
                     VPVNILEGHDVTFACIPQDLEYVLQEILKNSARAHIENHTPSNYSAEKPIEVTIVRSY
                     EDLEIRIRDFGGGIPPDVEDRMFDYSYTTSEKDAKDTGMSAYIIPGQDVSNVSGMGFG
                     LPLCKAYVEMFNGELDIVSLWGWGTDVYIRLKGPKESLLDRVK"
     gene            <483598..>484599
                     /locus_tag="AGOS_ADL115W"
                     /old_locus_tag="ADL115W"
                     /db_xref="GeneID:4620124"
     mRNA            <483598..>484599
                     /locus_tag="AGOS_ADL115W"
                     /old_locus_tag="ADL115W"
                     /product="ADL115Wp"
                     /transcript_id="NM_209334.1"
                     /db_xref="GeneID:4620124"
     CDS             483598..484599
                     /locus_tag="AGOS_ADL115W"
                     /old_locus_tag="ADL115W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL041W (GVP36)"
                     /codon_start=1
                     /product="ADL115Wp"
                     /protein_id="NP_983981.1"
                     /db_xref="GeneID:4620124"
                     /translation="MSFNAFADSFSKRFQEISSTVQQKAQEAQLDKKLKDLSLSVSQR
                     TQDLTSNLPSLAQTTQRRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQ
                     IYESESYDYPQHISDSVNDFSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNY
                     ALSKVALTSSEYLSKSGSDDVVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLRE
                     KLNTQFAEAMQSRKQVDQKRLQYDIARANFTAARPEKQASLRVQMETLEDQFAQSTED
                     AVALMQAVIDDTEFLKEFQELVTAQLGFHKAAAELLSGFATVFAADSAVHISSADYK"
     gene            complement(<484742..>486586)
                     /locus_tag="AGOS_ADL114C"
                     /old_locus_tag="ADL114C"
                     /db_xref="GeneID:4620125"
     mRNA            complement(<484742..>486586)
                     /locus_tag="AGOS_ADL114C"
                     /old_locus_tag="ADL114C"
                     /product="ADL114Cp"
                     /transcript_id="NM_209335.2"
                     /db_xref="GeneID:4620125"
     CDS             complement(484742..486586)
                     /locus_tag="AGOS_ADL114C"
                     /old_locus_tag="ADL114C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER049W (TPA1)"
                     /codon_start=1
                     /product="ADL114Cp"
                     /protein_id="NP_983982.2"
                     /db_xref="GeneID:4620125"
                     /translation="MKRRAPSQPVFESKQPFLEIEKVKASFNSKIWDDSYREQLREEV
                     ASNKPYNWGTIHDLVDPDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWK
                     DLSRLPSLCRLRQILYSDVYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVI
                     GSRRVSFILYLPDPDKTWKEHYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVQ
                     PGYSFHDVEEVKVDKHRLSIQGWYHIPQEGEEGFVPGEEEQYVNTNISTLAQLESNLL
                     QDYEFPKSERSILPLQQLKQLEKFLGSESEDTASYLNADELAYLSMYISEEHLSLEGI
                     KSLQSKFTENSYLQIDSFLNEQKSALLKKLIKIEELEKECPYKAAEVEKPWKTAIPPY
                     KWRFMYIDGKSHEHFCSEDDIKRRLVHEELPNFTLLKQGLSDHLSVEPALLELVEFFK
                     SFAFKKYLALLTLLCPLTEQLLIRRFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGV
                     LCLTPTDGWESGELGGYELYMGDQDDEDMNKDVEDAAVYRSDDSGSSVLINKPASWNS
                     FNLVLRDESVLQFVKYVSWAAKSSRWDISMNWDVKSFENDPNSNEEKD"
     gene            complement(<486929..>487255)
                     /locus_tag="AGOS_ADL113C"
                     /old_locus_tag="ADL113C"
                     /db_xref="GeneID:4620126"
     mRNA            complement(<486929..>487255)
                     /locus_tag="AGOS_ADL113C"
                     /old_locus_tag="ADL113C"
                     /product="ADL113Cp"
                     /transcript_id="NM_209336.1"
                     /db_xref="GeneID:4620126"
     CDS             complement(486929..487255)
                     /locus_tag="AGOS_ADL113C"
                     /old_locus_tag="ADL113C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER048W-A (ISD11)"
                     /codon_start=1
                     /product="ADL113Cp"
                     /protein_id="NP_983983.1"
                     /db_xref="GeneID:4620126"
                     /translation="MQVSINRSRAQRSLLLSATTTMAGPTRAGVLHLYREFVRSARQF
                     NNYNFREYFMRHSRDTFRKHREASGEELQQLWERAQQEVGVLKRQSVISQMYTFDKLV
                     VEQLRK"
     gene            complement(487276..487347)
                     /locus_tag="AGOS_t0065"
                     /db_xref="GeneID:4620127"
     tRNA            complement(487276..487347)
                     /locus_tag="AGOS_t0065"
                     /product="tRNA-Gln"
                     /codon_recognized="CAA"
                     /db_xref="GeneID:4620127"
     gene            <487380..>487916
                     /locus_tag="AGOS_ADL112W"
                     /old_locus_tag="ADL112W"
                     /db_xref="GeneID:4620190"
     mRNA            <487380..>487916
                     /locus_tag="AGOS_ADL112W"
                     /old_locus_tag="ADL112W"
                     /product="ADL112Wp"
                     /transcript_id="NM_209337.1"
                     /db_xref="GeneID:4620190"
     CDS             487380..487916
                     /locus_tag="AGOS_ADL112W"
                     /old_locus_tag="ADL112W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL040W (APQ12)"
                     /codon_start=1
                     /product="ADL112Wp"
                     /protein_id="NP_983984.1"
                     /db_xref="GeneID:4620190"
                     /translation="MCACCARVPCPAQEPARTKLCQHIASPPRHGPGPRATATAAGAP
                     QRRARTHLRAARRCSRAGARPPVPGCRVLAHPPPAHRRRRPRSSRAARCAAPHGPARA
                     RPARARCLQPRLGHARPPRPARDCRLRSRPRLGPRRHSPLRAARLRRPRRRGRPGLRG
                     RTPLPRRPAPPPPYIADL"
     gene            <488383..>490119
                     /locus_tag="AGOS_ADL111W"
                     /old_locus_tag="ADL111W"
                     /db_xref="GeneID:4620128"
     mRNA            <488383..>490119
                     /locus_tag="AGOS_ADL111W"
                     /old_locus_tag="ADL111W"
                     /product="ADL111Wp"
                     /transcript_id="NM_209338.2"
                     /db_xref="GeneID:4620128"
     CDS             488383..490119
                     /locus_tag="AGOS_ADL111W"
                     /old_locus_tag="ADL111W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER048C (CAJ1)"
                     /codon_start=1
                     /product="ADL111Wp"
                     /protein_id="NP_983985.2"
                     /db_xref="GeneID:4620128"
                     /translation="MVKDTTYYDILGVTPSASAEQIKKAYRKKAIQTHPDKNPNDPDA
                     QAKFQEVSKAYKVLSDPDLKNRYNEFGLSDERGEMVMEEDPFEMLMAVFGGDSFQQWI
                     GEYSFLRNLMKQTELFECEDEDDEHGESQDNKSAGGTPAGSACGRAESTHLSTYQRTA
                     SAGVSGGARSGGARSGGASSGGASSGGSGARTEQTSASSADTGTSGSSDQARKDRRHR
                     QRERFLELERERREEKKRQIEELARILDKKITDYQIAALAGRVSEFQESLQSEIDKSL
                     KTESFGIELLQLISKVYRSKANNFLMSQKTYGISRIFTGMHEKTKSVKSTFSMLNSAM
                     NAMSAQKELEKLDLENMNPYERAQIEFLIQGKSMGMMWSLNKFELQSKLKGICDRLLD
                     DKTVPSRQRVGKAKALLFIAEMFGNARRAPGDVDPAILEFEEMVLQSKNVRIKTRKQP
                     GRVTDQNIFFAKLNSADQENVPPTANGPPPTQGRERLHTSRSQHASQKPAPSRPHTSR
                     SPPQRPSPTRSTSQREPPQRPSTAHPSPTRSSNLPSTAHGGSVRGSGSYATARVSPMH
                     DTPPRAAAHPLC"
     gene            <490455..>491876
                     /locus_tag="AGOS_ADL110W"
                     /old_locus_tag="ADL110W"
                     /db_xref="GeneID:4620129"
     mRNA            <490455..>491876
                     /locus_tag="AGOS_ADL110W"
                     /old_locus_tag="ADL110W"
                     /product="ADL110Wp"
                     /transcript_id="NM_209339.1"
                     /db_xref="GeneID:4620129"
     CDS             490455..491876
                     /locus_tag="AGOS_ADL110W"
                     /old_locus_tag="ADL110W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL039W (TED1)"
                     /codon_start=1
                     /product="ADL110Wp"
                     /protein_id="NP_983986.1"
                     /db_xref="GeneID:4620129"
                     /translation="MSQQNLKKLTILALVLALASNLYIYTYPSLFPCRCSFEQQNALQ
                     GLDDNSTLAQRVWCRSQYYFSDVTKQLGSTHTRAATPEQGAVPEVRLLAIGDPQINGI
                     WPTTPYLRRLEIFINDYFLGHVIQRMLRRLAPTHVAVMGDLFSSQWIGDSEYYNRTMR
                     YTRRLLGRSDKLLQAQRDESHDAAGEYNRDWQQYGRDYEAVRQGDLTMFSWHRENAWR
                     WAPEDDYLLINITGNHDVGYSGDTTYQHMARYKHLFGEDNYWIEYDRDTDHAWRVVVL
                     NDLLLEGPALQPEFIDTTWRFLEHLAARDFPGTTVLLTHVPFHKPAGLCHDNPETRYY
                     PPGYEREPYKVGLLRSQNLLSPDVSDRVLNLVFANGKPGIILTGHDHEGCDTAYTRAP
                     DGSWAAQPPSAQPAHVRELTVRSVMAQYGGNVGLLRGSFDPATASWRWTYSVCPFAHQ
                     AVWYCAKLMPVVLILLLSTLYVW"
     gene            <492306..>494522
                     /locus_tag="AGOS_ADL109W"
                     /old_locus_tag="ADL109W"
                     /db_xref="GeneID:4620130"
     mRNA            <492306..>494522
                     /locus_tag="AGOS_ADL109W"
                     /old_locus_tag="ADL109W"
                     /product="ADL109Wp"
                     /transcript_id="NM_209340.2"
                     /db_xref="GeneID:4620130"
     CDS             492306..494522
                     /locus_tag="AGOS_ADL109W"
                     /old_locus_tag="ADL109W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER047C (SAP1)"
                     /codon_start=1
                     /product="ADL109Wp"
                     /protein_id="NP_983987.2"
                     /db_xref="GeneID:4620130"
                     /translation="MDGGSNAIGLLSRLSRRMKKPQQPLTDLTQLYSDVANETITNLG
                     LEERGEIKRAYQGWKALQTHVLYELGRIERSYPQVHLYNSEEMGLQSGVQELYTKLQV
                     HMERVGRLYETEGDRGRQTRSGTTQSGSSGSKAGSIGGTTLLRTLRRPPPAEEASARP
                     GATEPAAAPAREADQFFGFDEDVNLIDLSDEGESPRGGSKNPFITGSPEEEGDGSDYE
                     FNVDDYFNHYLEGDEDETPLGAKLERLSLESSEPPPVLATKARAEPSQSRAPANRGHY
                     RAGPRAASSTASLGNLGRPCSAPTVDGANLSTQAARNAVQPVAAAAASSGNIPAARRA
                     RPERRRVKTQVRRPGGGSGHAVTSRYIVYRKSATQKATPVGTPGGTPPLGVKGEPVPN
                     SWHATPCGSPAASLTKDINEEAYSEDLKEEMEAGIIDSLRGVDKTAAKQIFSEIVVRG
                     DEVHWDDIAGLDSAKNSLKEAVVYPFLRPDLFRGLREPVRGMLLFGPPGTGKTMLARA
                     VATESHSTFFSISASTLTSKYLGESEKLVRALFAVARKLSPSIIFVDEIDSILGSRNN
                     NSEHEASRRIKTEFLVQWSALSNAAAANEANEEDERVLVLAATNLPWCIDEAARRRFV
                     KRQYIPLPEGETRRLQIERLLSKQKHTLTEEGFAELIRLTEGYSGSDITSLAKDAAMG
                     PLRELGDNLLMTPRENIRPIALEDFINSLNYIKPSVSPEGLLQYENWADKFGSSGV"
     gene            complement(<495247..>497592)
                     /locus_tag="AGOS_ADL108C"
                     /old_locus_tag="ADL108C"
                     /db_xref="GeneID:4620131"
     mRNA            complement(<495247..>497592)
                     /locus_tag="AGOS_ADL108C"
                     /old_locus_tag="ADL108C"
                     /product="ADL108Cp"
                     /transcript_id="NM_209341.2"
                     /db_xref="GeneID:4620131"
     CDS             complement(495247..497592)
                     /locus_tag="AGOS_ADL108C"
                     /old_locus_tag="ADL108C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL038C (NOT3)"
                     /codon_start=1
                     /product="ADL108Cp"
                     /protein_id="NP_983988.2"
                     /db_xref="GeneID:4620131"
                     /translation="MAHRKLQQEIERVFKKINEGLEIFNTYYERHENCTNNPSQKDKL
                     EGDLKREVKKLQRLREQIKTWQSAPEVKDKDALLDYRRSVEVAMEKYKAVEKASKEKA
                     YSNTSLKRSEVLDPEERERREVSDYLSEKIDELERQYEQLQVDMDRLIGGRKRRGTAQ
                     EERKLELRQLQVRYRWHQQQMELALRLLANEELDPQAVRDIQDDITYFIESNQEPDFV
                     EDETIYDSLNLDANEAIAHEVAASFAAQANEESDDEQRDMSCLSKKEQRRLEREAKRA
                     AKLAAKGSLDSISSTPVTSAPSSALDHEPTDEVQDLASSSVVPKEDDPPTPASSQSPS
                     PTSTPSSSIPSTANTIATHTQSSKPQTPLAKPRQLTHISPEHQGHTHIHQTLNGVTTS
                     TLKPATVPAKPAGELKWAVAAAQALEKEKREKSASLMAMKTQGASSPRATMDMSSTSQ
                     LTDAHSSSNRSDTVYSTHAEDRGHLSGDNKDIPKVGNSAIKSTHLDALKKQEMPGLEL
                     VADNYESDSTDDELPEEPMPIQLDVEEYERRGSVSNQLFTELCQNFDLLKLPCGIQDM
                     IMGSLITSHDLHPPDGKLGGFRNFPDICRVTRLFELPRGVNPPQPLDATRCTEQWDSV
                     RIGLVDEKTVEDQEDQDLRISTYSKFRVLETFTLFYVYYYAYTPLEHDIAATILAERE
                     WRVSKDGATWFLREGQPKFTNELCEVADFKIFKLDDWTAINKMNFTLDYSILKDSQKP
                     TAAGSGTAGSTPSRHGSLSHGQTLLQQLRRGSSAMKVEPSH"
     gene            complement(<497926..>499530)
                     /locus_tag="AGOS_ADL106C"
                     /old_locus_tag="ADL106C"
                     /db_xref="GeneID:4620132"
     mRNA            complement(<497926..>499530)
                     /locus_tag="AGOS_ADL106C"
                     /old_locus_tag="ADL106C"
                     /product="ADL106Cp"
                     /transcript_id="NM_209343.2"
                     /db_xref="GeneID:4620132"
     CDS             complement(497926..499530)
                     /locus_tag="AGOS_ADL106C"
                     /old_locus_tag="ADL106C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL037C (PRM2)"
                     /codon_start=1
                     /product="ADL106Cp"
                     /protein_id="NP_983990.2"
                     /db_xref="GeneID:4620132"
                     /translation="MSDQQFVHPLGLKSRLLGCLFSPLVVVPAVVYLFTIWTVHTIAA
                     PHGTAVPPAALPGAPLLPAAGPAAPAGGTLWPPAAPTFDVRALDDALRRYLDESLTTS
                     AQTLDRYIRENYNHTVDASLRAWNETLSSSIKLLHELLLQQQRQSVSISGELQSQGQR
                     IRGAVKRLTETGLSVGSDLGPRVSDMHLDDSFLAPLYKDVNSTIKQLPSLIPAAFPAF
                     KWAPLNLSSVRREADQVRREALHLYANRYSGDLRRRSTPPALGLAARHTAVVAALTAA
                     ALVLRCAGEWFAFHLQNHAIVRAALEAHEPPCTGVALTAWRHAAIRALAAAHEHPFVY
                     CALRPMRDLAPRAWRRASTWALWCGAHGGALLWFLLFVALTDWQLAVATLPHAQRLHH
                     RAQPADAADVVANLHAALETRLRPALRDAHAAALGAAADHLHRKLAPLLARIDSSRPS
                     VLPLPALIVPQPVWPAWPPAADLAPVIRAAIPRAHPLRLASRSIPAPQFVAVSLSTVF
                     RPAVIVIAVLIIIHHLVGLLLVLRTR"
     gene            complement(<499734..>500795)
                     /locus_tag="AGOS_ADL105C"
                     /old_locus_tag="ADL105C"
                     /db_xref="GeneID:4620133"
     mRNA            complement(<499734..>500795)
                     /locus_tag="AGOS_ADL105C"
                     /old_locus_tag="ADL105C"
                     /product="ADL105Cp"
                     /transcript_id="NM_209344.2"
                     /db_xref="GeneID:4620133"
     CDS             complement(499734..500795)
                     /locus_tag="AGOS_ADL105C"
                     /old_locus_tag="ADL105C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER046W (SPO73)"
                     /codon_start=1
                     /product="ADL105Cp"
                     /protein_id="NP_983991.2"
                     /db_xref="GeneID:4620133"
                     /translation="MSSAGSRAQAERAKGRSACELQGVSEHIIVENQRGITLFGYPFF
                     SNKLLIPKVDPPQFHTEKEQQPISTTTSNYYGNTNNKLLLPLHFRYTGTLGAEGTGRL
                     RGRPASGGSDDEFAWFVSMDYRGQYDIDDQGWCYSWSFRSKYWKGKSGFVRKRFWVRL
                     PTRSEHLGQTSGPGARAGSRGARSAMHRTGSAGRAGWAAARHTEPQSPIAEEDDEKRD
                     EDRADTACMLGSYTRQEFSALYEGGNGRFAEELAQLVRKIDKLPLDRQKFEALEEFVQ
                     GMTPTQHRDMCRIVRDPNSGFTGKILSSFQFDVSRRKFLERWIHGLLMDTGQTESQTT
                     TQKMGRTPANQRQRGSTQQ"
     gene            <501579..>502526
                     /locus_tag="AGOS_ADL104W"
                     /old_locus_tag="ADL104W"
                     /db_xref="GeneID:4620134"
     mRNA            <501579..>502526
                     /locus_tag="AGOS_ADL104W"
                     /old_locus_tag="ADL104W"
                     /product="ADL104Wp"
                     /transcript_id="NM_209345.2"
                     /db_xref="GeneID:4620134"
     CDS             501579..502526
                     /locus_tag="AGOS_ADL104W"
                     /old_locus_tag="ADL104W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL036W (CST6) and YER045C (ACA1)"
                     /codon_start=1
                     /product="ADL104Wp"
                     /protein_id="NP_983992.2"
                     /db_xref="GeneID:4620134"
                     /translation="MRAAGGVHAVHAAAQGHYGVPPATYMSDPVIQESLSPFFQPVGI
                     DVTRLPLTNPPIFQSSLASYNGPPQRRRISISNGQIGQLGHMGQLDDEDVMESIYDLQ
                     PPPLPQRRNGAKPFSKPVVSHEQFLARQHPPSYQAAYVDVAPGKPAEGHGAAYAGSVS
                     SAPLHPHPEQPLTRPAHVLDAMASGPDFPRAASSSSLPTLYDAPPGTAAWKRARLLER
                     NRIAASKCRQRKKIAQLQLQKDVDILTKENKEIRRELEYYQKLVSKFKRFIELHMETC
                     NGSNGGVQIIEEMLKIDHSIVGQENDSGDKRDTSEEAPI"
     gene            <503169..>503939
                     /locus_tag="AGOS_ADL103W"
                     /old_locus_tag="ADL103W"
                     /db_xref="GeneID:4620135"
     mRNA            <503169..>503939
                     /locus_tag="AGOS_ADL103W"
                     /old_locus_tag="ADL103W"
                     /product="ADL103Wp"
                     /transcript_id="NM_209346.2"
                     /db_xref="GeneID:4620135"
     CDS             503169..503939
                     /locus_tag="AGOS_ADL103W"
                     /old_locus_tag="ADL103W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER044C-A (MEI4)"
                     /codon_start=1
                     /product="ADL103Wp"
                     /protein_id="NP_983993.2"
                     /db_xref="GeneID:4620135"
                     /translation="MAWVLSSYRRARWLWLLPDLGADTKRMARGLQTFIVSHYAFHAG
                     AEAMVKYVTHTLYYKFMLELWDTSHEQLQSGKYYGHEFSRYGPEALNRSALCKEQRRM
                     ALVILKIRSQRNRGKGPAVRCVMFMLQILESLARSYVKLSRRKAPHAGMETVGLQKAY
                     LQIYERRTKTFNDKYMVEICNILRRHENSVKALELMIKETLKFLQSLDWKSLHLNQKD
                     CDELASYRKFIQCSLLLTDNTSLIAGCRLVISKWPTKP"
     gene            complement(<504097..>505215)
                     /locus_tag="AGOS_ADL102C"
                     /old_locus_tag="ADL102C"
                     /db_xref="GeneID:4620136"
     mRNA            complement(<504097..>505215)
                     /locus_tag="AGOS_ADL102C"
                     /old_locus_tag="ADL102C"
                     /product="ADL102Cp"
                     /transcript_id="NM_209347.1"
                     /db_xref="GeneID:4620136"
     CDS             complement(504097..505215)
                     /locus_tag="AGOS_ADL102C"
                     /old_locus_tag="ADL102C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL035C (CKA1)"
                     /codon_start=1
                     /product="ADL102Cp"
                     /protein_id="NP_983994.1"
                     /db_xref="GeneID:4620136"
                     /translation="MKSRVCSEARVYTRVLAPLGEEYWDYENTTIDWRANNSQYEIET
                     KVGHGKYSEVFQGVQLSSRSKVVVKMLKPVKKKKIKREIKVLMNLASEQRAAAGFDKE
                     TYYSNRSAEVRVYNRYDQVYTMPHNGHENIIHLLDVIKDPISRTPALVFEYVDNVDFR
                     ILYPTFSDMDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQRKLRLIDWGLAE
                     LYHPKEEYNARVASRFFKGPELLVDYRMYDYSLDLWSLGTMLASMVFMKEPFFHGRSN
                     TDQLVKIVRVLGSEDFEKYLVKYQITLPREFMDMDQYIRRPWKRFINDANRHLCDNEE
                     IIDLIDNILKYDHHERLTAREAMQHPWFAPIRNGEYKL"
     gene            complement(<505432..>506256)
                     /locus_tag="AGOS_ADL101C"
                     /old_locus_tag="ADL101C"
                     /db_xref="GeneID:4620137"
     mRNA            complement(<505432..>506256)
                     /locus_tag="AGOS_ADL101C"
                     /old_locus_tag="ADL101C"
                     /product="ADL101Cp"
                     /transcript_id="NM_209348.1"
                     /db_xref="GeneID:4620137"
     CDS             complement(505432..506256)
                     /locus_tag="AGOS_ADL101C"
                     /old_locus_tag="ADL101C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL034C (CAP2)"
                     /codon_start=1
                     /product="ADL101Cp"
                     /protein_id="NP_983995.1"
                     /db_xref="GeneID:4620137"
                     /translation="MSEEKYDAAMDLLRRLDLENLESNLQALIELEPALAADLLSSVD
                     TPLTVKADPSCSGREFLCCDYNRDIDSHRSPWSNEYFPRLSAEELAESPFPSDALRRL
                     EVLANDSMDIYRDLYYEGGVSSVYMWSVDDAADDFAGVVLFKKGAQSTSHWDSIHVFE
                     VLHEGSHEVVYRITTTIILRLKDANAVALSGNLTRQTEKTASLPSGSEERTHITHVTN
                     LGSAIEEVEGQMRNLLEVVYFDKTKDVYHELRNDAAESLQVNRDKHQDLIKGLQGL"
     gene            <506692..>507135
                     /locus_tag="AGOS_ADL100W"
                     /old_locus_tag="ADL100W"
                     /db_xref="GeneID:4620138"
     mRNA            <506692..>507135
                     /locus_tag="AGOS_ADL100W"
                     /old_locus_tag="ADL100W"
                     /product="ADL100Wp"
                     /transcript_id="NM_209349.1"
                     /db_xref="GeneID:4620138"
     CDS             506692..507135
                     /locus_tag="AGOS_ADL100W"
                     /old_locus_tag="ADL100W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER044C (ERG28)"
                     /codon_start=1
                     /product="ADL100Wp"
                     /protein_id="NP_983996.1"
                     /db_xref="GeneID:4620138"
                     /translation="MWSFNYLLTQSRGILGSLPPGKLPSWLLFISVVSVFNSVQTYIN
                     KELTRRVYENKPSETTDLSARTFGTWTLLSSVIRLYGAFYLYDERIFQLTFITYSIAL
                     LHFGSEWLIFRTCKLGKGFMGPLLVATTSLVWMYNTKEYYTGRGW"
     gene            complement(<507279..>508655)
                     /locus_tag="AGOS_ADL099C"
                     /old_locus_tag="ADL099C"
                     /db_xref="GeneID:4620139"
     mRNA            complement(<507279..>508655)
                     /locus_tag="AGOS_ADL099C"
                     /old_locus_tag="ADL099C"
                     /product="ADL099Cp"
                     /transcript_id="NM_209350.1"
                     /db_xref="GeneID:4620139"
     CDS             complement(507279..508655)
                     /locus_tag="AGOS_ADL099C"
                     /old_locus_tag="ADL099C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL033C (BCY1)"
                     /codon_start=1
                     /product="ADL099Cp"
                     /protein_id="NP_983997.1"
                     /db_xref="GeneID:4620139"
                     /translation="MVLSQEHRDLLDAFQKEVEQRRPGDLLQFAANYFNKKLEEERLF
                     VRSQESLALSKGVVLFPGSEGCGANRAAGSPDARKTGEDEDVMFKLPFVEHDPHSRHI
                     YDDNKHGHDSCDPHTSFSREPGAGLFQGGYNMGQEAQKEAQTDFDPKASEVSSILKQR
                     NVPRKSGVNSKPLPMNFNAERRTSVSGETLKPDHFSDWTPENYTEKTREQLKGLESAV
                     GKNFLFNKLDSDSKTLVINSLEEKLVSKGQEIIRQGDEGDYFYIVEKGTVDFFLDDRK
                     VNTYGPGSCFGELALMYNSPRAVTAVAATDCVLWALDRLTFRRILLSGSFKKRLLYDD
                     FLKSMPLLKSLSNYDRAKLADALETEYYEAGQQVISEGDVGENFYLIEYGEADVSKRG
                     VGVVQHLKKGDYFGEVALLNDLPRQATVTATTKLKVATLGKSGFQRLLGPVVEVLRLN
                     DPTRADKR"
     gene            complement(<508875..>511289)
                     /locus_tag="AGOS_ADL098C"
                     /old_locus_tag="ADL098C"
                     /db_xref="GeneID:4620140"
     mRNA            complement(<508875..>511289)
                     /locus_tag="AGOS_ADL098C"
                     /old_locus_tag="ADL098C"
                     /product="ADL098Cp"
                     /transcript_id="NM_209351.1"
                     /db_xref="GeneID:4620140"
     CDS             complement(508875..511289)
                     /locus_tag="AGOS_ADL098C"
                     /old_locus_tag="ADL098C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR038W (IRC5)"
                     /codon_start=1
                     /product="ADL098Cp"
                     /protein_id="NP_983998.1"
                     /db_xref="GeneID:4620140"
                     /translation="MTRLRTRAAKSGVRVDYREQDQNFLYEVEASSSDEVDIIKDATA
                     TWLEDEKVELDITLDSDAEGDAELDAELDMNRRRAEKSAAAASEDAQDTEKDLDAYAV
                     QERVDRLQEFVRQSKVYSGIIADTLLHRAQERQSEQASSAAAPGPARKKPKTVVEFFK
                     RSKQQPADEKQPEPSIQQPTLVRNCTLKPYQVEGVNWLITLYENGLNGILADEMGLGK
                     TIQSIALLAFIYEMDTRGPFLVTAPLSVVDNWITEFEKFAPSIPVLKYYSADGPGKRH
                     AILKEFFRKNSGEGVVVTSYEIVMRDMNVILSHQWKFLIVDEGHRLKNINCKLIRELK
                     RINTFNRLLLTGTPLQNNLAELWSLLNFILPDVFADFEIFSKWFDFSDLDLKTSSQRW
                     DKIIGEELEKNLVTNLHTILKPFLLRRLKRVVLADALPPKREYIINCPLTPLQTRFYK
                     MALAGKLKRTVFTQAIKEFFTLNREHIGSVSNKTIREFIDYKTSDEEIQASKVITDME
                     KLYEQHIHKELRNKRLQNLMMQLRQIVDSTFLFYFPYLKAEDLQLPVLLQTSGKLQIL
                     QQLLPRLLAAKHKVLIFSQFVSMLDLIEDWCELNNYSACRIDGSMDNETRREQINSFS
                     EKGSPHSLFLLSTRAGGLGINLTAADSVILFDNDWNPQVDLQAMDRSHRIGQQHPVIV
                     YRLYCDKTVESVILARATNKRKLEQLVIQMGKFSTLKKLALNEHSFLTLGTQTASNNN
                     ARELVQELSKLLLDSESTFSFSSAGPLTDEELEVLTDRSIQAYKITDTEYPHIKLFET
                     SSGFDN"
     gene            <511899..>513623
                     /locus_tag="AGOS_ADL097W"
                     /old_locus_tag="ADL097W"
                     /db_xref="GeneID:4620141"
     mRNA            <511899..>513623
                     /locus_tag="AGOS_ADL097W"
                     /old_locus_tag="ADL097W"
                     /product="ADL097Wp"
                     /transcript_id="NM_209352.2"
                     /db_xref="GeneID:4620141"
     CDS             511899..513623
                     /locus_tag="AGOS_ADL097W"
                     /old_locus_tag="ADL097W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR037C (RSC8)"
                     /codon_start=1
                     /product="ADL097Wp"
                     /protein_id="NP_983999.2"
                     /db_xref="GeneID:4620141"
                     /translation="MSEPMDVQDGNIDNAGDGTLSSGNTGSVNPSVPVLPHLQQQQQQ
                     QEQPKIDYEQEAQKLEDKAARFLAKQAHPVIVPSFASWFQFNEIHELERRALPDFFND
                     SVRFKTAKAYKDVRNFMINTYRLSPYEYLTVTAVRRNIAMDVASIVKIHKFLEEWGLI
                     NYQIDPRSKPSLLGPAFTGHFQVVLDTPQGLKPFVPPEVVELPSDATASAPASGSAAA
                     SAAPATAETNSTDEEPVPGSNTNTFSSAPKVKMEFKQPKPFPVNLSLRKNVYDSVHDF
                     NALRSQQQQSKQIHKTYVCFTCGNDAVGVRYHNLRSGDTSLCSRCFQEGHFGANFHAS
                     DFIKLENMIHGNKSWSDQELLLLLEGIEMYEDNWEKIVDHIGGSKTLEECVEKFLTLP
                     IEDKYINEVTPQSVKRTKGPQVLDTKDAVTATIQALLNGLNDKVLDEDIPESAMQISS
                     KYLDEAHILTHDLVQLTLEKLDLKFKQLDAVEVALKAERDKFSRETEKLRNDRLSLSK
                     QVSDINKDLAQLNISKKLVLPSEQADSGVALVEKESGTNEEFKKLAQQDLESVSKAQP
                     QLYKPWSL"
     gene            <514142..>515320
                     /locus_tag="AGOS_ADL096W"
                     /old_locus_tag="ADL096W"
                     /db_xref="GeneID:4620142"
     mRNA            <514142..>515320
                     /locus_tag="AGOS_ADL096W"
                     /old_locus_tag="ADL096W"
                     /product="ADL096Wp"
                     /transcript_id="NM_209353.1"
                     /db_xref="GeneID:4620142"
     CDS             514142..515320
                     /locus_tag="AGOS_ADL096W"
                     /old_locus_tag="ADL096W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL023C (YKE4)"
                     /codon_start=1
                     /product="ADL096Wp"
                     /protein_id="NP_984000.1"
                     /db_xref="GeneID:4620142"
                     /translation="MRHVFPFSARYNALLATVYLSLIPCALAYLIPGLRASGRNRSSL
                     FLPLMVSFAFGGLMGDVFLCLLPEVFHSHELDGVERIMEMMRRPDERVASGLIRMAHE
                     HTPNMALGMAVFAGFFLFLAVDKTLRIVGGDDASLHSHSHAHAHSHNDVSSHAQHGIG
                     AACTPSNVFLEEAEQTLKKRNKSDILLESESSAEQTSAPGMPASAATGAPVSQSLRTS
                     IYLNLASGFIHNLTDGVAIATAFYTSKSVGVTTTIAVLMHEIPHELGDLALSLSSGMS
                     FSYAMKSQLLTSFGALLGTAAGCLLNEFAHQEPKSFIPEIGLLTNTYSRNTWGLSIPP
                     QDLILPLTAGGFLYIGTVGVVPELLHTTYPDNPSKELMKTMLQVVAIFAGFSLMSVMA
                     "
     gene            <515632..>517119
                     /locus_tag="AGOS_ADL095W"
                     /old_locus_tag="ADL095W"
                     /db_xref="GeneID:4620143"
     mRNA            <515632..>517119
                     /locus_tag="AGOS_ADL095W"
                     /old_locus_tag="ADL095W"
                     /product="ADL095Wp"
                     /transcript_id="NM_209354.2"
                     /db_xref="GeneID:4620143"
     CDS             515632..517119
                     /locus_tag="AGOS_ADL095W"
                     /old_locus_tag="ADL095W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YOL119C (MCH4)"
                     /codon_start=1
                     /product="ADL095Wp"
                     /protein_id="NP_984001.2"
                     /db_xref="GeneID:4620143"
                     /translation="MTGVGDHVVAPDFPMKAMSEQVHEITTEFGSPDQPVYGQAEGAG
                     GTSTGKLDEADKDGFVYPEGGTKAWLVTFGAMLGILPTWGIFFVAGTIENYIAHHQLA
                     HESTSTISWIFSVYNCLVLSSGIISGLYFDVAGAQQPLALGTAIFVCGLIATANCHHV
                     WSFVLAFGVLTGIGSGIVTSPMLGSVCHYFYRRRGLATAVAINGGSVGGAVFPMMLEA
                     MFRRVGFEWTMRAMALIALVCLALAFVLVRADPSKLMVKPRTQKPRAGPLRRVARTVR
                     DCFDYKALANPEYFWCTLATSTAELSAGAVLTYLSSYCAKAGYAEADSFIVITILNSL
                     TILGGILFSVVSDHWLGHFNVMILMNVSMALFSLAIWFPFGTRGRGIMYAFAALYGFF
                     YGSMLNLCPVCCSKISRTDEFGRRYSTMYVFVGLFFFAGIPIAGAIIGPGSLVRYRAF
                     ILFTAVMIAFSAGCFVVSKTYALHRSRDARSSLLAAARHHLFTIY"
     gene            <517460..>518239
                     /locus_tag="AGOS_ADL094W"
                     /old_locus_tag="ADL094W"
                     /db_xref="GeneID:4620144"
     mRNA            <517460..>518239
                     /locus_tag="AGOS_ADL094W"
                     /old_locus_tag="ADL094W"
                     /product="ADL094Wp"
                     /transcript_id="NM_209355.1"
                     /db_xref="GeneID:4620144"
     CDS             517460..518239
                     /locus_tag="AGOS_ADL094W"
                     /old_locus_tag="ADL094W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL024C"
                     /codon_start=1
                     /product="ADL094Wp"
                     /protein_id="NP_984002.1"
                     /db_xref="GeneID:4620144"
                     /translation="MAGLELVIAASQVDFERGDHVTVTGAFDGWQHEKHILQYDEGAR
                     AFRVELPYSGEEELVFKFVLNGSQWLTVGCFEAITDPEGHVNNRILCRDWLRPEEPLR
                     ESVATMDDVTIGTPEAEVQSLQLDASTELASSGSSEFHSGVSCVHSSDSDSDTEAAMR
                     SMLTSASSAGGGTYSGLLAGEDSAQLPAADSGGRPPLSFPGDYIHVASRGECSSSEEV
                     ELSSSVTGDDDMRYSHGSADPRPRLQGLLSVIRVFKTYWKG"
     gene            <518820..>522182
                     /locus_tag="AGOS_ADL093W"
                     /old_locus_tag="ADL093W"
                     /db_xref="GeneID:4620145"
     mRNA            <518820..>522182
                     /locus_tag="AGOS_ADL093W"
                     /old_locus_tag="ADL093W"
                     /product="ADL093Wp"
                     /transcript_id="NM_209356.2"
                     /db_xref="GeneID:4620145"
     CDS             518820..522182
                     /locus_tag="AGOS_ADL093W"
                     /old_locus_tag="ADL093W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL026C (IRR1)"
                     /codon_start=1
                     /product="ADL093Wp"
                     /protein_id="NP_984003.2"
                     /db_xref="GeneID:4620145"
                     /translation="MSEVRRSRRIREKSSREDDHEEGPLEADHSTAVVQADEQTYVEG
                     DEASEEESSGEEDGHSDEDYEEARAKKRRPRSGGGSRPGSGGAKRARTGTGGTRSRMA
                     GVGAGTKKEQDEYLALQEDFEPCRLFRIFSTAEDVSVEDIASDWLEEYNASRTGALKE
                     FINFLLNCCGSLVQVAEHDVLNNDSSNETVDEVQMLFQDQKIHEFHLYISKTQKKRSK
                     YKPLYDNFAEFMTKLIELASDKDMIYIEKTDEGDGEPQTVIETGPLMLDLFTWLSSFS
                     VCKIRCLRYVATLAMYLFQDQLTHLVVEMDTQSLLKLRKQLAMEQKKKRPSVKAVHKL
                     ESTIADIQGTRTVLESNIENIIKLCFVHRFKDVDETIRSESVLHLAKWLENYPEHFFK
                     ATYLKYFGWLLSDTSSVVRLQVLKTLSDLVKFINKQFRNMTDDSSLRQFFERFKHRVL
                     ELALKDIDLQVRLAAVQVLVEINKFRYLEDSEILSITSLIFSEHEVKVSSSAKNAKFL
                     SAVSKFFSHVERAQVPEFMEGKDPKKKIGDVKLGTVAEVGILMRFLIKSLSLYLNEQD
                     PLEQTTERKVHLLFQAAEFLQPYFGHLIKPICQLLTFQGEFGDISELQSTEEDSDAEE
                     QGEYSMELNKLLLPENENTVIQYITVLSGLCHGAVAIKQHNSKAETAETAMGYLLELF
                     GHLNLDSPVIFDQLLKIFQLFRYEDWITYGREGAFQQLFEIVVKKFKDMAIYTDPDDI
                     RRQAFTDILQYTQTLSSKKIEELWKNQLAEIKIALNKYLHEMDLSDPNKADQQLQTLQ
                     LMYLNKLVLFGKYYRVDFDTELLEMLFTKYMNPLALLSSELSDTTLGIVDFKILTQVT
                     TWNLQTWYQIFEDTNTPTPISKPMLELNKFIIDQLSITLITLQREHSGELSRKLAIEH
                     PVCVTLLDTVTAIKLFALNLPDKEAEWRHALTRDYPIYIDCPEAIMEVLLYLEALYAN
                     SIGVNLERGDEEAVDFNDLAPREDKADPIKLEKELCVFALKLRSLFKLGLLNHPHIEE
                     RLGLNREALGSLFQSIVDDSIFSEPEEQRVRKSSPPASSSTAPRTDRPHTQEELEPIE
                     EFSLEETTRRPLPLQEDPIEEEDEDLGEDDNQ"
     gene            <522354..>522767
                     /locus_tag="AGOS_ADL092W"
                     /old_locus_tag="ADL092W"
                     /db_xref="GeneID:4620146"
     mRNA            <522354..>522767
                     /locus_tag="AGOS_ADL092W"
                     /old_locus_tag="ADL092W"
                     /product="ADL092Wp"
                     /transcript_id="NM_209357.1"
                     /db_xref="GeneID:4620146"
     CDS             522354..522767
                     /locus_tag="AGOS_ADL092W"
                     /old_locus_tag="ADL092W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL027C (KRE27)"
                     /codon_start=1
                     /product="ADL092Wp"
                     /protein_id="NP_984004.1"
                     /db_xref="GeneID:4620146"
                     /translation="MSYISKILLAISVLQLVHSGFSSFEFHRLKRHLTLADGIPQGFR
                     LPSDIKAEVVCALVLFTLGIFLSFEKLQHLPLTGSRTPLTQDLYLHEIRMSEATKTDN
                     LIGSETYGDFTFMPSFIDVHARRKEIRTYMQHKNQ"
     gene            complement(<522804..>523160)
                     /locus_tag="AGOS_ADL091C"
                     /old_locus_tag="ADL091C"
                     /db_xref="GeneID:4620147"
     mRNA            complement(<522804..>523160)
                     /locus_tag="AGOS_ADL091C"
                     /old_locus_tag="ADL091C"
                     /product="ADL091Cp"
                     /transcript_id="NM_209358.1"
                     /db_xref="GeneID:4620147"
     CDS             complement(522804..523160)
                     /locus_tag="AGOS_ADL091C"
                     /old_locus_tag="ADL091C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR036W (CDC26)"
                     /codon_start=1
                     /product="ADL091Cp"
                     /protein_id="NP_984005.1"
                     /db_xref="GeneID:4620147"
                     /translation="MLRREPTTIQLTSDDLAELQDNLEEFKLLQQIKSQHMDLVRSST
                     RVGPPPAAAAADEPRPLSCSFQISPLNKQMQQQQQHRRAAGAGGLGEQLATQGIVTNT
                     PVLDERDTSNPFIQRG"
     gene            523483..523555
                     /locus_tag="AGOS_t0066"
                     /db_xref="GeneID:4620148"
     tRNA            523483..523555
                     /locus_tag="AGOS_t0066"
                     /product="tRNA-Lys"
                     /codon_recognized="AAG"
                     /db_xref="GeneID:4620148"
     gene            <523710..>527525
                     /locus_tag="AGOS_ADL090W"
                     /old_locus_tag="ADL090W"
                     /db_xref="GeneID:4620191"
     mRNA            <523710..>527525
                     /locus_tag="AGOS_ADL090W"
                     /old_locus_tag="ADL090W"
                     /product="ADL090Wp"
                     /transcript_id="NM_209359.2"
                     /db_xref="GeneID:4620191"
     CDS             523710..527525
                     /locus_tag="AGOS_ADL090W"
                     /old_locus_tag="ADL090W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL030C (SSM4)"
                     /codon_start=1
                     /product="ADL090Wp"
                     /protein_id="NP_984006.1"
                     /db_xref="GeneID:4620191"
                     /translation="MAADGDDQVPPCCRICRMEATEDNKLYHPCRCKGTIKYVHEPCL
                     FEWMESKRVEISRPGTTARCDICGVELRMRTIYEDRMGWDTLRQVSLRTLKRSYKVAH
                     DLTSAGAILLFFAVWLPVAWGGWCALYSAALDGAPVLQTEYPEFVAAWLRAVGVVPWR
                     RGAGVMWDKLAIGYGMASLSMVGTAALTLAFYTFTDMIVQSESFPKMLLLRIGPKYSN
                     VDLLRDRLRQRFPDLPEDVTKKFAVLADLAIRNDIPEFLQNIGGTDNENWELPLNLNR
                     RYLQALLYGEELADRRNIHVGQDDNGEHGASHDELDDEENEASFNLNQDDTVIDMQTE
                     YAIETPLDPSEHNIERNAALHDFVELLDAHDVDIHDRNQEMVQMPQFNQPENDWNAGD
                     QDEVRGFQLDIKINLFSAPLYSFVITIVFGIFLMATYVLPVVIGRYLLSAYSGLLLVF
                     WNIFSHAVKKVAELFPKYVLLLLLESDIGSYAMDYLLKMEIALSSLFYMKYFGTSSLI
                     YYPKALPLVTFYASLMVLVIIATDYLGRGYSVVNRMRNEKLRKLYTFAFAATCTIKVF
                     ILIYAEIFGFPYLSGLMVKYSVIKALVPLASWQFLSHIPLSRTCTSIIQYALDMMVGL
                     HCMYMFASFIGTVRRHIIRPGVLFFIRSPDAPNMNILQDNLLYSMKIHFSRLTMSLFM
                     YMTIIIGGIGFHTKLLLPFLFKNGLYPLEKSPDIHAVSQSLVVFYAFAFVGRSQALKD
                     LGKNYWTMVFNICCRRLRLSSFILNKDIPMERGYVIYRNYFYKYLASKRARWSNSTLY
                     SSPKTHEEAQQLFRADPSVHAYFVPDGCLMRVPASDLVSRNYVQMLFVPVTKDDKLLV
                     PLDLEGIKRRGSENAGEFSHLAKQSTDFDTYTVVYVPPSFKLRYSLLLLLIWAFTSLL
                     FISVGVGAHVVGQTILWLLTWTMPTRLIAYIDFVTNDQSFKQLNLYAICLGLVVSTLS
                     IQGNVFGHMATFYHNTIGRRLSNETQDNSEHPNAPTRNEQGIDGAGLALDEFTVSAVL
                     HKVKGLFTRLDLAAADSAFSPFYFCMCLTLTCNFIHLANEFRAEMLDPVFYQNYWDKV
                     FKYLRWITPFGTASTEKDNGILPLMLDVIINKYPEFLQRSTMFERFVCSCLYISAYTR
                     RERNTPLFIPLLKRCCGGHIFVIGFTLLFQMLAVELDYQFNASTYGTRAAIYQSWANF
                     MLLHEESGMKFSVFQHIFYLACPLISIFHSLYEISLITLRCCAYISQKMIDELYGKGR
                     TLIDMEDDI"
     gene            complement(<527767..>530691)
                     /locus_tag="AGOS_ADL089C"
                     /old_locus_tag="ADL089C"
                     /db_xref="GeneID:4620149"
     mRNA            complement(<527767..>530691)
                     /locus_tag="AGOS_ADL089C"
                     /old_locus_tag="ADL089C"
                     /product="ADL089Cp"
                     /transcript_id="NM_209360.2"
                     /db_xref="GeneID:4620149"
     CDS             complement(527767..530691)
                     /locus_tag="AGOS_ADL089C"
                     /old_locus_tag="ADL089C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL031W (ULP2)"
                     /codon_start=1
                     /product="ADL089Cp"
                     /protein_id="NP_984007.2"
                     /db_xref="GeneID:4620149"
                     /translation="MSRHRRLGLSPMDTLSGTSRAGKPTRHSGERYQAGRQRSGGVVA
                     MLEGEVPVQKRHKGSTSEGEGNGLLRAAGEGDEGGLLEGYLELVEKEGMRRIEGVQLA
                     VRGAAGTLMCELQSAAGHDLCLLDLQRDARAFYFDMHTTCVGLHLNQKVLLLGERMEA
                     TAQLLIWSTRGDRSDTRLVDIERTLKEAGLPVSDAASKSGIEAALRRQLSSVAEEGTK
                     RLGMLDKPLSSLNNTKTFKRKYGKSGQVISFPHTVECGSSDEERCDSPRSEISPKSFY
                     GSDRSSPSKPDLADHTYSSGLRKSSRLLDINNKKQFVVEDEDDYEKPEVFKPTLHYQF
                     SDDTKYTVTNQDFKCLYNHDWVNDTILDFFLKYYVECTISDSDLSLSDVHIFSSFFYT
                     KLVSNPEQYYANVKKWVASSNLLEKKYIVMPINVNFHWFGCIITNLSKLLRFFREGFH
                     ERWLEQSNSDSNVNEKERLLFPVVTILVYDSLRQTHSREVEPIKVFLIDYVKDKYGFD
                     LPKAQIRMKLCTVPRQPNMSDCGIHVILNTKKFFENPQKAIMLWYQKPSHLLTKEINL
                     YFEKTKRKTARQDLRNVLWGLQNEQVLRDGSLCQSDHELAEADNHSDLEIIEDTEGTK
                     CQPPKENDAISKLSESKVYVTSTPEETRNNALMKRIIDHGEPNAYIKDASGGTSGNPF
                     PEAAVDDTHTGKQQEIKGKPPSVCIIRSSSRDVSPRVRRHLSSSPVGDTLVNETGTKS
                     IFFVSSSCKESDLVPSAQKSEEGYNKVTAATSLLASEEGQHLKTTEDEAGQAGFQDHL
                     TEGETSDKNSPEHSKHAGSDHRPFTHGYLKKRWVLDQSVNVDTGDTVVSRDAEVNLLG
                     ETVHSAANLDLGTYKSEMKRTSMKHKSIKSTSSLSGTITVTDEEEMEPQRNREYVQLQ
                     DEIIIPHTGSQTPKTAQIYVSDSQDVEEAQKNSNVQVLEVHELVPEGRSLGGAPVVQR
                     KK"
     gene            <530971..>532431
                     /locus_tag="AGOS_ADL088W"
                     /old_locus_tag="ADL088W"
                     /db_xref="GeneID:4620150"
     mRNA            <530971..>532431
                     /locus_tag="AGOS_ADL088W"
                     /old_locus_tag="ADL088W"
                     /product="ADL088Wp"
                     /transcript_id="NM_209361.2"
                     /db_xref="GeneID:4620150"
     CDS             530971..532431
                     /locus_tag="AGOS_ADL088W"
                     /old_locus_tag="ADL088W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER051W (JHD1)"
                     /codon_start=1
                     /product="ADL088Wp"
                     /protein_id="NP_984008.2"
                     /db_xref="GeneID:4620150"
                     /translation="MLQQVTSTTVTGADIQLRAKLLLFSMTDDQCVYCKGKMEHRMWV
                     QCEACPQWVHVQCIPEECLSGGEYPSRSSDIAAFECSAHGTARARLALKGKRRRVEAK
                     EEPERAGTRRYRLRKRGPLDYIALNEGQDVRLRHEHPHRAAFQGCFTKWSGLGRTVTS
                     AELQQSFAELREPVLVADPEHSGMQTPAMDEQVLADVLGADYSLDVMDVQSQQNERWT
                     MGQWKEYMHTARGVRDRIRNVISLEVSHVPEFGQRIRRPRAVEDNDLVDLVWPVQPAP
                     EIGAKPKVQKYVLMSAANAYTDFHLDFAGTSVYYSLLRGAKQFLLFPPTPANLGAYKA
                     WCADDNQGLIFLGDRLQDGVSFSLRPGDLFMIPSGFIHAVYTPEDSFVVGGNYLCLRD
                     LSTHIRIVRIEQETQVPKKFTFPKFERVMGLTAEWLLEGLPERLQLITHEHAVALLDY
                     LRDTRLKYKPAHYHTKSTMLASLEKALEGCEPASGP"
     gene            <532618..>533481
                     /locus_tag="AGOS_ADL087W"
                     /old_locus_tag="ADL087W"
                     /db_xref="GeneID:4620151"
     mRNA            <532618..>533481
                     /locus_tag="AGOS_ADL087W"
                     /old_locus_tag="ADL087W"
                     /product="ADL087Wp"
                     /transcript_id="NM_209362.1"
                     /db_xref="GeneID:4620151"
     CDS             532618..533481
                     /locus_tag="AGOS_ADL087W"
                     /old_locus_tag="ADL087W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL043C (CBR1)"
                     /codon_start=1
                     /product="ADL087Wp"
                     /protein_id="NP_984009.1"
                     /db_xref="GeneID:4620151"
                     /translation="MDYKFEALVTALVLAVSFIFIYGKFSGAKQSQPAVKTTLNKDWQ
                     EFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDS
                     DATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTG
                     ISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDK
                     VAEGEQWEGKLGYITEAIMREHLPAPSSSAQLLLCGPPPMVSSAKRIAVSLGFEKAKP
                     ISKKGDQVFAF"
     gene            complement(<533604..>535262)
                     /locus_tag="AGOS_ADL086C"
                     /old_locus_tag="ADL086C"
                     /db_xref="GeneID:4620152"
     mRNA            complement(<533604..>535262)
                     /locus_tag="AGOS_ADL086C"
                     /old_locus_tag="ADL086C"
                     /product="ADL086Cp"
                     /transcript_id="NM_209363.1"
                     /db_xref="GeneID:4620152"
     CDS             complement(533604..535262)
                     /locus_tag="AGOS_ADL086C"
                     /old_locus_tag="ADL086C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER052C (HOM3)"
                     /codon_start=1
                     /product="ADL086Cp"
                     /protein_id="NP_984010.1"
                     /db_xref="GeneID:4620152"
                     /translation="MNKQNRRGLQLQLFPYSRSIAQRDTMRSIADQKTNWVVQKFGGT
                     SIGKFPTNIVNDIVKVFSHDYGKNVAVVCSARSSYTKSEGTTSRLLMACDAAASYDET
                     FQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQASQILGEVSNRTM
                     DLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDNSFYALLVVAF
                     KERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCAALVAVALNADELQ
                     VWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRAKIPIRI
                     KNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDIVVLN
                     IHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAVEE
                     LKKLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISC
                     VIDEKNSVRALQSIHAKLLEPLAPTSSGAVLNGRLEQLKSLDLS"
     gene            complement(<535719..>536540)
                     /locus_tag="AGOS_ADL085C"
                     /old_locus_tag="ADL085C"
                     /db_xref="GeneID:4620153"
     mRNA            complement(<535719..>536540)
                     /locus_tag="AGOS_ADL085C"
                     /old_locus_tag="ADL085C"
                     /product="ADL085Cp"
                     /transcript_id="NM_209364.1"
                     /db_xref="GeneID:4620153"
     CDS             complement(535719..536540)
                     /locus_tag="AGOS_ADL085C"
                     /old_locus_tag="ADL085C"
                     /note="NOHBY406; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F27577g"
                     /codon_start=1
                     /product="ADL085Cp"
                     /protein_id="NP_984011.1"
                     /db_xref="GeneID:4620153"
                     /translation="MQRYSRDLQTSLPAWVTCWVRVSWIVTWSRLGIIAEETNQLALL
                     LSLPLGKARQECSSGHTSKRTDAIGIVNGSLLNSKAGGYNRGMGLLRKISIEEVSQHT
                     SRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSMESLIYDMAP
                     GSYLGEVDGGENVNSCSSVVSWRSLRWLRSWGKGASDDATVRSLGSQSEKLESDLQNW
                     LQKTLLLLVICVCCVLLLVIRYHNRTRRAGRIHSTQAPLPPDTSGMPSWWDLVPT"
     gene            <536666..>537367
                     /locus_tag="AGOS_ADL084W"
                     /old_locus_tag="ADL084W"
                     /db_xref="GeneID:4620154"
     mRNA            <536666..>537367
                     /locus_tag="AGOS_ADL084W"
                     /old_locus_tag="ADL084W"
                     /product="ADL084Wp"
                     /transcript_id="NM_209365.1"
                     /db_xref="GeneID:4620154"
     CDS             536666..537367
                     /locus_tag="AGOS_ADL084W"
                     /old_locus_tag="ADL084W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL044C (AGE2)"
                     /codon_start=1
                     /product="ADL084Wp"
                     /protein_id="NP_984012.1"
                     /db_xref="GeneID:4620154"
                     /translation="MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCI
                     RCAGFHRSLGTHVSKVKSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQ
                     SKMGQFIKTKYEVRKWYLEEGACEPALPEAAPAAASPLPVSVPMSPAGVGREASASPA
                     LAVSPAPASPPVYSANARPDLKKSILSLYAKPRQQSPGVASSASSLNSAAASAGVSYS
                     AASLEDNELFKNVWT"
     gene            complement(<537844..>538908)
                     /locus_tag="AGOS_ADL083C"
                     /old_locus_tag="ADL083C"
                     /db_xref="GeneID:4620155"
     mRNA            complement(<537844..>538908)
                     /locus_tag="AGOS_ADL083C"
                     /old_locus_tag="ADL083C"
                     /product="ADL083Cp"
                     /transcript_id="NM_209366.2"
                     /db_xref="GeneID:4620155"
     CDS             complement(537844..538908)
                     /locus_tag="AGOS_ADL083C"
                     /old_locus_tag="ADL083C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL045W (PIG2) and YER054C (GIP2)"
                     /codon_start=1
                     /product="ADL083Cp"
                     /protein_id="NP_984013.2"
                     /db_xref="GeneID:4620155"
                     /translation="MNGGLGLQKSNIYIKPRSSQEGKYSSLALLRKPQRISSRTEREE
                     QENILKRNTDYNRKRGGGTWAADENIDPLDGDESPRRAGSPVVLTDYFSQSHAGYDNV
                     GHQRSKSLPGTPTSALKRPGGVRRSKSVHFDNRDVVSVKYFNSDESTLLVAHAQSFED
                     QLRLRQDARELAPNGLTLVAPAGGMAGGAKSPRKPLRKSKCFRQYQLRPQLRTLRNVN
                     FPILANKDPAVLTLNIFLNIAYNRKVFLQDLSLDSMLVMTGRVLVKNIHYDKSVIVRY
                     TWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAIDVPAPVSGTPRLEFCIRYQVRDN
                     SDFQTHWDNNHGNNYVVEYD"
     gene            complement(<539371..>541077)
                     /locus_tag="AGOS_ADL082C"
                     /old_locus_tag="ADL082C"
                     /db_xref="GeneID:4620156"
     mRNA            complement(<539371..>541077)
                     /locus_tag="AGOS_ADL082C"
                     /old_locus_tag="ADL082C"
                     /product="ADL082Cp"
                     /transcript_id="NM_209367.2"
                     /db_xref="GeneID:4620156"
     CDS             complement(539371..541077)
                     /locus_tag="AGOS_ADL082C"
                     /old_locus_tag="ADL082C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL046W (MET30)"
                     /codon_start=1
                     /product="ADL082Cp"
                     /protein_id="NP_984014.2"
                     /db_xref="GeneID:4620156"
                     /translation="MSNSTAGHLQQDGGHMSNKREAAEVDAEMQPATKQLRAPQYNFV
                     RYCYRHNPDIQAAPTQVRCVRQEQQRREEWQARVGELSSEGERQVVQEAVRLFDSSND
                     KLRKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLCSA
                     AAVCRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASKGE
                     GEDAPQSRMRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVLSLQLTNKLLLTGSY
                     DSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY
                     RGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTC
                     FSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEDPKDAVVPPDATAP
                     AHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADN
                     FRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEFVSGDELGCVKLYNFD
                     TT"
     gene            complement(<541363..>542256)
                     /locus_tag="AGOS_ADL081C"
                     /old_locus_tag="ADL081C"
                     /db_xref="GeneID:4620157"
     mRNA            complement(<541363..>542256)
                     /locus_tag="AGOS_ADL081C"
                     /old_locus_tag="ADL081C"
                     /product="ADL081Cp"
                     /transcript_id="NM_209368.1"
                     /db_xref="GeneID:4620157"
     CDS             complement(541363..542256)
                     /locus_tag="AGOS_ADL081C"
                     /old_locus_tag="ADL081C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER055C (HIS1)"
                     /codon_start=1
                     /product="ADL081Cp"
                     /protein_id="NP_984015.1"
                     /db_xref="GeneID:4620157"
                     /translation="MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDI
                     ALSTSTPVALIFLPAADIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQ
                     VQVPAGGPYSQPEQLIGKTIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAAC
                     ALGVADAIVDLVESGETMRAAGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEG
                     VLAAQHYVYCTYNAHADALPALLRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRIL
                     DDLKASGAEDIMVFEISNCRV"
     gene            <542543..>545134
                     /locus_tag="AGOS_ADL080W"
                     /old_locus_tag="ADL080W"
                     /db_xref="GeneID:4620158"
     mRNA            <542543..>545134
                     /locus_tag="AGOS_ADL080W"
                     /old_locus_tag="ADL080W"
                     /product="ADL080Wp"
                     /transcript_id="NM_209369.2"
                     /db_xref="GeneID:4620158"
     CDS             542543..545134
                     /locus_tag="AGOS_ADL080W"
                     /old_locus_tag="ADL080W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL047C (SYG1)"
                     /codon_start=1
                     /product="ADL080Wp"
                     /protein_id="NP_984016.2"
                     /db_xref="GeneID:4620158"
                     /translation="MKFAERLRESSIPEWRDKYLDYKLGKKKLKSYKEKLKASRALSV
                     RPTQRSRARDEPYTMQQEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQ
                     IEMYCLQKDENGAGLSYGATYEGQEETGLAAQLSAGRSPSPSRAGRLDRAQEGVKRWL
                     QERDLMPSLPARWSREQGPARVKKYSANTETFMHICPSKRQAQLQLGHALLEYYLTLQ
                     LLKNYRDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFEHMGQNLRLYANSFK
                     ASNSLCQPAARMNSSPEKDPVTYWEDQVFQWYTEALTESTQARKHHVQKLRSLSLQYS
                     MNEQIVHRNNTCVVQMFTAGSLLGVAVVLVIIALMLGIRADISSYRHLILFPVWGGWY
                     LVLLMSLLFCLDCYIWFRGKVNYQFIMFGEIHSRKGNTVFNNDFSTTKISGHLYMVSL
                     AFITVGAVSLCSMVRATLAPWLWLCALLFALGFSMSSFILPYWRELRKTRQWLIVTAI
                     RLVFSGAYPVQFGDFFLGDIVCSLTYSMADVASVFCVFSGKKYNMCGSSNLISMGVLS
                     CIPSYWRLMQCLRRYLDSNDRFPHLLNGAKYAVAILYNACLCAYRINKLHHSYRSWFI
                     AAGIINSVFSSIWDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYSKRRKAMYYV
                     SMISDVAIRFQWIVYAIAPRVIQQSAVTSFILGILEVVRRFIWIIFRVENEHVANVHL
                     FKITGETPLPYPISPSRALSTSTVHDKHALPSTKNSHEDLVLYASVRHPEVLHMRHRA
                     PSILSNIPWAHAKDFQRPSTSSLPRTSSGIDFDDDDEDEDDEDDFDDEQDRVIDGQQK
                     KPNSDLN"
     gene            complement(<545273..>548773)
                     /locus_tag="AGOS_ADL079C"
                     /old_locus_tag="ADL079C"
                     /db_xref="GeneID:4620159"
     mRNA            complement(<545273..>548773)
                     /locus_tag="AGOS_ADL079C"
                     /old_locus_tag="ADL079C"
                     /product="ADL079Cp"
                     /transcript_id="NM_209370.1"
                     /db_xref="GeneID:4620159"
     CDS             complement(545273..548773)
                     /locus_tag="AGOS_ADL079C"
                     /old_locus_tag="ADL079C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL048W (NEO1)"
                     /codon_start=1
                     /product="ADL079Cp"
                     /protein_id="NP_984017.1"
                     /db_xref="GeneID:4620159"
                     /translation="MSFTPPPETSSAYNYHPGKPFGSDRGQQGVGSSRRARQERRGSL
                     DSFELEFDDSLDAALESLQIKRSASHERHSGIRGAEDFELKSMGRVDDGGHSPSGVLT
                     NQDTQPLISQDSWDYGQVKRLRSGWLGPQSSWQRLKSWVLPGAKAGAPLLGVTATYSS
                     THSIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNL
                     YFLLVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEV
                     LNNSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLR
                     VAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLA
                     SSGTCVACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIG
                     GLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIP
                     EDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAA
                     GVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGL
                     SLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGAD
                     TVMSKIVQSNDWLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRD
                     EAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARC
                     VCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAE
                     FFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGI
                     VGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVY
                     SISSNLKPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTEGRS
                     LSYKTFFVWVILSLFQGAVIQGFSQLFIGVGSEVFKKMVALSFTALVINELIMVALEI
                     YTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSMLALPFFIQLTIILTVSIFPVWAAK
                     TIHRRLKPPSHAKVQQFSAV"
     gene            complement(<549116..>549664)
                     /locus_tag="AGOS_ADL078C"
                     /old_locus_tag="ADL078C"
                     /db_xref="GeneID:4620160"
     mRNA            complement(join(<549116..549459,549628..>549664))
                     /locus_tag="AGOS_ADL078C"
                     /old_locus_tag="ADL078C"
                     /product="60S ribosomal protein L34"
                     /transcript_id="NM_209371.2"
                     /db_xref="GeneID:4620160"
     CDS             complement(join(549116..549459,549628..549664))
                     /locus_tag="AGOS_ADL078C"
                     /old_locus_tag="ADL078C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL052C (RPL34B) and YER056C-A (RPL34A); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L34"
                     /protein_id="NP_984018.2"
                     /db_xref="GeneID:4620160"
                     /translation="MAQRVTFRRRNPYNTKSNKIKVVKTPGGVLRAQHVKKLATRPKC
                     GDCGIALAGISSLRPRQYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLIEEQKIVK
                     KVVKEQAEAAKKAEKKQSKKGKKN"
     gene            complement(<549945..>550373)
                     /locus_tag="AGOS_ADL077C"
                     /old_locus_tag="ADL077C"
                     /db_xref="GeneID:4620161"
     mRNA            complement(<549945..>550373)
                     /locus_tag="AGOS_ADL077C"
                     /old_locus_tag="ADL077C"
                     /product="ADL077Cp"
                     /transcript_id="NM_209372.1"
                     /db_xref="GeneID:4620161"
     CDS             complement(549945..550373)
                     /locus_tag="AGOS_ADL077C"
                     /old_locus_tag="ADL077C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL051C (MMF1) and YER057C (HMF1)"
                     /codon_start=1
                     /product="ADL077Cp"
                     /protein_id="NP_984019.1"
                     /db_xref="GeneID:4620161"
                     /translation="MRRLTQTATVLARSMSSLTPVRTTAAPPPAASYSQAMRANGMVF
                     VSGQIPYTPDNKPVEGSVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAE
                     FNSVYAKYFGEHKPARSCVAVRALPLNVDLEMEVIALERD"
     gene            <550477..>550818
                     /locus_tag="AGOS_ADL076W"
                     /old_locus_tag="ADL076W"
                     /db_xref="GeneID:4620162"
     mRNA            <550477..>550818
                     /locus_tag="AGOS_ADL076W"
                     /old_locus_tag="ADL076W"
                     /product="ADL076Wp"
                     /transcript_id="NM_209373.1"
                     /db_xref="GeneID:4620162"
     CDS             550477..550818
                     /locus_tag="AGOS_ADL076W"
                     /old_locus_tag="ADL076W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER058W (PET117)"
                     /codon_start=1
                     /product="ADL076Wp"
                     /protein_id="NP_984020.1"
                     /db_xref="GeneID:4620162"
                     /translation="MLSQTVRAKHTTPMSRASKITLALCTAASAATVVTVHLVQEMER
                     DALKQGPIKDALRTAEKRAERDADPEAARKKMLNASEHELQLELRRKYAAMQPLSGEV
                     VTQDGDVVERR"
     gene            <551364..>551987
                     /locus_tag="AGOS_ADL075W"
                     /old_locus_tag="ADL075W"
                     /db_xref="GeneID:4620163"
     mRNA            <551364..>551987
                     /locus_tag="AGOS_ADL075W"
                     /old_locus_tag="ADL075W"
                     /product="ADL075Wp"
                     /transcript_id="NM_209374.1"
                     /db_xref="GeneID:4620163"
     CDS             551364..551987
                     /locus_tag="AGOS_ADL075W"
                     /old_locus_tag="ADL075W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL050W (PCL7) and YER059W (PCL6)"
                     /codon_start=1
                     /product="ADL075Wp"
                     /protein_id="NP_984021.1"
                     /db_xref="GeneID:4620163"
                     /translation="MHCSQPEGVDQRIGHMDIAQFPTDKLLEMLTGLLYKIIKSNDRL
                     KPFDQEKHDINNKYVAHVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDR
                     IAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNR
                     LELQFSILCDFELIVSIQELQRYADLLYKFWHREHLAKASTNAAVPH"
     gene            <552401..>553975
                     /locus_tag="AGOS_ADL074W"
                     /old_locus_tag="ADL074W"
                     /db_xref="GeneID:4620164"
     mRNA            <552401..>553975
                     /locus_tag="AGOS_ADL074W"
                     /old_locus_tag="ADL074W"
                     /product="ADL074Wp"
                     /transcript_id="NM_209375.1"
                     /db_xref="GeneID:4620164"
     CDS             552401..553975
                     /locus_tag="AGOS_ADL074W"
                     /old_locus_tag="ADL074W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER056C (FCY2), YER060W (FCY21) and YER060W-A (FCY22);
                     Tandem gene duplication in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ADL074Wp"
                     /protein_id="NP_984022.1"
                     /db_xref="GeneID:4620164"
                     /translation="MGSSAEQYGTRSSMSLTKDDGSYGDLEKKKGFLSDAEEPVTPQV
                     DETEYTTLSWVNRWAARLNAETKGVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVG
                     VLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTARI
                     FCLINVIACVGWSSVNTIASTTLLHMINPTGARCPPWAASLIIVLSTVFITFFGYRVI
                     HAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLGGKATAGSFLSYGSVVFGFASGWT
                     TYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGAAAGRCVHTNPTWGEYYKKH
                     SVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSIALSTQALWSRFARVPRV
                     FWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVICVTEHFVFRKGFRGYD
                     VSHWDRPDLLPAGYAGCAALCVGAVGVAMGMSHEYYTGPIAKLAGGDIGFLLAAGFSF
                     IVYICCRPLELKYTGR"
     gene            <554128..>554961
                     /locus_tag="AGOS_ADL073W"
                     /old_locus_tag="ADL073W"
                     /db_xref="GeneID:4620165"
     mRNA            <554128..>554961
                     /locus_tag="AGOS_ADL073W"
                     /old_locus_tag="ADL073W"
                     /product="ADL073Wp"
                     /transcript_id="NM_209376.1"
                     /db_xref="GeneID:4620165"
     CDS             554128..554961
                     /locus_tag="AGOS_ADL073W"
                     /old_locus_tag="ADL073W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL049W (DFG10)"
                     /codon_start=1
                     /product="ADL073Wp"
                     /protein_id="NP_984023.1"
                     /db_xref="GeneID:4620165"
                     /translation="MQRNPRYNSQHMNQMLPPIAAGGAEVYVWHLIHFSYGIGLFSLW
                     LAKYRLPKLLQYGKTRQKKLVGVIEPWYTSIAVPRRYFSHFYVLSFVLATANLYWFPE
                     DVITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSVLNLSVYLQLNSRQR
                     TRSPSTVNKVFGAVGAVGFLLASWDQARNHIHLAHMIKYTLPRRGLFKIVACAHYFDE
                     IVIYASLAAMEATTRWSLTVAVIWVCANLGVSAVETKRYYDAKFKGQAVAPYALIPYI
                     M"
     gene            complement(<555025..>556326)
                     /locus_tag="AGOS_ADL072C"
                     /old_locus_tag="ADL072C"
                     /db_xref="GeneID:4620166"
     mRNA            complement(<555025..>556326)
                     /locus_tag="AGOS_ADL072C"
                     /old_locus_tag="ADL072C"
                     /product="ADL072Cp"
                     /transcript_id="NM_209377.1"
                     /db_xref="GeneID:4620166"
     CDS             complement(555025..556326)
                     /locus_tag="AGOS_ADL072C"
                     /old_locus_tag="ADL072C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER061C (CEM1)"
                     /codon_start=1
                     /product="ADL072Cp"
                     /protein_id="NP_984024.1"
                     /db_xref="GeneID:4620166"
                     /translation="MHPRVVVTGIGCYTPLGPSLAQSWKELLRGTSGLVRLQDLAEYE
                     GDYKPLSRLISGDLRVGKVGFEARDQELLSSQEQRRTSRAAQLAMVTAEEALRHAGLL
                     SGSHLVASVDRNRAGCIIGAGLPSMEDISQATASLSSARRPSVSPFFIPKMLNNMAAG
                     NVAIKFQLRGASNCPSTACASGNNAIGDAYNFIRLGYSDVIVAGASELSVHPLALAGF
                     VKAKSISASGISRPFDARRDGFVLGEGCGLLVLESLEHARHRGAEIIAEVVGYGVCSD
                     AHHITSPSEGGDGARRAMHMALQDAGIWDTRDQVGYVNAHATSTPLGDRAEARAIQAV
                     FGATGTGSTLVSSNKGHMGHLLGAAGAVEAVFTVQSLREGIVPHTLNLQTVGEGLADK
                     KDGFGGITFVQDNPVPAPLTYAMNNSFGFGGINSSLLFKKW"
     gene            complement(<556556..>557317)
                     /locus_tag="AGOS_ADL071C"
                     /old_locus_tag="ADL071C"
                     /db_xref="GeneID:4620167"
     mRNA            complement(<556556..>557317)
                     /locus_tag="AGOS_ADL071C"
                     /old_locus_tag="ADL071C"
                     /product="ADL071Cp"
                     /transcript_id="NM_209378.1"
                     /db_xref="GeneID:4620167"
     CDS             complement(556556..557317)
                     /locus_tag="AGOS_ADL071C"
                     /old_locus_tag="ADL071C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL053W (RHR2) and YER062C (HOR2)"
                     /codon_start=1
                     /product="ADL071Cp"
                     /protein_id="NP_984025.1"
                     /db_xref="GeneID:4620167"
                     /translation="MTSTADHKQPISLKVNGALFDVDGTIIISQPALAAFWREFGKDK
                     PYFDAEHVISATHGWRTYDAIATFAPDYLSEEYVTRLEGEIPDKYGKFSVEVPGAVTL
                     CNALNELPKEKWAVGTSGTFEMAHKWFDVLGIKRPSTFITANDVKQGKPHPEPYIKGR
                     NALGFPINEQNPKGSKVIVFEDAPAGIAAGKAAGCKIVGVATTFDVEYLKERGCDIIV
                     KDHRSIRVGGYNPETDEVEFVFDDYLYAKDDLLDW"
     gene            complement(<557841..>558482)
                     /locus_tag="AGOS_ADL070C"
                     /old_locus_tag="ADL070C"
                     /db_xref="GeneID:4620168"
     mRNA            complement(<557841..>558482)
                     /locus_tag="AGOS_ADL070C"
                     /old_locus_tag="ADL070C"
                     /product="ADL070Cp"
                     /transcript_id="NM_209379.1"
                     /db_xref="GeneID:4620168"
     CDS             complement(557841..558482)
                     /locus_tag="AGOS_ADL070C"
                     /old_locus_tag="ADL070C"
                     /note="NOHBY405; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ADL070Cp"
                     /protein_id="NP_984026.1"
                     /db_xref="GeneID:4620168"
                     /translation="MRLQEMAVLLTLWRQSILKATTSFLLAALQSTDHGRQRHRGGPQ
                     LPQKSWLTLRRIGSFLNFDHVPLPVLPYTVTRVRVPVQGLSRLAGACSYGLRHVTRRH
                     FCLVPRLAPPQTWAQFLAPRFASRPGLQFPDPARDSQAPSAPAILLVGICWYHFAGPG
                     PAYPSVGSACAPCLETSSIPAAHTGRSYRSPSFSSRNTTNHVMLQHVTVLNVP"
     gene            <558719..>559336
                     /locus_tag="AGOS_ADL069W"
                     /old_locus_tag="ADL069W"
                     /db_xref="GeneID:4620169"
     mRNA            <558719..>559336
                     /locus_tag="AGOS_ADL069W"
                     /old_locus_tag="ADL069W"
                     /product="ADL069Wp"
                     /transcript_id="NM_209380.1"
                     /db_xref="GeneID:4620169"
     CDS             558719..559336
                     /locus_tag="AGOS_ADL069W"
                     /old_locus_tag="ADL069W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER063W (THO1)"
                     /codon_start=1
                     /product="ADL069Wp"
                     /protein_id="NP_984027.1"
                     /db_xref="GeneID:4620169"
                     /translation="MDIDHVASAARKAGATDATGWPWLANRQSHDEMTDYASMTVAQL
                     KDVLKERELPTQGLKAALVERLQQADATAAEPTDATTRPAAEEHTPEAAEPAATPAEA
                     EAPVAEQRAAAEPRTLSPEEMKQAAVAHLSKKLHRARKFGEDDAAVGALQKQLARLEK
                     FGLDLTTQLAQELGFGRGPAAAVGKHAFHRRRGYHQGKKFKAQRR"
     gene            <559716..>560915
                     /locus_tag="AGOS_ADL068W"
                     /old_locus_tag="ADL068W"
                     /db_xref="GeneID:4620170"
     mRNA            <559716..>560915
                     /locus_tag="AGOS_ADL068W"
                     /old_locus_tag="ADL068W"
                     /product="ADL068Wp"
                     /transcript_id="NM_209381.1"
                     /db_xref="GeneID:4620170"
     CDS             559716..560915
                     /locus_tag="AGOS_ADL068W"
                     /old_locus_tag="ADL068W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL055C"
                     /codon_start=1
                     /product="ADL068Wp"
                     /protein_id="NP_984028.1"
                     /db_xref="GeneID:4620170"
                     /translation="MEWNKLGMAYPSHQMVQEVVASHPIRIRIDNLPPTKGWRQIKGF
                     LSQFVPYEQVLNVKVLPLIPSMTPPFIPLQSCIVLLRQDTDWPGLLMHLNGIQWDYYT
                     MMAWVLPNFIPQDGAPLLSVSPPDSGGSLHKNNGHHYDQAERQKHAARLPLHAFTGPA
                     MPALPGGEQSVQHPSKRLTQIFNEGAFRRQMSQRNMHQLQISNFPPCLHWDEVVKTTQ
                     IKLDSGGDIQRGDGGAAIPSHHVIQPHVLQDEKNEIVPDLTIMTAHPEKYGKLKWTIL
                     KDFIKLKCPKLLEIDHKSQGAALSNTREFYVGVYENSESHVEIILLPSDKPDRIIEGP
                     VSEEEAQAAGGPDLQRFKVRATLFQAVLGFHSKELCDLCLDAINGEEYMLGYKLQVQR
                     LAKLSST"
     gene            complement(<561155..>563074)
                     /locus_tag="AGOS_ADL067C"
                     /old_locus_tag="ADL067C"
                     /db_xref="GeneID:4620171"
     mRNA            complement(<561155..>563074)
                     /locus_tag="AGOS_ADL067C"
                     /old_locus_tag="ADL067C"
                     /product="ADL067Cp"
                     /transcript_id="NM_209382.2"
                     /db_xref="GeneID:4620171"
     CDS             complement(561155..563074)
                     /locus_tag="AGOS_ADL067C"
                     /old_locus_tag="ADL067C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER064C (VHR2) and YIL056W (VHR1)"
                     /codon_start=1
                     /product="ADL067Cp"
                     /protein_id="NP_984029.2"
                     /db_xref="GeneID:4620171"
                     /translation="MMNKVHKPTGNGTTHKIREQLNFKDNKKWKQFSSRRLELIDKFG
                     LSERKASEQDDNIRQIATILRTEFGYPVSSSGEFEKLVTAAVQSVRRNRKRCTKTRNA
                     NTMRKGGATSSGSATSTSDAEEGISKVSSPVMHGSTASLSSSAGCIPPIQSAPSLPVL
                     QPRPVRVVATRSLKLDHYGNGNPIYGSNVSAASAINCNEILRSVIMDLVYNHIPLAEQ
                     CRHDTSPSLTDLAIFSQHRNLLSLALASSKHESKEAEDREQSDQHNRAASNENIPFFL
                     REKILLHIQRSKTCMEIATEELRLENCVNLCMLGDTCIKAAVSFVMERFFSSLPVTST
                     EYITQKVTSLEQSALICMKFFAPGTKSNMQILSVENKVTLFQLIIGAIVKDFGFDPCL
                     YPLGEVFHDLILRQYPLVCSSSPSQKTAVLTTLSMKPQLANRDVNRKVLLKFQDKEQR
                     FTFPLLSNGPPTMNDVLENLRQLFQIPNTYSNLALFHNNTIIKDDMELASILNQFSAG
                     ETIIEIKEPSSASGQSVSAVESSFNGLTILSNVSTTAAPSISMPSSKPSSVIGRSSSP
                     LISNYTHSNTASVAALDSIISRISSPVAVKAQSANGEVIAPPTIRTKSPQPSGAQTKG
                     SFEKGLPQPVFQPLL"
     gene            complement(<564208..>565890)
                     /locus_tag="AGOS_ADL066C"
                     /old_locus_tag="ADL066C"
                     /db_xref="GeneID:4620172"
     mRNA            complement(<564208..>565890)
                     /locus_tag="AGOS_ADL066C"
                     /old_locus_tag="ADL066C"
                     /product="ADL066Cp"
                     /transcript_id="NM_209383.1"
                     /db_xref="GeneID:4620172"
     CDS             complement(564208..565890)
                     /locus_tag="AGOS_ADL066C"
                     /old_locus_tag="ADL066C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER065C (ICL1)"
                     /codon_start=1
                     /product="ADL066Cp"
                     /protein_id="NP_984030.1"
                     /db_xref="GeneID:4620172"
                     /translation="MSPSVRDARNDLASLQQQAAAEAEDIRRWWSQPRWAGTKRVYTA
                     EDIVKRRGTFPVVEYPSSVMADKLVETLARHSRNGTVSQTFGVLDPVQMTQMVKYLDT
                     IYVSGWQCSATASTSNEPGPDLADYPMDTVPNKVEHLFMAQLFHDRKQREARLSCTTQ
                     RELDQLGPEIDYLRPIVADADTGHGGLTAVFKLTKMFIERGAAGIHMEDQSSSNKKCG
                     HMAGRCVIPVQEHISRLVTVRMCADVMHSNLVLVARTDSEAATLLSSNIDARDHYYIV
                     GASNPEVTVPLIEVLDAAQQAGASGDRLAQLEEDWCKKAKLRLFHEAFADQVNASPSI
                     KDKAGVIAKFNSQIGPQTGASIREMRKLGRELLGQDVYFDWDLPRAREGLYRYKGGTQ
                     CAIMRARAFAPYADLVWFESNFPDFQQAKEFAQGVREKFPNKWMAYNLSPSFNWPKAM
                     PPKEQENYIQRLGEIGYVWQFITLAGLHTNALAIDNFSREFSRFGMRAYAQGIQQREM
                     DEGVDVLKHQKWAGAEYVDSILKLAQGGVSSTASMGKGVTEEQFGSSNGAKL"
     gene            complement(566287..566368)
                     /locus_tag="AGOS_t0067"
                     /db_xref="GeneID:4620173"
     tRNA            complement(566287..566368)
                     /locus_tag="AGOS_t0067"
                     /product="tRNA-Ser"
                     /codon_recognized="UCA"
                     /db_xref="GeneID:4620173"
     gene            <567148..>567657
                     /locus_tag="AGOS_ADL065W"
                     /old_locus_tag="ADL065W"
                     /db_xref="GeneID:4620192"
     mRNA            <567148..>567657
                     /locus_tag="AGOS_ADL065W"
                     /old_locus_tag="ADL065W"
                     /product="ADL065Wp"
                     /transcript_id="NM_209384.2"
                     /db_xref="GeneID:4620192"
     CDS             567148..567657
                     /locus_tag="AGOS_ADL065W"
                     /old_locus_tag="ADL065W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL057C (RGI2) and YER067W (RGI1)"
                     /codon_start=1
                     /product="ADL065Wp"
                     /protein_id="NP_984031.2"
                     /db_xref="GeneID:4620192"
                     /translation="MTKKDKKQKVKVKTVETKEGEKIRVFEDLDSFETYLRGETEDEE
                     FDHVHCQVRYYPPFVLHESHQDPEKIKESANSHNKKFVRHLHQHVEKHLLKDIKDSLG
                     VPELKFKDKSKEENFNHVVWRYHAPTAVRDREFLVHVTVECHNDTAMVDVDYLTEPMQ
                     PAVQSEQVA"
     gene            <568110..>570050
                     /locus_tag="AGOS_ADL064W"
                     /old_locus_tag="ADL064W"
                     /db_xref="GeneID:4620174"
     mRNA            <568110..>570050
                     /locus_tag="AGOS_ADL064W"
                     /old_locus_tag="ADL064W"
                     /product="ADL064Wp"
                     /transcript_id="NM_209385.1"
                     /db_xref="GeneID:4620174"
     CDS             568110..570050
                     /locus_tag="AGOS_ADL064W"
                     /old_locus_tag="ADL064W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER068W (MOT2)"
                     /codon_start=1
                     /product="ADL064Wp"
                     /protein_id="NP_984032.1"
                     /db_xref="GeneID:4620174"
                     /translation="MENPHVHDNLQHIQAVLSNYDTSFLSDDEEDYCPLCMEPLDITD
                     KNFKPCPCGYQICQFCYNNIRQNPELNGRCPACRRKYDDESVEYIVLSPEELKLERAK
                     QARKERERKQREKERKENEYANRKHLAGMRVIQKNLVYVIGLNPPVPYEEVGALLRSD
                     KYFGQYGKINKIVVNRKTGHNDHQTGYGIYVTFSRKEDAARCIQAVDGTFMDGRQVKA
                     AYGTTKYCSSYLRGQSCPNPNCMFLHEPGEEADSFNKRELSGKQQPHQQPGQQLHQHG
                     SQHLPSQLQSSVHQPAQVHVHQLNAQPHIHHPSPFKGPHNSGAAASNNSNGASAVPSP
                     AQAKAQLHMDDSSSSSTPAAHTPILTPAPLPTGANPWGITQSSTPVSALSKVSSSTAF
                     PTLGEAINTPAPTFNGVQAAASSYNQNGSSKNKKNNDTKNYEDPYDPLCSAVKFIDDT
                     IAFLSDYKCVSYNLRSGLIDDATYASYPSLFSFSNIDVSAESEGILGRKLIDMLAVKP
                     WDQVAATFPAVNEMSPQLQRQVLRQQQMATTPKQQQLVQMQRNNPDPNSQVSPTSQLQ
                     QQQLQHSHSQSQQEPPQEPPFSQQQQHRTVVHTPPPGMFVQNGQMSQTQSVPHMVAQT
                     RSNNSTDLLNQLINGKKVTAGT"
     gene            <570275..>571294
                     /locus_tag="AGOS_ADL063W"
                     /old_locus_tag="ADL063W"
                     /db_xref="GeneID:4620175"
     mRNA            join(<570275..570277,570335..>571294)
                     /locus_tag="AGOS_ADL063W"
                     /old_locus_tag="ADL063W"
                     /product="ADL063Wp"
                     /transcript_id="NM_209386.1"
                     /db_xref="GeneID:4620175"
     CDS             join(570275..570277,570335..571294)
                     /locus_tag="AGOS_ADL063W"
                     /old_locus_tag="ADL063W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL061C (SNP1); 1-intron"
                     /codon_start=1
                     /product="ADL063Wp"
                     /protein_id="NP_984033.1"
                     /db_xref="GeneID:4620175"
                     /translation="MSYSISKFPDRVSSLFKPRPPLQYRKPVDYAPEERKTATITPVS
                     SVLGTDALMRYMQEFPTGSENLLIQRYEELKTINSRKEQELEEELAKWAPENDTNIQG
                     TDPFRTIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPEC
                     SKKAYREIGVHRGLMIRGRSAIVDIERGRTVKFFRPRRLGGGLGGRGYMQRENMNQLP
                     PAADASAKRSLEPGRRSRFNSNASYGRFQGYSSGFRPGSYSHGPRYIREGSSYVPGAS
                     AGQPPEGPAAAAVSQQPPQSSYRSRRDRTSTPDSSGATSRWTAS"
     gene            <571556..>574123
                     /locus_tag="AGOS_ADL062W"
                     /old_locus_tag="ADL062W"
                     /db_xref="GeneID:4620176"
     mRNA            <571556..>574123
                     /locus_tag="AGOS_ADL062W"
                     /old_locus_tag="ADL062W"
                     /product="ADL062Wp"
                     /transcript_id="NM_209387.2"
                     /db_xref="GeneID:4620176"
     CDS             571556..574123
                     /locus_tag="AGOS_ADL062W"
                     /old_locus_tag="ADL062W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER069W (ARG5,6)"
                     /codon_start=1
                     /product="ADL062Wp"
                     /protein_id="NP_984034.2"
                     /db_xref="GeneID:4620176"
                     /translation="MLASTLYCFSRASLVAGSKTGRHGLVRAAYKRELFSTAAIKKLN
                     YARTGNNEGVGSLQTRSTVIQLLNSIGSKREVEQYLKYFTSVSEQQFAVIKVGGAIIS
                     DNLPELASCLAFLYHVGLYPIVLHGTGPQVNNKLEAQGIEPSYIEGIRVTDPVTMTVV
                     RECFLEQNLKLVTALEQMGVRARPITSGVFTADYLDKEKYQLVGNITSVCKDPIEASI
                     KAGALPILTSFAETTAGQTLNVNADVAASSLARAFEPLKVVYLNEKGGIINGETGEKV
                     SVINLDEEYEDLMRQSWVKYGTKLKLQEIKELLDYLPRTSSVAIINVQDLQKELFTDS
                     GAGTMIRRGYKLLKGSSMQQFGAERLRTALERDPEIRSGRLSVASYLKSIEETNITTY
                     ADEPMEVLAIIDNDGTIPRVDKFLCSQAGWLNNVADNVFKTLKRDFGALAWEVEERDP
                     AISWHFSNSEGSFLRNGKVLFWYGINDLETVVSIVDSFLRRVSPTSARNSMNNAFSAK
                     QSKRYYSIASRRAPPKLQGENTSISRVALIGARGHTGTNLISLIENHPYLELACVSSR
                     QNAGKPLEGYTKAQIVYDNLSPDDAKKLELEGAVDVWVMALPNNVCKPFVDAIESVQR
                     ESKIVDLSADYRFVPPAVAAYGLPELNDRNEIASARKIANPGCYATCAQLSLAPLLPY
                     MTAAPVVFGVSGYSGAGTTPSPKNDPAVLHDNLIPYSLTDHIHEREISTRLGTTVAFH
                     PHVAQWFQGITQTISVPVKKGALTQDRVSSLYKEFYRGERLVTIADDVPLVRAIAGSH
                     GVVIGGFKVNRSQDRVVVVGTIDNLLKGAATQCLQNINLALGYSEYEGIPTAPSNAS"
     gene            <574292..>574753
                     /locus_tag="AGOS_ADL061W"
                     /old_locus_tag="ADL061W"
                     /db_xref="GeneID:4620177"
     mRNA            <574292..>574753
                     /locus_tag="AGOS_ADL061W"
                     /old_locus_tag="ADL061W"
                     /product="ADL061Wp"
                     /transcript_id="NM_209388.1"
                     /db_xref="GeneID:4620177"
     CDS             574292..574753
                     /locus_tag="AGOS_ADL061W"
                     /old_locus_tag="ADL061W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL062C (ARC15)"
                     /codon_start=1
                     /product="ADL061Wp"
                     /protein_id="NP_984035.1"
                     /db_xref="GeneID:4620177"
                     /translation="MTDWRRIDIDAFDPDSGRLTAQDLVPPAASQPSPQELQARIAQL
                     RSAGASGDFARGVQIAVSDPPYGADEQTKSQYLLAVLDLLTQVRQADIAGILQQLNRP
                     QQDVLLKYLYRGMAVPEGQKQGGMLLAWFEKLTQQTGINPIVRFLSDRRTV"
     gene            <574994..>576013
                     /locus_tag="AGOS_ADL060W"
                     /old_locus_tag="ADL060W"
                     /db_xref="GeneID:4620178"
     mRNA            <574994..>576013
                     /locus_tag="AGOS_ADL060W"
                     /old_locus_tag="ADL060W"
                     /product="ADL060Wp"
                     /transcript_id="NM_209389.2"
                     /db_xref="GeneID:4620178"
     CDS             574994..576013
                     /locus_tag="AGOS_ADL060W"
                     /old_locus_tag="ADL060W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL063C (YRB2)"
                     /codon_start=1
                     /product="ADL060Wp"
                     /protein_id="NP_984036.2"
                     /db_xref="GeneID:4620178"
                     /translation="MPEQPIVEKADSNGHAEPEAAKRTRSEGSGEAEEQVEPHKKLRK
                     ATEEPESASETVCEDKAEHGDDSGGEQQTTRNGELSAAAEAQPQKQAAGDAPRTAFGE
                     RPPFVAAKPFGAAGFSVKKDGAAASGSASPPGAGAPSAGDPKPFSFGSGLAFGSGFKV
                     LKPDAKPGSTIFDKKDGTTSPLPESTAASVASEASDAADSDAREASICLQKQVTQTGE
                     EAEDSLYQANVKLYQLVSISEGWKERGVGPVHVNKDRSTGRARLVMRSRGLLKVILNL
                     PLVKGFSIQKGFPGSLQSEKFIRILAADSSKGPVQYALKTAAPPVAEQLYKTIADLIP
                     DKPSV"
     gene            complement(<576034..>576717)
                     /locus_tag="AGOS_ADL059C"
                     /old_locus_tag="ADL059C"
                     /db_xref="GeneID:4620179"
     mRNA            complement(<576034..>576717)
                     /locus_tag="AGOS_ADL059C"
                     /old_locus_tag="ADL059C"
                     /product="ADL059Cp"
                     /transcript_id="NM_209390.2"
                     /db_xref="GeneID:4620179"
     CDS             complement(576034..576717)
                     /locus_tag="AGOS_ADL059C"
                     /old_locus_tag="ADL059C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL064W (SEE1)"
                     /codon_start=1
                     /product="ADL059Cp"
                     /protein_id="NP_984037.2"
                     /db_xref="GeneID:4620179"
                     /translation="MDTTQLNQSKLGTREYWDEFYAVEQRNFEADAQDTGECWFDEDR
                     AAERMVEFLEEHVGEWRIAPDAAVLDVGCGNGHLLFALADAGFHGRLEGVDYSERSVQ
                     LARAIGATHDADVGFHAADVFSAAWQPGVFDVVLDKGTLDAIALSGMQPAGAASVPAA
                     YAAVVERVLAPGGVLLITSCNFTEDELVRLVEAGSGLRKCGRIAYPEFGFGGKKGSTI
                     CSVAFTKAM"
     gene            <576807..>577274
                     /locus_tag="AGOS_ADL058W"
                     /old_locus_tag="ADL058W"
                     /db_xref="GeneID:4620180"
     mRNA            <576807..>577274
                     /locus_tag="AGOS_ADL058W"
                     /old_locus_tag="ADL058W"
                     /product="ADL058Wp"
                     /transcript_id="NM_209391.1"
                     /db_xref="GeneID:4620180"
     CDS             576807..577274
                     /locus_tag="AGOS_ADL058W"
                     /old_locus_tag="ADL058W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL065C (FIS1)"
                     /codon_start=1
                     /product="ADL058Wp"
                     /protein_id="NP_984038.1"
                     /db_xref="GeneID:4620180"
                     /translation="MSNINFLPTIEDAYGALSAEQLDILRQQVLSEGGDIASIQSRFN
                     YAWGLVKSHDAEDQRLGVKLLTDIYKESPMRRRESLYYLAIGCYKLGEYAMAKRYADA
                     LVAHEPDNAQARTLKAMVEQKIQTEGLKGAALVGAGLAAVAAAAGFLLRQRRP"
     gene            <577553..>580225
                     /locus_tag="AGOS_ADL057W"
                     /old_locus_tag="ADL057W"
                     /db_xref="GeneID:4620181"
     mRNA            <577553..>580225
                     /locus_tag="AGOS_ADL057W"
                     /old_locus_tag="ADL057W"
                     /product="ADL057Wp"
                     /transcript_id="NM_209392.2"
                     /db_xref="GeneID:4620181"
     CDS             577553..580225
                     /locus_tag="AGOS_ADL057W"
                     /old_locus_tag="ADL057W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER070W (RNR1) and YIL066C (RNR3)"
                     /codon_start=1
                     /product="ADL057Wp"
                     /protein_id="NP_984039.2"
                     /db_xref="GeneID:4620181"
                     /translation="MYVYKRDGRKEPVKFDKITARISRLCYGLDPKHVDAVKITQRII
                     SGVYEGVTTVELDNLAAETCAYMTTVHPDYATLAARIAISNLHKQTTKQFSQVVSDLY
                     HYTNPKNGLHSPMISDEVYEIVMAHKDELNSAIVYDRDFQYNYFGFKTLERSYLLRID
                     GKVAERPQHMVMRVAVGIHGKDIKKAIETYNLMSMRYFTHASPTLFNAGTPHPQMSSC
                     FLVAMKDDSIEGIYDTLKECAMISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGIIPMV
                     RVYNNTARYVDQGGNKRPGAFAIYLEPWHSDVFDFIDIRKNHGKEEIRARDLFPALWV
                     PDLFMRRVQENGDWTLFSPSEAPGLSDVWGEEFEELYERYVREGRGRKTIKAQKLWYA
                     ILEAQTETGTPFILYKDACNRKSNQKNLGTIKSSNLCCEIVEYSSPEETAVCNLASIA
                     LPAFIAEAADGKTQWYDFDKLHEIAKVVTRNLNRVIDRNYYPVETAKRSNMRHRPIAL
                     GVQGLADAFMILRIPFDSPQAKELNSQIFETLYHAACEASMELAIEEGPYESFKGSPA
                     SQGILQFDMWNHKPSGMWDWDALKAKIIEHGMRNSLLLAPMPTASTSQILGYNECFEP
                     YTSNMYSRRVLSGEFQIVNPYLLRDLVDLGIWDDSMKSHIISDNGSIQGLPNIPQELK
                     DLYKTVWELSQKTIIDMAADRGAFVDQSQSLNIHIRAPTMGRLTSMHFYGWKKGLKTG
                     MYYLRTQAASAAIQFTVDKAVAEQAANNVADLSRLHRPRYVPHAVGVSAAPVSDSPRA
                     AAPSSAGDISSISASMASLEVQAAPPASSATAMSSEQASEGKPAASAESTVTAGSTVT
                     AESTLTAESDYDIYNSKVIACAIDNPGACEMCSG"
     gene            <580854..>583277
                     /locus_tag="AGOS_ADL056W"
                     /old_locus_tag="ADL056W"
                     /db_xref="GeneID:4620182"
     mRNA            <580854..>583277
                     /locus_tag="AGOS_ADL056W"
                     /old_locus_tag="ADL056W"
                     /product="ADL056Wp"
                     /transcript_id="NM_209393.2"
                     /db_xref="GeneID:4620182"
     CDS             580854..583277
                     /locus_tag="AGOS_ADL056W"
                     /old_locus_tag="ADL056W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL178W (MPT5)"
                     /codon_start=1
                     /product="ADL056Wp"
                     /protein_id="NP_984040.2"
                     /db_xref="GeneID:4620182"
                     /translation="MPYTHQPQLSINSIQSLVEPVTPPLGQMNNKQNHQRTNSLDLSG
                     FNQFMASNSPINLPTLSPMSGGMLSSVAKPRISSLPLITEFDTASVESSATLIAGETP
                     YGAALPALRSVSGSTVASNAGAASAGAAATARSSSSVSSATSASTGAQGCNPDLGSLP
                     IEELDYLQLATDQYGCRFLQRKLENPAESNQVRDLMYSQIKPYLLDLILDPFGNYLIQ
                     KLCEYLTLDQKTSMIQDIYTHVFEISINQYGTRSLQKIIDTTETEQHIDMIVSGFSQQ
                     FTSINQVVTLINDLNGNHVIQKCIFKFQPTKFDFIIDAIVEKDNIIKISTHKHGCCVL
                     QKLLSVCTLQQIFKISVKIIQYLPGLINDQFGNYIIQFLFDIKELDFYLLGEIFSKLS
                     HELCQLSCLKFSSNVVEKFIKKLFQIVHDSLTNPSASASPPIKVVSNGSHSYQHQADD
                     VVNVAMGILLTITDIFTANLNVLIRDNFGNYALQTLLDVKNYTHLLEIPGNNYIHSSP
                     RLTKFSHEFTLKVGNLIVLTKELLPSIKTTSYAKKIKLKVKAYAELTGVSFTDLSPKK
                     GQQNAPNGIASGSSAANGGCSHRKQHARHYSLPANSFRHQRSNSTISLSGGYHGQQGH
                     PQQQVNMMRLPQKLNFNMSQLSQQQHLSQQAVFNQLQTQQQHVQLVSPSHQAMNMPST
                     YQQQPQMPPQPEYLSMNFTNATPAYASGETQTTSFADPFTYEQQQKQQWHQHRQQQLQ
                     QQHSSVSHMRHNLSDAGLFSHQAASSSASNLMAMNSGAASPTPQQPMYLTNAAAMEYD
                     MHLGNGFYR"
     gene            complement(<584449..>586902)
                     /locus_tag="AGOS_ADL055C"
                     /old_locus_tag="ADL055C"
                     /db_xref="GeneID:4620183"
     mRNA            complement(<584449..>586902)
                     /locus_tag="AGOS_ADL055C"
                     /old_locus_tag="ADL055C"
                     /product="ADL055Cp"
                     /transcript_id="NM_209394.1"
                     /db_xref="GeneID:4620183"
     CDS             complement(584449..586902)
                     /locus_tag="AGOS_ADL055C"
                     /old_locus_tag="ADL055C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER125W (RSP5)"
                     /codon_start=1
                     /product="ADL055Cp"
                     /protein_id="NP_984041.1"
                     /db_xref="GeneID:4620183"
                     /translation="MSITVKLVAAESLYKRDVFRSPDPFAVLTIDGSQTKSTAAKKKT
                     LNPYWNETFTFSGVTENSILTIQVFDQKKFKKKDQGFLGVINVRVGDVLGHLDEDTAS
                     GSRRREETITRDLKRSNDGMNVSGRLIVVLSNVGEEGPSASAGGGLHPDMANGPSGAL
                     AASSSRGSASPMQWGHEEVVAGASQGTLQHNGLPASAALAPGSSINSSSHHNIANGSG
                     VAADGSRTNRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNTRTTTWKRPTLDQTES
                     ERGDQLTANTELERRQHRGRTLPGGATDSGGITVQTSASATPAVNGAAAAAFAVTGAT
                     TSGLGELPPGWEQRYTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPSNNTIQQQPVS
                     QLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKVIYF
                     RSQPSLRILPGQCHIRVRRKNIFEDAYQEIMRQSPDDLKKRLMIKFDGEEGLDYGGVS
                     REFFFLLSHEMFNPFYCLFEYSSHDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFH
                     RRFLDAFFVGALYKMMLRKKVVLQDMEGVDSEVYNSLKWILENSIAGILDLTFSADDE
                     RFGEVVTVDLKPNGRNIDVTDDNKKEYVELFTQWKICSRVEDQFKAFIDGFNELIPED
                     LVNVFDERELELLIGGIAEIDVEDWKKHTDYRGYQESDEVIKWFWKCISEWDNEQKAR
                     LLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLPAYHDYD
                     TLKQKLTLAVEETIGFGQE"
     gene            <587313..>589187
                     /locus_tag="AGOS_ADL054W"
                     /old_locus_tag="ADL054W"
                     /db_xref="GeneID:4620184"
     mRNA            <587313..>589187
                     /locus_tag="AGOS_ADL054W"
                     /old_locus_tag="ADL054W"
                     /product="ADL054Wp"
                     /transcript_id="NM_209395.1"
                     /db_xref="GeneID:4620184"
     CDS             587313..589187
                     /locus_tag="AGOS_ADL054W"
                     /old_locus_tag="ADL054W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER124C (DSE1)"
                     /codon_start=1
                     /product="ADL054Wp"
                     /protein_id="NP_984042.1"
                     /db_xref="GeneID:4620184"
                     /translation="MADTELRQVARPGCCLEPCAGCVATVRAGTGLSTATRAHMRLSS
                     LGEATAGSAAPAVVCGSRTDLYIACSCTEGQCSRADSMALNERGMQMDRGQARPAVRQ
                     PDERERKQRLVNRCFRESRVPDSESSPGTERRTAELSGFYTTKKLRSLYWTLRTDASL
                     TAFAVAQERDTILISNRHHSEENLKLYQYDNVKSKLRRIQTITLPGGSVVACALPGPG
                     FNVVMGEALRRTHDQLILTGHEDAVVNLIATSLEEGDARIIRRFNPAKYLRRLRAQYG
                     DEAADMPWLQEIDSLRVRQLTPWRSVKTDATGFIALVNELIFIYTFDDTREPLYMHHF
                     PGVESFDVNPENELLLALSGSKYGANGISLLDLTKMRGIGRQYAPAGHLKAFERAADS
                     KHCLWLDKSLLVNSVGNILRVWDIRCSTGLKCEVLGHKSNITAVRYHKNSHTLYSCDE
                     DGYIFSWELSHLLRELEGMTDVRRMTLCRSPQSIKTADDCSTTIQCGNIVVAPDTEFS
                     SKRNSSVRSSSSRLGRLHLQFLGDGTLITLDALELGVHKVQDAKCYIAPSKNKLRRHS
                     ELPIKTLAPSAVSHAVESDSSLSSDSTLVERAQLEELHHDIFGSGFMSLDLHAEVDHS
                     "
     gene            complement(<590014..>591429)
                     /locus_tag="AGOS_ADL053C"
                     /old_locus_tag="ADL053C"
                     /db_xref="GeneID:4620185"
     mRNA            complement(<590014..>591429)
                     /locus_tag="AGOS_ADL053C"
                     /old_locus_tag="ADL053C"
                     /product="ADL053Cp"
                     /transcript_id="NM_209396.1"
                     /db_xref="GeneID:4620185"
     CDS             complement(590014..591429)
                     /locus_tag="AGOS_ADL053C"
                     /old_locus_tag="ADL053C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER123W (YCK3)"
                     /codon_start=1
                     /product="ADL053Cp"
                     /protein_id="NP_984043.1"
                     /db_xref="GeneID:4620185"
                     /translation="MGNRGSQHVVGIHYAVGPKIGEGSFGIIFEGENMMEGGDAGRRP
                     VAIKFEPRRSDAPQLRDEFRAYRILNGVRGIPRAYYFGQEGVHNILIIDLLGPSLEDL
                     FEWCGRRFSVKTTCMLAKQMIERVRAIHGRDLIYRDIKPDNFLISEFQREVAAGEVVR
                     GCAATAGGDANLIYVVDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQ
                     SRRDDLESLGHVFFYFLRGSLPWQGLKAPNNKAKYEKIGLTKQKLKPEELISENIPVQ
                     FAEYLKYCRSLRFDEEPDYDYLISLMDSVMHDLNIEDNQHYDWMDLNNHTGWNIAVNK
                     RANLHGYGNPHPRNNNHTTSNLHQQQVQGQAQLKQQPSSPSYHMQYQEHSHKYSKLHR
                     SHSQSTPHRNSQSGKNRVELSTGSNEILTNHPSGKQAVAVQSYDAFGKRVTRSGQQNH
                     IEQDSLTDAGFFSRICCCRWC"
     gene            <591938..>592993
                     /locus_tag="AGOS_ADL052W"
                     /old_locus_tag="ADL052W"
                     /db_xref="GeneID:4620186"
     mRNA            <591938..>592993
                     /locus_tag="AGOS_ADL052W"
                     /old_locus_tag="ADL052W"
                     /product="ADL052Wp"
                     /transcript_id="NM_209397.1"
                     /db_xref="GeneID:4620186"
     CDS             591938..592993
                     /locus_tag="AGOS_ADL052W"
                     /old_locus_tag="ADL052W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR023C (EAF3)"
                     /codon_start=1
                     /product="ADL052Wp"
                     /protein_id="NP_984044.1"
                     /db_xref="GeneID:4620186"
                     /translation="MFGPVEVLRKAVQCRGMCGARSDGEKFEARRAATTSPRDTAMAF
                     EIDGKCLCYHGPLLYEARVLRVYDPASQTYRDRTRTGVPLEEEDGLPAESRGREHWFV
                     HYQGWKSTWDEWVGQERIRPYNDENLALKRQLVQDAKAAAAAAKRAKARPGKRERSPA
                     PAAPAAPAQGPRLAVRMPVELKALLVDDWERITKERKLVALPCAPTVGDILDAYYRER
                     TAQLASPVAQTLLHEFVEGVHLYFDQCLSHLLLYRLERLQFDEACGGAAPAASGLPAP
                     PEPRPSAVYGGVHLLRLLSMMPELICGTTMDEKSCHTVVAQCESLLAWMATHADDLVS
                     GDYINTSAQYEGVALGM"
     gene            complement(<594119..>594631)
                     /locus_tag="AGOS_ADL052CA"
                     /db_xref="GeneID:9487886"
     mRNA            complement(<594119..>594631)
                     /locus_tag="AGOS_ADL052CA"
                     /product="ADL052C-Ap"
                     /transcript_id="NM_001355310.1"
                     /db_xref="GeneID:9487886"
     CDS             complement(594119..594631)
                     /locus_tag="AGOS_ADL052CA"
                     /note="NOHBY451; No homolog in Saccharomyces cerevisiae;
                     Non-syntenic homolog of Kluyveromyces lactis KLLA0F22319g"
                     /codon_start=1
                     /product="ADL052C-Ap"
                     /protein_id="NP_001342256.1"
                     /db_xref="GeneID:9487886"
                     /translation="MMGPAQEGAVVSLDPPDRQIGEEPAWESFLDILEDSYTPYVGPF
                     QSFPWTQSLPHGEDRGLTPPLTLSLGAPLVCASLADARPLSEKTCPICNKTFTRKVSV
                     AIHMVVHTNLKPYACDFPGCKKKFNVKGNLQRHTKSHHLHGHSRLQTGPPAAAPSSTN
                     RVAAGPRHSP"
     gene            <595905..>596426
                     /locus_tag="AGOS_ADL051W"
                     /old_locus_tag="ADL051W"
                     /db_xref="GeneID:4620193"
     mRNA            <595905..>596426
                     /locus_tag="AGOS_ADL051W"
                     /old_locus_tag="ADL051W"
                     /product="ADL051Wp"
                     /transcript_id="NM_209398.1"
                     /db_xref="GeneID:4620193"
     CDS             595905..596426
                     /locus_tag="AGOS_ADL051W"
                     /old_locus_tag="ADL051W"
                     /note="NOHBY404; No homolog in Saccharomyces cerevisiae;
                     Non-syntenic homolog of Kluyveromyces lactis KLLA0F22319g"
                     /codon_start=1
                     /product="ADL051Wp"
                     /protein_id="NP_984045.1"
                     /db_xref="GeneID:4620193"
                     /translation="MPHTYQVPETLTIFTGPLHSFPWTVKFEAPVASQDEGLAVGSSL
                     APCARGGGNPDLAGKNKETDATLRGGALSLGGSQRLYEGQLVSLALQDVTLSCELSKG
                     VSDPANSVHKVSGKTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSN
                     LYRHERIHKRNCS"
     gene            <597638..>598078
                     /locus_tag="AGOS_ADL050W"
                     /old_locus_tag="ADL050W"
                     /db_xref="GeneID:4620194"
     mRNA            <597638..>598078
                     /locus_tag="AGOS_ADL050W"
                     /old_locus_tag="ADL050W"
                     /product="ADL050Wp"
                     /transcript_id="NM_209399.1"
                     /db_xref="GeneID:4620194"
     CDS             597638..598078
                     /locus_tag="AGOS_ADL050W"
                     /old_locus_tag="ADL050W"
                     /note="NOHBY403; No homolog in Saccharomyces cerevisiae;
                     Non-syntenic homolog of Kluyveromyces lactis KLLA0F22319g"
                     /codon_start=1
                     /product="ADL050Wp"
                     /protein_id="NP_984046.1"
                     /db_xref="GeneID:4620194"
                     /translation="MLPTLHSEEPKKTFTGPVQSYPWTRLEDPGQSSAEDGGTAGEQE
                     YTMAADGDAPAARPSPFGSPPALSPLMALNSKTCPVCLKEFTRKTSLNTHLLIHADIR
                     PYLCDYANCNKSFNVKSNLNRHLRIHRGHELHHEQGSSQEPSDP"
     gene            <598544..>601282
                     /locus_tag="AGOS_ADL049W"
                     /old_locus_tag="ADL049W"
                     /db_xref="GeneID:4620195"
     mRNA            <598544..>601282
                     /locus_tag="AGOS_ADL049W"
                     /old_locus_tag="ADL049W"
                     /product="ADL049Wp"
                     /transcript_id="NM_209400.1"
                     /db_xref="GeneID:4620195"
     CDS             598544..601282
                     /locus_tag="AGOS_ADL049W"
                     /old_locus_tag="ADL049W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR021C (AGC1)"
                     /codon_start=1
                     /product="ADL049Wp"
                     /protein_id="NP_984047.1"
                     /db_xref="GeneID:4620195"
                     /translation="MMELSSASTVKKKRQLAIFNAYATPLRQDERRLRASYEHGGVVG
                     GHVASNEKVLLFDDFVDLISNSRSFYSKFTDHCFNLNQIPNTVFGCIFFAIDENNKGY
                     LNVNDWFYFNNVLEYDNYHFIILYEFFRKFDAARERAYGPSVKSINYGNRFLSFDELY
                     LDLEQFQATLRLLHSCVRDDFIVNNKLFLDWKQFRWLKWYQFYPRGLLQNGPHITLNS
                     LISIVQNDLKSEKLLLGFHCLSQLDHRTNSMTISKNQLVYLMRLFYSHKIPADIFNSL
                     NMSTLSCAKCDNNHINYNVFRDLFYLIQNFDLLNQIVHRYAEVHKFSDRDVREQHISR
                     KDLLRFMNTEYNKINNIIEFSPAQISLLFSIVTNSKKLNYLNNARQNNPELSYHHRDS
                     EIDSFIHNEYINGNAASSLHNESLEKFNDDFENIIQADAGDTKQQISSTDWRSVFSWS
                     SFLSSFEWLHFKKRKSVQTNGLSDEYVNEALTLEDIMKIVNPNYLNDLVHHMELRRIE
                     SESRSSNLYFYPIFDSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSID
                     CLLKILSKEGVRGLYSGLGPQLIGVAPEKAIKLTVNDHMRATLAGRDGKLSLPCEIIS
                     GATAGACQVVFTNPLEIVKIRLQVKSDYVADAARNSVNAISVIKNLGLIGLYRGAGAC
                     LLRDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTP
                     FDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLA
                     AYEIFHNLFPAPRYDDSTTHRPTREPVGALAPINKTVSAFFPDQLEPHVGNNKWASRL
                     YGPNIDPYSSSFLNYYYKSCQVAKAFMDLDYNFAHFDFNTYQQFHDELNAMKNKKH"
     gene            complement(<601602..>602699)
                     /locus_tag="AGOS_ADL048C"
                     /old_locus_tag="ADL048C"
                     /db_xref="GeneID:4620196"
     mRNA            complement(<601602..>602699)
                     /locus_tag="AGOS_ADL048C"
                     /old_locus_tag="ADL048C"
                     /product="ADL048Cp"
                     /transcript_id="NM_209401.1"
                     /db_xref="GeneID:4620196"
     CDS             complement(601602..602699)
                     /locus_tag="AGOS_ADL048C"
                     /old_locus_tag="ADL048C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL175C (SAE2)"
                     /codon_start=1
                     /product="ADL048Cp"
                     /protein_id="NP_984048.1"
                     /db_xref="GeneID:4620196"
                     /translation="MLVQEGPPSTQQYEIKDWLRGLSWEHLVSLQYDIADELARRVRE
                     MKLASGLSKDKEDHTEELISTQTSATEAVQPQTGYLHMGAPSTFPEGDGDSQPLIPGT
                     LELRNKHFVLSSSPLKKELPESQNSQNSPRRNLRLLLGPRLAPKQSSPTKSPRRSPTK
                     EVSTPRAKQTQEAHEPIDEDEAEQISDSEGDLSWDSKLPDVHEGQEKRAKIDFNTNPI
                     AKRPWIYEDFQANHEVLEELSKKRLKDHRRNVMDGLAGLPNKLGGEANYDSSFDESFP
                     MYDNLRHRSKSPPGYGRLDFPTTQEIQDDKRKAQDMIYQRTKHRFKMAVQRKIPIFER
                     EYFFKNPQLNTWVDNGEISWSKEELQIFKRT"
     gene            <602829..>603641
                     /locus_tag="AGOS_ADL047W"
                     /old_locus_tag="ADL047W"
                     /db_xref="GeneID:4620197"
     mRNA            <602829..>603641
                     /locus_tag="AGOS_ADL047W"
                     /old_locus_tag="ADL047W"
                     /product="ADL047Wp"
                     /transcript_id="NM_209402.1"
                     /db_xref="GeneID:4620197"
     CDS             602829..603641
                     /locus_tag="AGOS_ADL047W"
                     /old_locus_tag="ADL047W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL174W (BUD13)"
                     /codon_start=1
                     /product="ADL047Wp"
                     /protein_id="NP_984049.1"
                     /db_xref="GeneID:4620197"
                     /translation="MSLNSYLTEAYGPKRAAKSRNGSKREAKVSNVSITDSAEQLVFT
                     NNKPTGHATDIKAKAKRTGLFKNLETNELTEFKPASEVQEPNEVKMSSGAHAGLQSAE
                     QVAEQIGKKQREAQREAAAAAVNKETVFRDSSGAQIADYSTYMRDRERADKLRERFQQ
                     NKSREMNMGDIQLHQLRNPDWRPARCEGEQIRRDDPAAQFTAESSAATYKLSPLGRKL
                     YNKAWPENRFQIAPGWRWDGVDRSNGFEQKWFAKQGELAERKAQQMAAQQDY"
     gene            complement(<603805..>608229)
                     /locus_tag="AGOS_ADL046C"
                     /old_locus_tag="ADL046C"
                     /db_xref="GeneID:4620198"
     mRNA            complement(<603805..>608229)
                     /locus_tag="AGOS_ADL046C"
                     /old_locus_tag="ADL046C"
                     /product="ADL046Cp"
                     /transcript_id="NM_209403.1"
                     /db_xref="GeneID:4620198"
     CDS             complement(603805..608229)
                     /locus_tag="AGOS_ADL046C"
                     /old_locus_tag="ADL046C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL173C (XRN1)"
                     /codon_start=1
                     /product="ADL046Cp"
                     /protein_id="NP_984050.1"
                     /db_xref="GeneID:4620198"
                     /translation="MGIPKFFRYVSERWPNISQLIDGTQISQFDNLYLDMNSILHTAT
                     HGNEDDIKKRLSEEEVFARIFVYIDHLFHTIKPQQTLYMAIDGVAPRAKMNQQRARRF
                     RSAMDAETSLNRARERGDEIPEGEPFDSNSITPGTEFMHKLTTNLKYFIHEKVSSDSL
                     WQNKNIILSGHEVPGEGEHKIMQYIRTLRAQQDYNPNTRHCIYGLDADLIMLGLSIHD
                     THVALLREEILYGRAQKPKALEQQNFYLLHLAIMREYLELEFQEISDELEFKFDFERL
                     LDDFILVMFVIGNDFLPNLPDLHLNKGAFPVLLQTFKETLKHLDGYINENGTINFARF
                     SVWLDYLSKFELMNFERDDIDVDWFNSQLENISLEGERKRKRIGKKLLLKQQKKIVGA
                     VKPWLMKKFSETLSPDVTEEEITMTPWLEKDLAEKNIDFLKEFALELGLIVVHSDSND
                     TYTFKIDLDSYSMNQSAEEHQTRVAELRRSIKKFEQAIIINDEEELEEAQEKYNERFI
                     RWKDSYYKEKVGFSIHDEDKLKEMANNYIEGLQWVLYYYYQGCPSWSWYYRYHYAPRI
                     SDIRKGLDVNISFSLDQPFKPFQQLMAVLPARSKELLPPVYRPLMYDDKSPILDLYPA
                     EVELDKNGKTADWEAVVKLKFVDQDRLLAAMAPLDDLLTPEEKKRNIVGTDLIFVFNP
                     QVDNVYKSPLKGVFTDIANNHCVEREYVHPSMEGRSILYGLPEGAKLGTSALAGFPTL
                     KSIPFNAQLAYNECTIFNQPSRHHSMLLTIKDVYQSSNLSVNDVAERYLGEIVYSNWP
                     YIRESKMVSIIDNNYVYIASEKCKKSGGTSVVRKPATPEEKKAFSSMVKNIIHGYSKK
                     KGIVLPEVRAIARVLPVTGLIRQPDGSYQKCFSKVEELYPLQLIVEDVENKDERYMER
                     PPLPIDEEFPTGSRVIFLGDYAYGGEATVDGYTSATRLKLTVNKQSTKAEPNIGKRRA
                     EMDRKAVHYWPSFVVAKRLGLHPLFLSRITSRFLIEVDNRSVNVGLMVKFPARDEKVL
                     GYARKNRESWEYSNLTLQLVDQYRKNFPDFFNALMNVDKKIPKLKDLLSRRNAEEASA
                     MLASITAFIKDARQSFVIVPLESDSLTKASIQAVEKEIMRIADLPDQSEKRQLAKVPR
                     EAILDPRQSFALLRTQRFDLGDRVIYVQDSGKVPLFSKGTVVGYTTIGSRISIQVLFD
                     QELAAGTTFGERLQTNRGIGVDSSCLLNISKRQFIYHSKASKQYTDKAAKKKQTNVRQ
                     PPKITPEQRRKRVEETKKQQAHEMLNRIRNENSSVPDNSNQLSGTNFANGIKGPSIIM
                     NTQVPLNTVGKSVANNVYNAVVSQLANPAMDQNIPFGLQSAHMMANHMPHSGIVPLPP
                     NGMVPMHQPVVFGFPPHGGAPPNMPVSRDFSRPSMVPQAFHVNAIGNITNPPVDEAST
                     AAMKNLIHPQRQDKKEAGRSQYSGRGRKGPYRGNHAKK"
     gene            <608554..>609705
                     /locus_tag="AGOS_ADL045W"
                     /old_locus_tag="ADL045W"
                     /db_xref="GeneID:4620199"
     mRNA            <608554..>609705
                     /locus_tag="AGOS_ADL045W"
                     /old_locus_tag="ADL045W"
                     /product="ADL045Wp"
                     /transcript_id="NM_209404.1"
                     /db_xref="GeneID:4620199"
     CDS             608554..609705
                     /locus_tag="AGOS_ADL045W"
                     /old_locus_tag="ADL045W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL172W (NUP49)"
                     /codon_start=1
                     /product="ADL045Wp"
                     /protein_id="NP_984051.1"
                     /db_xref="GeneID:4620199"
                     /translation="MEGALHRHTGKTRALGPSKHMFSFGNQSGTGGAQGSSGLFGQAA
                     AQPQTGAGSGGLFGQTTASGATTGTSFGQTGAGGAATGGGLFGQQGVSNSGGLFGQNA
                     GGSSGGLFGRDTTGTAKPGGLFGTQSTGGGAFGSKPAATGGLFGGAGGGAPGALFGTQ
                     AAPQPQPSALHSIAQLPITSMTRIGDLPPQVRQEIEQLDQYIQRQVAISHHLRAEEDE
                     HLELISSIPRDVQFIMKTYSLTTQSLQQDLKRIQAIKALTDDNIRDSECFSLILNQLL
                     TPGTKVSSAELQKFFQEKIQLYRVRLDEYFRVLSDIKSAVNGLDSDMFGSQENSTEYA
                     EPTKTGINSIVATVIEEFELFMDMAERVAQLHQRVKELNGSGKNPVISS"
     gene            <610125..>611255
                     /locus_tag="AGOS_ADL044W"
                     /old_locus_tag="ADL044W"
                     /db_xref="GeneID:4620200"
     mRNA            <610125..>611255
                     /locus_tag="AGOS_ADL044W"
                     /old_locus_tag="ADL044W"
                     /product="ADL044Wp"
                     /transcript_id="NM_209405.1"
                     /db_xref="GeneID:4620200"
     CDS             610125..611255
                     /locus_tag="AGOS_ADL044W"
                     /old_locus_tag="ADL044W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR312C"
                     /codon_start=1
                     /product="ADL044Wp"
                     /protein_id="NP_984052.1"
                     /db_xref="GeneID:4620200"
                     /translation="MPVVNRELDRAWNVVRVVDACDIGEAQVIEDALNFDDVLSNTSS
                     DESECVFKPNTADNGGGLESEAEGSEYGQSTFVQADSEESTVPKEHSECDNPVAGNGE
                     RATHPVSRIGSLSTLQVVLLTSSTTVVAYYWLQQLWFWLRPQNTGYPSPGVMTPSVLG
                     LGNDDTLVFNSAGLPVPFEKYGTKRFMVDFENKVAYPVHAPEDFLALYAGKYVVSNVL
                     SYQVALLYRLNYEWLPKLAYKYQVFRTHIHDSLSAPAHQLGAYCLPSYSALRQIAASA
                     SDNVREIVTIYIQRTCRTVEISYEGAVHALSTMFRELQPKLNIPLQRFESRLISIKQR
                     TVEPLLQSGLLNYNALRRWGLRKTVLVATQVRKYVAKCASIF"
     gene            complement(<612500..>614521)
                     /locus_tag="AGOS_ADL043C"
                     /old_locus_tag="ADL043C"
                     /db_xref="GeneID:4620201"
     mRNA            complement(<612500..>614521)
                     /locus_tag="AGOS_ADL043C"
                     /old_locus_tag="ADL043C"
                     /product="ADL043Cp"
                     /transcript_id="NM_209406.1"
                     /db_xref="GeneID:4620201"
     CDS             complement(612500..614521)
                     /locus_tag="AGOS_ADL043C"
                     /old_locus_tag="ADL043C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL019C (KNS1)"
                     /codon_start=1
                     /product="ADL043Cp"
                     /protein_id="NP_984053.1"
                     /db_xref="GeneID:4620201"
                     /translation="MAENTQLRRKRTRAFDLNGSRAVGAQNGRMGAAGVEMGDATGTA
                     RNGLYIEEEPDPLVNDMLQRQMFLLGSNSGNSGDSGSLVRDADDADSSLAFMGDVGDM
                     VGELALGGTHAGSNYTARRFKKQRTVSLPQLPHAKLFYRLDARGPAASKAVPRRSQND
                     DELLHISGSSSRTLDGNRMVTLPVIRSESPSSLLPPTQLEQQTALNGSAITKATSLLT
                     GQQKLPKLITRRQRSIRRDNFNTDKEGHYVFHGNDIFANGRFMTEELLGQGTFGKVVK
                     CVDNAEPTKKHVAVKIIRALDRYRQAAKTELRVLQTIRDNDPLGQFQCLLLRDCFDYR
                     NHICLVTDLFGKSIYDFMCNNGNPRFPGSHVQAISRQLIRSVCFLHDLGIIHTDLKPE
                     NILICDESFVETPLPDTVLATLSTRRKQVSGGKHKVLTNPEVKLIDFGSAVFCEEYHP
                     PVISTRHYRAPEIVLGLGWSFPCDLWSIGCVLVELVTGESLYPIHENLEHMAMMQRVN
                     GQSFPRKMISKMFYKVEHKLGNLPTDLMTTVVRHFDKTSMALQWPERNYKGEIVTKEK
                     SMKRVMATCDRLDKHISTKLQRDYGEWLIIDWDYTPEQNWSMIESKFYNRTMRIDRET
                     FLFWYWFVDLCRKMFEFDPTKRITAKDAMDHEWFTYGILDEGISSFGQT"
     gene            <616227..>617072
                     /locus_tag="AGOS_ADL042W"
                     /old_locus_tag="ADL042W"
                     /db_xref="GeneID:4620202"
     mRNA            <616227..>617072
                     /locus_tag="AGOS_ADL042W"
                     /old_locus_tag="ADL042W"
                     /product="ADL042Wp"
                     /transcript_id="NM_209407.1"
                     /db_xref="GeneID:4620202"
     CDS             616227..617072
                     /locus_tag="AGOS_ADL042W"
                     /old_locus_tag="ADL042W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR015C and YPR013C"
                     /codon_start=1
                     /product="ADL042Wp"
                     /protein_id="NP_984054.1"
                     /db_xref="GeneID:4620202"
                     /translation="MSQNYRMHPDSCHNYCAATAMSADVHVRNSHQLQPSDLAVAASH
                     PISGGGSYHYYPSDISSGTKNSSSSITSRSLPSLPSLKEILNSTPAVPVAPPVPRHYI
                     APGVSTCQSKVMLPPIQVAHYLPQQRQYEHMYAQDKSGHSSVLDSPRMTPLIMLNVSS
                     PPANPISGVSATSTQQIHQAQILPRRNSLPCFTASQTPPQQPLLNSPLHTRKNPYRGS
                     AYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK
                     HKEAP"
     gene            complement(<617958..>618257)
                     /locus_tag="AGOS_ADL041C"
                     /old_locus_tag="ADL041C"
                     /db_xref="GeneID:4620203"
     mRNA            complement(<617958..>618257)
                     /locus_tag="AGOS_ADL041C"
                     /old_locus_tag="ADL041C"
                     /product="ADL041Cp"
                     /transcript_id="NM_209408.2"
                     /db_xref="GeneID:4620203"
     CDS             complement(617958..618257)
                     /locus_tag="AGOS_ADL041C"
                     /old_locus_tag="ADL041C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL018C-A (COX19)"
                     /codon_start=1
                     /product="ADL041Cp"
                     /protein_id="NP_984055.2"
                     /db_xref="GeneID:4620203"
                     /translation="MSGNPGSALQALSPTPPERGSFPLDHEGECTAQMMEYLNCMKLV
                     RGENAPNCRLLARNYLKCRMDHRLMDRDEWAHLGLPDDKRAEAAASADSARPPRQ"
     gene            <619264..>620256
                     /locus_tag="AGOS_ADL040W"
                     /old_locus_tag="ADL040W"
                     /db_xref="GeneID:4620204"
     mRNA            <619264..>620256
                     /locus_tag="AGOS_ADL040W"
                     /old_locus_tag="ADL040W"
                     /product="ADL040Wp"
                     /transcript_id="NM_209409.2"
                     /db_xref="GeneID:4620204"
     CDS             619264..620256
                     /locus_tag="AGOS_ADL040W"
                     /old_locus_tag="ADL040W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR013C"
                     /codon_start=1
                     /product="ADL040Wp"
                     /protein_id="NP_984056.2"
                     /db_xref="GeneID:4620204"
                     /translation="MGIAGSFLWVPSVKQECGYIIRISLSNASTKICLHSAVEAYLRV
                     PRTGIYTEPRVLCPERAWWIQAKKLDDQRNSVERQMYLPSRIDNIPPPGARIECTQAT
                     RASGLGAAGLGCSGRLGGEAHYHSVLWCGGDATPRSCGLHSSHACTRSRVTLPPLASL
                     LQSSGYMGFNSEPRAVTRSCLGATHPEGHYGRDMLSSAVGHAACYVGRQSPLLPLGDA
                     IAPALPPKPSHRCVAGNAQLRRPVLPIVGPAASPRYETNKTCLVCGRRCTRPSTLKTH
                     MLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSHKRRLMKESKKKSSSPGAGML"
     gene            complement(<621035..>622705)
                     /locus_tag="AGOS_ADL039C"
                     /old_locus_tag="ADL039C"
                     /db_xref="GeneID:4620205"
     mRNA            complement(<621035..>622705)
                     /locus_tag="AGOS_ADL039C"
                     /old_locus_tag="ADL039C"
                     /product="ADL039Cp"
                     /transcript_id="NM_209410.1"
                     /db_xref="GeneID:4620205"
     CDS             complement(621035..622705)
                     /locus_tag="AGOS_ADL039C"
                     /old_locus_tag="ADL039C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL018C (DPS1)"
                     /codon_start=1
                     /product="ADL039Cp"
                     /protein_id="NP_984057.1"
                     /db_xref="GeneID:4620205"
                     /translation="MSEQVEQVADKVAELSTKEETVILGEDGQPLSKKALKKLLKEQE
                     KQKKKEERAAQLAAEAEARQKASAASDTARDNYGALPLIQSASRTGEKRIQFAELTAE
                     DEGKEVLLRSRVHTVRQQGATLAFLMLRQRSSLIQALVKANAEGTVSKQMVKWAGSLN
                     LESIVLVRGVVRKVEEPVKSATVQDFEIQITQLHTISETPQQLPILIEDASRSEAEAE
                     AAGLPVVNLDTRLDARVIDLRTVTNQAIFRIKAGVCGLFREFFQSRNFTEIHTPKLLA
                     SPSEGGANVFEVKYFKGNAYLAQSPQFYKQQLIAADFERVFEVAPVFRAENSNTHRHM
                     TEFTGVDLEMAFEEHYHEVIEVMGEMFMFVFTELKKRFAREIAQVRKQYPVEEFKFPA
                     DGKMVILHYKEGIAMLREAGKEIGDFDDLSTENERFLGKLVREKYDTDFYILDKFPAE
                     LRPFYTMPDPADPRYSNSYDFFMRGEEIMSGAQRIHDPELLRERMKHHGLQPEDAGFK
                     DYCDAFTYGCPPHAGGGIGLERIVMFYLDLKNIRRATLFPRDPKRLRP"
     gene            <623719..>628245
                     /locus_tag="AGOS_ADL038W"
                     /old_locus_tag="ADL038W"
                     /db_xref="GeneID:4620206"
     mRNA            <623719..>628245
                     /locus_tag="AGOS_ADL038W"
                     /old_locus_tag="ADL038W"
                     /product="ADL038Wp"
                     /transcript_id="NM_209411.2"
                     /db_xref="GeneID:4620206"
     CDS             623719..628245
                     /locus_tag="AGOS_ADL038W"
                     /old_locus_tag="ADL038W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR310C (CDC25), YLL016W (SDC25) and YLL017W; YLL016W and
                     YLL017W represent one ORF in this genome"
                     /codon_start=1
                     /product="ADL038Wp"
                     /protein_id="NP_984058.2"
                     /db_xref="GeneID:4620206"
                     /translation="MAESLTSSQPPTLVKCKDVVRALCDFVPLKKQHLPLKAGDVVYV
                     LSRHESGWCDGIIIEQTAKGNSTVTQCQRGWFPRTYTRSIRERRCTQSSSAGAAGVAH
                     NFVSRPHMMLRNPSTPTLRRNSLNIRVSHLGGNTSNHGGTNLARAVTGQSDTHFSPHM
                     FTTTSSPGSSQTHLKQDYKLDMRRRSVCSQRRASMASSHNTRSPSKSPFTELLPVDPL
                     QRLPIDETPNTEPSQTKNSPAPAQKSNSYRAQLLSVAEVQMFFNSLGSIRYVPVWSPV
                     GTEDGEVLFYNKEHNIYCRTLPLLQEPRMDCQSIFPKDDHLIDLSLRKPHEIKNATSN
                     ITAEGQYPTALNCPNTDSGEICVRDLSREATDGPDAQSRAATRTQKCELETTMEKVPV
                     LFSKQELFFHHTSDMRTWTELRDCTLYYLYLSHDSFFRRNQLQFKRNFDHLARLTTMW
                     QLACRLLRNEVTKKNMHKEIRKLVKGLTKSLSKISLASTIYVSTDCRQPGTSSAERRS
                     TAADDISFIRDMKASVTSRSTTLNEVDLSPTIDNSERDPPTESSVRNEDMIPDIPEST
                     IEIDQGGATTVLPAIPSRLINRTEPERGSAALSPTVKTGATYDKSPNFLDETSILSIE
                     MLFHVIDHEVDQYKGKIAKLYHLLKSELLTEDVIPQLYPRMLKNSFDGGAWTNPFHPQ
                     MFPLSSSGDINFTSNSGSLSVGKAGSSGTESARLDARNFSNTSSKTVTSIFNRNKSRT
                     FSRSKLSKKTRYPLNEDTLRLIKGKVTHLTDKLEEYDSYVLNLAKSKHRDLEMAASTY
                     EIIAIISQLIDMLESLDLTFFVNLRNLPTLETAANLDKESMELRDHCVATVTVLMMEF
                     FEVKQALHDIAIGVIIEVQGLTLRDPFVFSPMRDDLGEAGEYDFKKHSFIKQDRFAAA
                     LARSLVQQDVECNNVNFPVSDPVSMEAASKLVQMVETGYQLTEQLVSERENILNYAAR
                     LMKNDLIAELMKGEHDRWFEEDDTNRSVGVEGGIADSHDIQKKKIDLPWYLDSQYESQ
                     LVYDANGNIRGGTKEALIEHLTSHLVIDASFNVTMLITFKSMFTTTELLSALILRYNL
                     YPPEGLSYEEYNEWVQKKHLPIKANVINIMKLWFSQYWSPAYYDPCLEELVAFAQLAS
                     AEKIPDSDPLIDLIKKVVAQKNDMQGFIPRRIPFMVENSVFFQAGSSSYVPSPPLPPN
                     HSLTTNASSASLGTSFRLKKLKQVDIEASVFAKQLTIKENLLYCKIHLFECLDRTWKT
                     RYCDFGGSPNISNFIQNSNHLTNYVSYMIVKQTDLKRRVQIVQYFIDVAETCRALNNF
                     SSMTAITSAMLSSSIYRLKRTWAMVHDNYKESLDRMNALMDSAKNFRKYRELLESLGD
                     CPCVPFFGVYLSDLTFTAGGNPDYLKGTTGVINFAKRARIVNVLKEIDSYQRISYRLK
                     RIAEIQEFIDERLLNVPNIEKQYELSLRIEPRQEVSTGLNADASYAKHGSAAMKGKKL
                     GFVNRIKRSHGSAS"
     gene            <628864..>629007
                     /locus_tag="AGOS_ADL037WA"
                     /db_xref="GeneID:9487901"
     mRNA            <628864..>629007
                     /locus_tag="AGOS_ADL037WA"
                     /product="ADL037W-Ap"
                     /transcript_id="NM_001355309.1"
                     /db_xref="GeneID:9487901"
     CDS             628864..629007
                     /locus_tag="AGOS_ADL037WA"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YDR034W-B and YBR056W-A"
                     /codon_start=1
                     /product="ADL037W-Ap"
                     /protein_id="NP_001342257.1"
                     /db_xref="GeneID:9487901"
                     /translation="MYYQQPAQPVYIQQAPPPQQESSCCGTCCKVLLCCCIFQMCADM
                     CCG"
     gene            <629399..>632062
                     /locus_tag="AGOS_ADL037W"
                     /old_locus_tag="ADL037W"
                     /db_xref="GeneID:4620207"
     mRNA            <629399..>632062
                     /locus_tag="AGOS_ADL037W"
                     /old_locus_tag="ADL037W"
                     /product="ADL037Wp"
                     /transcript_id="NM_209412.2"
                     /db_xref="GeneID:4620207"
     CDS             629399..632062
                     /locus_tag="AGOS_ADL037W"
                     /old_locus_tag="ADL037W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR309C (IMH1)"
                     /codon_start=1
                     /product="ADL037Wp"
                     /protein_id="NP_984059.2"
                     /db_xref="GeneID:4620207"
                     /translation="MFKQLSQFGKNITDELAKGINEDTASEGQHGAGAQGGRREEGGS
                     PYEELPKEIQAKLRKFEKYEQKYPLLLNAYKAEKEKSDEVELLLKVLSENTPVSAIGD
                     VETLRGFFEDVGVKTAMLTEEIKRITGENNGLQKQLAEAQESLEQRQRDLTSREEELA
                     KSSREATELRELRQQAVAEKDAAVTERDDAQKAAAEMETRCTEAEAHAAEMKSQIESM
                     ETELKRTEKLLTTYKSTIQELGASQATGEAQPSSEAPSVRGKKGKGKRGKGKKRVQAA
                     DEKADTSSELELGEEKTPSTSSAGDEIIEAIETKQKYENLVEEHQQLSLELEKSRHWE
                     QECLDSRKKVETLETELKDVKAKLKNSNEELETVRGMLKTVGNELVHARDELKQLNCE
                     GTNEVERLKSELQELRTENSTQIATLKEQLQLLNDQKKALETDVEQHKRKMEDLESEL
                     LKSQENVSKFRNQNNDLSEKLRDYIVLKKSEATTRMSLSQKEKTIEYLEEQVRQYNSK
                     EIEDKKAFADSKTELERWQRTAANLEKQLERIRLETKRHDDNLESYIKENGKLSERLE
                     VLQEKYDSLQNLKSNSGDQVSAIRKQCEELNSKLKEATKRVMSLEDELNETSTVLQER
                     TREATTMRRMINSDRSSKDTKIRELEDRVAAASEERDKLKSELDVLLARKNHETQDLK
                     NTNQELVVKINALELKEQELATEVQQLKVLNQTIRRHSSTAADGSEELELTVRKLKDS
                     LRTSEKKMRELKDSNEELKSLNDELNAKLDRLANRYKVLSTQLKMSKDMSSQSRHSSR
                     SGSLVSPSSDNETGNSPRKISISSAHPAPVVASYDNSAEMESNEKLAYIRNVLLGFLE
                     HREQRSQLLPVVSTLLQLSSHDEKRLLTSLK"
     gene            complement(<632308..>633246)
                     /locus_tag="AGOS_ADL036C"
                     /old_locus_tag="ADL036C"
                     /db_xref="GeneID:4620208"
     mRNA            complement(<632308..>633246)
                     /locus_tag="AGOS_ADL036C"
                     /old_locus_tag="ADL036C"
                     /product="ADL036Cp"
                     /transcript_id="NM_209413.1"
                     /db_xref="GeneID:4620208"
     CDS             complement(632308..633246)
                     /locus_tag="AGOS_ADL036C"
                     /old_locus_tag="ADL036C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR308W (CDA2) and YLR307W (CDA1); Tandem gene duplication
                     in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ADL036Cp"
                     /protein_id="NP_984060.1"
                     /db_xref="GeneID:4620208"
                     /translation="MKSSLLKKALVLACASGRFAAAMPSQNEYEVDAEMTPFPAWLTE
                     LTGLSQWPDADPPYIPIESIDLSKVPDYKPYREGECHLNPPESCSFDCYKCLAIDDVH
                     TCPRLSQTFDDGPSEATLELLGHLNHKTTFFNLGYNIVRNPAVYRQVMAAGHLIGTHT
                     WSHPFLPSLTNEQVVAQLQWSIWAMNATGNHLPRWFRPPYGGIDNRIRAIARQFGLTT
                     VLWDRDTFDWMLQSSEFSRTEQQILDDVTEWMRTGTGLILEHDGHERTARMGIQVNDM
                     IGPNQMTVAECAGGVDYLQSLPWFSRNSHLSSEEAQ"
     gene            <634116..>634343
                     /locus_tag="AGOS_ADL036WA"
                     /old_locus_tag="ADL036W-A"
                     /db_xref="GeneID:4620209"
     mRNA            <634116..>634343
                     /locus_tag="AGOS_ADL036WA"
                     /old_locus_tag="ADL036W-A"
                     /product="ADL036W-Ap"
                     /transcript_id="NM_209414.1"
                     /db_xref="GeneID:4620209"
     CDS             634116..634343
                     /locus_tag="AGOS_ADL036WA"
                     /old_locus_tag="ADL036W-A"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR307C-A"
                     /codon_start=1
                     /product="ADL036W-Ap"
                     /protein_id="NP_984061.1"
                     /db_xref="GeneID:4620209"
                     /translation="MFSKNAFQILSPAVMARCAVPRGEIKTTTFPQLARAASTAAATR
                     LWSLGNKEQKPTVVISSDSDEVETVCDHIRV"
     gene            complement(<634463..>635117)
                     /locus_tag="AGOS_ADL035C"
                     /old_locus_tag="ADL035C"
                     /db_xref="GeneID:4620210"
     mRNA            complement(join(<634463..635014,635067..>635117))
                     /locus_tag="AGOS_ADL035C"
                     /old_locus_tag="ADL035C"
                     /product="ADL035Cp"
                     /transcript_id="NM_209415.1"
                     /db_xref="GeneID:4620210"
     CDS             complement(join(634463..635014,635067..635117))
                     /locus_tag="AGOS_ADL035C"
                     /old_locus_tag="ADL035C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR306W (UBC12); 1-intron"
                     /codon_start=1
                     /product="ADL035Cp"
                     /protein_id="NP_984062.1"
                     /db_xref="GeneID:4620210"
                     /translation="MLRRMPPATEPATRYTMLKLRQLQKEKQRQAAQAQAPAQGRSAA
                     SPAQLRVEKDLATLELPTTVTLDTKCLGSENKVYLRISPEEGVYRGGHFRFSVVFRDT
                     YPIEPPTVKCLNTIYHPNIDYSGNICLNVLREDWSPVMDLQTVVLGLLFLFLEPNGSD
                     PLNRQAADTMLRDPYRFETNVQATMMGGHLDGQVFDNVRH"
     gene            <635174..>636523
                     /locus_tag="AGOS_ADL034W"
                     /old_locus_tag="ADL034W"
                     /db_xref="GeneID:4620211"
     mRNA            <635174..>636523
                     /locus_tag="AGOS_ADL034W"
                     /old_locus_tag="ADL034W"
                     /product="ADL034Wp"
                     /transcript_id="NM_209416.1"
                     /db_xref="GeneID:4620211"
     CDS             635174..636523
                     /locus_tag="AGOS_ADL034W"
                     /old_locus_tag="ADL034W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL176C"
                     /codon_start=1
                     /product="ADL034Wp"
                     /protein_id="NP_984063.1"
                     /db_xref="GeneID:4620211"
                     /translation="MAPELPGFYYDSARGRYFRVAAAGAPAGAERYGRDELRRKRAHN
                     SDNLRRQQEAARAEQARRELVLALARGRAGDLRRIAGAPAPPTTGRVREHLDVFRERP
                     PATLLPQMFYEDGVFLLMDQRAVLYAVRDADGSVSTAAPAAGFGAGEAAGPVLDEQGG
                     LGGWLLRAHGAYSLAAPDGTLRDTALPRGGEVFAALALGDEAFFAQHARVLRAPAGAR
                     RLPRSADTDVLALAVAPHGAALFAGCRNGQLFRLPPAPHAPPELIHTFPGPVVGLRPL
                     PGTPLLVASVHAHPAQLLCVLDTRGPARQPVVRRLATRLRNAAAATEILQLAGSLLLY
                     GSTAARDGRGDWDLFCLDPLAHHAADYDPACGAPSVLPAMTMDQCLAPCSRRRLLAAA
                     LCPRLHAADADGLFHAACSAHQTQFYRETDTQQPRMRVAMLCRDADEVGLVLRSTDL"
     gene            <636729..>642479
                     /locus_tag="AGOS_ADL033W"
                     /old_locus_tag="ADL033W"
                     /db_xref="GeneID:4620212"
     mRNA            <636729..>642479
                     /locus_tag="AGOS_ADL033W"
                     /old_locus_tag="ADL033W"
                     /product="ADL033Wp"
                     /transcript_id="NM_209417.1"
                     /db_xref="GeneID:4620212"
     CDS             636729..642479
                     /locus_tag="AGOS_ADL033W"
                     /old_locus_tag="ADL033W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR305C (STT4)"
                     /codon_start=1
                     /product="ADL033Wp"
                     /protein_id="NP_984064.1"
                     /db_xref="GeneID:4620212"
                     /translation="MRKYGVCAMVPNINLTIGCRKGDFSVRASALKRLSQITLDGGGN
                     LDRITRSLPVAYSADTSKLYTIPLTVNELEILLSVSEAVPRTQAQAAQLLDHVIGVYF
                     VEAPRQRFTDNLLHRFRIAHLRHPVEVETFHLTNFLITLDTRFGELDGRVRELLRGFL
                     ERVFTQVDLVGLLALIGFLRAFIDYRHGTAISDLQAYVLELFHKYMDATFLGRVEQVV
                     SETVVNETLVNYFDNGCEVCAFLFCKLVGDLQLATVSNLLDIPRGDKKITTFLLRMQD
                     LEYQYENAKDGEENDLDCLDRFKTAVRSNKQFLFKVLNFAHQQVNELEEGLKFANLNT
                     LQRLHLAYATKASALEVLSLGIFVDQQRYQTPLVSILSTELTNIYTMGPSTPSGTLET
                     VISSASLMNFFTEELSTQLLRIFPNIVSSPHIPTETVTTISMLFAIGLKPLTQDSVVS
                     SVYSLNNLLAVSANGSSMPILKECRYTANYETQIDKLFNARPLRSNTAAPYQQVVSAT
                     KANETANSSSSNGEQISDDTSLTQHAHFEEGAAYHDALFKNAVTAVITIAANYNDSTI
                     AALVVTILTQKFRVVSEQLDMIILEGLSDLCYFVKDTEFHLLMKFYNGATAVAMKEGN
                     ESLLQGVQSARTSISKKLKTKLDHPMYITYLRELLEVIIARGDVDKLEHHRSHSEIAI
                     IAEQIAVYLKPLATLLPSQGEKPLNLRNDEITTSLYRNIWYNMVVHGFHAESRLTEKY
                     YQELRIIAYNSPPLASDFPANNRETSVDMNTILRRGSSNHNVKEQKNRLNSHLNMNTV
                     AARSISIPKIMFLAATLFLETLRCDSGDCSTSLSYFLNTSIVSSSLDKFVNSIIISIV
                     HKFTKLVNKGDTRVFSSERIASQLSNMILLLSHRNSHLQDCAFQCCDILIKRVPSSLC
                     HRDPLFMLLDSLTMLFDSIVDCETNKYEPCYEFELKHSKTKVMISDSQQWRKTSLQRL
                     HKSAREWVRIILKKANQDVKILLQSYLSDLGGFHRLSSVEFGVSFAFEMAGSVLSIDR
                     ELSKLNNCGMEKPDTISGFLAQHSWRSKFLVEKAALSSCEALELERVSSKTEIEKMLD
                     ASQRIPEQLMADYLDLCSTLLLLHSGDASKLVYDMVSIPFRDFSSYSMKIATNVWLSV
                     IKGRKDLSHFLVAEIASAFIRSVDEKRGLYSHEHDLVPESYQHMEYSPYDKHHIELMA
                     NKAANSIQPHVHVVRLFASHFEGTLFESTHLLKIFMRMAYHGVTNLKYASFHPYARTA
                     RNELLNFALMILSFIINQHTWDAKILSQAIINGALMWFKKPRSWPFGSNELKIRADLS
                     LLMELQNHIKVLDSVLHGYMGDKVTLLECFLISEIHILETWLNPLHEGTELPHLPQGL
                     IQVAFDIDPAMAVSLVGRYPYKKHKETLSNLVHKNPLSCIHIPDALYNFLQKGGANSP
                     YVLYWAPLGPIQVINLFLPEWSNYKLLLQYNVRALESHDVNLTFFYVPQLVQCLRYDK
                     LGYVQRFILDTAKQSVLFSHQIIWNMLANSYKDDEATIEDDLKPTLDFIREKMIADFS
                     AAHRDYYQREFGFFNEVTSISGKLKPFIKKTKAEKKNKIDEEMAKIAIQPDVYLPSNP
                     DGVVIDIDRKSGKPLQSHAKAPFMATFKIRKTVSDEETGAVSYIEKWQGAIFKVGDDC
                     RQDVLALQLISVFRTIWASIGMDVYVFPYRVTATAPGCGVIDVLPNSISRDMLGREAV
                     NGLYEYFTTKFGPENSIEFEHARNNFVKSLAAYSVISYLLQFKDRHNGNIMYDEHGHC
                     LHIDFGFIFDIVPGGVKFEAVPFKLTKEMVRVMGGSPDTQAYQRFQELCTKAYLAARP
                     HMDTIVQCVLPMLGSGLPCFKADKTIRHLEARFQPAKSDHDAAHFMRGLIRRSYESVF
                     TKGYDEFQRLTNGIPY"
     gene            <642848..>645178
                     /locus_tag="AGOS_ADL032W"
                     /old_locus_tag="ADL032W"
                     /db_xref="GeneID:4620213"
     mRNA            <642848..>645178
                     /locus_tag="AGOS_ADL032W"
                     /old_locus_tag="ADL032W"
                     /product="ADL032Wp"
                     /transcript_id="NM_209418.1"
                     /db_xref="GeneID:4620213"
     CDS             642848..645178
                     /locus_tag="AGOS_ADL032W"
                     /old_locus_tag="ADL032W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR304C (ACO1)"
                     /codon_start=1
                     /product="ADL032Wp"
                     /protein_id="NP_984065.1"
                     /db_xref="GeneID:4620213"
                     /translation="MLSARALGRTPVARGMATVAKLTRDSQVKQNLLEDKSFINYKQN
                     LEYVDIVRQRLGRPLTYAEKILYGHLEDPHGQEIERGVSYLKLNPDRVACQDATAQMA
                     ILQFMSAGLPEVAKPVTVHCDHLIQAQVGGEKDLARACDLNKEVYDFLATATAKYNMG
                     FWKPGSGIIHQIVLENYAFPGALLIGTDSHTPNAGGLGQLAIGVGGADAVDVMSNLAW
                     ELKAPKILGVKLTGRMSGWTSPKDIILKLAGITTVKGGTGKIVEYFGDGVDTFSATGM
                     GTICNMGAEIGATTSVFPFNKSMVEYLNATNRHQVAEFAQLYKKDLLSADEGAEYDEV
                     IEIDLNKLEPYVNGPFTPDLATPISKLKEVAVEKNWPLEVKVGLIGSCTNSSYEDMSR
                     SASIIKDAAAHGLKAKSLFTVTPGSEQIRATIARDGQLDTFTEFGGIVLANACGPCIG
                     QWDRRDIKKGEKNTIVSSYNRNFTSRNDGNPETHSFVASPELVTAFAIAGDLRFNPMT
                     DKLKGKDGKEFLLQPPTGEGLPSGGYDPGENTYQAPPKDRNQVEVKVSPTSDRLQLLS
                     AFKPWDGKDPQNMPILIKSLGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENK
                     KANCVKNHYTGEYSGVPETARAYRDQGIKWVVIGGENFGEGSSREHAALEPRYLGGFA
                     IITRSFARIHETNLKKQGLLPLTFHEPAAYDKINPEDTVDIIGLSEFAPGKPLTLRIH
                     SSSGTWETPLDHTFNKEQIEWFKAGSALNKLAAAKK"
     gene            complement(645416..645489)
                     /locus_tag="AGOS_t0068"
                     /db_xref="GeneID:4620214"
     tRNA            complement(645416..645489)
                     /locus_tag="AGOS_t0068"
                     /product="tRNA-Ile"
                     /codon_recognized="AUU"
                     /db_xref="GeneID:4620214"
     gene            645713..645809
                     /locus_tag="AGOS_t0069"
                     /db_xref="GeneID:4620367"
     tRNA            join(645713..645750,645766..645809)
                     /locus_tag="AGOS_t0069"
                     /product="tRNA-Leu"
                     /codon_recognized="CUA"
                     /db_xref="GeneID:4620367"
     gene            <646184..>647587
                     /locus_tag="AGOS_ADL031W"
                     /old_locus_tag="ADL031W"
                     /db_xref="GeneID:4620368"
     mRNA            <646184..>647587
                     /locus_tag="AGOS_ADL031W"
                     /old_locus_tag="ADL031W"
                     /product="ADL031Wp"
                     /transcript_id="NM_209419.2"
                     /db_xref="GeneID:4620368"
     CDS             646184..647587
                     /locus_tag="AGOS_ADL031W"
                     /old_locus_tag="ADL031W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR303W (MET17)"
                     /codon_start=1
                     /product="ADL031Wp"
                     /protein_id="NP_984066.2"
                     /db_xref="GeneID:4620368"
                     /translation="MGYHFDTLQLHAGQEDAAENANSPRAVPIYATTSYVFNDSKHGA
                     QLFGLEAPGFIYSRIMNPTNDVLEKRIAALEGGAAALAVASGQAAQLVAIGGLAHAGD
                     NIVSTSYLYGGSYNQFKVAFKRLGIECRFVEGDNAEDFEARFDSKTKAVFLESIGNPK
                     YNVPDFERIVAVAHRHGIPVVVDNTFGAGGYFCQPIKFGADIVTHSATKWIGGHGTAI
                     GGLVVDSGKFPWKDYPAKFPQFSEPSEGYHGLVLNEALGPLAFVGHARIELLRDLGPA
                     LSPFAAFLFLQGLETLSLRAERHGQNALALAKYLETSAYVSWVSYPGLESHDYHSNAT
                     RYLQNGYGGVLSFGVKPLPDTDEEADPFKAAGAQFVDNLKLASNLANVGDSKTLVIAP
                     YFTTHQQLSESEKLASGVTRDLIRVSVGTEYLQDIIADFEQAFSTVYGTPKGIAPVDV
                     SADNSRLVEGVPDKIQV"
     gene            complement(<647828..>648565)
                     /locus_tag="AGOS_ADL030C"
                     /old_locus_tag="ADL030C"
                     /db_xref="GeneID:4620215"
     mRNA            complement(<647828..>648565)
                     /locus_tag="AGOS_ADL030C"
                     /old_locus_tag="ADL030C"
                     /product="ADL030Cp"
                     /transcript_id="NM_209420.1"
                     /db_xref="GeneID:4620215"
     CDS             complement(647828..648565)
                     /locus_tag="AGOS_ADL030C"
                     /old_locus_tag="ADL030C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR016C (TIF6)"
                     /codon_start=1
                     /product="ADL030Cp"
                     /protein_id="NP_984067.1"
                     /db_xref="GeneID:4620215"
                     /translation="MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGD
                     AIPIVHTTIAGTRIVGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLS
                     ALGNVICCNDYVALVHPDIDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGL
                     VHPQTTIQDQEELSSLLQVPLVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVI
                     ESIFRLQDANPDAISGNLRDTLIETYS"
     gene            <648987..>650594
                     /locus_tag="AGOS_ADL029W"
                     /old_locus_tag="ADL029W"
                     /db_xref="GeneID:4620216"
     mRNA            <648987..>650594
                     /locus_tag="AGOS_ADL029W"
                     /old_locus_tag="ADL029W"
                     /product="ADL029Wp"
                     /transcript_id="NM_209421.1"
                     /db_xref="GeneID:4620216"
     CDS             648987..650594
                     /locus_tag="AGOS_ADL029W"
                     /old_locus_tag="ADL029W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL170C (SPO74)"
                     /codon_start=1
                     /product="ADL029Wp"
                     /protein_id="NP_984068.1"
                     /db_xref="GeneID:4620216"
                     /translation="MWCAAMVSRIAQITVSAARQRQRMRKDTAFGFCVTQTIYLLNED
                     LQSSAAVILLAQAKMSDLVNLSSWSRKVRTISQHSSCMEGPRKSTASSGGVCKSSGTA
                     PDEVLALQNENCHLQLMLSEKGSEVELLKSKVGQLQQRLDELLLSNNSAMTGNVPLSD
                     LYLKPDEDEVMTHFSGSPYRGSRPFSHSTKHSAVSVTSNSRHMSYLFVSRQLVPYMRE
                     AISIFERSDLFSGQALKARRAFVKAIDGALSAVPQFDDLVDVLDELTILQRNAIVCLN
                     RELEYKKVSQQLEYLATIFRDPKECGLRTEDYVEHLRKQLIEVITNIHSTMPLLDPAC
                     YSSVPTENTTSDPLRHDATDVTPSESLLPDDTDRSPPMMPHQQCENTPAPRTPHPTFR
                     TMLPIAAHRTAPSALPELFKRTRPPKLAGTHTSPQLRRGPSASNNYVQALSDLKLTMP
                     ARRTPKEPLEFIPIGFDGRLSGAQTPSRLTSPRKLGKVVLTPLTWSRDGCDDYVSGDP
                     LEQFYAERVSGTDLEDTRTTITGFNSI"
     gene            <650834..>652633
                     /locus_tag="AGOS_ADL028W"
                     /old_locus_tag="ADL028W"
                     /db_xref="GeneID:4620217"
     mRNA            <650834..>652633
                     /locus_tag="AGOS_ADL028W"
                     /old_locus_tag="ADL028W"
                     /product="ADL028Wp"
                     /transcript_id="NM_209422.2"
                     /db_xref="GeneID:4620217"
     CDS             650834..652633
                     /locus_tag="AGOS_ADL028W"
                     /old_locus_tag="ADL028W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR018W (RLF2)"
                     /codon_start=1
                     /product="ADL028Wp"
                     /protein_id="NP_984069.2"
                     /db_xref="GeneID:4620217"
                     /translation="MHNTQAASPNQDVLPFFQGETAVKEDNIERDEDQLVTKRSSPAR
                     DASVCEVQCVDIGSDEDAGAIDIIEVDTKENDAVEAADCVTVLEEAPAEQKPGAPLGE
                     NRKTRSKGAVKESSKAKKQATKEQLELKKRQEREERELKKLRDKEERELKKLREKEER
                     ELKKLREKEERELKRQKEKEERELKKLREKEERELKRQKEKEERELKKQLEKEERERK
                     EEEKQKKTEAKERAQLRIGSFFKKTVISKSLDDSKSDYDRAFLPFYIKRDVKVAGLHQ
                     LDRGKLQDSEAAIDKRLHDAAAPQDTLDWLASVRPPKCGYEIRCTAVEVLQKMTAKQK
                     TDEELQTLLGQVPHKYIKFYENIRPPYIGTYSKNVTLPRCNPFSTEETGFNYDYDSDL
                     DWINDEDEEGGDVDDLEADDDDDDDDDDEQDQGDEHEFDGFLDSDDDSGSTSKKSFAG
                     PLIPVVHLVRDFDNLKADEQQYFNMLAVQYLIEAQPFPIDPNYAPNKRPPPRGVCEST
                     TSPEHGQAQKKAKSLISEPKDLLKLLDEVHESTFSLGTISEIVQKHVPHYSKETIKNT
                     VKHYAARSSGKGNTSRKWQVIDVEGWEQLKVNR"
     gene            <652822..>653832
                     /locus_tag="AGOS_ADL027W"
                     /old_locus_tag="ADL027W"
                     /db_xref="GeneID:4620218"
     mRNA            <652822..>653832
                     /locus_tag="AGOS_ADL027W"
                     /old_locus_tag="ADL027W"
                     /product="ADL027Wp"
                     /transcript_id="NM_209423.1"
                     /db_xref="GeneID:4620218"
     CDS             652822..653832
                     /locus_tag="AGOS_ADL027W"
                     /old_locus_tag="ADL027W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YOL048C (RRT8) (RRT8) and YAL018C"
                     /codon_start=1
                     /product="ADL027Wp"
                     /protein_id="NP_984070.1"
                     /db_xref="GeneID:4620218"
                     /translation="MSLYDQRSLSSQRTSISQNHGFWNELYNATVGSLFELSTVVTAR
                     AGALRKNFWDDFTNYRNYLYPIRGFCEFLKWPRYWGFGLIVGFCYALLFIMLTALYFT
                     FLLPILSAWQVVLLGPIGMVISIIQMVLQCNMWTVRGVKWFVLPVIKEDLFDTYLRRK
                     GYGRLLNTLKQRSFPVVPTYRKNHLEFWIYQIPLQVFLFVCSVTLTIFIIALSMVPII
                     GPTFATILLSPRRSFNYYNTWMNQLRMTRQMKCDSYYEKLGQHMAFGLSCGFFELFPV
                     LSIIGICSNVISTALVVEDEIDQRRIALDSAELASIATTSTTESSSQTSQTTGTSSTS
                     SS"
     gene            <654128..>656794
                     /locus_tag="AGOS_ADL026W"
                     /old_locus_tag="ADL026W"
                     /db_xref="GeneID:4620219"
     mRNA            <654128..>656794
                     /locus_tag="AGOS_ADL026W"
                     /old_locus_tag="ADL026W"
                     /product="ADL026Wp"
                     /transcript_id="NM_209424.2"
                     /db_xref="GeneID:4620219"
     CDS             654128..656794
                     /locus_tag="AGOS_ADL026W"
                     /old_locus_tag="ADL026W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR019W (MCM4)"
                     /codon_start=1
                     /product="ADL026Wp"
                     /protein_id="NP_984071.2"
                     /db_xref="GeneID:4620219"
                     /translation="MTSSPSRPQEASSPALFYNPSSSSQPDTYERGQQNAGNMIGSSP
                     FHYPSSSQSQQNTRSNRGGAFSSQGVPRSERSYAGSSLPGTARTRLQHYGRSDIHASD
                     LSSPRRMVNFNSPSTLSSSDPPSENDEPMRIIWGTNVSIQEVACTFKNFLMTFKYKYR
                     KIKDEQELFINETTDEELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLNY
                     PQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNP
                     NDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVACN
                     QRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEV
                     TGIFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDNV
                     EELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLFGGTNKTFT
                     KGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDVDT
                     KQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISVAKAGIITTLNART
                     SILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSL
                     YLEDKPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSR
                     ADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAIDPKTG
                     KIDMNLIQTGKSVIQRKLQEDLAREIVRLLTERSADVITYNELARLLNENSQDRLDNM
                     TISDALNRLQQEDKIVVLGDGVRRSIRLNGRV"
     gene            <657167..>657526
                     /locus_tag="AGOS_ADL025W"
                     /old_locus_tag="ADL025W"
                     /db_xref="GeneID:4620220"
     mRNA            <657167..>657526
                     /locus_tag="AGOS_ADL025W"
                     /old_locus_tag="ADL025W"
                     /product="ADL025Wp"
                     /transcript_id="NM_209425.1"
                     /db_xref="GeneID:4620220"
     CDS             657167..657526
                     /locus_tag="AGOS_ADL025W"
                     /old_locus_tag="ADL025W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR020W (ATP20)"
                     /codon_start=1
                     /product="ADL025Wp"
                     /protein_id="NP_984072.1"
                     /db_xref="GeneID:4620220"
                     /translation="MASRVQAFINCASQKASFFVSKTVYCGKVAGELTKTVYFKEGLQ
                     PPNISDFEMVYWRLLKQFKNAAAHPQQTLASVKSLGKNDLVKYGAVGVQMLGLYSLGE
                     AIGRRHLVGYTNYSSHH"
     gene            complement(<657744..>659453)
                     /locus_tag="AGOS_ADL024C"
                     /old_locus_tag="ADL024C"
                     /db_xref="GeneID:4620221"
     mRNA            complement(<657744..>659453)
                     /locus_tag="AGOS_ADL024C"
                     /old_locus_tag="ADL024C"
                     /product="ADL024Cp"
                     /transcript_id="NM_209426.1"
                     /db_xref="GeneID:4620221"
     CDS             complement(657744..659453)
                     /locus_tag="AGOS_ADL024C"
                     /old_locus_tag="ADL024C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL171W (ROK1)"
                     /codon_start=1
                     /product="ADL024Cp"
                     /protein_id="NP_984073.1"
                     /db_xref="GeneID:4620221"
                     /translation="MDIFRVLTRGASVKKDGKQVDFSRVQSQRTARPGQRGKDEDEEQ
                     LSRELDFFRTRRSVPAAAERPAEETGDAHRDETEQDEGAEDVAPPPRITTAEEASQLR
                     RSYRGKVTGADAPLPIGSFEDLVTRFKLDKRLLSNLIENNFTEPTPIQCEAIPISLQN
                     RDIVACAPTGSGKTLAFLIPLLQQVISDKAVGTGVKGLIISPTKELANQIFDECSKLA
                     QRIFLEKKRPLSVALLSKSLAAKLKNQIVSDKKYDIIISTPLRLIDIVKSESLDLSAV
                     KYLIFDEADKLFDKTFVEQTDDILSACSHPNISKVLFSATLPSSVEELAQSIMTDPVR
                     VIIGHKEAANTNIEQKLVFCGNEEGKLVAIRQLIQEGMFRPPVIIFLESITRAKALFH
                     ELLYDKLNVDVIHAERTQVQREKIIERFKSGDLWCLICTDVLARGIDFKGINLVINYD
                     VPRSAQAYVHRIGRTGRGGRKGTAVTFFTKQDAIAVKPIVNVMKQSGCEVAAWMENIA
                     KMTKREKEMIKKGKAFVDRKQISTVPKILKQKKRQQKEMIEASKKRKLAQQAGDASEE
                     EHA"
     gene            <659739..>660425
                     /locus_tag="AGOS_ADL023W"
                     /old_locus_tag="ADL023W"
                     /db_xref="GeneID:4620222"
     mRNA            <659739..>660425
                     /locus_tag="AGOS_ADL023W"
                     /old_locus_tag="ADL023W"
                     /product="ADL023Wp"
                     /transcript_id="NM_209427.1"
                     /db_xref="GeneID:4620222"
     CDS             659739..660425
                     /locus_tag="AGOS_ADL023W"
                     /old_locus_tag="ADL023W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR312W-A (MRPL15)"
                     /codon_start=1
                     /product="ADL023Wp"
                     /protein_id="NP_984074.1"
                     /db_xref="GeneID:4620222"
                     /translation="MLCSKISIGTRQSTRHASYIVNGIKVRGLKNPNEDLKNPAGLHY
                     NEVDPARHQAKFKQAFNLDKYGLQIPDDILLQCLTHKSFANSAKPYNEKLSLLGGQLL
                     KWYASALTVQQPGAAGVQQKPVNGLNVANLGHEPYTLWTDSKVISEHMRTRDVDDLIF
                     WNKRDSRATEKFNGLPKVRTTVLQALIGSSLTFNGEEKTAKFVLEELMDSNNANSLPS
                     LALQMAELKA"
     gene            complement(<660801..>670979)
                     /locus_tag="AGOS_ADL022C"
                     /old_locus_tag="ADL022C"
                     /db_xref="GeneID:4620223"
     mRNA            complement(<660801..>670979)
                     /locus_tag="AGOS_ADL022C"
                     /old_locus_tag="ADL022C"
                     /product="ADL022Cp"
                     /transcript_id="NM_209428.2"
                     /db_xref="GeneID:4620223"
     CDS             complement(660801..670979)
                     /locus_tag="AGOS_ADL022C"
                     /old_locus_tag="ADL022C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL021W (SPA2) and YLR313C (SPH1)"
                     /codon_start=1
                     /product="ADL022Cp"
                     /protein_id="NP_984075.2"
                     /db_xref="GeneID:4620223"
                     /translation="MGEENQELRGGQAGQVYGYYVALRQFCDVTGNSQDRSTSTRAQK
                     ARAKLLKLSPAQFFELSTDVHDELQRRIDETQEQPDHLLPKDHFHVKRNQARQKLANL
                     SQTRFNDLVDDILYEIQRRGYHLRKPEHGSNATRGSPHHTRQSVPHSGSEASPSKAQS
                     PSASLRGQDTAADSRKSDKSSSASGQVPMLVAPNTSVQTSQVIPKTASIDWSSDEEEV
                     AAATKRVSRLKHMSKVMISTEDGTVVSPKHGSPGSYSARHSSPKSALLKQASPKLASK
                     HSSPKHGSKSASPKHPSPKSLSIASTPSHKSVALMDTTSISPTSPLHQRTSSASRQAL
                     SAVLGRDKDRDIVLLLEEGNKLEAKLMQITEENKSLEQKSDELAGQVTQLLSEKEILT
                     EQVLDLHTKLEESEKTVTDLSEEVVKLREKADAGVVLQQQISALTNQVNELTFENEAL
                     TQKNLTLTTQLADQDATVGRSMGDSFKEKLSALNSQLEELITQNQTLKLSKAELAAKL
                     SKQQDIIASRSVDDNFQKQMSVLTNQLNDLSIENETLKQSNAELTLKLKRISNITASP
                     LNIFIPSSSKSTNVAIESISKFISPEGSIPLPLIKSFNSKLELVFKHLNQGEQTGNVL
                     FEDIAQVSEVVEHMLNLVSPSDYQQATLLLKAATSHAITTIRYYAAYPTILPVFTAES
                     ALTNISFAVCKLVAVAGIKQGSYDELPITPLTKVAHDEISQSNASNDGLDMSNTSHAA
                     SNFDSNDDMSTVKPLRITQKVNSALFTPPKEKPLMPRRPSGTSLISSIITSEKKEANR
                     NRNKLNLSIPTDSSSAVPSRRGSVSSNMGNSVSPERELSDTNTIHTNPGNPTDASDGN
                     TQRLMKNKPFDTVAGQNPGGSALPSNIGKTKPTSFLSLGKGYQQSSDSFVTAPEDNKE
                     SPTIKPGNSDSRTRSNLTLEPINFGSPQQKAEIDGLAANLTMNNDSHQEMLPDSGEVA
                     TRSLQASGKQALSSIPVASSAFSSPRSLTDSDKSDLNVTPKGVSPKVLPHTSTIQPKE
                     LNSGNDGISPSKSPGVELLEPISKQGDAASLSHSEKDDIGLSSLDTGKQSRNLGKLMK
                     MSSDLSEVSSKHYSIESTESARSNSTPASSKKSASTPTSPISSVNRHMQTPSGVHSYS
                     PSHVIATVTPERRVFNGFTEDSYDDNSSDDGSANTMVSDDDSTYQALKNSMRRNRAAS
                     PGSLVSAQNLAKMQQTSVADNNLKPGDTPIVDTLGGSPFNFETSSGFNGTPQTMAEAM
                     SVTPLETNFPNTVVYDKGFTTNSYHIKPTTYAPDMVSNFAYQKKDQHMDQSIEITEEH
                     IDHPARSEFSSSASSSVKQASPLTPQKVRLPGSNTGTISKRPLQLDSPIDEQQDTMPL
                     QIGNTRQLHNAVSSPTSDSTVSTEEPYSANPEVFSPMRGEGFLLNSAFSVTPLGVDAT
                     SNSKPPFSAVSSSGASVRRVRLGSTKRPHATAIQPVIDDARMSESSENERGIMSSGGS
                     SNYTGIHSTPAALTSREQTPKSQTFGKSGLSPVPDQISTKALVFGVAAQASPDAQKRV
                     INLQSRTSPPKSETHSHIRHNASSVYQSETTDNITKDTGMFSAVKSGFPHIQQKTISA
                     GSELDDTDFQRTQTTSTGPLPTSSEYDSAPVTVHGGLDISPRPPSSSSTDFDEYPTGT
                     ITESHRRPYNVSQLPENNGNSAATRVIKRNSSVLSSPGSVTTTPMVNRATVLSASPGA
                     VKLTEKQHSPASSSDISTANKTHSNSIDLNTTPNVPHHSPVINVMRSITEETRNKRSS
                     FSSSMHSDNIDGETLSKDAINMADTLHGDNAHSTPSSFAMSSLHSTPTVYAQPRNQDH
                     AAMKPSEGPQFKKFEADAHYSSVMSSKKEGSVKEKDYRIALKNESADDRRAVEFSKSI
                     SGSSLQSDKQNIPIRKELHLTFEEQNDNTHASSDLTLEVLQDAQTRDTGSLTNNLAHT
                     PLNTRTEAGEIPSAFETFIEESQTRKRYSIESHEISTDHGKLDFTRGLPARSEVISPG
                     GLTTLGDFKPTAHGEVQSIAHDQVNNFTEGSTVHDEANATEGSYAFDKLKHSEGSPAR
                     GELKSTIHGELNSAPLGELKSTARTEAISTDSSPAREVVISTGTSPVRNEVNATEDST
                     ASAQVKLTSNGELKSPVRHEAISTGTSPARAEVHSTEDLPACDPVKSTARGEVISARV
                     SPANIDVISTGSLPDHDEVISTGTSPALGEMISTGSSPARGDAVHDESKTAAPTQLIS
                     TGVSPALGEVKSVAHDGSRPTARTQVISTGVSPARGDAISAGSSPARGEVKSVAHESR
                     PTARTQVISTGVSPARGDVISTGSSPARTQVISTGVSPARGEVTSVTHNESRPTARTQ
                     AISTGVSPADSDVISTGSSPARGEVKSVAHDGSRPTARTQVISTGSSPARGDVISTGS
                     SPARGEVTSVAHNESRPTARTQLISTGVSPARGDAISAGSSPARTQVISTGVSPARGD
                     AISAGSSPARGEVTSVAHNESRPTARTQAISTGVSPADSDVISAGSSPARTQVISTGL
                     SPARGEVESVAHDGSKTTAYTQVISTGVSPARGGVTSVAHDELKFTGSLSARNEVKFT
                     EDLPAIGAAKSIVRDEMKSTEGSASQVEMVSIGSSPARGELKSTARDNAVSTRSSPAS
                     GEAKSTPRSELMSTGGSPAPGKLTSTPRHAAVSARSSPARGEAKSTPRSELVSIGGSP
                     APGRLTSTVRGEVKSTTRVEAKSTPRHAAVSARSSPACGEAKPTSRNELISTGVSPAH
                     GEIKSTAHDAVISTGDLPDCDEVKSTEGSDAHREVKLTAPSELKSTAHDEEKSSGCSP
                     PRGEVTSTDRGTQKPNLLDELKYNGGFHVRGELKSTGGSTTHEVCEDLPTVRVSTDRE
                     HDFNPPSTTIASPDFTPSNVAMENVPAMTANSLPGTTSNTNDIAKDSMADSADFQRKV
                     EVKLSTYQDPQMEHTPVKTTFGSPQTASREPLSIPTEHHVTPMKRHVSQYDDNNESEF
                     SKSGESRVFLHDGGIIPQEKLPSTRLNTVGDLEGKVSVSKAPAGISTTPIYSEGVTNS
                     ENIVDDSTAEKDNKSSHSRIIGKPSSLEEPKDDHPLPKSTSSGETTNIGKDRTAVGDN
                     QQHEHIRNTTIPKDSPAIKHGNAAKTYENDSNISRTASHSMKLNARPSAAPLILKTNN
                     NHAPLSREAELPRKTTTYEPETPRIDFYGTPTSANSTYTDQSDDYDDDGEIDFNVDDF
                     DIENPDNTLAELLLYLEHQTIDVISTIQSLLTGIKQPKATTGVLRRESNAINQVIGQM
                     AGATSVSMNQSRNAALKEHGNWVVQSLVDCRRRITVLCNLRPDGILVADERDDHFADK
                     HFKQRLAGVAFDVAKCTKELVKTVEEASLKEEIEYLNSKLAK"
     gene            671607..671679
                     /locus_tag="AGOS_t0070"
                     /db_xref="GeneID:4620224"
     tRNA            671607..671679
                     /locus_tag="AGOS_t0070"
                     /product="tRNA-Thr"
                     /codon_recognized="ACU"
                     /db_xref="GeneID:4620224"
     gene            <671894..>673282
                     /locus_tag="AGOS_ADL021W"
                     /old_locus_tag="ADL021W"
                     /db_xref="GeneID:4620369"
     mRNA            <671894..>673282
                     /locus_tag="AGOS_ADL021W"
                     /old_locus_tag="ADL021W"
                     /product="ADL021Wp"
                     /transcript_id="NM_209429.2"
                     /db_xref="GeneID:4620369"
     CDS             671894..673282
                     /locus_tag="AGOS_ADL021W"
                     /old_locus_tag="ADL021W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YOL030W (GAS5)"
                     /codon_start=1
                     /product="ADL021Wp"
                     /protein_id="NP_984076.2"
                     /db_xref="GeneID:4620369"
                     /translation="MRLGANLAAVTLALAVANAASDSSSSSMAPIEVRGNAFFKKGSD
                     KRFYIRGVDYQPGGTGELVDPLADTEICKRDVENFKELGLNAIRVYTVDNTKDHDECM
                     KMLADAGIYLILDVNTPKASISRFNTECSYNANYLQHVFATVDAFQKYDNLLGFFAGN
                     EVINDKDTTETAPYVKAVVRDMKKYMKAKKYRKIPVGYSAADVAENRVLAAQYFNCGD
                     DEDARIDMLGVNDYSWCGSKTFRTSGYSEKMNLYEGYSVPIFLSEYGCNTMPGAREFG
                     EVSSIFSEKMSSLFSGGLAFEYSMEGNNFGLVEIKGGKVKKLEDFENLKKQYAEAKDP
                     EGDAGYSKDGKPASCPPYDKGTWDADTKLPEMPKDAEAFFKGKTPKPNSLDLETQSNC
                     GGLKDSGDSSAKGGSSSSASSASSGATATAKAESSSSAAPESSSSAAGAYNAARVPLA
                     FYWVLGAASYLI"
     gene            <674470..>675570
                     /locus_tag="AGOS_ADL020W"
                     /old_locus_tag="ADL020W"
                     /db_xref="GeneID:4620225"
     mRNA            <674470..>675570
                     /locus_tag="AGOS_ADL020W"
                     /old_locus_tag="ADL020W"
                     /product="ADL020Wp"
                     /transcript_id="NM_209430.2"
                     /db_xref="GeneID:4620225"
     CDS             674470..675570
                     /locus_tag="AGOS_ADL020W"
                     /old_locus_tag="ADL020W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR008C (SLG1)"
                     /codon_start=1
                     /product="ADL020Wp"
                     /protein_id="NP_984077.2"
                     /db_xref="GeneID:4620225"
                     /translation="MRLGVMTRRNMSMHDQILWWVSLALSTFVVLGTDLSSNEHFGEW
                     INLKDAGEMGCFAQLPSSFTKKKLDGQTSYTCFLECREVGTRYMALFNRDYCLCGNSR
                     PDGAKSESCNLGCKQYPGENCGGPNAYFVYNIAPDKNGESSSALASSSTQGAASSSTT
                     DPAGAGGKNPTTTNGERPDATPTTKAEGATTPTVAPSAAVTTTPAAAGGNTLTTEVIA
                     TTLRVTNSAGVYQTTVTAVASSTPSSDSAPEPEHKKKGPPTSTLVGAIVGSLVGLLFL
                     IFLLIYFLRRMYARREQERMEKEYQEAIKPVDYEEAMYMTPTLPEGKELERSETTKLN
                     PFDDTRRISTGSLIDSSPVTANHILTVVNPDQ"
     gene            <676253..>677980
                     /locus_tag="AGOS_ADL019W"
                     /old_locus_tag="ADL019W"
                     /db_xref="GeneID:4620226"
     mRNA            <676253..>677980
                     /locus_tag="AGOS_ADL019W"
                     /old_locus_tag="ADL019W"
                     /product="ADL019Wp"
                     /transcript_id="NM_209431.2"
                     /db_xref="GeneID:4620226"
     CDS             676253..677980
                     /locus_tag="AGOS_ADL019W"
                     /old_locus_tag="ADL019W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL260W"
                     /codon_start=1
                     /product="ADL019Wp"
                     /protein_id="NP_984078.2"
                     /db_xref="GeneID:4620226"
                     /translation="MSVLTDSPDEQELAVVPYDEVEILNYFTDVRNLLSRLKQDRNQY
                     LNSRDVMATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQ
                     LLSLSFLTVGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVE
                     KNSYMSMVEDEAPLDELAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQ
                     PLSDKLFHIRRELLSLAASAKTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVE
                     SHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIY
                     EELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQALI
                     LYLLRRCYATIYKLLESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQ
                     MKLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVN
                     EDDAGEYNSSPCIEMTKDPTDRDVAADTSSTSRYLSVQAADNDDNDDLSAHYSEHSYE
                     EEETRNTYD"
     gene            <678655..>679389
                     /locus_tag="AGOS_ADL018W"
                     /old_locus_tag="ADL018W"
                     /db_xref="GeneID:4620227"
     mRNA            <678655..>679389
                     /locus_tag="AGOS_ADL018W"
                     /old_locus_tag="ADL018W"
                     /product="ADL018Wp"
                     /transcript_id="NM_209432.1"
                     /db_xref="GeneID:4620227"
     CDS             678655..679389
                     /locus_tag="AGOS_ADL018W"
                     /old_locus_tag="ADL018W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL010W (DOT5)"
                     /codon_start=1
                     /product="ADL018Wp"
                     /protein_id="NP_984079.1"
                     /db_xref="GeneID:4620227"
                     /translation="MATELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKK
                     VATDAPKKVVTEAPKKEAGAAKKVETPKKAAAAEASTGPGGELQVGDVLPEITLKNQD
                     QADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVK
                     SQKSFQQKQKLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISP
                     EMSIADGLSEVLLFAKKSLAGNPGKT"
     gene            complement(<679547..>680878)
                     /locus_tag="AGOS_ADL017C"
                     /old_locus_tag="ADL017C"
                     /db_xref="GeneID:4620228"
     mRNA            complement(<679547..>680878)
                     /locus_tag="AGOS_ADL017C"
                     /old_locus_tag="ADL017C"
                     /product="ADL017Cp"
                     /transcript_id="NM_209433.1"
                     /db_xref="GeneID:4620228"
     CDS             complement(679547..680878)
                     /locus_tag="AGOS_ADL017C"
                     /old_locus_tag="ADL017C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL259C (APM1)"
                     /codon_start=1
                     /product="ADL017Cp"
                     /protein_id="NP_984080.1"
                     /db_xref="GeneID:4620228"
                     /translation="MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESS
                     VLPPCFSFNGVQYLFIQHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEE
                     SIKDNFVIIYELLDEMMDHGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATL
                     TNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLK
                     LGLNDKGIFAQGDDDDDEEGASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPP
                     DGDFELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPV
                     PEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLK
                     RPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM"
     gene            complement(<681052..>681661)
                     /locus_tag="AGOS_ADL016C"
                     /old_locus_tag="ADL016C"
                     /db_xref="GeneID:4620229"
     mRNA            complement(<681052..>681661)
                     /locus_tag="AGOS_ADL016C"
                     /old_locus_tag="ADL016C"
                     /product="ADL016Cp"
                     /transcript_id="NM_209434.3"
                     /db_xref="GeneID:4620229"
     CDS             complement(join(681052..681375,681377..681661))
                     /locus_tag="AGOS_ADL016C"
                     /old_locus_tag="ADL016C"
                     /ribosomal_slippage
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL009C-A (EST3); no intron; ribosomal slippage at
                     consensus CTTAGTT site"
                     /codon_start=1
                     /product="ADL016Cp"
                     /protein_id="NP_984081.1"
                     /db_xref="GeneID:4620229"
                     /translation="MPKVVLASRAHKADSIFLREWLVDAVVPALERSGACAPWAGVEC
                     FIPALPPATATLSLEPTVIQNPKRFLRIVRFTRVHDFAVCAVARDAGCCILVEFTPHC
                     VSNFERRYHQRITSSTVNSLFVIGNTSLLFYARSDAAAAFEVPALMNGSSTLPVLRVG
                     DCAIFDQDQVESHRRFPLVQEHPRFVQSLDMAMQGSVLSRYT"
     gene            complement(681741..681812)
                     /locus_tag="AGOS_t0071"
                     /db_xref="GeneID:4620230"
     tRNA            complement(681741..681812)
                     /locus_tag="AGOS_t0071"
                     /product="tRNA-Asp"
                     /codon_recognized="GAC"
                     /db_xref="GeneID:4620230"
     gene            complement(<682324..>684060)
                     /locus_tag="AGOS_ADL015C"
                     /old_locus_tag="ADL015C"
                     /db_xref="GeneID:4620370"
     mRNA            complement(<682324..>684060)
                     /locus_tag="AGOS_ADL015C"
                     /old_locus_tag="ADL015C"
                     /product="ADL015Cp"
                     /transcript_id="NM_209435.1"
                     /db_xref="GeneID:4620370"
     CDS             complement(682324..684060)
                     /locus_tag="AGOS_ADL015C"
                     /old_locus_tag="ADL015C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YNL104C (LEU4)"
                     /codon_start=1
                     /product="ADL015Cp"
                     /protein_id="NP_984082.1"
                     /db_xref="GeneID:4620370"
                     /translation="MPYYSDPSAKYKPFVNSVKLTNRQWPSRTIEKAPRWLATDLRDG
                     NQSLPDPMSFDEKKLMLNKLVEMGYKEIEVAFPSASNIDFEFTQYAVKAVPDDVYVQV
                     LSPCREELISRTIESLRGARNAIVHIYLATSACFRNVVFGKMTEEESIKKAAACTALV
                     RKLTKDDPSQQGTNWMFEFSPETFSDTEPEFVIKICEAVKEAWGPSKDVPIIFNLPAT
                     VEVATPNIFADQVEYFATHISEREKVCISLHPHNDRGCAVAAAELAQMAGADRVEGCL
                     FGNGERTGNVDLVTLGLNLYTQGVSPNIDFSDMSSIIDVVEKCNKISVHPRAPYGGQL
                     VVCAFSGSHQDAIKKGFSQYEKDLVTAQEKHGPEAVVPWKVPYLPLDPGDIGRTYEAI
                     IRVNSQSGKGGASWIILKNMGLDLPRGLQVDFSRVVQRETENLQRELKCQELIDLFAG
                     EYFLSTPCDSQIRLVDYDFSRHQGVCSLKVQISVNNETRDMEGTGNGPISCFVNAVNS
                     AVGANLNVNDYHEHSLGNRSNSQAATYISLESDQALQWGVGIHEDVTEASFLCLISCI
                     NGLRRSGSFSFF"
     gene            complement(684281..684352)
                     /locus_tag="AGOS_t0072"
                     /db_xref="GeneID:4620231"
     tRNA            complement(684281..684352)
                     /locus_tag="AGOS_t0072"
                     /product="tRNA-Arg"
                     /codon_recognized="AGA"
                     /db_xref="GeneID:4620231"
     gene            <684547..>684849
                     /locus_tag="AGOS_ADL014W"
                     /old_locus_tag="ADL014W"
                     /db_xref="GeneID:4620371"
     mRNA            <684547..>684849
                     /locus_tag="AGOS_ADL014W"
                     /old_locus_tag="ADL014W"
                     /product="ADL014Wp"
                     /transcript_id="NM_209436.1"
                     /db_xref="GeneID:4620371"
     CDS             684547..684849
                     /locus_tag="AGOS_ADL014W"
                     /old_locus_tag="ADL014W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL008W (URM1)"
                     /codon_start=1
                     /product="ADL014Wp"
                     /protein_id="NP_984083.1"
                     /db_xref="GeneID:4620371"
                     /translation="MVQVQVEFLGGLDVIFSKQRKHQVSVEGANGSVTVGDLIDYIVS
                     NMIQKQKDVSVFLEDNTIRPGILTLINDTDWELEGEKEYVLEDGDIVSFTSTLHGG"
     gene            complement(<684942..>685598)
                     /locus_tag="AGOS_ADL013C"
                     /old_locus_tag="ADL013C"
                     /db_xref="GeneID:4620232"
     mRNA            complement(<684942..>685598)
                     /locus_tag="AGOS_ADL013C"
                     /old_locus_tag="ADL013C"
                     /product="ADL013Cp"
                     /transcript_id="NM_209437.1"
                     /db_xref="GeneID:4620232"
     CDS             complement(684942..685598)
                     /locus_tag="AGOS_ADL013C"
                     /old_locus_tag="ADL013C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL007C (NAS2)"
                     /codon_start=1
                     /product="ADL013Cp"
                     /protein_id="NP_984084.1"
                     /db_xref="GeneID:4620232"
                     /translation="MSEFDAIVGDLNRLTLDPSIRTQIETIKTLSLAELFALKKTVED
                     ELGRLFDLLQNTHKCDLTNPLVTPDGFPRSDVDIVQVRILRRNINMLRNDLKAIIDHC
                     NNVMSPEFQSKRAEQPASRHGVSYELKIPFAVVTELTVDSPSSRAGILVGDKIVKVGN
                     IHAGNHQKLSAVGMTVRQSKDKQLSIRVLRKDGAFYDLTLTPSEWAGPGLLGCRLSEL
                     "
     gene            complement(<685825..>686802)
                     /locus_tag="AGOS_ADL012C"
                     /old_locus_tag="ADL012C"
                     /db_xref="GeneID:4620233"
     mRNA            complement(<685825..>686802)
                     /locus_tag="AGOS_ADL012C"
                     /old_locus_tag="ADL012C"
                     /product="ADL012Cp"
                     /transcript_id="NM_209438.2"
                     /db_xref="GeneID:4620233"
     CDS             complement(685825..686802)
                     /locus_tag="AGOS_ADL012C"
                     /old_locus_tag="ADL012C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL009C (GCN4)"
                     /codon_start=1
                     /product="ADL012Cp"
                     /protein_id="NP_984085.2"
                     /db_xref="GeneID:4620233"
                     /translation="MPANDLNSAISMFEMNAGTPGAGAAVAPCSAPVAAYHMGVTPAE
                     QHEALQSSSSTSSSDSSILLGELVFEKFACADNLDHEALAKLERSMPMFSESKSSTDL
                     DSAVENFFGSSSDSTPLFEFEGLGKTADPKTWSSLFDDDIPVTLEDVGAVEPISAAAG
                     TESCFLPTPIIEDAVLKPPKRSLTKRDADSVPASKSASPVSISSNISSPALNGCTSAS
                     ATSRRRSSVMKSEKYDHLGVITYNRKQRATPLTPVVPESDDPVALKRARNTEAARRSR
                     ARKLERMNQLEERVEQLLQKNSELEAEVARLRSLVPSSEQPKYTSRAGN"
     gene            <689719..>690168
                     /locus_tag="AGOS_ADL011W"
                     /db_xref="GeneID:4620234"
     mRNA            <689719..>690168
                     /locus_tag="AGOS_ADL011W"
                     /product="ADL011Wp"
                     /transcript_id="NM_209439.2"
                     /db_xref="GeneID:4620234"
     CDS             689719..690168
                     /locus_tag="AGOS_ADL011W"
                     /note="NOHBY401; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ADL011Wp"
                     /protein_id="NP_984086.2"
                     /db_xref="GeneID:4620234"
                     /translation="MMSRSDTSYSARERVTRSVTLSVAVCKRRWAEITPSARRVPVWT
                     SLCLFFGIIFGFIFSSLFWYIRDRIRYVSHPTYSTGSPLPQRTGSADGTQDLAQKLVG
                     TVKDECWSREVVKQEHAYVPLGKQGPIKRRWFPSSRLSTLSPFITWS"
     gene            <690994..>692637
                     /locus_tag="AGOS_ADL010W"
                     /old_locus_tag="ADL010W"
                     /db_xref="GeneID:4620235"
     mRNA            <690994..>692637
                     /locus_tag="AGOS_ADL010W"
                     /old_locus_tag="ADL010W"
                     /product="ADL010Wp"
                     /transcript_id="NM_209440.1"
                     /db_xref="GeneID:4620235"
     CDS             690994..692637
                     /locus_tag="AGOS_ADL010W"
                     /old_locus_tag="ADL010W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL007W (MIT1)"
                     /codon_start=1
                     /product="ADL010Wp"
                     /protein_id="NP_984087.1"
                     /db_xref="GeneID:4620235"
                     /translation="MEVSPSYHGYIETNTDALLLAQAILDGKLKPVSRRPYEIERPQL
                     IISGNVFVFIEEKSGIKRWTDGVSWSPSRIMGKFLVYRELDKQNSSLLQGHAGQSGRR
                     KNSDVAEPLQEDQRNPVSKALVGSLNSSYAFKPGGLVKKTMSLKLKRASHVETIHIIS
                     YYTAEDVESGKLLKPSGTPFFKQLQPCRELILALDSSSVGNSRNASSNMGSSNQVVNV
                     SNVPVLPLCTQLPGAAVSSYINPPIVQPIVNQSGYQGLGQLTTHHHHQHHHHHHQQLS
                     QASLQGQAHNPFYSHNYYPGSSQHNPNAPLYHSYSYYTQNNPNMHLSPDHQHLSLNKP
                     HDHQHQQQPQQPQEQVAQRRPHTGSAASATDISQLANASVASAPSSLSATSSPPHGQF
                     AALPLPGSLFAADQQKQTGIQLPLPFPQGSSASAPPSASALRQPPPQQHAPICPKGTA
                     AGYAPYPGYNMQQYVQTPPIYPVSRYGISSAAQLSFAPHMVSPSAQISPLPQQVYAYP
                     LQHENPPSRGSASGTHTTVNADTLLNFTGRKTMHGKERK"
     gene            <693536..>694675
                     /locus_tag="AGOS_ADL009W"
                     /old_locus_tag="ADL009W"
                     /db_xref="GeneID:4620236"
     mRNA            <693536..>694675
                     /locus_tag="AGOS_ADL009W"
                     /old_locus_tag="ADL009W"
                     /product="ADL009Wp"
                     /transcript_id="NM_209441.2"
                     /db_xref="GeneID:4620236"
     CDS             693536..694675
                     /locus_tag="AGOS_ADL009W"
                     /old_locus_tag="ADL009W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL006W (YIA6) and YEL006W (YEA6)"
                     /codon_start=1
                     /product="ADL009Wp"
                     /protein_id="NP_984088.1"
                     /db_xref="GeneID:4620236"
                     /translation="MDVDAGGAPPLELAQERLVAGRRGAEGGGNVVSAEDIVAPDCST
                     PLSSAEVLEELIGGGGTAGSGGSGRGLRGTGSALQLLDDTQVTAVSGALAGFVSGIMV
                     CPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPIVLGYFPTWML
                     YFSVYEKCKQRYPSYLPGGFVSHAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDS
                     TNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGLFHVAIHFPVYEKLKIWLHRNTPAAD
                     GQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGVPPSLLNLLGRIR
                     ASEGYVGFYSGFATNLVRTVPASVITLVSFEYFRKYLRMWNEGLM"
     gene            <694966..>697053
                     /locus_tag="AGOS_ADL008W"
                     /old_locus_tag="ADL008W"
                     /db_xref="GeneID:4620237"
     mRNA            <694966..>697053
                     /locus_tag="AGOS_ADL008W"
                     /old_locus_tag="ADL008W"
                     /product="ADL008Wp"
                     /transcript_id="NM_209442.1"
                     /db_xref="GeneID:4620237"
     CDS             694966..697053
                     /locus_tag="AGOS_ADL008W"
                     /old_locus_tag="ADL008W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL005W (EPS1)"
                     /codon_start=1
                     /product="ADL008Wp"
                     /protein_id="NP_984089.1"
                     /db_xref="GeneID:4620237"
                     /translation="MWVTLRVCIYVSLFAGRVFSASVGTPATEPAGEQEKMPEPLTSV
                     DFSSTMSTGLHMVEFYSPLCHHCKLFAPTWEKTWKEFHKKGARMGISMAQVECLQSGD
                     LCKQENVVSYPSIRLYGPAGYIKDYPHMERDQESLVQFMMAEARNKNNMELMGLESKS
                     EPLNKKRFNQLLEAGVESPTLISFWPAPEVADITKVTQFRNCRYCAAFRNTWKLLSNR
                     ADTEGISTFHFSCYLNGDLCRKVGLERLTKRSGDGEKIPALALLLPNVDSLIFYERDS
                     YAFEDFLDFVLRSYSNYLAPHISPEEVAKMLLTVPKVSDISEGFAGKTILLYNPAPTT
                     NAEKDGKLLHSLLRELDGIPNVYIYKFEGRLKKNIDRMLDRIYTTLLERASQELVGLN
                     KELFHLRTLSVGDPLFIMFKECSRTPIALQNQVDQEDISSRAIQWIKENSYPYLRDFT
                     RTSGKPLLKGKDSPRKPVVIQVLDTSNEQEVKSSKNIKGFFDVISKFEGTWDEYVYKG
                     LSRLYGDKAILKIVNGNDKTETAFLSEINEKLTENYNGVLYGYIDKSSKKALKRLGLN
                     VHDYELENGDVLIVDEKGKFYYAKGLDGSRMTVHSPEHVVDAIRALVFPESGKSRNDL
                     RRFLVGSPFGPRWRFFEHIHQYGFLGWFLLIVAVFFALRLPRIYKKYVQRKKYAARHD
                     TMGILGKEGAFPE"
     gene            complement(<697157..>697564)
                     /locus_tag="AGOS_ADL007C"
                     /old_locus_tag="ADL007C"
                     /db_xref="GeneID:4620238"
     mRNA            complement(<697157..>697564)
                     /locus_tag="AGOS_ADL007C"
                     /old_locus_tag="ADL007C"
                     /product="ADL007Cp"
                     /transcript_id="NM_209443.1"
                     /db_xref="GeneID:4620238"
     CDS             complement(697157..697564)
                     /locus_tag="AGOS_ADL007C"
                     /old_locus_tag="ADL007C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL004C (BET1)"
                     /codon_start=1
                     /product="ADL007Cp"
                     /protein_id="NP_984090.1"
                     /db_xref="GeneID:4620238"
                     /translation="MSSRFDHNTAHQRTQLFGPNYGKPVKRSSSPFSNPSIDYSQSTL
                     AQLESQSDADVGVMREKIMALKTLSERMGEEIRGSSKTLDSLGSTFDATANKLKRTYK
                     KMMVMASKSRISVKVWLAIFFGFGVLFFYVWVR"
     gene            <697707..>698645
                     /locus_tag="AGOS_ADL006W"
                     /old_locus_tag="ADL006W"
                     /db_xref="GeneID:4620239"
     mRNA            <697707..>698645
                     /locus_tag="AGOS_ADL006W"
                     /old_locus_tag="ADL006W"
                     /product="ADL006Wp"
                     /transcript_id="NM_209444.1"
                     /db_xref="GeneID:4620239"
     CDS             697707..698645
                     /locus_tag="AGOS_ADL006W"
                     /old_locus_tag="ADL006W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL003W (CFD1)"
                     /codon_start=1
                     /product="ADL006Wp"
                     /protein_id="NP_984091.1"
                     /db_xref="GeneID:4620239"
                     /translation="MIHRLIEVITSHLHLVSSSHEHTNKVQREIEMAEEIVVEPESLR
                     EIEHIVLVLSGKGGVGKSSVTTQLGMALACRGLKVGILDIDLTGPSLPRMVGMEGKSV
                     LQGPRGWIPVDVPTGMEQGCLRVMSLGFLLDDRGDSVVWRGPKKTAMIKQFISDVYWG
                     ALDYLLIDTPPGTSDEHISIAEELRGARPDGAIIVSTPQKVAVADVKKEINFCRKVNF
                     KLLGVVENMSGFVCPHCSECTNIFARGGGESLALESGVPFLGTVPIDPAFVEMIESQS
                     SREEPLISLYKTSGLYPIFARIVQHVLDQGIPSRCQ"
     gene            complement(<698684..>699661)
                     /locus_tag="AGOS_ADL005C"
                     /old_locus_tag="ADL005C"
                     /db_xref="GeneID:4620240"
     mRNA            complement(<698684..>699661)
                     /locus_tag="AGOS_ADL005C"
                     /old_locus_tag="ADL005C"
                     /product="ADL005Cp"
                     /transcript_id="NM_209445.1"
                     /db_xref="GeneID:4620240"
     CDS             complement(698684..699661)
                     /locus_tag="AGOS_ADL005C"
                     /old_locus_tag="ADL005C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL005C (VAB2)"
                     /codon_start=1
                     /product="ADL005Cp"
                     /protein_id="NP_984092.1"
                     /db_xref="GeneID:4620240"
                     /translation="MSFLFSGELRSPKNASTERFVSVRGSDAYKELCSLGMLPSSKDL
                     RQDSIFRAVANEVKQVKQDVVEINSRVVAEVQVEKELAEHLNQKLKASEYKVDHLAKK
                     LVRLRQKHSTNTQRQVRKLDDCIGDFESNIRELHGTVAEMVDRLGSVDMGLPEKERLI
                     GDHQLNARHYPLLYELFRDKFPSKFGAPRGLGIASSLPERAFPKALGESDTGDLSHHD
                     VATREAPPLEMDSAEEGCFYHPQNLAVDHIRNHFMNSRSSDINERELEISGSAHATKA
                     SSARENIPERILMPQFQKVASPQTAPTLENIEVTVPFSSKSAGHERHSG"
     gene            <700507..>700903
                     /locus_tag="AGOS_ADL004W"
                     /old_locus_tag="ADL004W"
                     /db_xref="GeneID:4620241"
     mRNA            join(<700507..700531,700587..>700903)
                     /locus_tag="AGOS_ADL004W"
                     /old_locus_tag="ADL004W"
                     /product="ADL004Wp"
                     /transcript_id="NM_209446.2"
                     /db_xref="GeneID:4620241"
     CDS             join(700507..700531,700587..700903)
                     /locus_tag="AGOS_ADL004W"
                     /old_locus_tag="ADL004W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL003W (GIM4); 1-intron"
                     /codon_start=1
                     /product="ADL004Wp"
                     /protein_id="NP_984093.2"
                     /db_xref="GeneID:4620241"
                     /translation="MSAEQRSNVLQLKYNEYKQTLEELQTKIIELGNDKEEHEVVLTT
                     LNGVDKARKCYRMVGGALVETDVQTTIPILQTKKENLSSTISALKGELVKVAEEFEKW
                     KKDNKIQVLKQ"
     gene            complement(<700982..>702265)
                     /locus_tag="AGOS_ADL003C"
                     /old_locus_tag="ADL003C"
                     /db_xref="GeneID:4620242"
     mRNA            complement(<700982..>702265)
                     /locus_tag="AGOS_ADL003C"
                     /old_locus_tag="ADL003C"
                     /product="ADL003Cp"
                     /transcript_id="NM_209447.2"
                     /db_xref="GeneID:4620242"
     CDS             complement(700982..702265)
                     /locus_tag="AGOS_ADL003C"
                     /old_locus_tag="ADL003C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL002C (WBP1)"
                     /codon_start=1
                     /product="ADL003Cp"
                     /protein_id="NP_984094.2"
                     /db_xref="GeneID:4620242"
                     /translation="MLERVLLGLLYVVSMAAAISVHGMKTLLIYDSRITDLGQYQNFL
                     GMLRERQYQVEEVSVDGTASSISLYDGDVRLYDNLILFPIKSRTISKDINVKSLLQFF
                     EEGGSVLAVTSPNGVTESARVYLEQMKIHVSPRDYKLVDYFHDGPIDVLPVNTSTVRN
                     KHIFSSDSVSELTYSGSSALLRNDGLVIPVLPAPRTSLSKNKKGEQWTAGSQGYLVAS
                     VQNLNNARTSWVGSDSFFNDGNWQKNGAFVEELIKWTFGEKAVIKSTGFTHKHSNGLT
                     FDQLPYKIKDNIFYEIGFSEWNGSKWVPFHADDIQFELRMLDPYYRLTLEPSRVSVDS
                     QYYSTGNFALPDHHGVYTFVTQYMNSGLSFVIQKDVKPIRHLANDEYPRSYEITNSWV
                     FLCSISAVIALFVAFVAIYLFTPVVPSVSPEKKKS"
     gene            <702496..>702699
                     /locus_tag="AGOS_ADL003WA"
                     /db_xref="GeneID:9487902"
     mRNA            <702496..>702699
                     /locus_tag="AGOS_ADL003WA"
                     /product="ADL003W-Ap"
                     /transcript_id="NM_001355308.1"
                     /db_xref="GeneID:9487902"
     CDS             702496..702699
                     /locus_tag="AGOS_ADL003WA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL002W-A"
                     /codon_start=1
                     /product="ADL003W-Ap"
                     /protein_id="NP_001342258.1"
                     /db_xref="GeneID:9487902"
                     /translation="MTIDPASEVSTKEFLEAFQKLKEGEETADRMEKMLNKLEGNIEA
                     LLAAAEELNKSDKATNSNIEPSA"
     gene            complement(<702756..>705593)
                     /locus_tag="AGOS_ADL002C"
                     /old_locus_tag="ADL002C"
                     /db_xref="GeneID:4620243"
     mRNA            complement(<702756..>705593)
                     /locus_tag="AGOS_ADL002C"
                     /old_locus_tag="ADL002C"
                     /product="ADL002Cp"
                     /transcript_id="NM_209448.1"
                     /db_xref="GeneID:4620243"
     CDS             complement(702756..705593)
                     /locus_tag="AGOS_ADL002C"
                     /old_locus_tag="ADL002C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL002C (INP51)"
                     /codon_start=1
                     /product="ADL002Cp"
                     /protein_id="NP_984095.1"
                     /db_xref="GeneID:4620243"
                     /translation="MKLFVRKEPRAIALASNDYVLVFERSKNNPKQPQVKNAPPTIMV
                     KTMSEASLVNGGGFVEWTAFLIKGLLGVIHVRNQVFIGLITGVKDVAKPRWRIRDGKM
                     KSIESIFQILSVNFYCLDSPLYDQWLYYVSEICQEKLLTEHPCAPLKKLFSDGTFYYS
                     RDFDISNVLQERGLKHRIENTIENQEKKFIWNLNLMSEILQLRGRITPAELQAFDGGQ
                     FLTFLIRGFCKTVFANEIHSPTSLTLISKTSIEDLDSINDFQKGIDEEGNVARFIESE
                     LIIQTERYLFAYVQTSADIPLSWEVVEGQLLHSKKLKLTKSPERIQATFDRHFDDMIS
                     RYGVISIVNLVKHRSSSQETLSGAYKACAEVKELHYTAVDYPVDVIKKSPYKLMYFLR
                     DDIYEFGAFAYDIARGVYVGKQTGSFRVSAVDATSKMNLVEMCISREVLDLTTDELED
                     FAITTSLVKKHEALWSDNDFWLHRIHTKNIKNPAKYKKVYSQVFSLSSKVLLYDPLHA
                     HIAKCLKKLKNEYTYEKEISIFAGTFNVNGKQCKDEAMGTWLFPPNGESEGNYADIYV
                     IGLEEVVELTPGHMLSTDPMSKQFWEKTILRHLNSQEGRHYNCIGTNQLGGVLLLLYV
                     NESECSKIKHLEYDVKKTGFGGISANKGAAAIRFMYSATKFCFIVSHLAAGLENVEQR
                     HSDYKTIMKSIGFSRGKRIKDHDGIIWMGDFNYRILLSNEEVRRAILEGDYGKLFEKD
                     QLNQQMIAGESFPYFNEMEITFPPTYKFDPGTKSYDTSEKMRIPAWTDRILNRGEILK
                     AISYGCAEDVIFSDHRPVYATFKARTTVVDEEQRGQLSRIIHERLTEMFSGLNDEQKY
                     AFLVDSELIVDKIEMEGKLPLVSQVKKGKRLPPPSSDLRKWWIGNGKQVRITLDVDPK
                     KQMLNPERPVNPFIPGEDGQAYVVPKSRLNN"
     gene            complement(<707146..>707808)
                     /locus_tag="AGOS_ADL001C"
                     /old_locus_tag="ADL001C"
                     /db_xref="GeneID:4620244"
     mRNA            complement(<707146..>707808)
                     /locus_tag="AGOS_ADL001C"
                     /old_locus_tag="ADL001C"
                     /product="ADL001Cp"
                     /transcript_id="NM_209449.1"
                     /db_xref="GeneID:4620244"
     CDS             complement(707146..707808)
                     /locus_tag="AGOS_ADL001C"
                     /old_locus_tag="ADL001C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL001C (IRC22)"
                     /codon_start=1
                     /product="ADL001Cp"
                     /protein_id="NP_984096.1"
                     /db_xref="GeneID:4620244"
                     /translation="MKLSNLLLFANVGTLLVKATDENISPNEENTPRYAQFNIDYSVL
                     DQPNYDPMAPMEFENGENITLAFNFANNEEVPVKLIAVGGNIINARSGDEVANITRSS
                     LGEIEVDVNTSVSFNQAINLKLDEGDYFLLPNVFVLKEGELMAVGTSPSRIKILPPPM
                     SFFNPKFLSIQAVLIGVISYFTYFIFRSSKKERRGVVSKTKAPKKVKLDESWLPENHL
                     KK"
     centromere      708288..708477
                     /note="Chromosome IV centromere"
     centromere      708288..708295
                     /note="Chromosome IV centromere CDE I element"
     centromere      708296..708460
                     /note="Chromosome IV centromere CDE II element"
     centromere      708461..708477
                     /note="Chromosome IV centromere CDE III element"
     gene            complement(<708895..>709869)
                     /locus_tag="AGOS_ADR001C"
                     /old_locus_tag="ADR001C"
                     /db_xref="GeneID:4620245"
     mRNA            complement(<708895..>709869)
                     /locus_tag="AGOS_ADR001C"
                     /old_locus_tag="ADR001C"
                     /product="ADR001Cp"
                     /transcript_id="NM_209450.1"
                     /db_xref="GeneID:4620245"
     CDS             complement(708895..709869)
                     /locus_tag="AGOS_ADR001C"
                     /old_locus_tag="ADR001C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR001C (SGN1)"
                     /codon_start=1
                     /product="ADR001Cp"
                     /protein_id="NP_984097.1"
                     /db_xref="GeneID:4620245"
                     /translation="MVESAVLSNPVPGNSAAIPIESPRSDEQLADTEDSSWEQDMSSD
                     SKGDQDEQSSYNSLDSTTPVSQPLSKDRKHAKQVELDSRSVFVSSITPEATAEMLEEH
                     FKDVGVISRITILYNKKTGEPKGYAYIQFESISSVEKALQLDGSSFNGNTISVAKKRT
                     NLPGFNRPFNYYPYQQFHAHGNGRYHHPQSHHPHPQQHQFFYGNQWQNGYPHAHWNYG
                     AYGGAYTPYKNVNFYNSYRFQQQGQHLPQMIPNENSRAHLREGRAGTRGNKGGNPNSS
                     RKSRQTVGPSKTNDAKLMNDPPVSNSTSHSVNSVSTSATTSETGVKRE"
     gene            <710195..>710905
                     /locus_tag="AGOS_ADR002W"
                     /old_locus_tag="ADR002W"
                     /db_xref="GeneID:4620246"
     mRNA            <710195..>710905
                     /locus_tag="AGOS_ADR002W"
                     /old_locus_tag="ADR002W"
                     /product="ADR002Wp"
                     /transcript_id="NM_209451.1"
                     /db_xref="GeneID:4620246"
     CDS             710195..710905
                     /locus_tag="AGOS_ADR002W"
                     /old_locus_tag="ADR002W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER002W (NOP16)"
                     /codon_start=1
                     /product="ADR002Wp"
                     /protein_id="NP_984098.1"
                     /db_xref="GeneID:4620246"
                     /translation="MASVRKRKMARSSVRKVTRRNRDKQRKVNIACNPIIEKNWDYNL
                     TLAQNYKRLGLTAKLAPRAGGEEIDLSKVIQKSVPICSAFEDYDSESDVEQEKRNNDD
                     ALEDGEYDPAKIPEGEARIQRDENGDVVKVVYGTMKTVDVDEDISELKQKLEQDKVKT
                     EVVQELESYASRPVNRRVRYQSSREEEWLGRLYEKHGEDYNSMARDLKLNIYQQSVGD
                     LKRRMKKWLKAHHIDERQ"
     gene            complement(<711034..>712323)
                     /locus_tag="AGOS_ADR003C"
                     /old_locus_tag="ADR003C"
                     /db_xref="GeneID:4620247"
     mRNA            complement(<711034..>712323)
                     /locus_tag="AGOS_ADR003C"
                     /old_locus_tag="ADR003C"
                     /product="ADR003Cp"
                     /transcript_id="NM_209452.1"
                     /db_xref="GeneID:4620247"
     CDS             complement(711034..712323)
                     /locus_tag="AGOS_ADR003C"
                     /old_locus_tag="ADR003C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER003C (PMI40)"
                     /codon_start=1
                     /product="ADR003Cp"
                     /protein_id="NP_984099.1"
                     /db_xref="GeneID:4620247"
                     /translation="MSAKLFRLDAGYQQYDWGKIGSSSAVAQYAANSDPSVQIEEDKP
                     YAELWMGTHHKVPSRHHDTKVALSDLIAANPEGMLGSGNVEKFHSRKDLPFLFKVLSI
                     EKVLSIQAHPDKNLGRRLHIQDPKNYPDDNHKPEMAIAISDFEGFCGFKPLEELAEEL
                     QRIPEFRSLVGEDIAAQFCAGIKVGAQEGSEEDKSNRKLLQSVFSNVMNASDDVIASH
                     ARHLVERAKQSPADFNNETLPALILRLNEQFPEDVGLFCGCLMLNHCVLKAGESIFLR
                     AKDPHAYITGDIIECMAASDNVVRAGFTPKFKDVKNLVEMLTYSYDSVEDQKMKLLPF
                     ARSSGSGDSILYNPPIEEFAVLQTNFHGSTGTHHFDGLDGPSIVITTNGSGYIQSGDV
                     RLKAEAGYVFFIAPHAEVDLQTEDSNFTTYRAFVEPN"
     gene            <712542..>713117
                     /locus_tag="AGOS_ADR004W"
                     /db_xref="GeneID:4620248"
     mRNA            <712542..>713117
                     /locus_tag="AGOS_ADR004W"
                     /product="ADR004Wp"
                     /transcript_id="NM_209453.2"
                     /db_xref="GeneID:4620248"
     CDS             712542..713117
                     /locus_tag="AGOS_ADR004W"
                     /note="NOHBY422; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0D13706g"
                     /codon_start=1
                     /product="ADR004Wp"
                     /protein_id="NP_984100.2"
                     /db_xref="GeneID:4620248"
                     /translation="MADWIETSNGNRISKKATITGSQRILIAGSCLIRENCVVEGNVR
                     TLEKSASAISMGRFCMLGRASVVKPAVIGYKTDKNTGKSVSIHCPLVMNSYTLVKPGA
                     QIHCKRMGSRVVVGANSILARCCTIGDVVIIEDDVVVPENCYVPSFSRVRRHSEWPGS
                     IDITPLNDSMRQVIENWCKQEYLGMTPDYDD"
     gene            <713333..>714007
                     /locus_tag="AGOS_ADR005W"
                     /old_locus_tag="ADR005W"
                     /db_xref="GeneID:4620249"
     mRNA            <713333..>714007
                     /locus_tag="AGOS_ADR005W"
                     /old_locus_tag="ADR005W"
                     /product="ADR005Wp"
                     /transcript_id="NM_209454.1"
                     /db_xref="GeneID:4620249"
     CDS             713333..714007
                     /locus_tag="AGOS_ADR005W"
                     /old_locus_tag="ADR005W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER004W (FMP52)"
                     /codon_start=1
                     /product="ADR005Wp"
                     /protein_id="NP_984101.1"
                     /db_xref="GeneID:4620249"
                     /translation="MNALVVGATGLCGAAILKHAAEATSFNKVYALVRRQIPNSAARV
                     ETIVNEQSDSWPESVPAGVDVFFSGLGTTRANAGGLENQYKVDHDLNIAVAKAAKERG
                     CRVCVIVSAIGASVNARLPYNKLKGDIERDLLALEFERTVILRPGVLLGERETHHKGF
                     GNSVAVFLGKLVYRGRFQALLGYPVYGDEVGQVAVALALSDDKSKVRIVESAEILSLV
                     KQENTQ"
     gene            <714108..>716153
                     /locus_tag="AGOS_ADR006W"
                     /old_locus_tag="ADR006W"
                     /db_xref="GeneID:4620250"
     mRNA            <714108..>716153
                     /locus_tag="AGOS_ADR006W"
                     /old_locus_tag="ADR006W"
                     /product="ADR006Wp"
                     /transcript_id="NM_209455.2"
                     /db_xref="GeneID:4620250"
     CDS             714108..716153
                     /locus_tag="AGOS_ADR006W"
                     /old_locus_tag="ADR006W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER005W (YND1)"
                     /codon_start=1
                     /product="ADR006Wp"
                     /protein_id="NP_984102.2"
                     /db_xref="GeneID:4620250"
                     /translation="MLCIPPVGPPKKAGTGTRDSLYTLLNSINNGKPLLQRRRGDMVE
                     EDKEIAEHDKYGVVIDAGSSGSRVYVYKWTDPTALGKETSDESVLHSVPHIRTRKEWT
                     KRIEPGLSSFNKKPERAYKKHIKILLEHAKEVIPEDKHHETPIFIQSTAGMRLLSDVE
                     QKRITDVLCRKIRDETHFLLENCAAQIETIDGETEGIYGWLSLNYLKKYFDEYDGKLT
                     DHKSHGFLDMGGGSLQIAFKPSDPEEISKHREDISTITLKSVNGDVQQWDVFTSTWLR
                     FGTREVRKRYLNQLVHTALNGSGEKSPKALKDRGVYDPCLPKGSEHSFTYSGTELRIK
                     GVGEYEQCSKTIYPLLLKNSPCLEQPCSFSGVHMPKIDFTRDSFLGVSEYTYTINDVF
                     HMDAEYNFSNFSGKVQQFCELDWQKILQERENGNYGDISKSSLLEACFKANWVINVLH
                     EGFGIPRKGIDPPDAGSGDVGNHITFSSADNVNGNELTWTLGKILLYACSMVQLGENI
                     KVGLQPSALSAKNDGKKFIPGGISRDLEYDSVMVQFLHSLGQMVLLFSVGLLLYWLYV
                     KLHIKQYVSINSLKSAINYVRGKINKIRYSKVMNPGQLEQLEAGVLPMSRFGGDRDGF
                     KFRSRTMLNLSPQGYEDHPIPGGRASGAASPALSENAMGTIFSMADFSDFNRPSSNY"
     gene            complement(<716351..>717415)
                     /locus_tag="AGOS_ADR007C"
                     /old_locus_tag="ADR007C"
                     /db_xref="GeneID:4620251"
     mRNA            complement(<716351..>717415)
                     /locus_tag="AGOS_ADR007C"
                     /old_locus_tag="ADR007C"
                     /product="ADR007Cp"
                     /transcript_id="NM_209456.2"
                     /db_xref="GeneID:4620251"
     CDS             complement(716351..717415)
                     /locus_tag="AGOS_ADR007C"
                     /old_locus_tag="ADR007C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YPR086W (SUA7)"
                     /codon_start=1
                     /product="ADR007Cp"
                     /protein_id="NP_984103.2"
                     /db_xref="GeneID:4620251"
                     /translation="MSLPSAANANAAAAARRKVPNLNIVISCPECKVYPPKVVERFSE
                     GDIVCALCGLVLSDRIVDTRSEWRTFSNDDQNGDDPSRVGEASNPLLDGNHLSTRIGQ
                     VQGSDVKLTRELNRAQSKSIVDKKDNELQAAYAKITMMCDAAELPRIVKDCAKEAYKL
                     CFEERALKGKSQESIMASVILVGCRRAEVGRTFKEILSLTNVRKKEIGKTFNIIKKIL
                     REKNDSGFANVDTANISTGQTNAETFIPRFCSHLGLSVQVANAAEYIAKHAKDINVLA
                     GRSPLTIAASAIYMANLLFRYNITPSQISATLQVTEGTVKGGYKILYEHKEKVVDPEL
                     ITTGKVSFDDLPKVSDKGDK"
     gene            <717681..>719222
                     /locus_tag="AGOS_ADR008W"
                     /old_locus_tag="ADR008W"
                     /db_xref="GeneID:4620252"
     mRNA            <717681..>719222
                     /locus_tag="AGOS_ADR008W"
                     /old_locus_tag="ADR008W"
                     /product="ADR008Wp"
                     /transcript_id="NM_209457.2"
                     /db_xref="GeneID:4620252"
     CDS             717681..719222
                     /locus_tag="AGOS_ADR008W"
                     /old_locus_tag="ADR008W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER006W (NUG1)"
                     /codon_start=1
                     /product="ADR008Wp"
                     /protein_id="NP_984104.2"
                     /db_xref="GeneID:4620252"
                     /translation="MRVRKRTSKRTSTRLREGIKKKAAAQHRKERKQAKKDVTWKSRA
                     KKDPGIPASFPYKHKILEAMEEKKREDQEERERRRQERQEAKRLARERGEEVMDDEDS
                     DEEMEEGNGLSALVESAQLAAKEYDGAVGGDAEEDVEVQDLDVDFYADAGEAESELEK
                     SRKAYDKIFKTVVDAADVVLYVLDARDPEGTRSRKVEEAVLQAQGKRLLLIINKVDLV
                     PPHVLEQWMTFLKSSFPTIPFRAAPGATNAASFNKKLTLSATASGLLECLKTYAHQSN
                     LKRSIVVGVIGYPNVGKSSIINALTSRRGGSFKACPVGNMPGVTTSLREVKIDNKLKI
                     LDSPGICFPSESTKKTKSEQEAELALLNALPPKYIIDPYPAVLKLIKRLSQNEEMTAS
                     FKKFYELPAIPAPDAESFTKQFLIHVARKRGRLSKGGIPNLTSAGVSVLNDWRDGKIM
                     GWVLPNSSKAASAKATQPGASSETGPAGVRSSTEQTTIVEEWSKEFDLDSLFASLDNA
                     IQTAN"
     gene            <719439..>720911
                     /locus_tag="AGOS_ADR009W"
                     /old_locus_tag="ADR009W"
                     /db_xref="GeneID:4620253"
     mRNA            <719439..>720911
                     /locus_tag="AGOS_ADR009W"
                     /old_locus_tag="ADR009W"
                     /product="ADR009Wp"
                     /transcript_id="NM_209458.1"
                     /db_xref="GeneID:4620253"
     CDS             719439..720911
                     /locus_tag="AGOS_ADR009W"
                     /old_locus_tag="ADR009W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER007W (PAC2)"
                     /codon_start=1
                     /product="ADR009Wp"
                     /protein_id="NP_984105.1"
                     /db_xref="GeneID:4620253"
                     /translation="MKYKVGERLDLDGELCTLRYIGAIPDWPGQVAYGVEWDSQGRGK
                     HSGTLHGVKYFETSRPDTGSFLKESRVLKTVGITRTLLEALHSRYGEKLLELDEMYIG
                     SKRLEGYGFEKLTLINNDYLNLKVLSLSKLGINRIGSDEDLSNFVTNCSNVEELDITS
                     NLFIDFGAVISIASNLRKLRTLDVSNNKFSITGGFMNQCLHVKRLIIRHCRLDVTSLR
                     RILEAFPNLENLDVLDNSIDDIDSVKLPKTLKTFNVSQNTIKSWQSQSLKGLQTLIAA
                     NNIIADIPPDPCPTIRTLDLSYNNIALWDVVDKFQTVFPNMHDLRINNNIFSSDEEDT
                     DEFYQIIARIPSLTMLEGSILGKDTRREAELYFISKVRSGDISYDCSSIRWKSLLYHH
                     GISDNSTQNFSYETLWHDICVLEVHFEGKQLELHLLNTSSVRLLKNLIAQLLDLDLLA
                     MSLSYSITPGIVSEFNYEFSPLTTFGIRSDAIVYVNPSDC"
     gene            complement(<720970..>721569)
                     /locus_tag="AGOS_ADR010C"
                     /old_locus_tag="ADR010C"
                     /db_xref="GeneID:4620254"
     mRNA            complement(join(<720970..721504,721559..>721569))
                     /locus_tag="AGOS_ADR010C"
                     /old_locus_tag="ADR010C"
                     /product="ADR010Cp"
                     /transcript_id="NM_209459.1"
                     /db_xref="GeneID:4620254"
     CDS             complement(join(720970..721504,721559..721569))
                     /locus_tag="AGOS_ADR010C"
                     /old_locus_tag="ADR010C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER007C-A (TMA20); 1-intron"
                     /codon_start=1
                     /product="ADR010Cp"
                     /protein_id="NP_984106.1"
                     /db_xref="GeneID:4620254"
                     /translation="MFKKFSKEDIHTRTKVKTSVQRSLKSKLVEQFPKLEEVIDELLP
                     KKTELQIIKCSDKIQLYAVGDEVLFFQKFEELIPTLRFVHKYPEAFPTIQIDRGAIKF
                     VLSGANIMCPGLTSSGAALPEAPGLAQDSIVVVNAENKENALAIGKLLMSTEDIKSIN
                     KGHGVETIHHLGDCLWNFSLV"
     gene            complement(721821..721964)
                     /locus_tag="AGOS_AgSNR14"
                     /old_locus_tag="AgSNR14"
                     /db_xref="GeneID:4620255"
     ncRNA           complement(721821..721964)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR14"
                     /old_locus_tag="AgSNR14"
                     /product="AgSNR14"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR14; start and end coordinates are
                     approximate"
                     /transcript_id="NR_149362.1"
                     /db_xref="GeneID:4620255"
     gene            complement(<722135..>725368)
                     /locus_tag="AGOS_ADR011C"
                     /old_locus_tag="ADR011C"
                     /db_xref="GeneID:4620256"
     mRNA            complement(<722135..>725368)
                     /locus_tag="AGOS_ADR011C"
                     /old_locus_tag="ADR011C"
                     /product="ADR011Cp"
                     /transcript_id="NM_209460.2"
                     /db_xref="GeneID:4620256"
     CDS             complement(722135..725368)
                     /locus_tag="AGOS_ADR011C"
                     /old_locus_tag="ADR011C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR002C (MPH1)"
                     /codon_start=1
                     /product="ADR011Cp"
                     /protein_id="NP_984107.2"
                     /db_xref="GeneID:4620256"
                     /translation="MLQHATITKMTDFSDLDDDDIVGLLDQDVNRCVETSVTRHKLAM
                     QRDLTGKVLDGEKRYYEEVVTSVTYKPTHHQLRYENLNTYLYPTNYEVREYQFNIVHR
                     ALFENVLCAIPTGMGKTFIASTVMLNYYRWTVGTKIIFTAPTRPLVAQQIKACLGITG
                     IPYNDTAILLDKSRKHREQIWSEKRVFFATPQVVENDLKRGALNPKDVVLLVIDEAHR
                     ARGSYAYVELTKFIDRFNTSYRVLALTATPATDLEGVQEVVDNLQISKIELRTEESED
                     IVRYMKRRDTEEVIVPLIPEIEDIIEQLGIAITPVLKEAVQLGLYDDCEPVNINAFIA
                     MQQSQKILANSSIPEGVKWKNYFILQLLCHVGHMLKRLKIYGIQTFYTYFDNKYREFT
                     TKYGIGKSTNKTAASFYYSSILKNITKTCQAYTANPSFLGHGKLYRVRDELSTFFASA
                     GDDSRVIIFTELRESALELVKCVDNMNDRFIRPHIFIGQAKGKESFDDGEYLRKHAPK
                     GRKKVDRIRRLEEEKRLADEKLRKKEEEKLARTARRTGSSEEAQISGMTQKQQKEVIS
                     LFKKGDYNVLVCTSIGEEGLDIGEVDMIICYDTTSSPIKNIQRMGRTGRKRDGRIVLL
                     LSDNEPRKFEQAMEDYAQLQRLIGEESLNYKVTDRIIPKGINPQCQKEFITISEKNSA
                     VNGMEDADSVIKYATQAMLGKLDKRKAVKKSTGKAAPKRFFMPDDVETGIVPAMKLVK
                     SYKYTENGEAFPVAESVKGRRPKSKDTLLDRLEYDSLESELSSPEKATKSQNVVEIRP
                     KLLSDILLKDEDTLHFEHSSSCPKVDSLASVTTLSSDNKSTPDQLKRSQSDNGFGIPP
                     KRQRLCYDTSANCSSTDTHLMEAQSKNKDNPANRKTGEPHYKLEVSPLKREEDDRDVI
                     PQNIAVKPEVPHLTQECLTTGRVYKSEFSKYDGFLTVSERRYFEQNYSPVHLVSLEPR
                     PVFSRSRNRVAIVPHSERVQRLINIFAAMDTDDKVHIIDMHRKHALARRTVHGGPTEN
                     SDLLQPSSDGIIVPNDDIRLFSLRPRATDFEDMLEDDEGLSELLDSD"
     gene            complement(<725553..>729506)
                     /locus_tag="AGOS_ADR012C"
                     /old_locus_tag="ADR012C"
                     /db_xref="GeneID:4620257"
     mRNA            complement(<725553..>729506)
                     /locus_tag="AGOS_ADR012C"
                     /old_locus_tag="ADR012C"
                     /product="ADR012Cp"
                     /transcript_id="NM_209461.2"
                     /db_xref="GeneID:4620257"
     CDS             complement(725553..729506)
                     /locus_tag="AGOS_ADR012C"
                     /old_locus_tag="ADR012C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER008C (SEC3)"
                     /codon_start=1
                     /product="ADR012Cp"
                     /protein_id="NP_984108.2"
                     /db_xref="GeneID:4620257"
                     /translation="MLKRFSHSRGESLDDNGSGHSIFHKRTPSTQAAANAAGLGAAAH
                     RRTTSRSSVSSTSSNFLAEQYERDRRAIIQSCFQKVDAVTGLPMNVYITHVRIIEDSR
                     YPSSRPPADSPLTNKKKRALIVSTRANGLGMQLHKARENSNGTFQIGRSWDLKELVLI
                     ERDLERPEGFVFIMGKKYYWETNSAKERLVFIKSIVKIYMENSNGRVPQLINWDLSIF
                     YLDEQSYQRAVIRAKSQPDVPPANARDGAHVATHVGNTMHTGSAIHPSAMNIGMQPGP
                     QAQAQAQTQSQFVPPQSKTSFKELSAFSPDPTYTENSSADVLPHNWPSYSPGHDHSQA
                     PQQAPQQAPQQAPQQAPRQNNPLGSAQSSAHGEPPRPAVQQPNIPTAATHTVAGAIPS
                     GPPSSTPHQGSHPYSSFYARGRSDSGNKTLRIPHSPSSVRSDVSKTGISPVMPLNVSP
                     EEGQQKEDSPYQRSMQENVTPGPAQPTAVGRHKPGTVTESRVSFENDRYMEELDGALR
                     SSLDINRDHSPSNINTFSDEPSPYKKETNMQEAPAAPMLEAIRKFPSELSFGEDDIRP
                     ERFSHTKTDSHSKFSLPTRNEPRIAVPELSPPETTGSHTEISENEVLDFQAMVGILDE
                     IHWSANDGSDVVLERLLLKVAEAEYQFNKQLMSLPKKASDLKLYKAKTVQECDRMDPT
                     LSLFTMELSSISKDIEYVERQSNGLQVNCVNKKLLSKDLSGILDSVSLAESSLEELLN
                     LSLVEKNLDKIESLLLGLHKAIGAIKGGKKDEQSDLGEIRALKDRRQAYERITDSFLK
                     KLVSQMDAKFKKMQVCSSDLNELLSGLLVFSSLPLFCKDVSEHTFNVLLENWSADVCK
                     LYNTRVASVLDYMQERTAKLQQPPSTTGKDELVQLWDTYRKTKSLSFASCTKSNEVDT
                     ILKSLGAIEELCITYQNFVDRFFHMSSSFTFPEYVKKFDTKSRQFDLYTVKSMESNRD
                     SAKLKNQMVTTVFQAEFASFFAEVSQTLRKNQWHIPVVLLYLDNRIKWLKPTDQEFLL
                     SAIVKIYEKLKQDWEAYINEQTVHHERAVIDYKARYLFPPVLNFPIFVKTAEDELAHA
                     FTNFNLSPEHSSDILNYLDETYCGWGASVVKLLGREDKSELGSTKLPPVNHSANIERC
                     VSIVKNSHWFVEILPIFRKDSFLDIIQQSKQVFDKQKESYADMLLYQEMGELFAFVDG
                     THGLINSSSAKADPSRWAAYSPQHLNTLLSKYTSQQIDNIVDKMYNNMVQHFSEHAES
                     KMAESLREKLWSCIQGQTVSFYLKLYSLIDRHYKGIHVHFTKNDIISAFEGHKNW"
     gene            <729916..>730293
                     /locus_tag="AGOS_ADR013W"
                     /old_locus_tag="ADR013W"
                     /db_xref="GeneID:4620258"
     mRNA            <729916..>730293
                     /locus_tag="AGOS_ADR013W"
                     /old_locus_tag="ADR013W"
                     /product="ADR013Wp"
                     /transcript_id="NM_209462.1"
                     /db_xref="GeneID:4620258"
     CDS             729916..730293
                     /locus_tag="AGOS_ADR013W"
                     /old_locus_tag="ADR013W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER009W (NTF2)"
                     /codon_start=1
                     /product="ADR013Wp"
                     /protein_id="NP_984109.1"
                     /db_xref="GeneID:4620258"
                     /translation="MSMDFSALAQQFTEFYYNQFDTDRSQLGNLYRDQSMLTFETSQL
                     QGAKDIVEKLVSLPFQKVQHRITTLDAQPASPNGDVLVMITGDLLIDDEQNAQRFSQV
                     FHLMPEGNSYYVFNDIFRLNYSA"
     gene            <730481..>732229
                     /locus_tag="AGOS_ADR014W"
                     /old_locus_tag="ADR014W"
                     /db_xref="GeneID:4620259"
     mRNA            <730481..>732229
                     /locus_tag="AGOS_ADR014W"
                     /old_locus_tag="ADR014W"
                     /product="ADR014Wp"
                     /transcript_id="NM_209463.2"
                     /db_xref="GeneID:4620259"
     CDS             730481..732229
                     /locus_tag="AGOS_ADR014W"
                     /old_locus_tag="ADR014W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR003W (AIM21)"
                     /codon_start=1
                     /product="ADR014Wp"
                     /protein_id="NP_984110.2"
                     /db_xref="GeneID:4620259"
                     /translation="MINTAIKRSNSSASERPALAHSEQKMSEPPPIPERPKVPIRPKK
                     RLTASSLESAARSSPLPEEATNAGAASDAPDAEAQEGRHADGHALGAGIPAPHECVEH
                     AGEETIACRVPDESAHKHRGAAGATTNDALSLEQEGARAGLVPQREGVPRNGDELTEQ
                     ATSPRNVPEAAAADEENSVSAHKPLPQATGETSEQPASAAGALMNAEDETPAAHSQGA
                     ARAVSPDLAGASSSLGGSPGRSKGKPLVPKKPSSKIAAFQEMLQRQQTEIYGSKVHDE
                     HHSVLTPAKLGGSRANFTQNLNNLFAMPGIAPGGQLPPLSRKLTSASESTGGSRSPTG
                     SPVHRSVSPPRHSASPPRCSLSPPRRSQSPPKSTVPAPLPTSNTRVRGPSRKLPSAFK
                     GVEKAKPVSTNTITSFPTWSVTFTARAPSEEIASNSSSASVNSAFSASAGTAFSASAG
                     TAFSASAGTAFSAGARSASSVSPTAVSSAGSSHDASSEICLSSAADASSAAGPSAVHA
                     SRLDVSRESTSEYSIGDYAQDGDTDDRWRQRLLQKYQTSSSMGNNTTSQLDSAPASPN
                     NGSSTNDFMDYITKDL"
     gene            <732632..>733942
                     /locus_tag="AGOS_ADR015W"
                     /old_locus_tag="ADR015W"
                     /db_xref="GeneID:4620260"
     mRNA            <732632..>733942
                     /locus_tag="AGOS_ADR015W"
                     /old_locus_tag="ADR015W"
                     /product="ADR015Wp"
                     /transcript_id="NM_209464.2"
                     /db_xref="GeneID:4620260"
     CDS             732632..733942
                     /locus_tag="AGOS_ADR015W"
                     /old_locus_tag="ADR015W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR004W (DJP1)"
                     /codon_start=1
                     /product="ADR015Wp"
                     /protein_id="NP_984111.2"
                     /db_xref="GeneID:4620260"
                     /translation="MVVDTAYYDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKA
                     TERFQAISEAYQVLSSDELRAKYDKFGKEEAVPQNGFEDAGEQFAAIFGGEAFASYIG
                     ELTLLKNIQKTEELVQQDEEEKQREKQRVHEKTQDQKKGATPQTGAPAAGEPAAAAER
                     VKPSGRGAIEENGGAKAASDKGDGETQDERKKTKLEQFEEQQRLDKEKMIDKLSKILC
                     DRLSVVTESSYDEPCKRAFEKKFEEEANMLKMESFGLDILHTIGEVYCQKAEIFLKNQ
                     RILGIGGFFHSVRAKCGFVVDTVRTVSAALDAQNTMQELEKLKLAVDSDEPLRDDKGN
                     ELPKPTVEELAHMEQLVMGKVLSAAWHGSKFEIMSTLKSVCTRVLEDKNAELETRIRR
                     AEALIMLGRVFKRTYRTPVEQEDAQVFEELAAEATKNKSRSRRK"
     gene            complement(<734086..>734802)
                     /locus_tag="AGOS_ADR016C"
                     /old_locus_tag="ADR016C"
                     /db_xref="GeneID:4620261"
     mRNA            complement(<734086..>734802)
                     /locus_tag="AGOS_ADR016C"
                     /old_locus_tag="ADR016C"
                     /product="ADR016Cp"
                     /transcript_id="NM_209465.1"
                     /db_xref="GeneID:4620261"
     CDS             complement(734086..734802)
                     /locus_tag="AGOS_ADR016C"
                     /old_locus_tag="ADR016C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER010C"
                     /codon_start=1
                     /product="ADR016Cp"
                     /protein_id="NP_984112.1"
                     /db_xref="GeneID:4620261"
                     /translation="MSHSRALSKFSTCDVADGLLNFCGIDDGGFLGNLTQWSGSEQGT
                     LVGPAYTVLFDKVENVDEEVNYIDSLPRGVVLVIGLPLEQQLPTAPHVIVSQALYGGL
                     MSTRAQYLGSRGTIVFGRVRDVDEHRQLNYPVFSHALGVCAPRMAVKPAKIGVALPIL
                     MPDGSVRHLNPGDYVVADENGVVQIPASVSSKMEKLINYIDHSIKADQRVAQDIKIGV
                     PAKQAQRNRRAALKDLIEPN"
     gene            <734917..>735438
                     /locus_tag="AGOS_ADR017W"
                     /old_locus_tag="ADR017W"
                     /db_xref="GeneID:4620262"
     mRNA            <734917..>735438
                     /locus_tag="AGOS_ADR017W"
                     /old_locus_tag="ADR017W"
                     /product="ADR017Wp"
                     /transcript_id="NM_209466.1"
                     /db_xref="GeneID:4620262"
     CDS             734917..735438
                     /locus_tag="AGOS_ADR017W"
                     /old_locus_tag="ADR017W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR005W (IST3)"
                     /codon_start=1
                     /product="ADR017Wp"
                     /protein_id="NP_984113.1"
                     /db_xref="GeneID:4620262"
                     /translation="MNQIRSIQKLSETELEHGILSEEASWHYQYKDQAYIHFSGLNVE
                     LTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCG
                     RVLKVDHCFYEPRDEDEAYVKTVREELARDLVDVEVGTTAPIQGKITLTEDAELADPM
                     GEFLSSKKDVDGR"
     gene            complement(<735558..>739304)
                     /locus_tag="AGOS_ADR018C"
                     /old_locus_tag="ADR018C"
                     /db_xref="GeneID:4620263"
     mRNA            complement(<735558..>739304)
                     /locus_tag="AGOS_ADR018C"
                     /old_locus_tag="ADR018C"
                     /product="ADR018Cp"
                     /transcript_id="NM_209467.2"
                     /db_xref="GeneID:4620263"
     CDS             complement(735558..739304)
                     /locus_tag="AGOS_ADR018C"
                     /old_locus_tag="ADR018C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR006C (PAN1)"
                     /codon_start=1
                     /product="ADR018Cp"
                     /protein_id="NP_984114.2"
                     /db_xref="GeneID:4620263"
                     /translation="MYNPYQQSGGPAYGADGYGQQGYGQAYGQQGFGQAYGQQGGGYE
                     AGPAATYTAGAAQPLRPTATGFVNAAASRGLNTELKIPLFRLSFLTAADQAKFETLFR
                     SAVRPGATTITGEDCKHILLRSGLSPFQLGLIWTLCDTNNAGELLFPEFALAMHLVNG
                     VLQGERIPRALDSKVKNEVSSFVDLINFSVGSNSPPPEGQKARTPFDALTQGAGTLQP
                     QATGFMPPTSFGVPQATGLGFGQAPMQPQATGYMPPTSFGAGLGAHTTGGNALASQMT
                     GGLQQYAGGAFQNYQATGGKGLGAQVTGGFAQQPAGANPLLSQLTGGQGFQQQRQPTG
                     ANSLMPQVTGGFQQPSNAIGSQPPAMGMPQGLSQGQSVGLQAQATGFLPPSQFAPTAP
                     LAAQKTGFGNNEIYSHAAFASGFPAGEDDKLTPEEKSLFYNIFDTYDTDKTGQLHFKV
                     AAEIFRKSGLNRSELERIWNLCDTNNSGQLNRQEFAVGMHLIYRRINGHNLPHTLPPS
                     LVPSSTRILNNVKNQLKVSSSSKKEPTRIDGLAYKNNDDDILPSFKNRRKTFTEPRQS
                     KDNKTVDDLKKLVEEKRRKLESERSQLSLRQKDQQIKDEETMRHVDSLMHQIRSLPMK
                     KHAAVPSDMKARFDSLTSSISTLFNNIAEIDDEITNAKVHLYRLKNPSSIVGSGPNGE
                     VTEYDQKKARQKAVLAARMAALTGTPIETPSEADLRREEQGLNEEVAKIKEESRKNQE
                     ILNDIKSSITEISAPISTFIYGSGNADKDPAYERWELGIGLEPEVCDFIRKLKETQTQ
                     AQAQEQARAQEQARAQEQARAQEKARAQEKARAQEQARVQEQARAQEQARAQEQARAQ
                     EQARAQEQARAQEQAKADAASRESTRSPEEFARWPQDQSPSHPGLTASVSPQSQSVSV
                     SNRGTPQLGQQQMGSGFYSDYQSADARAAYVRQQSQLKQPAPAPTSTTDFNSEDEEDE
                     EERSLREQLAALKLKRKAEKEAKLAVGRNQTGASQDPAVRASPDEWDEQPSRPSHTPV
                     YSTSPAMASQGELPKQGSSAPHLHPTTTGDRSPFFKQKQGSTSTFDLKAAEQQRRLQR
                     GLDDGDGWSDDEDSSSKPTQPTATTSATDIPSSGADSGARAPVSAAPASIVRPDGSTA
                     TQPPVVPSPPVPQPGPSSGAPIPIAPPLPTLNGQQAGPAPSVAPTGHVERAASQPQIN
                     DGNEDDEDSDVLSIPESVESEDGKDQYTTAIPEIPYIPPPPPLP"
     gene            complement(<739637..>740269)
                     /locus_tag="AGOS_ADR019C"
                     /old_locus_tag="ADR019C"
                     /db_xref="GeneID:4620264"
     mRNA            complement(<739637..>740269)
                     /locus_tag="AGOS_ADR019C"
                     /old_locus_tag="ADR019C"
                     /product="ADR019Cp"
                     /transcript_id="NM_209468.1"
                     /db_xref="GeneID:4620264"
     CDS             complement(739637..740269)
                     /locus_tag="AGOS_ADR019C"
                     /old_locus_tag="ADR019C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER011W (TIR1) and YIL011W (TIR3) and Non-syntenic homolog
                     of Saccharomyces cerevisiae YBR067C (TIP1)"
                     /codon_start=1
                     /product="ADR019Cp"
                     /protein_id="NP_984115.1"
                     /db_xref="GeneID:4620264"
                     /translation="MKFQSAAAVAALVATAVAAVDKLESSSLDVLFSDAQAHTQDYMG
                     FFKPVGTHDPPRGLKEAFFKLLAGNFPTEADYEAIDFETVKNGVKDLPWYNDRLAKPL
                     AAIGGAAEQPAKTEAPASSAPASSAPAKTEAPASSAPASSAPAKTEAPASSAPASSAP
                     ASSAPPAPASSAPAASTSSHAVATKDGAANVLPWSAGLGVVVAGAIGMLM"
     gene            complement(<740845..>742659)
                     /locus_tag="AGOS_ADR020C"
                     /old_locus_tag="ADR020C"
                     /db_xref="GeneID:4620265"
     mRNA            complement(<740845..>742659)
                     /locus_tag="AGOS_ADR020C"
                     /old_locus_tag="ADR020C"
                     /product="ADR020Cp"
                     /transcript_id="NM_209469.3"
                     /db_xref="GeneID:4620265"
     CDS             complement(740845..742659)
                     /locus_tag="AGOS_ADR020C"
                     /old_locus_tag="ADR020C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL014W (MNT3)"
                     /codon_start=1
                     /product="ADR020Cp"
                     /protein_id="NP_984116.3"
                     /db_xref="GeneID:4620265"
                     /translation="MILQRQVQRRWLPSCRALLVACVALLLLWWARASWSTRSTVANN
                     NGLRAALKFSPLFMLDTDSYRSPFGGWGERSLRMRCKTYFRQTYEVHNAWENRLLLRN
                     EDQYFKDIVASLAMERLRVYDECFISGGLAVHDSMLEPLTRIELRTRMFPFLAPSHRQ
                     DLIWPTVINATSGRHIRRLLKISTGELHRIRPDRSFWYNWREFANGRGIAVAVNDELA
                     DSFQALLAVLDHLGNTLPVQAVHNGGELSQRRFDELVAHIQAHSRQQVFFVDCTPTLR
                     NMWLRKFARVPPSRLAALFNSFDEFVLLDASAVPFVPPAQLLALPEFADTAALFFKGR
                     AYTTQPQRSCLHSMARLLPSAEEARLWRGAAAFNASGAAAAFNASGAAAARDGAAAAL
                     LRAGLVDGLDHALVLVRKPRALAALLAALLLDLQPRAPGCRPHARSLFPLALHAMALP
                     YAVHPGAAGALGELDPAAPADCPVLCSAQLAHLDAAGRLLWASGGLRRCHTSDARRDF
                     RDNDAHFRPAPASPDGLAEARARPLSVHAFLAPASPAGWTPHPDCAHTTHCAALCRQP
                     SADVMLGTLLRFGQAERRRHADLTRIWNDALPAFLRQA"
     gene            complement(742765..742837)
                     /locus_tag="AGOS_t0073"
                     /db_xref="GeneID:4620266"
     tRNA            complement(742765..742837)
                     /locus_tag="AGOS_t0073"
                     /product="tRNA-Thr"
                     /codon_recognized="ACU"
                     /db_xref="GeneID:4620266"
     gene            743538..743609
                     /locus_tag="AGOS_t0074"
                     /db_xref="GeneID:4620372"
     tRNA            743538..743609
                     /locus_tag="AGOS_t0074"
                     /product="tRNA-Met"
                     /note="Initiator-tRNA"
                     /codon_recognized="AUG"
                     /db_xref="GeneID:4620372"
     gene            <743735..>744265
                     /locus_tag="AGOS_ADR021W"
                     /old_locus_tag="ADR021W"
                     /db_xref="GeneID:4620373"
     mRNA            <743735..>744265
                     /locus_tag="AGOS_ADR021W"
                     /old_locus_tag="ADR021W"
                     /product="ADR021Wp"
                     /transcript_id="NM_209470.1"
                     /db_xref="GeneID:4620373"
     CDS             743735..744265
                     /locus_tag="AGOS_ADR021W"
                     /old_locus_tag="ADR021W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR009W (ADI1)"
                     /codon_start=1
                     /product="ADR021Wp"
                     /protein_id="NP_984117.1"
                     /db_xref="GeneID:4620373"
                     /translation="MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQD
                     EVDAVACARHYSNRDEVTISPASFPSEDAFRDKLAVFYTEHLHEDEEIRYALAGEGYF
                     DLRDATTGDWIRVKLTTGDLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRPE
                     GDARPVHKEYLASLAI"
     gene            <744696..>745769
                     /locus_tag="AGOS_ADR022W"
                     /old_locus_tag="ADR022W"
                     /db_xref="GeneID:4620267"
     mRNA            <744696..>745769
                     /locus_tag="AGOS_ADR022W"
                     /old_locus_tag="ADR022W"
                     /product="ADR022Wp"
                     /transcript_id="NM_209471.2"
                     /db_xref="GeneID:4620267"
     CDS             744696..745769
                     /locus_tag="AGOS_ADR022W"
                     /old_locus_tag="ADR022W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR010W"
                     /codon_start=1
                     /product="ADR022Wp"
                     /protein_id="NP_984118.2"
                     /db_xref="GeneID:4620267"
                     /translation="MLNSTVIGRDVGEAAAALGGGAPGFGSYWPRIDQFYIPPWLDVQ
                     FLANNIISFTPLFSYGTTVWSIKRSKTALGFSIDICATMLIASILRVSYYLITPYDVA
                     LLRQSLVMIFIQLILLYTSLCYRPEEYKYESLKPVERFGQLSQDVWQEFFPLCSMGAG
                     WKGIWQAMSWNSFAGYMEKMLLVALYKFLKFFDPGYQRIGAFWQWNNPRYFWLFLLWF
                     TCGQFLMTFFIARVMNLEWLGQWLGSFIGSLGLLIEALLPLPQISILHTLKSVQGFKL
                     ILLVSWLCGDILKISYLVFGAKNISMIFFLFALFQMGLDIYIAFIYVYYKYYFPKYRR
                     KSEPPRIEMQMLLSNGEAAAFSV"
     gene            complement(<745828..>748002)
                     /locus_tag="AGOS_ADR023C"
                     /old_locus_tag="ADR023C"
                     /db_xref="GeneID:4620268"
     mRNA            complement(<745828..>748002)
                     /locus_tag="AGOS_ADR023C"
                     /old_locus_tag="ADR023C"
                     /product="ADR023Cp"
                     /transcript_id="NM_209472.1"
                     /db_xref="GeneID:4620268"
     CDS             complement(745828..748002)
                     /locus_tag="AGOS_ADR023C"
                     /old_locus_tag="ADR023C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR017W (PET127)"
                     /codon_start=1
                     /product="ADR023Cp"
                     /protein_id="NP_984119.1"
                     /db_xref="GeneID:4620268"
                     /translation="MLGARNLRPLCCDRVVLGSRRIGSGIRCGSTETANVADEMTRNT
                     LDSVLATSEKLSSSVRRWPRPRRAAAARGAGSEKHIVLTGPFSMGLQEAGATELPPRL
                     AHGLERCLFQPLSVVPLRDRRSGVYNFEPFIERVIKVQDFDFEAIADFVPPSRDLRLL
                     ERAKEGQARYVSSTSAMSGVLSHLHYLLSNFRPLNGRHLSATLLRKDAQVTKCCKMTS
                     SMLLQRRSQAPPIFSLSSDSSADREIILSQLGHALEALLTTDQADFARIYDKGKRAQP
                     GSQPLGKGHATSAFRFNKHGRFLLRSQLDAHDPKLPGTGVFDLKTRAVAAVRHDLDYV
                     SQNGNTTGYQLMRRSGQFESYEREISELVRNAMLKYSFQARIGAMDGIFVAYHNISRI
                     FGFQYIPLEEMDYIIHSSADRAAAMSLTRRESALQELFNPVEYVTRYRFENTARETAS
                     TLAQAEFNYSMRILEHLFDEITSYFPESVPTVRIMLKTVEHKDKPPSMVAIATPLDTK
                     QSEQLEKFNLQREFLNSDPVSFTRHVNELHDFYHSVMPGSVKFTVSVKHSMSQDQKPV
                     WTRSSAFFKRNKADQQKLMDAASSDYYGPHWKHPYFFSPEDVSRWNIRVSISNPVAAN
                     AREYAQLLQDDIAFLDGQAVVKKKETISNGKHGKMATAAKGSQLDQVSQLQALLRAFG
                     IKGQKDEQVTMERDRRSKNKYLLMWDGQKRQRVTTDPKDLTR"
     gene            <748361..>749779
                     /locus_tag="AGOS_ADR024W"
                     /old_locus_tag="ADR024W"
                     /db_xref="GeneID:4620269"
     mRNA            <748361..>749779
                     /locus_tag="AGOS_ADR024W"
                     /old_locus_tag="ADR024W"
                     /product="ADR024Wp"
                     /transcript_id="NM_209473.2"
                     /db_xref="GeneID:4620269"
     CDS             748361..749779
                     /locus_tag="AGOS_ADR024W"
                     /old_locus_tag="ADR024W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL021C (AIM17)"
                     /codon_start=1
                     /product="ADR024Wp"
                     /protein_id="NP_984120.1"
                     /db_xref="GeneID:4620269"
                     /translation="MHFSKAIQTTRQIGRGLLLARKQSNGPMGLRPGAQQPDAAGEQV
                     HSAGSVVNTMFNKHSTTVTYTWPGREEPQTVAFSNVFLRDASRSPASVDAVSSQKLFT
                     TGAVLANEQATVPHSVAVTADGRAIEIGWGDGDMYAYPLEFIHQHSGTEPLQRTPRQP
                     PVLWDKQLLKTNIADLLSIDYESFMAPDCDGKLYQTLVNLQKYGISFITNIPDETTSE
                     LDSWYVKTIAERIGNIRHTFYGELFDVINKAGAENIAYTNVPLPLHMDLLYLETVPGW
                     QLLHAIRNSTGATDLGMNYFADAFHAARYVRETDSDAYDALTHMPVNYGYNRDDKRYY
                     RSRPVIEEHEFGEGTSLSSQFNRLIKCVNYSPPFQKPFTYGIWEKPKGAEVSTPQGKL
                     TERFVFRDFQRGLRLFEQYINNPENQFRVKLPEGTCVIFNNRRILHARTGFTGERWLK
                     GCYLDSDSVLSKLQYLEEKYGG"
     gene            <749923..>751017
                     /locus_tag="AGOS_ADR025W"
                     /old_locus_tag="ADR025W"
                     /db_xref="GeneID:4620270"
     mRNA            <749923..>751017
                     /locus_tag="AGOS_ADR025W"
                     /old_locus_tag="ADR025W"
                     /product="ADR025Wp"
                     /transcript_id="NM_209474.1"
                     /db_xref="GeneID:4620270"
     CDS             749923..751017
                     /locus_tag="AGOS_ADR025W"
                     /old_locus_tag="ADR025W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL022C (SPO11)"
                     /codon_start=1
                     /product="ADR025Wp"
                     /protein_id="NP_984121.1"
                     /db_xref="GeneID:4620270"
                     /translation="MVSLRHSLRELMDEHGTRGKLLNALQHTAKREIQLGPRTPVDRI
                     EAEVGMALDLIKNAMQLNAVPVVIKLVRCDGRCSRIVYPARGSTTSAGARRAATFVSV
                     LKTVHTRMRSRQTATVRDVFYGNVELYGRQQVVVDWLVALEQCFGVEKSVFRILAAQK
                     GLVHVPVPLEVEGQELKGVGLIPYVSDSSCVSCKQWDAVEAVIVVEKEAVFHRLTRAA
                     AYCSNKIIITGKGYPDQLTRVFLYRLLASAPRNVAVRAIADSDPYGIDIVLKYCGASP
                     APGMQRFDYGGIFIRDLIDAGVCANPVTEGCTLQDMSLREWKMAQKMLIALCNEGERG
                     YLSNSGAASIRRELQWQLLSFKKGEMNAIM"
     gene            complement(751037..751148)
                     /locus_tag="AGOS_t0075"
                     /db_xref="GeneID:4620271"
     tRNA            complement(join(751037..751072,751113..751148))
                     /locus_tag="AGOS_t0075"
                     /product="tRNA-Pro"
                     /codon_recognized="CCA"
                     /db_xref="GeneID:4620271"
     gene            <751856..>752485
                     /locus_tag="AGOS_ADR026W"
                     /old_locus_tag="ADR026W"
                     /db_xref="GeneID:4620374"
     mRNA            <751856..>752485
                     /locus_tag="AGOS_ADR026W"
                     /old_locus_tag="ADR026W"
                     /product="ADR026Wp"
                     /transcript_id="NM_209475.1"
                     /db_xref="GeneID:4620374"
     CDS             751856..752485
                     /locus_tag="AGOS_ADR026W"
                     /old_locus_tag="ADR026W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL007C (ERP2) and YOR016C (ERP4)"
                     /codon_start=1
                     /product="ADR026Wp"
                     /protein_id="NP_984122.1"
                     /db_xref="GeneID:4620374"
                     /translation="MLYPVVFLIGLLSGLAAVSADFSTRTPMSVMLPAFSRECVYFDL
                     KEGQDHILMSYQVLTGGNFEIDFEITAPEGNVIGSDTRSKYGDFHVYSWGVGQYSFCF
                     TNSYGTALKKVEFTLGLQEQERKVEKEDPEDLLALDSIDEINRNFDHITKIMAYLRAR
                     EWRNMSTVKSTESRLVWLSVLTALVMIGVSAGQSIMVQFFFKDRHRNYV"
     gene            <752725..>753951
                     /locus_tag="AGOS_ADR027W"
                     /old_locus_tag="ADR027W"
                     /db_xref="GeneID:4620272"
     mRNA            <752725..>753951
                     /locus_tag="AGOS_ADR027W"
                     /old_locus_tag="ADR027W"
                     /product="ADR027Wp"
                     /transcript_id="NM_209476.2"
                     /db_xref="GeneID:4620272"
     CDS             752725..753951
                     /locus_tag="AGOS_ADR027W"
                     /old_locus_tag="ADR027W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR108W (RPN7)"
                     /codon_start=1
                     /product="ADR027Wp"
                     /protein_id="NP_984123.2"
                     /db_xref="GeneID:4620272"
                     /translation="MSDEESNYVEPAVNKVPNYEVSEHAFLLTQPKLHNRHPESLEFV
                     MKAIREEKMAPYYKYLCEEYLPSGLIEWDQALYDSLVDANTQDITELKEHLQEIEEKD
                     EGELEKAQCWIKLGEYYAQIGDRKNAEETLTEAINKAVSMGAKIDIMLTITRLGFFYN
                     DQVFVKQKLAQINSMIEKGGDWERRNRYKTYKGIHCLAVRDFKEAALLLVDSLATFTC
                     VELTSYENIATYASVAGLYALERVDLKAKVIDSPELLSLMSTTPALQSITSLTISLYT
                     SEYSSYFPYLLETYDNVLMPCKYLNRHADCFVREMRRKVYAQLLESYKTLSIKSMANT
                     FGVSVEFLDKDLSKFIPNKQLNCIIDRVNGIVETNRPDNKNAQYHQLIKQGDGLLTKL
                     QRYGAAVRLTGTDRSV"
     gene            <754378..>756876
                     /locus_tag="AGOS_ADR028W"
                     /old_locus_tag="ADR028W"
                     /db_xref="GeneID:4620273"
     mRNA            <754378..>756876
                     /locus_tag="AGOS_ADR028W"
                     /old_locus_tag="ADR028W"
                     /product="ADR028Wp"
                     /transcript_id="NM_209477.2"
                     /db_xref="GeneID:4620273"
     CDS             754378..756876
                     /locus_tag="AGOS_ADR028W"
                     /old_locus_tag="ADR028W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR089W (NNF2)"
                     /codon_start=1
                     /product="ADR028Wp"
                     /protein_id="NP_984124.2"
                     /db_xref="GeneID:4620273"
                     /translation="MTKLCAGPRRFTTRHRMKDTIALLLVFLSFNHLIALCILGLFAA
                     ASSSEGFLTECVSQLYWRWYGRPGKNGALSIFGFTLRKPHLERVKNAKRAPGALAESV
                     PTRPAPGSPAMLPKRALLALELFMAWMLQRFGRHHFKVPVENLAMSIVASSLVNDRGE
                     LLSYATTCSVTYAVTTRIVWHIGVYYKWPYLFRLFPAEGEAIEKHLAPPYTHVGSASA
                     STFEHYILLLKYIISFHVVAWQFYASISRRPTPTPSLLNVKPLRMDSAGRFALNPASE
                     SKANSAEQSTVTGGPCHEKPIVTAASQNSLTVSDGSCDSPRLSSHLLQNPLTNAEINQ
                     DSSVSLVPTFTDRVVDFNTSAITTTGVANFDEKAKVAATAEHKEDSTETPGLFAYYTE
                     VFLTRAANEESGFSSELDTCISRVNQFNLIQKLLRAKDRFVLPPLWATFTVLKVLFLR
                     NIFWERLPPALGPRKPSPRQSVILKPQELPANEEYYSDYKKLQLVAPAPTESTVCITE
                     IGKTTATFSVSNMARGELLVLVNELLWPYFSSAVTDNSTSRLCVVINGLVPACTYAIQ
                     FVNRIDGVGDHLFADVLLQTEDKDGTKRSEQAPVTFECRPILSPLMTLKRSVLYTNAR
                     LAEERAKLKKAKKETARKINALRQDVDHMKSKIESNSSQDEKSTFKIDNLKTVLHKNE
                     DQILALEASLAAIHDEQTALETEYLRSKENRLQRRSEYDELDATFKRDILSAHERLSK
                     LQSDLEQLHAKRERLLLRKERLQNDLGQYTQECDKFREQFLRRRERARADKRQRHLQE
                     ADELELKAKGLEQDISRLEAENKAMARLIRPAEY"
     gene            757086..757157
                     /locus_tag="AGOS_t0076"
                     /db_xref="GeneID:4620274"
     tRNA            757086..757157
                     /locus_tag="AGOS_t0076"
                     /product="tRNA-Thr"
                     /codon_recognized="ACA"
                     /db_xref="GeneID:4620274"
     gene            <757445..>761089
                     /locus_tag="AGOS_ADR029W"
                     /old_locus_tag="ADR029W"
                     /db_xref="GeneID:4620375"
     mRNA            <757445..>761089
                     /locus_tag="AGOS_ADR029W"
                     /old_locus_tag="ADR029W"
                     /product="ADR029Wp"
                     /transcript_id="NM_209478.2"
                     /db_xref="GeneID:4620375"
     CDS             757445..761089
                     /locus_tag="AGOS_ADR029W"
                     /old_locus_tag="ADR029W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR090W (UTP22)"
                     /codon_start=1
                     /product="ADR029Wp"
                     /protein_id="NP_984125.2"
                     /db_xref="GeneID:4620375"
                     /translation="MDNVVVHRSCIDNQKLLAMAPTKRNASAVEDASDVSSTKKALIE
                     TSGQGAAEQIEEAMDDATDSSSGEEEDIGEQKRSTRKAGVGAQDIQIARETAELFKSN
                     IFKMQIDELQEQVKLKESHILRVEKFLHRLYDLLQGVPEWEGRGLAEVEAFFKDKAVC
                     VPFCDPKPASSTPYKFGYKTPSVALIGSFALKTAIYQPQGSSIDVLLTMPEELFEKKD
                     FLNFRCVHKRSVYLAYLTYQLSLALKKNRLEFLHLEYAHRNSDPLQPMLRISCNEASD
                     SEYNFHKTKFSVNLIVGFPYGVFEPKKLLPTRNCIRVGEDNSTPTPFYNFSVLSSCTH
                     EHYLKYLYKTKKQTEAFKEACVLGRLWLAQRGFHSDMSHAALLGGFGNFEFAILMAVL
                     LNGGGVNGNKILLHGFSSYQLFKGIMKYLATMDLCSDGYLQFHSDLDSVSNVPTSKYV
                     EEGFRTPTLFDKTTKVNILSKMSVSGYHMLKLHAQQTLAMLNDVVRDQFAGIFLTKLD
                     KIPSVSYDLSYDLEFPSQEELLSKFGPLEKVRFISFEEFLVNKLANVIRIALGDRIRA
                     EEFELVGHKTKFPINRRKPAGPMNFSSIKIKLLVNPVESEKLVTRGPANKEEQSAEAA
                     EFTSFWGKKASLRRFKDGSIIHSCVWSTSANQPVITSILDYVLKLHISDDVKLSNAIT
                     RQFHSRLPQPNLPGSLKLSVLNSTSFHQLKRSFDNLYKIVFQLKLPLSVKSILPVGAA
                     FRYATMCQPVPYAYSNPEFLQEVILEFETSPKWPDEISALEKAKTAFLLKIQEQLTAQ
                     QGDKYRCYFARDESIPYNLDIVTLNILTPEGYGFKFRVLTERDEVMYLRAISNARSEL
                     KQELERTFLKFTSKYQASIRHTRTLELLSHSFPFYSPVVRLFKQWLDSHLLLGHLPEE
                     LVELIAIKPFVEPYPYAAPGSIENGFLKVLKFLSEWNWKEDPLILDLVRPEDSDDLET
                     SIGASDLDSRAMKKLSEKLTLQQYKTIQANFRSLRNGDPHGMQLQFFVASKNDPSGIL
                     YSTSVPLPIATRLTALAKVAVNLIQVHGLNTQSINLLFTPALKDYDFTVRIRSPTPLR
                     LSSGVLSPDGFKNLDEQPTQFPKDLSTLSEKMDCTYQLVKYLNMKYKNSILFSSHLHV
                     GVHGGPRGDENVITGLIRPAFKSPFRFKANMDCNARPLDPDTVKLNSDAVFREIATFG
                     KELVVSFESS"
     gene            <761419..>762237
                     /locus_tag="AGOS_ADR030W"
                     /old_locus_tag="ADR030W"
                     /db_xref="GeneID:4620275"
     mRNA            <761419..>762237
                     /locus_tag="AGOS_ADR030W"
                     /old_locus_tag="ADR030W"
                     /product="ADR030Wp"
                     /transcript_id="NM_209479.2"
                     /db_xref="GeneID:4620275"
     CDS             761419..762237
                     /locus_tag="AGOS_ADR030W"
                     /old_locus_tag="ADR030W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR109W"
                     /codon_start=1
                     /product="ADR030Wp"
                     /protein_id="NP_984126.2"
                     /db_xref="GeneID:4620275"
                     /translation="MDSSISSATPVCSIGPFRQQLVEHIGLLGYTVIVLSYIKFGGSI
                     VVFLFRLLLQSALLSPFPNRQQLVLRFGGASGRTEGEDEQTPGRGARGAEAEAEDMTK
                     EFLQRIQCALFHAAFTFNCLALVTWIIWPADFQELLGMYRYEGYPGPANTPLPLDNYV
                     MQGEWHGKWFFQLIGEAVPASNIGGNLMAVTYQLLILCLQFGLYMLSCVYFSPLTKTQ
                     LPGYDGSGCTQPAGEGRINVAHINPVEVFRVIHGTTAHFRQGAGARNASPTSMV"
     gene            complement(<762358..>763452)
                     /locus_tag="AGOS_ADR031C"
                     /old_locus_tag="ADR031C"
                     /db_xref="GeneID:4620276"
     mRNA            complement(<762358..>763452)
                     /locus_tag="AGOS_ADR031C"
                     /old_locus_tag="ADR031C"
                     /product="ADR031Cp"
                     /transcript_id="NM_209480.1"
                     /db_xref="GeneID:4620276"
     CDS             complement(762358..763452)
                     /locus_tag="AGOS_ADR031C"
                     /old_locus_tag="ADR031C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR110C (RPC40)"
                     /codon_start=1
                     /product="ADR031Cp"
                     /protein_id="NP_984127.1"
                     /db_xref="GeneID:4620276"
                     /translation="MTCSRNGALTSDLASLSAPRSPRVLSRAFPMSNIVNIEYNRVTN
                     TTSTDFPGFSHQKECAWDVDEFRRTMDVQIKSLDEREANFDLLRVDTSIANAFRRIMI
                     SEVPSVAPEYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDKSLPEAERFTDEN
                     TVVLSLNVKCTHNPDAPKGSTDPKELYRNAHIYARDLKFEPQGKQLETFAKCPVVPAD
                     PDILLAKLRPGQEISLRVHCILGIGSDHAKFSPVATASYRLMPYINIVEPITGPDAEK
                     FVKCFPPGVAAINEKGEAFVQDARKDTVSREVLRHPELEQKVKLGRVRDHFIFNVESA
                     GAMTPEEIFFKSVRILKNKAEYLKNCPITQ"
     gene            <763586..>764701
                     /locus_tag="AGOS_ADR032W"
                     /old_locus_tag="ADR032W"
                     /db_xref="GeneID:4620277"
     mRNA            <763586..>764701
                     /locus_tag="AGOS_ADR032W"
                     /old_locus_tag="ADR032W"
                     /product="ADR032Wp"
                     /transcript_id="NM_209481.3"
                     /db_xref="GeneID:4620277"
     CDS             763586..764701
                     /locus_tag="AGOS_ADR032W"
                     /old_locus_tag="ADR032W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR091W (PRP31)"
                     /codon_start=1
                     /product="ADR032Wp"
                     /protein_id="NP_984128.3"
                     /db_xref="GeneID:4620277"
                     /translation="MDLLEGLDDPPSPQDAHVSAAEAPSGALQQRLHALLQCAPRSRP
                     SALPLLPELHEALAAGQLDLGTLGQLLPVLRDEAADVYRQLEARYRPVFPELAELVPS
                     QRTYVRVLRALETGAPLDELLTREQAMLVAMTRPQAPRADPARWPRELAPHADRHEQL
                     HTAVDAIDAHIVRQAHRLAPTVTALVGPVVAAALLSHAGSVRELAQVPACNLAAIGAP
                     RHAAHARRTDASGVRLRGHVWDTPLVQEQPPALQRQALRMLCARLALAARVDASAPDP
                     ALAARWRADILARIAARAAPPAPAAAAPLPVPADAKPRRRAGRRFRAHRSKFRLSAAR
                     QLQNRAAFGVPERTAVDGFGEEIGLGLSGAPAAPPPR"
     gene            <765140..>766873
                     /locus_tag="AGOS_ADR033W"
                     /old_locus_tag="ADR033W"
                     /db_xref="GeneID:4620278"
     mRNA            <765140..>766873
                     /locus_tag="AGOS_ADR033W"
                     /old_locus_tag="ADR033W"
                     /product="ADR033Wp"
                     /transcript_id="NM_209482.1"
                     /db_xref="GeneID:4620278"
     CDS             765140..766873
                     /locus_tag="AGOS_ADR033W"
                     /old_locus_tag="ADR033W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR092W (DBF2) and YPR111W (DBF20)"
                     /codon_start=1
                     /product="ADR033Wp"
                     /protein_id="NP_984129.1"
                     /db_xref="GeneID:4620278"
                     /translation="MFSGRGNNVRDVDALAQDIGQLSFEGEMENRRHIVIDPPHTPSR
                     YLQRTPNGKSPAGRQGGYLTVENADYSGMDVDERPRDDIDLSRSPKKLPMDFHKRASS
                     TKTKRLVSVCQMFFLDYYCDMFDYVISRRERTRQVMNYLEQQRAQGLHSAQEISEEWQ
                     NYLYRETDILRKRRLKPKNKDFEIITQVGQGGYGQVYLARKKDTKEICALKILNKNLL
                     AKLNGTDHVLTERDILTTTRSEWLVKLLYAFQDPHSLYLAMEFVPGGDYRTLLINTRF
                     LQAPHARFYISEMFCAVDALHKLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSME
                     RIESMRIRLEEVKNLEFPEFKETSMDYRRKMYHRVREKELNYASSTVGSPDYMALEVL
                     EAKNYDFTVDYWSLGCILFESLVGYTPFSGSSSNETYENLRRWKQVLRRPRCENGRPA
                     FSDRTWELITRLIADPINRLRSFEHVKKMKYFAEIDFANLRSMSPPFIPQLDSETDAG
                     YFDDFTNEADMAKYADVFKRQDKLNAMVEESSNSSKLVGFTFRHRKGKTGSSGVLHNG
                     SEHADPFATFY"
     gene            <767013..>768746
                     /locus_tag="AGOS_ADR034W"
                     /old_locus_tag="ADR034W"
                     /db_xref="GeneID:4620279"
     mRNA            join(<767013..767200,767267..>768746)
                     /locus_tag="AGOS_ADR034W"
                     /old_locus_tag="ADR034W"
                     /product="ADR034Wp"
                     /transcript_id="NM_209483.2"
                     /db_xref="GeneID:4620279"
     CDS             join(767013..767200,767267..768746)
                     /locus_tag="AGOS_ADR034W"
                     /old_locus_tag="ADR034W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR093W; 1-intron"
                     /codon_start=1
                     /product="ADR034Wp"
                     /protein_id="NP_984130.2"
                     /db_xref="GeneID:4620279"
                     /translation="MFIPTPILGLAIGGQKFTVRVQACYAGAQTEKKNINIYIYSFSS
                     VKGTVSEAGHSSTMPKQKVLLLRSSSATLDEVLKKAADLNSKSGPFDATIITGAVLTD
                     LAFKPANPVSFPVYVTNGGQFVSELRGSHTICDKLILLNEHGIYELPSGMKIGYFTPS
                     ERIEPSAVDAELEIFKKVGRLDILLTKEWPKSVRSKLEEVSGTDTVDQLVISSKPQYH
                     FATLGDKYFELEPFGWDRSSMPDITRFINLATFGSGEKWAYAFNITVGTDQEASVPTN
                     LTTNPFITMDRPKRDLDSDPLPPPKKRTKVLPAACHFCLSNPSVEDHMVISIGKHSYL
                     TIAKGPLSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTTSAIMETEMGKEVMRYESA
                     LVNMNYKKFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFTTALDRQLHINNEKFKK
                     NANFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVFIATFKSEDSIDLQF
                     GRRVAAFLLKLPKRVIWNSKACLQSKEEEEIEVKDFQRSFQDFEFTE"
     gene            complement(<768814..>771330)
                     /locus_tag="AGOS_ADR035C"
                     /old_locus_tag="ADR035C"
                     /db_xref="GeneID:4620280"
     mRNA            complement(<768814..>771330)
                     /locus_tag="AGOS_ADR035C"
                     /old_locus_tag="ADR035C"
                     /product="ADR035Cp"
                     /transcript_id="NM_209484.2"
                     /db_xref="GeneID:4620280"
     CDS             complement(768814..771330)
                     /locus_tag="AGOS_ADR035C"
                     /old_locus_tag="ADR035C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR112C (MRD1)"
                     /codon_start=1
                     /product="ADR035Cp"
                     /protein_id="NP_984131.2"
                     /db_xref="GeneID:4620280"
                     /translation="MSRVIVKGLPIYLEEARLRAHFLKRLQQQGRGSEDQITDVKIVK
                     DKSGNSRRFAFIGYRSEQDAFDAIEYFNGSFIDTARIEVAMAKSFADPRVPTPMREKR
                     REALKRLREREDRILAEKRQKQTKPQHGIDAEISKNKQLQEFIETMNPKMAAAAANPM
                     ARAAEQPASANPLLSALHGAEDDEEVDMFQLSEQESDDEYTDLHQRPQSAEEDELEEP
                     AVGQDLDAAPAPDAAEDGMATNQEVSDLEWLKNRRIRIRDGEDAEAAPAPQEQAAEEP
                     AEQEVPQEDEVSAEEAALTKIRATGRLFLRNILYDATEEDFKQLFSPYGELEEVHVAV
                     DTRTGQSKGFAYVLFKDPEHAANAYIELDKQIFQGRLLHILPADAKKTHRLDEFDLKN
                     LPLKKQRELKRKATAAQQTFSWNSLFMNQDAVLSSVAAKLGMEKSQLIDPENSGSAVK
                     QALAEAHVIGDVRKYFEARGVDLTQFEKFKKVTERDDRIILVKNFPHGTTREELAELF
                     LPFGKIERLLMPPSGTIAIIQYRDVPAARGAFTKLSYKRFKEAILYLEKGPKDCFSRE
                     PRGDELLEGDAAPEDVKEIKKSVEDVMDADSKTPSSEATAIDGPTVSIFVKNLNFSTT
                     SAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAGAVIAAMDGAV
                     IDGHKIQLKISHKQSSLPKTSKGSKKKISGKIIVKNLPFEATRKDVFELFSSFGQLKS
                     VRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQYAEQESDDVEEQI
                     SKMTMKMKKQAAVSKMGALRNSGKRKIDMSDDENDGLNGF"
     gene            complement(<771519..>772541)
                     /locus_tag="AGOS_ADR036C"
                     /old_locus_tag="ADR036C"
                     /db_xref="GeneID:4620281"
     mRNA            complement(<771519..>772541)
                     /locus_tag="AGOS_ADR036C"
                     /old_locus_tag="ADR036C"
                     /product="ADR036Cp"
                     /transcript_id="NM_209485.1"
                     /db_xref="GeneID:4620281"
     CDS             complement(771519..772541)
                     /locus_tag="AGOS_ADR036C"
                     /old_locus_tag="ADR036C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR128C (ANT1)"
                     /codon_start=1
                     /product="ADR036Cp"
                     /protein_id="NP_984132.1"
                     /db_xref="GeneID:4620281"
                     /translation="MSFENAVIGATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEE
                     AGEERAGSRRQNRIKPIALRSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAG
                     FIQSFSYFFWYTLVRKHYFRLKQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVA
                     TRQQTRGQAAGAADMRTVAREVHAENGWRGFWAGLKVSLVLTVNPSITYATYERLREA
                     LFPTPAAASHLVDSAALLSPGQNFVMGVLSKIVSTVLTQPLIIAKASLQRSGSCFQDF
                     HQVLHHLYSTEGPLSLWKGLGPQITKGVLVQGLLFMFKGELTKMLRKLMFYLALLRSS
                     RRALKG"
     gene            <772903..>773661
                     /locus_tag="AGOS_ADR037W"
                     /old_locus_tag="ADR037W"
                     /db_xref="GeneID:4620282"
     mRNA            <772903..>773661
                     /locus_tag="AGOS_ADR037W"
                     /old_locus_tag="ADR037W"
                     /product="ADR037Wp"
                     /transcript_id="NM_209486.2"
                     /db_xref="GeneID:4620282"
     CDS             772903..773661
                     /locus_tag="AGOS_ADR037W"
                     /old_locus_tag="ADR037W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR129W (SCD6)"
                     /codon_start=1
                     /product="ADR037Wp"
                     /protein_id="NP_984133.2"
                     /db_xref="GeneID:4620282"
                     /translation="MSQYIGKTISLVSNNDNRYVGLLESIDSEQGVVTLNNVRCFGTE
                     GRRGGGADEVYPNPAVYNSVVFNGNDVKDLSILDCALEEVQPALPPQVPAAVAGYGVY
                     APAASEGAAPAAAPAAAAAPAAAAGAVAAGAAGRAGADFDFEQSNARFSKGAAAGTAG
                     AEAPAAAAGEEVFYDKKSSFFDSISTSTETNTNMRWKDERQLNMDTFGQASARPRNGR
                     GWFRGRGGRGGRGRGRGGRRGGGGGGARPAKVDF"
     gene            complement(<773742..>774326)
                     /locus_tag="AGOS_ADR038C"
                     /old_locus_tag="ADR038C"
                     /db_xref="GeneID:4620283"
     mRNA            complement(<773742..>774326)
                     /locus_tag="AGOS_ADR038C"
                     /old_locus_tag="ADR038C"
                     /product="ADR038Cp"
                     /transcript_id="NM_209487.1"
                     /db_xref="GeneID:4620283"
     CDS             complement(773742..774326)
                     /locus_tag="AGOS_ADR038C"
                     /old_locus_tag="ADR038C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR131C (NAT3)"
                     /codon_start=1
                     /product="ADR038Cp"
                     /protein_id="NP_984134.1"
                     /db_xref="GeneID:4620283"
                     /translation="MSSVKPFEATDLFKLNVINLDPFTENFPIEFYLEYLILWPSLFF
                     KSVETTSHTARDAVSGYMMAKTEGKAAEWHAHITAVTVSPSFRRIALASMLCNVLETT
                     TDFKPHEVNFIDLFVKCNNALAIRLYEKLGYSVYRRVVGYYNTAEEYRLHSLKVLRED
                     KDAFDMRKAMPRDCGRSIRPNGRKHLCHPHEVRF"
     gene            <774758..>776269
                     /locus_tag="AGOS_ADR039W"
                     /old_locus_tag="ADR039W"
                     /db_xref="GeneID:4620284"
     mRNA            <774758..>776269
                     /locus_tag="AGOS_ADR039W"
                     /old_locus_tag="ADR039W"
                     /product="ADR039Wp"
                     /transcript_id="NM_209488.1"
                     /db_xref="GeneID:4620284"
     CDS             774758..776269
                     /locus_tag="AGOS_ADR039W"
                     /old_locus_tag="ADR039W"
                     /note="NOHBY423; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ADR039Wp"
                     /protein_id="NP_984135.1"
                     /db_xref="GeneID:4620284"
                     /translation="MFRTNLFQNKIDAYSNKTAKRKLFHLYEGDDREVFQYLSDQGTL
                     KNPDVLDTYLDNAAPDVRDFHQFVGRLLCLYDVTHDQYVYCATEFRQNARNILFPRLE
                     RIFEIDSKMIGALPLRRCYKRIKQRFDSDLQEVVYNACEQRRAIEGNWIERQVQADDP
                     AVNNRFSAIINWENQECLDAGAYDRALQDNIVTWFVRMNKRVIEKLSARTSKFKTLCK
                     SWFSVSRNYCYWSVLECVMQSEHVYYEFMLEKLKKKADLMTNSPQVEGEITIADVQLV
                     VDQFKELETSFSALEEDDNLLEDISSSDSSISSPQTLIPITNQAHWKKPKPHIEFAGK
                     VTRVYHPFQTPGDYLLEVPHTDSLAPGPLDIDTTYQQFSTRFRDLMVIYLRWDFVQKS
                     GQSPGTGPFGWFFLMFRNGDPVPVYITERVHKVVFEKPEEDENVPCDEEQHIKMEWPN
                     ELKMPVCNTKRWEGRSVYIPMDEFAKDLVFRSKEAAVNRYYHTLGQLRELECL"
     gene            complement(<776327..>777748)
                     /locus_tag="AGOS_ADR040C"
                     /old_locus_tag="ADR040C"
                     /db_xref="GeneID:4620285"
     mRNA            complement(<776327..>777748)
                     /locus_tag="AGOS_ADR040C"
                     /old_locus_tag="ADR040C"
                     /product="ADR040Cp"
                     /transcript_id="NM_209489.1"
                     /db_xref="GeneID:4620285"
     CDS             complement(776327..777748)
                     /locus_tag="AGOS_ADR040C"
                     /old_locus_tag="ADR040C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR117C"
                     /codon_start=1
                     /product="ADR040Cp"
                     /protein_id="NP_984136.1"
                     /db_xref="GeneID:4620285"
                     /translation="MEDPPGSVKVVVAQFLQKYGYQKTLGHFLNEAGLSLGALQSGDA
                     AEDLETIIGERTQYLERARNDEPSQLDVGVSSIACEQLPRWNYAVQWAAARELQGANG
                     LVISADLSGAQPVLATSSREVLQYGSTLQLEKRSVSSIGCIRKFGWFAGPRGSRERYA
                     LGMDGSLALLGADGVPLRSWRLHGRMITHAAFFVTTERKILCFTYGLDGYIRLHEFDE
                     EMEEPKSMDEYKLVNSCTGFQLAQTDDDEPTLYYTREDHTHLFVLQVHDLKLQEVYRI
                     ALNAAQFSTHSFSVRDMIVVNFEHIYAADDRNSHLPWSGPGSVLIAATSHTPYMRLIF
                     VELPNTKELPVSSGVPHTNSATVPNLLDSFTGNSGTTPHQKPAVNSGPKVYYDKVKRN
                     IATPVPQNLYSQPILALCTVSSGLLVGADDGVYAVDLHLGNTWKLALPNGNERVKAMA
                     LHDDFLLVSLSNKTVFIWEAQKD"
     gene            <778176..>780617
                     /locus_tag="AGOS_ADR041W"
                     /old_locus_tag="ADR041W"
                     /db_xref="GeneID:4620286"
     mRNA            <778176..>780617
                     /locus_tag="AGOS_ADR041W"
                     /old_locus_tag="ADR041W"
                     /product="ADR041Wp"
                     /transcript_id="NM_209490.2"
                     /db_xref="GeneID:4620286"
     CDS             778176..780617
                     /locus_tag="AGOS_ADR041W"
                     /old_locus_tag="ADR041W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR202W (MCM7)"
                     /codon_start=1
                     /product="ADR041Wp"
                     /protein_id="NP_984137.1"
                     /db_xref="GeneID:4620286"
                     /translation="MNAALPSIQLGIDYGRIKEEIEDFLVHFKGSSSTEDAGEIEMEE
                     DMVGAGPKYLDLLQQVANRELTTLYVELDDVAAYQTMRGEAVDRMPGPQLCELILENA
                     LRYTELFSEVVDKLLPPPTKEFDHHDDVLDVIVHQRQLRNQRQITERREELEQMDEDA
                     GEEQLNELARQQDEGQEDLFPPMLMRRYNLYFTPLTKFQGVGKHVRSHYGPFSAREVK
                     GSHLGKLITVSGIVTRISDVKPAVLVTAYTCDQCGAEVFQEVNKRTFTPFLECTSRQC
                     QQNQNKGQLFMSTRASKFSAFQECKIQEMSHQVPIGHIPRTLTIHVNGPLVRSMVPGD
                     IVDVTGIYLPAPYTGFKALKAGLLTETYLEAQYVRQHKKKFSSFEITSDVEKRVMSIV
                     QQGDVYTRLAKSIAPEIYGNLDVKKALLLLMVGGVHKTVGDGMKIRGDINICLMGDPG
                     VAKSQLLKSICKITPRGVYTTGKGSSGVGLTAAVMKDPVTDEMVLEGGALVLADNGIC
                     CIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPVYGRYNPRLS
                     PLENINLPAALLSRFDIMFLLLDMPHRENDEKLAEHVAYVHMHNRQPELDFEPIEPAA
                     MREFIAFAKTKRPIMTQEVNELVVQSYIRMRQDSKNVTDPKQQFGQATPRTLLAVIRI
                     SQALAKLRFSDQVDVEDVEEALRLIQVSKDSLYNDTQTRADDETPTTKIFTIIKKMAM
                     ETARLNKNLPMDTITKIVRSRGFTQQQLDACVEEYTYLNVWHKLEEENALKFVGGSEY
                     DVEMTPSQDTEMVDA"
     gene            <781086..>782414
                     /locus_tag="AGOS_ADR042W"
                     /old_locus_tag="ADR042W"
                     /db_xref="GeneID:4620287"
     mRNA            <781086..>782414
                     /locus_tag="AGOS_ADR042W"
                     /old_locus_tag="ADR042W"
                     /product="ADR042Wp"
                     /transcript_id="NM_209491.1"
                     /db_xref="GeneID:4620287"
     CDS             781086..782414
                     /locus_tag="AGOS_ADR042W"
                     /old_locus_tag="ADR042W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL066W"
                     /codon_start=1
                     /product="ADR042Wp"
                     /protein_id="NP_984138.1"
                     /db_xref="GeneID:4620287"
                     /translation="MPYPVISLKPSYNSIIRGCPGVPQTLPRIECELRIRSNDGRPML
                     IDRIEVLLKTSEVLHSSVPAFTSKARLEKDIVHYKRSIRLSDKKIIGIDIPLTIALPD
                     DIKDTNYNKFGYTFTSFECNVLYFPKTEKHAVANATMNTESFTTVVNVEKYNLFASPS
                     LFPPLRRKFLSPDRKFKIKYCIQNPCLTTDDLLHINLIIVPNLSRNYPGSYSNKLFNK
                     KVKLKSIVFDVKEVLEVYDSHADVKENTLQSLIKPFNTTINEAGIEVTSDIKIYTKNV
                     YFKEFERCMNEPAVMFQLPHNEPNLDAPIPETVLLKGKSKNVQAFQYHCSITSRGQLF
                     SITHGLSIKFKISNGKDFEIYQPLDVSAWPKVDINLVEKVIAHETEVAMHAKNFYDSF
                     GGIRRNRTTGALEYPPLPPVVYTADKNTLKHVGVMYNMDNKYSHKIPLIE"
     gene            <782589..>783311
                     /locus_tag="AGOS_ADR043W"
                     /old_locus_tag="ADR043W"
                     /db_xref="GeneID:4620288"
     mRNA            <782589..>783311
                     /locus_tag="AGOS_ADR043W"
                     /old_locus_tag="ADR043W"
                     /product="ADR043Wp"
                     /transcript_id="NM_209492.1"
                     /db_xref="GeneID:4620288"
     CDS             782589..783311
                     /locus_tag="AGOS_ADR043W"
                     /old_locus_tag="ADR043W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL065W (VPS28)"
                     /codon_start=1
                     /product="ADR043Wp"
                     /protein_id="NP_984139.1"
                     /db_xref="GeneID:4620288"
                     /translation="MSDRAPVNYYGSKNSTRSFNNALFEEVPLFDASTTPQQREVTET
                     LSEIYSIIVALEQVEKAYLKDGISSDDYTVSVNKLIAQYKTYLANNSDVQAVFGDLQQ
                     FRQRWNINASNAIARLERGMPVTVEHGIQGSSGDNPASSSGTQFNAKAVAEATGNFIT
                     VMDALKLRLKAKDQLHPLMSELLLSINRVGPQDFEKRSKLVEWIVQINKMKANESLGD
                     DEARELLFDLDSAYKAFYTLLG"
     gene            complement(<783328..>784239)
                     /locus_tag="AGOS_ADR044C"
                     /old_locus_tag="ADR044C"
                     /db_xref="GeneID:4620289"
     mRNA            complement(<783328..>784239)
                     /locus_tag="AGOS_ADR044C"
                     /old_locus_tag="ADR044C"
                     /product="ADR044Cp"
                     /transcript_id="NM_209493.1"
                     /db_xref="GeneID:4620289"
     CDS             complement(783328..784239)
                     /locus_tag="AGOS_ADR044C"
                     /old_locus_tag="ADR044C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL064C (CWC27)"
                     /codon_start=1
                     /product="ADR044Cp"
                     /protein_id="NP_984140.1"
                     /db_xref="GeneID:4620289"
                     /translation="MSSEPSASGKCVLYTTKGELQIELWAKECPKTVRSFLQSIQDGK
                     WDGIVLGKVAEDAVWAPAGLCACSAEINGRLRFNRRGLVGMAPGQDQPFFTLASRGEL
                     DGRAVVFGTLVGQSVYRLMEIAQGEVGDDGKTFVYPAEVRRAEVTIPYFDGLSGQKRR
                     AEPEQQAAPRPRKIATRVRLEYEESEDEASDPPLDVRIRAAHDILQDERLTDALHGDS
                     PPPRPAEAPRGSDSAPCVASPDRRAEAAPPTDGPPSRCASLAGPAPASPGPVTDLAPQ
                     LSAREQGTLSSLAEFRCKRGGKNPLLG"
     gene            <784481..>785911
                     /locus_tag="AGOS_ADR045W"
                     /old_locus_tag="ADR045W"
                     /db_xref="GeneID:4620290"
     mRNA            <784481..>785911
                     /locus_tag="AGOS_ADR045W"
                     /old_locus_tag="ADR045W"
                     /product="ADR045Wp"
                     /transcript_id="NM_209494.2"
                     /db_xref="GeneID:4620290"
     CDS             784481..785911
                     /locus_tag="AGOS_ADR045W"
                     /old_locus_tag="ADR045W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL063W (TIM50)"
                     /codon_start=1
                     /product="ADR045Wp"
                     /protein_id="NP_984141.2"
                     /db_xref="GeneID:4620290"
                     /translation="MLHVIRRSRATSARQLPRVAGLLAGAAAVRSRTYIGTRILHEEQ
                     KPKKPEPPNSILTEDMLARAGVDAERGPETEKAPAEDKAGESTETGSGAGKKKRARKT
                     TTEIKRERYANLFYLFSLTGLAGGAVYMSRDWDADEPEEERKGIENGYTPGLMYRRFK
                     ARFDSLFTFFQEPPYPDLLPPPPPPPYQRPLTLVLPLEDFFVHSEWTQQHGWRTAKRP
                     GADYFLGYLSQYYEIVLFSSNYMVYSEKVVEKLDPIRAFITYNLFKDHCVYKDGIHIK
                     DLSHLNRDLGKTLIIDTDPNSVKLQMENAILAEPWDGKADDALLRYIPFLEYLVTQPI
                     NDVRPILNSFKDRHHIPEEFAERVEKLRAKFNADQKAKAGSGLSFLLNPGMASKPAKF
                     PLDLIREEGEKNYVRFMKLIEEEKEKLKLQQEHMSAPTFTLKDMAEGNMPTPEEQMKM
                     QLQKQKEFEELYEKEKQKMQQQTKGQ"
     gene            complement(<787956..>790985)
                     /locus_tag="AGOS_ADR046C"
                     /old_locus_tag="ADR046C"
                     /db_xref="GeneID:4620291"
     mRNA            complement(<787956..>790985)
                     /locus_tag="AGOS_ADR046C"
                     /old_locus_tag="ADR046C"
                     /product="ADR046Cp"
                     /transcript_id="NM_209495.2"
                     /db_xref="GeneID:4620291"
     CDS             complement(787956..790985)
                     /locus_tag="AGOS_ADR046C"
                     /old_locus_tag="ADR046C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR204C (LDH1)"
                     /codon_start=1
                     /product="ADR046Cp"
                     /protein_id="NP_984142.2"
                     /db_xref="GeneID:4620291"
                     /translation="MNHRDIESVVRVAAEPLPPLSGKTIQEIEDEYKDGPALAKNIRN
                     NPNDFTSKFLLDHVEFVRLTRGKVRTLHNLGRSGESRRYGPLKRREKKERMKSAKSGK
                     SAKTKAAGKTREARSAKTAKTAKARPASKGARAARRARGTAGAEDSAAVEGAEAAEGA
                     GVEAEPSAELELAAEPELAAEPELAAEPELATEPEPAMEPEHVAEKAAGGADALCVAS
                     AAPEDDDDFRSVAEAAVLSASSATGAPSSCVEKDDEDDFKSIIDVDVQQGSSHAAEDI
                     VVDVDVTQFRAKSERGLNPIPEKDEDSESGAHEHASQHAEHSSESAKDDKSAAALSAK
                     ESAGIASPAPSGDDNKTAKPSNAATGDASTAPYWGSAVPGYESAAPEYESAAPAYESA
                     APEGPSPLPSASELTTCGAKSSTVVDAGGDSAKTEVRGPTVGGSDASEAKSTCGAATA
                     TTTTAAGSATAGLDLKTEAGSACEPSATVSAIAFGNQQSPAGSVLTSTANETEGANSA
                     HTDAVSTIKADDASGSIETKLHSADVPVQSPALDGSKADSIPGTASPGNVSPVKIGGN
                     TAAGSAVATESDVVVSTDAGSGASSPGKTELEAGVSGASSPLRTSPLARSATNGALPI
                     NEAVLPPTGGKDAQHCGTASSSKVGTAPISTTSEAPSGKAATTGKSTTSKKKKSDKKS
                     KKANQSPISILSLGQGTAKSTDKSADKPADKPVDNKPLTPVQPSNDAPEPAANPQVGE
                     AQANGEPLLVNFMIHGIGGNVKHFEPLMYMLDILGEKYLAFDLPGFGESDHWADGYPM
                     MEVVESIKELLDIMVLRPNHNNVRVRFFGHSMGCILLLHLAFRYGVNNLNAEKIILLA
                     PPPPRTLKSKLDIVEPYLNLSLTFFKPFLIMLLKFIRTNFDQMKGLNSSGIKFFFSNM
                     GNKYRKLNHFYDGVAVSTKSITEYLLGWQDLINGPPLLDSGCTGHVLVGSEDKVCPAN
                     ATHYPDYSFRVVVNTGHNMFYDGASEALFEVYKLIYQ"
     gene            <791199..>792320
                     /locus_tag="AGOS_ADR047W"
                     /old_locus_tag="ADR047W"
                     /db_xref="GeneID:4620292"
     mRNA            <791199..>792320
                     /locus_tag="AGOS_ADR047W"
                     /old_locus_tag="ADR047W"
                     /product="ADR047Wp"
                     /transcript_id="NM_209496.1"
                     /db_xref="GeneID:4620292"
     CDS             791199..792320
                     /locus_tag="AGOS_ADR047W"
                     /old_locus_tag="ADR047W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YGR263C (SAY1)"
                     /codon_start=1
                     /product="ADR047Wp"
                     /protein_id="NP_984143.1"
                     /db_xref="GeneID:4620292"
                     /translation="MGSPNKTWSVLAFLLKFYGLGVPAALARLVYSVVRRAGRRTLLG
                     LLGVEAARHADPAAAAALRASVGTCVPWWHARRSFERGGEVLEETYVVQDSDLFELGG
                     PAAAAAERTARAVYVSRPDKRHPDDPVVLYVHGGAFCEGLTPVDYALAAKITAAYQCT
                     FPQAAMLALDYAGAEDGGFPLAALDVVQLYRAVCREFPRGPIWLVGSEAGGHLMLGLL
                     QYLACADEEGLRWPRRAFCMTPWLNLTAWSADDAEYAAADADRSAVHGFLQRMAAAYC
                     ESLGEGAQKNPYVNIEANLNADRWRRVLENTEIHVAVDDCDVLAPQARRFAEQLGLPV
                     TDYDHDELVAATLSIYGYSEDWLLDNGLAFAMAKFFYLH"
     gene            <792458..>793720
                     /locus_tag="AGOS_ADR048W"
                     /old_locus_tag="ADR048W"
                     /db_xref="GeneID:4620293"
     mRNA            <792458..>793720
                     /locus_tag="AGOS_ADR048W"
                     /old_locus_tag="ADR048W"
                     /product="ADR048Wp"
                     /transcript_id="NM_209497.1"
                     /db_xref="GeneID:4620293"
     CDS             792458..793720
                     /locus_tag="AGOS_ADR048W"
                     /old_locus_tag="ADR048W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR205W (KTR3)"
                     /codon_start=1
                     /product="ADR048Wp"
                     /protein_id="NP_984144.1"
                     /db_xref="GeneID:4620293"
                     /translation="MQPGFGEPALRHHCRRSALAVTMYKNTRKRLMPKSAVLVRRYER
                     QIKTVFVAFLAALMIMFLAREPYLGIGSGTRSDAKLQPAAAERLQGVRVLEDAGEPVR
                     AAFVVLAREEDLWSLVTSIRHVEDRFNARYHYDWVFVGATPLSEKFQTVTRSLVSGRA
                     RFCVAQAAAREYPPAVEKERAGKATTALAESGVSIEQVLLWRFHAGYLALLPEMQEYE
                     YYWYVEPDIELYCDINYDIFRFMKAHRKQFGFILATEDPSDYSALWTEATAFAKQRAD
                     LLAHDNLRNFVSNDGDTFNGCVFRAGFQVSSLDFWRSDAFRAFFEALDASGGFFYNLW
                     TDVAVQTLAVALLMDRRDVHFFDSIGLYHREMRSCPFEQTIRRQNKCICNPEQDLTWE
                     TGYVCTRRFMQARGLQLPKGIRRAARAV"
     gene            <793917..>795098
                     /locus_tag="AGOS_ADR049W"
                     /old_locus_tag="ADR049W"
                     /db_xref="GeneID:4620294"
     mRNA            <793917..>795098
                     /locus_tag="AGOS_ADR049W"
                     /old_locus_tag="ADR049W"
                     /product="ADR049Wp"
                     /transcript_id="NM_209498.2"
                     /db_xref="GeneID:4620294"
     CDS             793917..795098
                     /locus_tag="AGOS_ADR049W"
                     /old_locus_tag="ADR049W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL060W (MFM1)"
                     /codon_start=1
                     /product="ADR049Wp"
                     /protein_id="NP_984145.2"
                     /db_xref="GeneID:4620294"
                     /translation="MLGLRLPVCRRAVMASPRACWRLWHSSTAAAAGMQDLSAVLQRN
                     LALRNQSLYNQSSDTIRCSMFDSDGALIGGAAADIRREELIQKHGLLPRDLRKIEMAR
                     RHDLVPIVLVRDRCIMVSLLTIRALVKSDTVLLFDPMGIGMDSVAHTRFVADLQTRLK
                     NQGAPGLGKDPLPYEFRALESIFITALANLTAELRVHLAVTKGALHDLEYGIDKDKLK
                     FLLVQNKKLSVFHKKSLLMREMMDDLMDQDDVLSEMYLSEKMRGKPRDVADHSELEMV
                     LETYYTQVNEIVQSIEGAIANVRTTEEIINIILDSNRNELMLLGLRFAIGLLSLGSVM
                     FVAALYGMNLENFIEEGNVGFALVTATGLVLMVCLFRYSIKRLHKLQKMTLLGGQGRH
                     S"
     gene            <795307..>796551
                     /locus_tag="AGOS_ADR050W"
                     /old_locus_tag="ADR050W"
                     /db_xref="GeneID:4620295"
     mRNA            <795307..>796551
                     /locus_tag="AGOS_ADR050W"
                     /old_locus_tag="ADR050W"
                     /product="ADR050Wp"
                     /transcript_id="NM_209499.1"
                     /db_xref="GeneID:4620295"
     CDS             795307..796551
                     /locus_tag="AGOS_ADR050W"
                     /old_locus_tag="ADR050W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR207W (FTH1)"
                     /codon_start=1
                     /product="ADR050Wp"
                     /protein_id="NP_984146.1"
                     /db_xref="GeneID:4620295"
                     /translation="MQVEKYFSFQIFFIFLRESLEIVIIISILLTIVKQALLKPESAS
                     SKYLGGGRLEAEEEVELNAALQEAGPLEAVENSQLYRRLKVQILSGGALGLLCCMLVG
                     GLFIVLFYYVGKDLWAASEHYYEGVLSIVASVIISFMGLFFLRMGRLRDKFRIKLASM
                     LYAQSSDPLAPSRRARKFSEKYALFILPFVTSLREGLEAVVFVGGIGIDQPLSSIPLS
                     MLSAAVVSYAFGRFFFASSGSFSLEVCLVTATCLLYLVAAGLFSKGVWQFELQHYVDL
                     CNGQDMSEVGSGPGSYDISNSVWHVNCCNGERDGLWMIFTAIFGWTNSATYGSVISYI
                     IYWLAVIGVLHVLKIEETLGYIPYVPIKWQARRIKKRLALIEKARALQSRPPSGSPPV
                     YQTARLSQESTNSNTLLLSSQE"
     gene            complement(<796632..>802091)
                     /locus_tag="AGOS_ADR051C"
                     /old_locus_tag="ADR051C"
                     /db_xref="GeneID:4620296"
     mRNA            complement(<796632..>802091)
                     /locus_tag="AGOS_ADR051C"
                     /old_locus_tag="ADR051C"
                     /product="ADR051Cp"
                     /transcript_id="NM_209500.2"
                     /db_xref="GeneID:4620296"
     CDS             complement(796632..802091)
                     /locus_tag="AGOS_ADR051C"
                     /old_locus_tag="ADR051C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR208C (DUR1,2)"
                     /codon_start=1
                     /product="ADR051Cp"
                     /protein_id="NP_984147.2"
                     /db_xref="GeneID:4620296"
                     /translation="MTDHSSTVGWTSQQWREFHRRASADASLARLLALAHAERDAGAA
                     WISVASDEHIEHQWRVLQSRGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAA
                     QDATAVRLLRDAGAVILGKTNMDQFATGLVGTRSPYGSVASAFSSAHAAGGSSSGSAV
                     VVARGAVPLTLGTDTAGSGRVPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFAR
                     DVADAHRCLRILARPDGSDPYSRPSPADAPRRFGTCPVVGVPREAEWFGESQNAELFA
                     AACQRMRAAGARVVEVDPQPLLDLGRSLYEGPWVAERYAAMRAFYSGQPPRDTLDPTV
                     TGIITSAGGYSAADVFDHGLRRQKLVAAIEAELAGVDALLVPTCPLNPTLAAIAAEPL
                     LVNARQGMWTNFVNLADLAAVAIPAGFRRDGLPQGVTLVGRKFSDLALLELGSRLLRV
                     EDAEPRRCGALPAGQALCEDEVVSGSEERDSTVLLAVVGAHLRGLALHWQLDEVQAEF
                     VREARTAPSYRLYALPKTGPVLKPALRRVCAGKGAAIELEVYSVPEATFGRFVAMVPA
                     PLAIGSVELESGEYIKSFVCEEDGYIQDGTVDITHFGGFRRYVEHLRRQRDVDKPFDT
                     VLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGSSAAETYLD
                     IDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWAR
                     ELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAA
                     AFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQK
                     IIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQ
                     VEHPITEMVTGLDLVEWMLRIAANTPPDFDAGVEIEGVSMEARVYAENPVKGFTPSPG
                     LLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRIA
                     GCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTIQDYPGRVGY
                     WRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHSDAVIAVTGGAVPV
                     TLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFAMGGIG
                     GHNGRVLAPGDVLFINKDSSVAVGDTVTIPSGLQPVIPRESWKIGLVCGPHGSPDFFK
                     REALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHPSNTHDYVYSVGAIN
                     FTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVPISVDTARALKRS
                     QDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQSGDRYILIEYG
                     ENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQEDLLSVLSAY
                     ELEINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADFVANVNG
                     ITRADVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNGVVGI
                     GGMYMCIYCTDSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEERI
                     NELTEEVENGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKV
                     ANSDLETAVRKEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKT
                     EMVVSATADGEVINILHANGDMVDAGNLVVVLKNC"
     gene            <802514..>804766
                     /locus_tag="AGOS_ADR052W"
                     /old_locus_tag="ADR052W"
                     /db_xref="GeneID:4620297"
     mRNA            <802514..>804766
                     /locus_tag="AGOS_ADR052W"
                     /old_locus_tag="ADR052W"
                     /product="ADR052Wp"
                     /transcript_id="NM_209501.1"
                     /db_xref="GeneID:4620297"
     CDS             802514..804766
                     /locus_tag="AGOS_ADR052W"
                     /old_locus_tag="ADR052W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YER015W (FAA2)"
                     /codon_start=1
                     /product="ADR052Wp"
                     /protein_id="NP_984148.1"
                     /db_xref="GeneID:4620297"
                     /translation="MSNETEVNRYPGMGPISLVEVIRTDARFAELWKRLSLFQQGSVE
                     FYKELYDNMPLFAGMDGMALSAPVPGSGKKGYSPVFRNVLVPEGKLLSAIDEGVDTGY
                     HVFKLSARMYPDNHCLGMRAYDEATGKWLDEYRWETYSQVERRAENLGAGLLSVVNVK
                     RSKPLDTNDFIVAMMSANSKEWVLTDLACQTFSLVNTALYETLGPNTSEYIMNLTESP
                     VVVVSKPNLLRIFALASKLRALNTIVIMDDMDLQEVDRLASLLPVTKNAKGETISVLT
                     LRQVEKIGELNNIAPIPPSPDSFHTISFTSGTTSLPKGVQLTHRAYCAALAFACSHVR
                     CEPNKQRYALCLLPLTHIYQRQMTGLNLMHAFGIGFLHKPNPDLFIEAMCVLRPAMVS
                     LVPRVLTKLEAGIKNSIQGADVSTFKRKLAKTVIDAKDKRFSAVSGPDDSYMNRFIYR
                     KIFVDKIRDKLGFTNVPLVTTGSAPISPETLRFIQCAMDIGILQGYGLTETFGGNFLS
                     VPYETDCGSCGPPAMTTEVRLRDVPGMSYNAEKDHMGEVVVRSQQQFERYYKMPEKTA
                     EVLDKDGWFSTGDVGYIDKKGRLFITDRVKNIFKLSQGEYIAPEKVENCYLSSCPFIT
                     QIFVHGNSLNNYLVGVVGIDVVPFKAILDSRTSKWSKLPLEEVIPTINKDPALKQLTL
                     KIINSFVTAELQGFEKIGNLYADVEPLSVDGETLTPTFKVKREVCTKVFKDILSSLYD
                     EGHILKAGKL"
     gene            <805155..>805571
                     /locus_tag="AGOS_ADR053W"
                     /old_locus_tag="ADR053W"
                     /db_xref="GeneID:4620298"
     mRNA            <805155..>805571
                     /locus_tag="AGOS_ADR053W"
                     /old_locus_tag="ADR053W"
                     /product="ADR053Wp"
                     /transcript_id="NM_209502.1"
                     /db_xref="GeneID:4620298"
     CDS             805155..805571
                     /locus_tag="AGOS_ADR053W"
                     /old_locus_tag="ADR053W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL059W (GRX5)"
                     /codon_start=1
                     /product="ADR053Wp"
                     /protein_id="NP_984149.1"
                     /db_xref="GeneID:4620298"
                     /translation="MFATYSASILRSTLPLRSVGVRLLSQETRRAIEGAISSAPVVLF
                     MKGTPEFPQCGFSKAAIEILGRQGVDPAKFAAFNVLEDSELRSGIKEYSEWPTIPQLY
                     VNKEFVGGCDILTNMAQSGELTTMLEEASVLVPDTE"
     gene            complement(<806308..>807891)
                     /locus_tag="AGOS_ADR054C"
                     /old_locus_tag="ADR054C"
                     /db_xref="GeneID:4620299"
     mRNA            complement(<806308..>807891)
                     /locus_tag="AGOS_ADR054C"
                     /old_locus_tag="ADR054C"
                     /product="ADR054Cp"
                     /transcript_id="NM_209503.1"
                     /db_xref="GeneID:4620299"
     CDS             complement(806308..807891)
                     /locus_tag="AGOS_ADR054C"
                     /old_locus_tag="ADR054C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR163W (EXO5)"
                     /codon_start=1
                     /product="ADR054Cp"
                     /protein_id="NP_984150.1"
                     /db_xref="GeneID:4620299"
                     /translation="MRTVRQRWATGWGRALHTSGSAPAGSSAESALLPEMGQLDPKVA
                     AAPRRKYLSAKYRVVGKLFQQAENGGYLAYRKPAALENPYLDVQARPRVDGATGQIVY
                     QGTPRLSVTRLLTKQWCELRTAYDLYSNMPLFESKAMRIGKRAHRKLENKLHGASDAA
                     ATQALERLQLAVPVDPLHRLAADWAGAIDRMCTLFQKGEARELLCHGYISADHGAFVE
                     GPVREDSDVLVSGVIDHLVLTQRGGGSPLSALQPERSLQFPSDMAELVPFLKDLGERR
                     AAEWEVVVGDIKTRKYTQVPSQASVVETSRLQVMYYRRFLEDLGADVDKAYEKLLTNA
                     QRRGLDVDAPLAAGSAISVMEGIPQLGADMLRLVRGDPIGFGPFDSYNRYAAHDTYDF
                     TQHAALLQDQPELQKYAVFFGQWKTPFNLRFLAARMAQLYGCIAPLLSNTLLIEYYMG
                     GECFHVNTFKYDAAELRKHCEDSARFWFGKREIEPIEPTIRNVNAYCKFCDYKDICLW
                     RKEAVLGWKSLGEELRGLP"
     gene            complement(<808031..>808219)
                     /locus_tag="AGOS_ADR055C"
                     /old_locus_tag="ADR055C"
                     /db_xref="GeneID:4620300"
     mRNA            complement(<808031..>808219)
                     /locus_tag="AGOS_ADR055C"
                     /old_locus_tag="ADR055C"
                     /product="ADR055Cp"
                     /transcript_id="NM_209504.1"
                     /db_xref="GeneID:4620300"
     CDS             complement(808031..808219)
                     /locus_tag="AGOS_ADR055C"
                     /old_locus_tag="ADR055C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR162W-A (YSY6)"
                     /codon_start=1
                     /product="ADR055Cp"
                     /protein_id="NP_984151.1"
                     /db_xref="GeneID:4620300"
                     /translation="MALQTPKQRAANLRFAKANEKKVGKKKKTGSKTEYPISKTWILV
                     LLFLLVGGGVLELVSLLF"
     gene            <809024..>810529
                     /locus_tag="AGOS_ADR056W"
                     /old_locus_tag="ADR056W"
                     /db_xref="GeneID:4620301"
     mRNA            <809024..>810529
                     /locus_tag="AGOS_ADR056W"
                     /old_locus_tag="ADR056W"
                     /product="ADR056Wp"
                     /transcript_id="NM_209505.1"
                     /db_xref="GeneID:4620301"
     CDS             809024..810529
                     /locus_tag="AGOS_ADR056W"
                     /old_locus_tag="ADR056W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR162C (TOS1)"
                     /codon_start=1
                     /product="ADR056Wp"
                     /protein_id="NP_984152.1"
                     /db_xref="GeneID:4620301"
                     /translation="MKLSTVVAGGLLAAQQVLGDCDFIGGNYYCSKAENIRYANVGYS
                     GTYLDVTSMDEKSCKCKQRKLEFSGSLSPLDQELTVHFRGPLRLKQFGVYYPAGSDGG
                     SEQKPGHKHNSGHKHKPGHDHDKRAVHYVHVTSTVYVKGGAHAETPVAAAPASTSEPA
                     KAVESAPAPLSESAPAPLLESAPAPPSKSAPAPSLESAPSSSLSSLSQSASPSSKEEG
                     KGGLHSFLTKVFGDHGHKQSSSSTSSAAQASSTGAGSSSVSGWKRVAHYTPGSTDNCT
                     FFNHQGGKGSGTWSQCFGNSISFASSDGRSGASNPTPLDDVTFKSNEEIMIFSGASCK
                     DKSLGDCGFHRDKIPAYHGFGGATKMFVFEFTMPSDEHGNDYNQDMPAIWLLNAKIPR
                     TLQYGDSSCSCWKTGCGEMDLFEVLSKGSKYMISHIHDGQGNDGYNVGGGGSQDYFER
                     PLQRPMKAAVIFDGENSNVHIVEVDGDFEASLSASTVQNWISKEGTVAMLP"
     gene            <810732..>811181
                     /locus_tag="AGOS_ADR057W"
                     /old_locus_tag="ADR057W"
                     /db_xref="GeneID:4620302"
     mRNA            <810732..>811181
                     /locus_tag="AGOS_ADR057W"
                     /old_locus_tag="ADR057W"
                     /product="ADR057Wp"
                     /transcript_id="NM_209506.1"
                     /db_xref="GeneID:4620302"
     CDS             810732..811181
                     /locus_tag="AGOS_ADR057W"
                     /old_locus_tag="ADR057W"
                     /note="NOHBY424; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ADR057Wp"
                     /protein_id="NP_984153.1"
                     /db_xref="GeneID:4620302"
                     /translation="MCHRMSRNMFDAATTCMWTLPVTLGRCTRPRAPSSTAAPRAAVP
                     VLHAGAGPVGIPACLAAKRRDARTRGHMRRCGSRSLGSAQASLRTRYASARADIVRPH
                     DLQRPRAAGPQGPAQPQPPACARGSFRVSRGGVRGPGAHNSPYSSAF"
     gene            complement(<811360..>812247)
                     /locus_tag="AGOS_ADR058C"
                     /old_locus_tag="ADR058C"
                     /db_xref="GeneID:4620303"
     mRNA            complement(<811360..>812247)
                     /locus_tag="AGOS_ADR058C"
                     /old_locus_tag="ADR058C"
                     /product="ADR058Cp"
                     /transcript_id="NM_209507.1"
                     /db_xref="GeneID:4620303"
     CDS             complement(811360..812247)
                     /locus_tag="AGOS_ADR058C"
                     /old_locus_tag="ADR058C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR160W (CDC28)"
                     /codon_start=1
                     /product="ADR058Cp"
                     /protein_id="NP_984154.1"
                     /db_xref="GeneID:4620303"
                     /translation="MSDLTNYKRLEKVGEGTYGVVYKAVDLRHGQRIVALKKIRLESE
                     DEGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKD
                     QPLGDKIIKKFMMQLCKGIAYCHAHRIIHRDLKPQNLLINRNGNLKLGDFGLARAFGV
                     PLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDVWSIGCIFAEMCNRKPLFSGDSEIDQI
                     FKIFRLLGTPNESVWPDIVYLPDFKPTFPKWQRRDLAQVVPSLNEHGLDLLDKLVTYD
                     PIHRISAKRAVTHPYFKDE"
     gene            complement(<812362..>813417)
                     /locus_tag="AGOS_ADR059C"
                     /old_locus_tag="ADR059C"
                     /db_xref="GeneID:4620304"
     mRNA            complement(<812362..>813417)
                     /locus_tag="AGOS_ADR059C"
                     /old_locus_tag="ADR059C"
                     /product="ADR059Cp"
                     /transcript_id="NM_209508.2"
                     /db_xref="GeneID:4620304"
     CDS             complement(812362..813417)
                     /locus_tag="AGOS_ADR059C"
                     /old_locus_tag="ADR059C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR159W (IFA38)"
                     /codon_start=1
                     /product="ADR059Cp"
                     /protein_id="NP_984155.2"
                     /db_xref="GeneID:4620304"
                     /translation="MGSLSDISFFDHLQELARRDCCVNALLWCAFTVGAVKLTTFMLS
                     LISIALETTVLPSASYKKYGARKGAYALVTGASDGIGKEFALQLASKGFNVLLVSRTE
                     AKLLELKQEIMAKYKVDARVLSVDFGVDNRLTYTAISELCGELPVTVLVNNVGVSHSI
                     PVSFLETTEEELRGIITVNNTATLMVTQTVAPLVIANARRLQCRGLVLTMGSFGGLLP
                     TPLLATYSGSKAFLQAWSAALAGELAPHNVDVQIVLSYLVTSAMSKVRRASALIPTPR
                     AFVRSTLASLGRRVGAQERYATCTPYWSHALYHFLIENTVGVHSRLANAINYRFHADI
                     RKRALRKAARKAAEKQE"
     gene            complement(<813589..>814323)
                     /locus_tag="AGOS_ADR060C"
                     /old_locus_tag="ADR060C"
                     /db_xref="GeneID:4620305"
     mRNA            complement(<813589..>814323)
                     /locus_tag="AGOS_ADR060C"
                     /old_locus_tag="ADR060C"
                     /product="ADR060Cp"
                     /transcript_id="NM_209509.1"
                     /db_xref="GeneID:4620305"
     CDS             complement(813589..814323)
                     /locus_tag="AGOS_ADR060C"
                     /old_locus_tag="ADR060C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL055C (LGE1)"
                     /codon_start=1
                     /product="ADR060Cp"
                     /protein_id="NP_984156.1"
                     /db_xref="GeneID:4620305"
                     /translation="MSFSGEHPGNANNEGPPPPPPPPPPPSHSSAPPSSQGGSARAAP
                     LNGAFHSHQPHSQGYARAEGSNGYRQPYGRGGYRGSGGRYYGGYGYGHGGGGYGYGHG
                     GGGNYGHGHHGYYGYQGEYRGHSGYQRFNSPAPVGTRYSGAAGPAARPPPPPEPEPEQ
                     PFELTDDPLFHLTELDRSTDDPRQLDEMRRIFKDSVQLDQKLEQQKLAMWRTELELSL
                     LDTQSAKDALNVQLNQENLDALLMQG"
     gene            complement(<814453..>815631)
                     /locus_tag="AGOS_ADR061C"
                     /old_locus_tag="ADR061C"
                     /db_xref="GeneID:4620306"
     mRNA            complement(<814453..>815631)
                     /locus_tag="AGOS_ADR061C"
                     /old_locus_tag="ADR061C"
                     /product="ADR061Cp"
                     /transcript_id="NM_209510.1"
                     /db_xref="GeneID:4620306"
     CDS             complement(814453..815631)
                     /locus_tag="AGOS_ADR061C"
                     /old_locus_tag="ADR061C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR158W (AMN1)"
                     /codon_start=1
                     /product="ADR061Cp"
                     /protein_id="NP_984157.1"
                     /db_xref="GeneID:4620306"
                     /translation="MSAEKSKIEHAPWAWGLPVTPPRAAAACAASPWTPRVPADIAQA
                     GGRAGTPRRRAPARTLGHVIFAVPELVEQLVRFVAAGSEQAGAPRALHHCLLVNRLWH
                     AVTVAVLRERLYFADARRLRQFAAAAHRGRLAPELVVLHKLTRLEQRDLDRALQHVSP
                     ERLRRLELYVCPRVLPPAGYLGRAGGLRRLALPGNKLVSDDFLIEACVHLPRLQVLDL
                     RACDRVSDAGVVAVATNCPRLHTVNLGRHRNGHLITSVAVVALARHVQLETLGVAGCD
                     VSDAGLWELAAVCGPSLARLSLNNCRYLTNRSVPALLELNAFPNLSVLELRNIPHLTD
                     VRAVVRYRQWKRACGLPVLVEGCDRLTQLFRCEERKLCKENCASPVRDLAAWLRSEED
                     "
     gene            <816301..>817443
                     /locus_tag="AGOS_ADR062W"
                     /old_locus_tag="ADR062W"
                     /db_xref="GeneID:4620307"
     mRNA            <816301..>817443
                     /locus_tag="AGOS_ADR062W"
                     /old_locus_tag="ADR062W"
                     /product="ADR062Wp"
                     /transcript_id="NM_209511.1"
                     /db_xref="GeneID:4620307"
     CDS             816301..817443
                     /locus_tag="AGOS_ADR062W"
                     /old_locus_tag="ADR062W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL054W (LEE1)"
                     /codon_start=1
                     /product="ADR062Wp"
                     /protein_id="NP_984158.1"
                     /db_xref="GeneID:4620307"
                     /translation="MYTYSQNGAGGQRSGRCRARTRAKSSQGSRARAASDGEGEGGRP
                     GFTAQHQKAIIEHLLITKNSAPQKNYSHVPCKFFRQGACQAGSSCPFSHSLNVLVADQ
                     TPCKYFEKGTCKFGAKCANAHILPDGTRVNPSKQALYAGGKGGRRAARYAEAEGGAEG
                     GGGGLRGLAFSTPPLVDEFDAFEGEVLVPSELSDLLTPKELKRRNSRPSSTSQRVSLS
                     ELSTSSTTSSEQYGYLPGRTWSATSATTPPPSIMDPMGSAAFGNKLLSSSNYTYQDAF
                     GSFAPKSPWNSAPNGALGARSLNSAATAYAPAVGPNWTEYQFHQLTDDLTKLKIYEED
                     APSPPNALSTVERGSTGQGAASKIHLQHNQGDGMQLFLDDFTRSIY"
     gene            complement(818003..818091)
                     /locus_tag="AGOS_t0077"
                     /db_xref="GeneID:4620308"
     tRNA            complement(join(818003..818040,818055..818091))
                     /locus_tag="AGOS_t0077"
                     /product="tRNA-Phe"
                     /codon_recognized="UUC"
                     /db_xref="GeneID:4620308"
     gene            <818570..>819202
                     /locus_tag="AGOS_ADR063W"
                     /old_locus_tag="ADR063W"
                     /db_xref="GeneID:4620376"
     mRNA            join(<818570..818620,818687..>819202)
                     /locus_tag="AGOS_ADR063W"
                     /old_locus_tag="ADR063W"
                     /product="ADR063Wp"
                     /transcript_id="NM_209512.2"
                     /db_xref="GeneID:4620376"
     CDS             join(818570..818620,818687..819202)
                     /locus_tag="AGOS_ADR063W"
                     /old_locus_tag="ADR063W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR028W (YOP1); 1-intron"
                     /codon_start=1
                     /product="ADR063Wp"
                     /protein_id="NP_984159.2"
                     /db_xref="GeneID:4620376"
                     /translation="MAEIAGNLQRILQSLDRQFAGNKYLQEFERKTGFPKSYAIAGAG
                     VAYLFIIFINVGGVGEILSNFLGFVLPCYYSLHAIKTTTTADDTELLTYWIVFAFFSV
                     IEFWSKAILYWVPFYWFFKTIFLIFIALPQLGGASLIYHRVIAPLTDPYIAAGSQRKA
                     SGISSKMEQAAKGASARATGAASHQSSD"
     gene            complement(<819332..>821707)
                     /locus_tag="AGOS_ADR064C"
                     /old_locus_tag="ADR064C"
                     /db_xref="GeneID:4620309"
     mRNA            complement(<819332..>821707)
                     /locus_tag="AGOS_ADR064C"
                     /old_locus_tag="ADR064C"
                     /product="ADR064Cp"
                     /transcript_id="NM_209513.2"
                     /db_xref="GeneID:4620309"
     CDS             complement(819332..821707)
                     /locus_tag="AGOS_ADR064C"
                     /old_locus_tag="ADR064C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR029C (APL4)"
                     /codon_start=1
                     /product="ADR064Cp"
                     /protein_id="NP_984160.2"
                     /db_xref="GeneID:4620309"
                     /translation="MGSLRTFIKDVRSAKTLADERSIITKESAKIRTKLKDDHLSLSK
                     RRKNIHKLLYLYVLGEKTHFAQVECINLIASDDFENKRLGYLAAMLLLDEKQELLTLL
                     TNVLNSDLCHPTKYVVSLALCALGTLASVELARDLHPDVERILQTSQDPYLFKKALQC
                     AAKMVARDSFLASIFYPYVRRALSHELSTHGVLFGALQLLQSIMAVEDLSDIDDQNKI
                     VDAVAGAVPDLLSKLQLLNTPSFTPEYDAVGVADPFLQVELLYTLRRIFEKVPDNVSR
                     YSGKLVSVLSSLCSHAEQSKNGTNAILYEAVRTIFALKLEHKLRIQAIDILAIFLTSK
                     DINNKYVALNMLTQVVSTEPQAVQTRRKFISKCLFDPDASIRRRALELTFAIIEDSNM
                     KDTVEELVAFLTSSDGEDRDLIVYTVEHLLNIFGMREVADERWKLTVLIRILKVIGQH
                     MTVEIISEILVMLNNISDVATKKEIGLQLVQFSLDKEQNNISEDNIGWKLIIVWVIGE
                     YAELMLGEPGVTDISLTNYLSSLNSFYSDDHKLIGYILTAALKLSLKIHDPACFERLR
                     QLIKSHDRDTDLILQTKAVHYGILFSQPANIKKAFLEPMPLIVTTIRNSGPSATNATR
                     KPSLPDPIGDLLSDIPQTQSLPAVAVKSVNTKQGDLLTDIFKSSSPPPVQKVPTPTAT
                     VTVPAGATEMHHSNLVQVFGSVVSSANGKAEVELFFKAKSRITQLHVLVAVAKTQQLT
                     LGALTNTNMNPGDITCQSLQVVGTGALKLRVKLEASGGVTEQFDHKFNAIL"
     gene            <822521..>825259
                     /locus_tag="AGOS_ADR065W"
                     /old_locus_tag="ADR065W"
                     /db_xref="GeneID:4620310"
     mRNA            <822521..>825259
                     /locus_tag="AGOS_ADR065W"
                     /old_locus_tag="ADR065W"
                     /product="ADR065Wp"
                     /transcript_id="NM_209514.2"
                     /db_xref="GeneID:4620310"
     CDS             822521..825259
                     /locus_tag="AGOS_ADR065W"
                     /old_locus_tag="ADR065W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL101C (ECM21) and YPR030W (CSR2)"
                     /codon_start=1
                     /product="ADR065Wp"
                     /protein_id="NP_984161.2"
                     /db_xref="GeneID:4620310"
                     /translation="MMPFAIRHPVTAMENDTEAERRRRRSSSVKQALSSFFTGERGSE
                     EAAEMDRSGPQGRRASTPGLEGTTRRVARRFSSPARADSRPEHRAQYTLGDEGLRWSM
                     EHGVEDMYDEGTLFGIDDVGPGSCAEAAGCGGLDSREFLTEYLAERGFVQQRTLLSKG
                     DVAVYALTSGEIVFLPTASSLEEGYLRNIRQSLENGDAFSDDYGDSHTVYDDPEAAIP
                     DSYSATSLDSDVSESAMPVTQLTTELLDDATTLFNLAVVVSIAKPVEMSEIKARLFSR
                     VRVHWHNGLPPGRRKFEEYYTIGDLKWTLTAENYNLYVPLHVSTEDQIIERSTGVVHR
                     KLFRNVYERDDSSDRVNSTLASFMTNLSEQNYTFKPGDYVFILPVQFIRQVPETIYVP
                     SARLNYDFCCGMRVNKLTVPDNETIDQYPAETTGPSKCQKEIDTPHKLADRLIKKVKA
                     RLTSSSQASSGKDGVADTIACGSMPVTVVRTPPLRSISIADKPIYINRVWTNALSYEI
                     SLLQKYVPLDSEIPLKIKLVPLMKHVSVKRIRINISEKITLVSKDLKYEFDQMDVILQ
                     DPYNPLFPELQFLKKPARSLPLLEVRTKDKGIKALREEVIENSTGDNLLCYSDAALNS
                     DKGVEMVDSLTLETTLKFPKFTVPRKNGTMPPYGIEELVPSPDSPHTHRPPPSHGVLG
                     LFGRRSSGSHPRTAEGPSPSTTASSATAHSGSTFRTGSRVPIEHSTFLNVPKRGLYAD
                     STHFKHIVVKHKLEVMLRVSKRDSDADGAKLRHYEVLIDTPIVLLSEYCSRQNVDLPT
                     YNMVTGDSRFRSPLPTFEEAVSETLSAPDSPITSPLASPDILASYDPDEFSIQQLSLS
                     RTTTHTQADPLLPADFSPLRRYSNIDEMMRSSSSNTASADSRCPAYSADPPTYEDT"
     gene            complement(<825281..>825919)
                     /locus_tag="AGOS_ADR066C"
                     /old_locus_tag="ADR066C"
                     /db_xref="GeneID:4620311"
     mRNA            complement(<825281..>825919)
                     /locus_tag="AGOS_ADR066C"
                     /old_locus_tag="ADR066C"
                     /product="ADR066Cp"
                     /transcript_id="NM_209515.2"
                     /db_xref="GeneID:4620311"
     CDS             complement(825281..825919)
                     /locus_tag="AGOS_ADR066C"
                     /old_locus_tag="ADR066C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL102W (SFT2)"
                     /codon_start=1
                     /product="ADR066Cp"
                     /protein_id="NP_984162.2"
                     /db_xref="GeneID:4620311"
                     /translation="MESNEQSSSLRDSLNRWNAGRAQQGSSVNEGAKTLLAGWAESLN
                     ARAADVYQRLPLTQQDLVQSPEPAWFALSRTERLALFVVFLAAAAGCFAACVMLFPVL
                     ALKPRKFGLLWPVGSLLFVLAFGVLQGPVAYAKHMLSRERLPFTAFFLTTCAATIYFA
                     AIAKSTLLTIPCALLQLVAVVYYGVSYFPFGAAGLRMVSAAGLSTARGALRI"
     gene            <826090..>827097
                     /locus_tag="AGOS_ADR067W"
                     /old_locus_tag="ADR067W"
                     /db_xref="GeneID:4620312"
     mRNA            <826090..>827097
                     /locus_tag="AGOS_ADR067W"
                     /old_locus_tag="ADR067W"
                     /product="ADR067Wp"
                     /transcript_id="NM_209516.1"
                     /db_xref="GeneID:4620312"
     CDS             826090..827097
                     /locus_tag="AGOS_ADR067W"
                     /old_locus_tag="ADR067W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL103C (RTG3)"
                     /codon_start=1
                     /product="ADR067Wp"
                     /protein_id="NP_984163.1"
                     /db_xref="GeneID:4620312"
                     /translation="MDGHLQGAEDLLEELLKQAQSESNTGPGAQGAGYARHDGKQRQQ
                     SMASQLADDGAFLDEYFLAGGDGLFADTLLPEFKDDGGRSPLGSSLGSMTSEFLSPAG
                     SVQQAQRRGSLESGPQHLRSPSASARAGAHLSSSLRSQARARQSSLSSLASTPVLEDG
                     AGSLTQEEKLRRRREFHNAVERRRRELIKSKIKELGKLVPPSLLNYNDEGKEVRLNKG
                     IILLRTVEYLEYLRQVLDVQARKRAQLLDKLRTLERRRRDLPPPRPAAAPAPRASLDS
                     PEQIIDGRALPQLLKDDPPPLADDLRQFLAGPQMEHEDNSKLIFSAPEHPAGFLLNFE
                     P"
     gene            <827451..>828578
                     /locus_tag="AGOS_ADR068W"
                     /old_locus_tag="ADR068W"
                     /db_xref="GeneID:4620313"
     mRNA            <827451..>828578
                     /locus_tag="AGOS_ADR068W"
                     /old_locus_tag="ADR068W"
                     /product="ADR068Wp"
                     /transcript_id="NM_209517.1"
                     /db_xref="GeneID:4620313"
     CDS             827451..828578
                     /locus_tag="AGOS_ADR068W"
                     /old_locus_tag="ADR068W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR210W (CLB4) and YDL155W (CLB3)"
                     /codon_start=1
                     /product="ADR068Wp"
                     /protein_id="NP_984164.1"
                     /db_xref="GeneID:4620313"
                     /translation="MYGARAGNENSGAGAAGSRAGRRGSGGSGGPRVALGDVTAQVNN
                     RGPRAGGKDARAGKPQGDAAVQGGENVEETVRAVGPVWDAAAEAAVAAAAAEYGGAPD
                     PADEDTWDAVMVAEYAPEIFAYLRGLEVRFAPAADYMRGQPELRWEYRATLVDWLVQV
                     HCRFQLLPETLYLTVNIIDRFLSRKTVTLNRFQLVGAAALFIASKYEEINCPTLRELL
                     YMLDNAYTADEVLKAERYMIDTLEFEFGWPGPMSFLRRVSKADNYEYDIRTLAKYLLE
                     TTIMDPRLVAAPPSWLAAGAYYLSRIIIGYNTWTRQHVFYSGYTAEQLVSLATVILEN
                     CRHAETRHQAIFEKYSKSRHRRSAQVVARWIAMAEENLQPA"
     gene            complement(<829067..>830794)
                     /locus_tag="AGOS_ADR069C"
                     /old_locus_tag="ADR069C"
                     /db_xref="GeneID:4620314"
     mRNA            complement(<829067..>830794)
                     /locus_tag="AGOS_ADR069C"
                     /old_locus_tag="ADR069C"
                     /product="ADR069Cp"
                     /transcript_id="NM_209518.1"
                     /db_xref="GeneID:4620314"
     CDS             complement(829067..830794)
                     /locus_tag="AGOS_ADR069C"
                     /old_locus_tag="ADR069C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL153C (SAS10)"
                     /codon_start=1
                     /product="ADR069Cp"
                     /protein_id="NP_984165.1"
                     /db_xref="GeneID:4620314"
                     /translation="MKTRNSAKGVSSEDPYGANEVDDFAAKREKVMLEEAGLDGRSDS
                     DDSDVPDEQEDEVMAMTDDSSDEDSALDGEEAYKRVFGRRLDADIEEAEQGDMLDNEA
                     AWGSTKNDYYGADDLDDEDAAREIEKEALQQQRKHLEELNMGDFLEDEIEQDWVKEAK
                     AFDIGEFQASTQQTSVSVADVLNMSIEGKESFLNTSFPEFYPLCKDFEKRNAELELLK
                     EDDQTEVNRLRIMALSSYLGTIASYFAIFLHELKTNEDFSTMKDHPIMESILMSREMW
                     RQAKELPADAVVPEGEEQVSEDEEEPNSVYEYEAPMEESGDEQEQDMSAESAEGDSDV
                     QEELDIDVSKPRIKKSHKKAATQDADDFAESEITEVDAQEKQKRRKTLRFYTSKIDQK
                     ANKTEKFKGDDDIPYKERLFERQQRLLEEARKRGVHDKNGADLQNDEFNSDDERTAQS
                     VNAEAVDDYYAQVSASRVAKKETRMKAHKDALRAVREGKLSELAEEVDEHGKRAINYQ
                     ILKNKGLTPKRKKDNRNSRVKKRKKFEKAQKKLKSVRAVYSGGQNGAYEGEQTGIRKN
                     VTKSVKFRS"
     gene            <831051..>832214
                     /locus_tag="AGOS_ADR070W"
                     /old_locus_tag="ADR070W"
                     /db_xref="GeneID:4620315"
     mRNA            <831051..>832214
                     /locus_tag="AGOS_ADR070W"
                     /old_locus_tag="ADR070W"
                     /product="ADR070Wp"
                     /transcript_id="NM_209519.2"
                     /db_xref="GeneID:4620315"
     CDS             831051..832214
                     /locus_tag="AGOS_ADR070W"
                     /old_locus_tag="ADR070W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL150W (RPC53)"
                     /codon_start=1
                     /product="ADR070Wp"
                     /protein_id="NP_984166.2"
                     /db_xref="GeneID:4620315"
                     /translation="MSNRLNSLGGSNSKPGLKFKPKVVARKSKEERDAATARINAEEK
                     PSFERKKYTKKPPQQRRLPRYLENTKVITSGPLAAGNFSNGGDSGRPFFKVEGSQSKL
                     LQQGLLAAGNDTGEDGSDQEDYQDNKNRINMGKETKPEQLFQEDEESDVEMDADAATS
                     RRVAELFPVRAVRVRHEELESSTSVVAEAPSDSATPATPPAFGDATLDTMLRAHQEEL
                     RTKLDELHVGGLESAEVMAERKKISQDHRYIKGKLDRLDKQPGKFLFFQLPSELPEFR
                     PLNPKPREPAPEQQTEPVPKTEDSQEDEADAAPVAKPTADLSELDQLAGNIGSLRIHK
                     SGMISVRLGDCIMDVVRGAEFTFLQDVIALDNEGQEIELLGQVDGRVVVTPHL"
     gene            <832549..>835242
                     /locus_tag="AGOS_ADR071W"
                     /old_locus_tag="ADR071W"
                     /db_xref="GeneID:4620316"
     mRNA            <832549..>835242
                     /locus_tag="AGOS_ADR071W"
                     /old_locus_tag="ADR071W"
                     /product="ADR071Wp"
                     /transcript_id="NM_209520.1"
                     /db_xref="GeneID:4620316"
     CDS             832549..835242
                     /locus_tag="AGOS_ADR071W"
                     /old_locus_tag="ADR071W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL149W (ATG9)"
                     /codon_start=1
                     /product="ADR071Wp"
                     /protein_id="NP_984167.1"
                     /db_xref="GeneID:4620316"
                     /translation="MEQSEDTIQHERKNTFLSRVFGVHSSEVGDSIETAELSQYPIQI
                     ARSGSNAIDESRVIESDQASSSEEEDTDGHDLSVAENMTSYNGAQGSGSEDSDVPFSD
                     QELETIETYTIAKVGQGSSSEDDRLQADSAEEEDALLFQHRLQDGSKGRNKVSSQPLG
                     LKRILGSKGKSILGKEPASQEDSFIFRKGPTWDEENQLRPESKRPGLLSGKSNARLSS
                     PSRPSPLSARERALWKWANVENLDGFLQDVYSYYLGNGFYCIMIEKILNLLTLLFIVF
                     ISTYMSHCIDYSKLPNGHKFSDVRVDQCYETQITGTTKLLFWIFGVFVVLKVVQMYFD
                     FRRIHEIHNFYTYLLNISDKELQTIPWQSVIHQIMRLKDQNAVTANVVEVKAKNHIDA
                     HDVANRIMRKENYLIALYNKDILHLSLPIPLYRTSTLTKTLEWNIHLCIIGFAFNEAG
                     FLKQSFLNPAQREFLSEELKKRFILAGFLNIILAPFLVVYFVLLYFFRYFNEYKTSPG
                     SLSTRQYTPIAEWKFREYNELYHLFKKRMGLSYEVANTYINQFPNALGDYFFKFVKFI
                     SGSFVAILALMTVLDPENFLNFELTADRTVLFYMTVLGTIWAVCHSAVNDNCSVFDPE
                     DSLKELITYIHYAPKEWDGRYHTDEVKQEFCKLYNLRVILLLRELASLIMTPFILWFS
                     LPNSAESIVDFFREVTVYGDGLGYVCKYAMFDENCKKGLRTNKHLQGTQTKYGHSLGD
                     DHDSSDEETDKGMNKMIQSYMYFVDDYQNSVNAVGKYQIPKTQNLSHESKYNMKSHQH
                     YSWKKQFKLGSKPEDFKIGSVTPRALSSSILANKPKSNLRARLDPEISHSNVQFDDLG
                     ESFINSIPVADYDPIERSDAMGGNGVLGLLNQYYRKSDVGR"
     gene            complement(<835365..>837785)
                     /locus_tag="AGOS_ADR072C"
                     /old_locus_tag="ADR072C"
                     /db_xref="GeneID:4620317"
     mRNA            complement(<835365..>837785)
                     /locus_tag="AGOS_ADR072C"
                     /old_locus_tag="ADR072C"
                     /product="ADR072Cp"
                     /transcript_id="NM_209521.1"
                     /db_xref="GeneID:4620317"
     CDS             complement(835365..837785)
                     /locus_tag="AGOS_ADR072C"
                     /old_locus_tag="ADR072C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL148C (NOP14)"
                     /codon_start=1
                     /product="ADR072Cp"
                     /protein_id="NP_984168.1"
                     /db_xref="GeneID:4620317"
                     /translation="MAGSQLKRLRATLKAHGLTGQTNVKKSKNRKTSKEYDHEEKARV
                     VSAIREQFNPFDVKANRSKLHAAGAGDAKVAVGKPGISKQIGEEQRLRFHESKKAQKN
                     RAGGLIDKRFGERNKHMTAEEIMLERFTKERQAQSRQSKKSLFNLDDEEDDGDASGAL
                     THFGKPLASDFEDGDLGVGMAGALGPKRGLADDEMEPEVPKKKTKAEVMKEVIAKSKF
                     YKHERQKAREQMEEEIDQLDDEFEGIMSELRAAPRARTNPVESKPSQELEYDQKVREL
                     CLDRRAAPADRVKTDEEMKQEREEKLKKLELDRVNRMNGLVDGEDAQGVEDLDNGFWE
                     AEDSDAGEYGEYMEAIADSDDDLKFENEPETAEPTGTSHKQKKIAALPCPITHAELMD
                     VLTAYQLEEQPHVVKNIIKAYQPKLAEGNKEKLDKFSGVLLHHILFLSSSDYASQADV
                     IVEVQNSLISILKLMSEKYNQALSEACRQVVTEIQQRFKAQHYLGLKPSDLVFFSLVG
                     YIFSTSDHYHLVVTPCCILLGEFLEQIKLTDYERLIFVAIAANICVRYQRISRRHVPE
                     LAYFLKRALASLLPFSTENSQAFNIRLDSDKLSLSKTLVLEDIEPTLKLRFLFLKEYD
                     DSVQAQLLVNLLSTLDACVSQLWKGVSAFPELTQPFKPLLSAFASSYPTFAKPQQIME
                     RMERISNLQQHFPLTLQNHKPAAIPSYMPKFEDNFNPEKKSYDPDRTRNDINKMKAQL
                     KKERKLTMKELRKDTKFEARQKIEEQRKHADDYKAKMARIVNQISTEEGADKNKYEKE
                     KRLRAGKR"
     gene            <838063..>839388
                     /locus_tag="AGOS_ADR073W"
                     /old_locus_tag="ADR073W"
                     /db_xref="GeneID:4620318"
     mRNA            <838063..>839388
                     /locus_tag="AGOS_ADR073W"
                     /old_locus_tag="ADR073W"
                     /product="ADR073Wp"
                     /transcript_id="NM_209522.2"
                     /db_xref="GeneID:4620318"
     CDS             838063..839388
                     /locus_tag="AGOS_ADR073W"
                     /old_locus_tag="ADR073W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL147W (RPN5)"
                     /codon_start=1
                     /product="ADR073Wp"
                     /protein_id="NP_984169.2"
                     /db_xref="GeneID:4620318"
                     /translation="MSRDAPIKAEKNYADILNDQFPGIDILAKTNHGEALDKLLSLEK
                     QTRQASDLESSKRVLVRIVDLLVANNDWAQLDEQLVLLSKKHGQLKLSIQTMVQRIME
                     HLNELDNVDTKIASIETIRKVAENKIFVEVERARVTRELAHIRREQGKLDEAADILCE
                     LQVETYGSMDMSEKIEFIIEQMELSILKGDFSQATVLSRKILKKTFKNEKYEALKLEY
                     YKLLIKIGLHKSDYLEIAQYYQEIYNTPSVRSSEEQWKTALSHVVYFLILAPYDNLQN
                     DLILKVQQDNNLKKLELQESLVKLFTTPELMRWPMVKQTYEPVLSKENVVFGSNQGHW
                     DDLRKRVIEHNLRTISKYYTRITLPRLNELLDLNEAETETFISNLVNQGIIYAKINRP
                     AKIVNFGKPKNSSELLNEWSSNVDQLLEHIETIGHLITKDEIMHGLKAK"
     gene            complement(<839452..>839931)
                     /locus_tag="AGOS_ADR074C"
                     /old_locus_tag="ADR074C"
                     /db_xref="GeneID:4620319"
     mRNA            complement(<839452..>839931)
                     /locus_tag="AGOS_ADR074C"
                     /old_locus_tag="ADR074C"
                     /product="ADR074Cp"
                     /transcript_id="NM_209523.2"
                     /db_xref="GeneID:4620319"
     CDS             complement(839452..839931)
                     /locus_tag="AGOS_ADR074C"
                     /old_locus_tag="ADR074C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR211C"
                     /codon_start=1
                     /product="ADR074Cp"
                     /protein_id="NP_984170.2"
                     /db_xref="GeneID:4620319"
                     /translation="MILLREDIQIKIKELEQWELRQPSAGLGAGLSPNRKNSPVRGPE
                     ATSHLSNGVPIADPFLASIINKLQTNILQTLSQRLAGEGKPMGKQELEAVVSPQMTQF
                     QKEMTVFEQRKFREYDSKMDQLLKENRKLSNQVIRLKDRWDSLVESAKQKRNQQERQ"
     gene            <840317..>841690
                     /locus_tag="AGOS_ADR075W"
                     /old_locus_tag="ADR075W"
                     /db_xref="GeneID:4620320"
     mRNA            <840317..>841690
                     /locus_tag="AGOS_ADR075W"
                     /old_locus_tag="ADR075W"
                     /product="ADR075Wp"
                     /transcript_id="NM_209524.2"
                     /db_xref="GeneID:4620320"
     CDS             840317..841690
                     /locus_tag="AGOS_ADR075W"
                     /old_locus_tag="ADR075W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL146W (LDB17)"
                     /codon_start=1
                     /product="ADR075Wp"
                     /protein_id="NP_984171.2"
                     /db_xref="GeneID:4620320"
                     /translation="MALKPPYSPESGGASRSRTQTETVHFWEYLESLLDAADCTSEAQ
                     VNSALVAYVKTASERYGEYLVEDRDFYRVALLLLRAPLYERNKSFCISKMLSLLSIDL
                     LEMSMKFVISYILLCECKADSSSLDHVLDYQGFTVIYNKLYEHFAYLHRYSDDEETTF
                     EANITELDEEINEELRKISTVLLDLLFQILKYSKCELANLQRVDDFFVYYMMVSLRSD
                     TVEDMYNNAKFRLLLALNEQYMISNHKAGLENKVYAYLMNHTASKQFVELLLLQFNRT
                     VDKSLQIMMCKIIYLILTSRDEIAMDYFYLNDLHVVTDVLIRNLTNISEDEEVLRNTF
                     LRILDLILRKTEWTQSHYREQELLELLEYLCSVDNLCSSGNVKSEHMSTTKLAFKCRQ
                     AIRQLKVEQKKSRDAAAAPAPRPKTPEPRFERTDSHMSVPMDKITRAIGRSPFASPPP
                     PPPSRRV"
     gene            complement(<841925..>843337)
                     /locus_tag="AGOS_ADR076C"
                     /old_locus_tag="ADR076C"
                     /db_xref="GeneID:4620321"
     mRNA            complement(<841925..>843337)
                     /locus_tag="AGOS_ADR076C"
                     /old_locus_tag="ADR076C"
                     /product="ADR076Cp"
                     /transcript_id="NM_209525.1"
                     /db_xref="GeneID:4620321"
     CDS             complement(841925..843337)
                     /locus_tag="AGOS_ADR076C"
                     /old_locus_tag="ADR076C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR212C (TUB4)"
                     /codon_start=1
                     /product="ADR076Cp"
                     /protein_id="NP_984172.1"
                     /db_xref="GeneID:4620321"
                     /translation="MTGEIISIQVGQCGNQVGKQFWGQLAREHGIGVDGQSLHPEDAN
                     VVREDDTNVFFRQNDHNRFTPRALLYDLEPSAIGDVQNCFPGFFNERNVWISKEELGA
                     GNTWSIGYDYGLEKQDEFMNMIDKEIDATGNFEGFQLIHSVAGGTGSGLGSNLLEALS
                     DRYHKKIVSTYSVFPSRESEVVVQPYNTILTLRRLIDNSDASVLFDNDALLNLTARVL
                     RDSNTSYQQTNQLIASVMSSVTNSLRFPSYMYNSLPSIFSTLVPTPELHFLAPSFTPF
                     TSDFVPGAKDFKRLSAYDVILDLFDKNNSMVTRDTDTPVYLAIYDALQGAVEQSDVTR
                     AILKTQQRIKFAPWSPTSLHVNLGRKSPYNSSANSDYVSGMMLANTSSIVSVFQKTVS
                     SFDVIFKRGAFLHKFQNGKMFQHGWDEFLESREVIQGVIDEYIAAEQENYLDDVLEED
                     GNFVGGDAEMIDIESNDDII"
     gene            complement(<843584..>847198)
                     /locus_tag="AGOS_ADR077C"
                     /old_locus_tag="ADR077C"
                     /db_xref="GeneID:4620322"
     mRNA            complement(<843584..>847198)
                     /locus_tag="AGOS_ADR077C"
                     /old_locus_tag="ADR077C"
                     /product="ADR077Cp"
                     /transcript_id="NM_209526.1"
                     /db_xref="GeneID:4620322"
     CDS             complement(843584..847198)
                     /locus_tag="AGOS_ADR077C"
                     /old_locus_tag="ADR077C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL145C (COP1)"
                     /codon_start=1
                     /product="ADR077Cp"
                     /protein_id="NP_984173.1"
                     /db_xref="GeneID:4620322"
                     /translation="MKMLTKFESKSTRAKAIAFHPSRPWVLVALFSSTIQLWDYRMGV
                     LLHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNGHLDYVRTVF
                     FHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLDET
                     VRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHTRGVNWASFH
                     PTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPFQNLIISVGEDST
                     IRVWDLDKRTPVKQFKREQDRFWSIRAHPNVNLFGAAHDSGIMVFKLDRERPPVAVNQ
                     NQLYFVNKEKQVQMFDYEKKVSSLPFVSLKNFGKPYNVFKSISYNPSQHSLLVNSSSR
                     DGDRYALCLLPKQASGAVDATNIVEDKGSFATFVARNRYAVYNSASESLEVRGLDNKV
                     TKSIKIEGTVKDIVYGGPGAVLILKPKAVVLFDVQQGKKLAEVALKMVKYAVWSPDGQ
                     YVALMSKHTLTIATRKLEITTSNHETIRIKSAAWDETGVLLLSTLNHIKYCLLNGDSG
                     IIKTLSKTLYITKAHGKHIYALNRDGDIEILTIDPTEYRFKKALVNKNFPEVLRLIRT
                     SNLVGQNIISYLQKAGYPEIALQFVEDPQTRFDLALEYGNLTVALTEASKLQNDAVWE
                     RLGKEAVLQGNTTIAECVYQNLKQLDKLSFLYLLKGDSIKLSKMENIAEQRGDISSLL
                     MHTFYTNSVSKRADTFAAAGSVPLAYAVAKANGDEEKASQLLKEAGLSEDDVVLPETV
                     SGSAFVKDSTLAQPFENWPMREAELSYFEKAVLGQIEELDLDTEPAPENETKHLDFAA
                     EDEDMGLFEDAAMSGEEDAWDIDDNDLALDEEPNKDDDTMVEELDATEENTWVKNSKL
                     PAVLVAAGAFEAAAQALHKQAGIVNFEPLRQRFHDIYEGSRAYMPATPKELSSIAGCI
                     RMRVDEDDSKALPYVLGISSVTSKLNEGFKLFKANNLEAAVEAFRNVIYMITLLAVDN
                     SDDAETARNALERARDYILGLSIELERRALPQNDVKRNLELASYFTKVNLFAQHRSNA
                     LQVAMSQSFKHKNFVQASHFASEFLEIVPSGPRADQARKIKDKADSLASDAVEIDFDP
                     YAEFDICAATHTPIYKGTQSSVDPLTGAKYHISEKGKLDKIAYISKVGATASGLRIQI
                     "
     gene            complement(<847571..>848923)
                     /locus_tag="AGOS_ADR078C"
                     /old_locus_tag="ADR078C"
                     /db_xref="GeneID:4620323"
     mRNA            complement(<847571..>848923)
                     /locus_tag="AGOS_ADR078C"
                     /old_locus_tag="ADR078C"
                     /product="ADR078Cp"
                     /transcript_id="NM_209527.1"
                     /db_xref="GeneID:4620323"
     CDS             complement(847571..848923)
                     /locus_tag="AGOS_ADR078C"
                     /old_locus_tag="ADR078C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR213C (CRR1)"
                     /codon_start=1
                     /product="ADR078Cp"
                     /protein_id="NP_984174.1"
                     /db_xref="GeneID:4620323"
                     /translation="MSKRIIQLILLSAFARANYVEPFKSNPYIACSEASHCPKEWPCC
                     SQYGQCGSGPLCISGCNPKFSHSPESCVPVPALLPQLEIVASDDKGVYLEMSGQPALV
                     TKFQRKSSAQLLEVHHEEQQYGVSALEQDLNSRGLIHFPDYMITSKPKVAREMLEQYD
                     FIHSGFISVDGKSESLILGMPKKTTGSLISSSKVFLYGRAAVTMKTSRGPGVITAIVF
                     MSSTQDEIDYEFVGSELHTVQTNYYYQGELNHSRMRRHSLPSNSHEEYHIYEVDWDAE
                     RIHWMVDGEIVRTLYKRDTWDPVHKIYKYPQTPMMLQISLWPAGTPDAPQGTIEWAGG
                     LIDWENAPDIKAHGQLAAQIQRVAITPYNNDFCPEIHESMGQWGAQNSEEEPFRVAYG
                     YESNNGRFDPKKLKWYTDARLHLSSWHATGIKPTAAQRQQHHRRSLPHVEAPPITNTM
                     "
     gene            complement(<849148..>850206)
                     /locus_tag="AGOS_ADR079C"
                     /old_locus_tag="ADR079C"
                     /db_xref="GeneID:4620324"
     mRNA            complement(<849148..>850206)
                     /locus_tag="AGOS_ADR079C"
                     /old_locus_tag="ADR079C"
                     /product="ADR079Cp"
                     /transcript_id="NM_209528.1"
                     /db_xref="GeneID:4620324"
     CDS             complement(849148..850206)
                     /locus_tag="AGOS_ADR079C"
                     /old_locus_tag="ADR079C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL144C"
                     /codon_start=1
                     /product="ADR079Cp"
                     /protein_id="NP_984175.1"
                     /db_xref="GeneID:4620324"
                     /translation="MSTLGEQDKLRALVIGAGAVGVVAAYALFRNGGAEVSLVSRSDY
                     DRVVSQGYTIDSVNYGNVTGWRPSHLYKSLTDAIAADVFYDYVVLTTKNVPDGPVQDT
                     VAHILAPILDANKRVDPEKPFGLVLMQNGIDIEHTVLQDGDTADRKLALLSGVQMVAS
                     TKIEPGRISQKTPDRLYVGAFDIADELAIQFAKRFVSLYHNEGVNEALYDANVRETRW
                     TKLLYNASINPTTALVGLDVSRCLSYGIQGKSTAEHIFRPAMKEIIAAAASEGIVLDE
                     KLVPFFIDITGKIPFKPSMCVDAEHSRLMEIEVILGNPIRIAERHNVPVPTLSMLYHL
                     LILVQGKLKAQQGIVNHV"
     gene            <850921..>852996
                     /locus_tag="AGOS_ADR080W"
                     /old_locus_tag="ADR080W"
                     /db_xref="GeneID:4620325"
     mRNA            <850921..>852996
                     /locus_tag="AGOS_ADR080W"
                     /old_locus_tag="ADR080W"
                     /product="ADR080Wp"
                     /transcript_id="NM_209529.1"
                     /db_xref="GeneID:4620325"
     CDS             850921..852996
                     /locus_tag="AGOS_ADR080W"
                     /old_locus_tag="ADR080W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR214W (FRE1)"
                     /codon_start=1
                     /product="ADR080Wp"
                     /protein_id="NP_984176.1"
                     /db_xref="GeneID:4620325"
                     /translation="MKIPVVVLAYLPLVINALVIVDSALATACIYYDKTFNWGCGSTG
                     NGQRAYACRCRNVNWLGTVTNCIVSNSDSKKVIEHALRHVSQRCKDRGNYNYSLEDMY
                     GFYHNGTAFLRDPTPEDLKQTVNTTLRANPKEFSWYYTKFQLFNDSVRKSQWFGWILV
                     FYWAAVVGFATLFNICDRVFGVRPMRWNWVKKHIALPSVFSDYHERTYFFCRILPLNF
                     PTRLHGLIVTGFVALTVLLCCFDYNIKLPHPFTTSQWFMDLDLISYRVDLMAISLFPV
                     IYFFGIRNNPFIPLSGMSFSTFNFYHKWTAYACFVLAAIHSLIWIVYSESKEGGGFKA
                     WWGDAYFKWGLFATVLAGLLVLHSEKFIRQRTYEFFLILHKLFNIVFIVCMYMHIKTL
                     GWHGWVWSMVAIYCFERVARIARIVLAGGIKKATLTDVGDRVLKMTVEKPKHFKYYPG
                     AYVFVYFISGKDAWFYPFQSHPFTVLNTPKIDGDNLVIYFKVHKGVTQQLLNRIFLSG
                     KESIEYKVLLEGPYGNTIPRLAAPDRRYVGASAGLGVAAVYPHFVSLLDKESQFTHSF
                     YWIINDLSYLHWFSHELRYLADRNCDIKIIYTRSNESAKELTPDVADSASAKFVDSLD
                     ICRLLLRPDLKEIVEEQILLSSNQAQDVTFISSGPSTFNDHFRYAVKSSITGKLQCDV
                     DLEEESYTW"
     gene            complement(<853030..>854073)
                     /locus_tag="AGOS_ADR081C"
                     /old_locus_tag="ADR081C"
                     /db_xref="GeneID:4620326"
     mRNA            complement(<853030..>854073)
                     /locus_tag="AGOS_ADR081C"
                     /old_locus_tag="ADR081C"
                     /product="ADR081Cp"
                     /transcript_id="NM_209530.1"
                     /db_xref="GeneID:4620326"
     CDS             complement(853030..854073)
                     /locus_tag="AGOS_ADR081C"
                     /old_locus_tag="ADR081C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR215C (CDC123); Tandem gene duplication in this genome"
                     /codon_start=1
                     /product="ADR081Cp"
                     /protein_id="NP_984177.1"
                     /db_xref="GeneID:4620326"
                     /translation="MSTEYAALTKIAVTAEHIKKCAFSSWYEAFKGHTPRAEVIRPLP
                     EAFVRYLEQDGIRLAQEEGSVSFYTQELEQTAENEYSDWEGGDSASERSCVPVDPVAD
                     FPEVHARVKQAIARFGAVAPKLNWSAPKDATWLLPNNSMKCSEANDVYLLLNGSGHVM
                     HDLQDAFRECVDGGAERPAPELVLREWFNLNPALEFRVFVRDGEVLGACQRDLNYYDY
                     LKPLEEQLRTAIEDFVHEVMLQRFPDDTFVADVYIPRPFTKVWLIDVNPFARKTDPLL
                     FSWNELCTLKPDAEGQPELRLVAENNIGRFAAKEHSENQVPLDVVEAGLNPQSMQKLV
                     ETWRDLLKIQEEE"
     gene            complement(<854341..>855408)
                     /locus_tag="AGOS_ADR082C"
                     /old_locus_tag="ADR082C"
                     /db_xref="GeneID:4620327"
     mRNA            complement(<854341..>855408)
                     /locus_tag="AGOS_ADR082C"
                     /old_locus_tag="ADR082C"
                     /product="ADR082Cp"
                     /transcript_id="NM_209531.1"
                     /db_xref="GeneID:4620327"
     CDS             complement(854341..855408)
                     /locus_tag="AGOS_ADR082C"
                     /old_locus_tag="ADR082C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR215C (CDC123); Tandem gene duplication in this genome"
                     /codon_start=1
                     /product="ADR082Cp"
                     /protein_id="NP_984178.1"
                     /db_xref="GeneID:4620327"
                     /translation="MSTEDAALTGIAVTAELKKKCAFSSWYEAFKGHTPRAEVIRPLP
                     EEFVSYVDQRGIRLAREEGSKYFYGQELEPTTDGEYSDWEGGDSASERSFVPLDPVAD
                     FPEVHARVKQAIARFGAVAPKLNRSAPKDAMWRLRNYSMKCNEANDVYLLLNGSSHVA
                     CDVSDTLLDWLASTEDEPVMELVLREWLDVNPALEFRVFVRGGEVLGACQRDLNYYDY
                     LKPLEEKLRTAIEDFVHDVMLQRLPDDTFVADVYIPRPFTKVWLIDVNPFARETDPLL
                     FSWNELCTLKPNAEGQPELRLVAENYIGRFAENNIGRFAAKEHSEHQVPLDVVEAGLN
                     PQSMQKLVETWRDLLKIQEEE"
     gene            <855646..>857235
                     /locus_tag="AGOS_ADR083W"
                     /old_locus_tag="ADR083W"
                     /db_xref="GeneID:4620328"
     mRNA            <855646..>857235
                     /locus_tag="AGOS_ADR083W"
                     /old_locus_tag="ADR083W"
                     /product="ADR083Wp"
                     /transcript_id="NM_209532.1"
                     /db_xref="GeneID:4620328"
     CDS             855646..857235
                     /locus_tag="AGOS_ADR083W"
                     /old_locus_tag="ADR083W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL143W (CCT4)"
                     /codon_start=1
                     /product="ADR083Wp"
                     /protein_id="NP_984179.1"
                     /db_xref="GeneID:4620328"
                     /translation="MPPKVSASNATFKNREKPQEVRKANIIAARAVADAIRTSLGPKG
                     MDKMIKTARGEILISNDGHTILKQMAILHPVAKMLVEVSAAQDSEAGDGTTSVVILTG
                     ALLGAAEKLLAKGIHPTIIAESFQRAGQRAVEVLLGMSKRISLQDRAELVRAASTSLS
                     SKIVSQYSTFLAPLAVDCVLSLTNEASTNVDLNDIRLVKKVGGTIDDTEMVDGVVLTQ
                     NIVKSAGGPVRMEKAKIGLIQFQISPPKPDTENNIVVNDYRQMDKILKEERAYLLKIC
                     KKIKKAKCNVLLIQKSILRDAVNELALHFLSKLNIVVIKDVERDEIEFLSKSLGCKPI
                     SDVELFTEDRLGSADLVEEIDSDGTKIVKITGIKTGNAKPTVSCIVRGANNVVLDETE
                     RSLHDALCVIRCLVKERALIAGGGAPEIEVSRTIMRESRAMQGVEAFVWQEFAEALEV
                     IPTTLAENAGLNSIKVVTELRSRHESGETNAGISVRRSGTTNTYDEHILQPVLVSTSA
                     ITLAAECVKSILRIDDITFSR"
     gene            complement(<857326..>858156)
                     /locus_tag="AGOS_ADR084C"
                     /old_locus_tag="ADR084C"
                     /db_xref="GeneID:4620329"
     mRNA            complement(<857326..>858156)
                     /locus_tag="AGOS_ADR084C"
                     /old_locus_tag="ADR084C"
                     /product="ADR084Cp"
                     /transcript_id="NM_209533.2"
                     /db_xref="GeneID:4620329"
     CDS             complement(857326..858156)
                     /locus_tag="AGOS_ADR084C"
                     /old_locus_tag="ADR084C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL142C (CRD1)"
                     /codon_start=1
                     /product="ADR084Cp"
                     /protein_id="NP_984180.2"
                     /db_xref="GeneID:4620329"
                     /translation="MIVKPLSPLWRLPALEVRARIAGNRWMVPGVLVGRSYSCRAGPP
                     SEQQTHDAAPKSVIWTVPNILTMSRIACAPFIGHCIMTQQLMPAFCLFAYSCVTDFLD
                     GYLARKYKSRTVAGTILDPMADKLLMIVTTAGLTLPTGPQLIPLPIASLILGRDGLLA
                     LSAIYYRYASMRAVYGKVTWGTYCDFFRYPSAEVKPTLISKWNTFLQMVYLGCGLVVL
                     ALGPDEARPETEGEGDPWWRRAYRYLGYVVGATTVLSGASYIFSKSAVKYLKPQGPRP
                     "
     gene            <858582..>860621
                     /locus_tag="AGOS_ADR085W"
                     /old_locus_tag="ADR085W"
                     /db_xref="GeneID:4620330"
     mRNA            <858582..>860621
                     /locus_tag="AGOS_ADR085W"
                     /old_locus_tag="ADR085W"
                     /product="ADR085Wp"
                     /transcript_id="NM_209534.1"
                     /db_xref="GeneID:4620330"
     CDS             858582..860621
                     /locus_tag="AGOS_ADR085W"
                     /old_locus_tag="ADR085W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL141W (BPL1)"
                     /codon_start=1
                     /product="ADR085Wp"
                     /protein_id="NP_984181.1"
                     /db_xref="GeneID:4620330"
                     /translation="MNVLVYNGPGASPESVRQTLLELRRLLEPHYAVSTVQAKALSSE
                     PWQGKTAALVFPGGADLPFGRECKAALPAIRRYVSQLGGTYIGFCAGGYFGSSRVEFD
                     VDGPLEVVGPRELQFFPDVARGPAFSGFQYSSEEGARAAMLKSSEAGAGSFACYYNGG
                     SVFLDAHKYGNVSILASFEEEVDIPTDMEPAAPRAAVVLCSVGKGKALLTSPHPEFNP
                     SSMCAAQDGLAPGLLAKLREHELSRAHFMRYILTEAGLDCNEAITRLPPSLTPLLLCS
                     PSRPELVSRFVEGFKESSKPLATYHILEDNSDKFALHEGFERYSCAEGFLQDHDPETA
                     TKQLVLGAHGQVLPPRSLTPNFDMERYFASLEKDTGIGSVLLYGDVVTSTSVLLDSNK
                     KLLGLLPENSVLHVGSLQLSGRGRGSNSWVNPRGVSASTTCISLPLVSPITGKHISIV
                     FVQYLAILAYCEAILSYGSGFEDIPIRIKWPNDMYVLKPHYYYQNKLRLLGGGVNAKL
                     PVPADAEESYAKISGLLVNSNLMNNKYSLLLGCGLNVSNELPTVSLKSWVDILNVERK
                     NMGLNLLPELSAEELLAKYMNKLDIILKDFVNHGPHVILPRYYKLWMHSGQVITLTEH
                     NCRAKISGITPDYGLLIANELKQNSNDEYTGKVYHLQPDGNTFDIFRGLLSRRAG"
     gene            complement(<860817..>866054)
                     /locus_tag="AGOS_ADR086C"
                     /old_locus_tag="ADR086C"
                     /db_xref="GeneID:4620331"
     mRNA            complement(<860817..>866054)
                     /locus_tag="AGOS_ADR086C"
                     /old_locus_tag="ADR086C"
                     /product="ADR086Cp"
                     /transcript_id="NM_209535.2"
                     /db_xref="GeneID:4620331"
     CDS             complement(860817..866054)
                     /locus_tag="AGOS_ADR086C"
                     /old_locus_tag="ADR086C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL140C (RPO21)"
                     /codon_start=1
                     /product="ADR086Cp"
                     /protein_id="NP_984182.2"
                     /db_xref="GeneID:4620331"
                     /translation="MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDET
                     QMRAKVGGLNDPRLGSIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKV
                     CECVCMHCGKLLLDEYNELMRQAIKIKDPKRRFNAVWSLCKAKMVCDTEVPSEDDPSK
                     YISRGGCGNAQPSIRKDGLSLVGTWKKDKNAEDADQPEKRIISAEEILNVFKHISPED
                     SWRLGFNEDFSRPEWMLLTVLPVPPPPVRPSISFNESQRGEDDLTYKLGDILKANINV
                     QRLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSGRPIKSIRARLKGKEG
                     RIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLV
                     RNGPNEHPGAKYVIRDNGDRIDLRYSKRAGDIQLQYGWKVERHIMDDDPVLFNRQPSL
                     HKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP
                     LQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGVIPTPTIL
                     KPKPLWSGKQLLSMAIPSGIHLQRFDEGTTYLSPKDNGMLIIDGQIIFGVVDKKTVGS
                     SSGGLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHNGFSIGIGDTIADEKTMREITDA
                     IALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAEVNLKDL
                     NNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKG
                     FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTT
                     RNSLGNIIQFVYGEDGMDAAHIEKQSIDTIPGSDLAFEKRYRIDLLNPNYALDPNLLE
                     SGTEIVGDLKLQNLLDEEYKQLVQDRHFLRKIFMDGEHNWPLPVNIRRIIQNAQQTFR
                     IDSTKPTDLSIQDVVQGVRGLQERLLVLRGKSQILQEAQENAITLFCCLLRSRLATRR
                     VITEYRLTKQTFEWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG
                     VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEESYATDQEKAKLIRSAIEHTTLKSV
                     TVASEIYYDPDPSSTVIEEDEEIIQLHFSLMDEETEASLKHQSPWLLRLELDRVAMTD
                     KDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLK
                     KIENTMLESITLRGVQDITRVVMMKYDRKVPSETGEYHKIPEWVLETDGVNLSEVMSV
                     PGVDPTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTS
                     QGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCSGVSENVILGQMAP
                     IGTGSFDVMIDDESLIKYMPEQKLSTAVEVNDGGATPYNSDAGLVNTKVDIKDELMFS
                     PLVEAGTSDAIASGGFTAYGGADYGGATSPFSGYGNGPTSPGFGDVSSPGFSPTSPAY
                     SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
                     TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
                     PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPQYSPRSPS
                     YSPSFNNNDKEQKDENGTH"
     gene            complement(<866719..>867828)
                     /locus_tag="AGOS_ADR087C"
                     /old_locus_tag="ADR087C"
                     /db_xref="GeneID:4620332"
     mRNA            complement(<866719..>867828)
                     /locus_tag="AGOS_ADR087C"
                     /old_locus_tag="ADR087C"
                     /product="ADR087Cp"
                     /transcript_id="NM_209536.2"
                     /db_xref="GeneID:4620332"
     CDS             complement(866719..867828)
                     /locus_tag="AGOS_ADR087C"
                     /old_locus_tag="ADR087C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR216C (CPR6)"
                     /codon_start=1
                     /product="ADR087Cp"
                     /protein_id="NP_984183.1"
                     /db_xref="GeneID:4620332"
                     /translation="MTERQKTYFDLSIGGKPAGRVVFEVYSDVTPKTAENFVRLCAGD
                     AGECRTKPGVPLCYQGSLFHRVIKGFMCQFGDFTNGDGTGGESIYGEKFEDENFARKH
                     DRPFLLSMANAGPNTNGSQCFITCAPTPHLDGKHVVFGEVIQGKRVVRAIERQETAAD
                     RPLADVRIDACGILPASYEVPADAEATPADEYGDDYEETLADDAKVDLADPRSVIRAV
                     EAVKAIGTAQLQAARFDVAVQKYAKAAGFLQEYFPDDLPDADVAALEQLKVAVHLNLA
                     LAALKAGNHQRVLSAASEVLHGAADDKAKAKALYRRGLAYHHLKDPEMALTDLELAAT
                     YQPGDAGIAQAIVNARALKQKLREQQKKALSKMFS"
     gene            complement(<867923..>868477)
                     /locus_tag="AGOS_ADR088C"
                     /old_locus_tag="ADR088C"
                     /db_xref="GeneID:4620333"
     mRNA            complement(<867923..>868477)
                     /locus_tag="AGOS_ADR088C"
                     /old_locus_tag="ADR088C"
                     /product="ADR088Cp"
                     /transcript_id="NM_209537.1"
                     /db_xref="GeneID:4620333"
     CDS             complement(867923..868477)
                     /locus_tag="AGOS_ADR088C"
                     /old_locus_tag="ADR088C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL139C (SCM3)"
                     /codon_start=1
                     /product="ADR088Cp"
                     /protein_id="NP_984184.1"
                     /db_xref="GeneID:4620333"
                     /translation="MIKKRRTGRLRRLTGALRELLDERPAPPAADTRPAGVVYVMSRE
                     NEPIPRLSDAEVMERHRRADENMKQAWTRIIEKYEALDDQGDVVDLRTGEIVEDNGHI
                     RGLADGVRAEVRYESALRDLVDVDEARGGVWSAEDTDGADSGAESEGAAESEGAASGA
                     EHDDSATPEPPAPGPAARAPAPVD"
     gene            complement(<868591..>868836)
                     /locus_tag="AGOS_ADR089C"
                     /old_locus_tag="ADR089C"
                     /db_xref="GeneID:4620334"
     mRNA            complement(<868591..>868836)
                     /locus_tag="AGOS_ADR089C"
                     /old_locus_tag="ADR089C"
                     /product="ADR089Cp"
                     /transcript_id="NM_209538.1"
                     /db_xref="GeneID:4620334"
     CDS             complement(868591..868836)
                     /locus_tag="AGOS_ADR089C"
                     /old_locus_tag="ADR089C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR218C (COA4)"
                     /codon_start=1
                     /product="ADR089Cp"
                     /protein_id="NP_984185.1"
                     /db_xref="GeneID:4620334"
                     /translation="MAGDTEYYKQAVEEYAALKQDTDPEEWDRRIAQTGCYVENMALQ
                     LCHAETGDWRACAADMARFKACWAAQGNRERVRTVDR"
     gene            <869153..>872857
                     /locus_tag="AGOS_ADR090W"
                     /old_locus_tag="ADR090W"
                     /db_xref="GeneID:4620335"
     mRNA            <869153..>872857
                     /locus_tag="AGOS_ADR090W"
                     /old_locus_tag="ADR090W"
                     /product="ADR090Wp"
                     /transcript_id="NM_209539.2"
                     /db_xref="GeneID:4620335"
     CDS             869153..872857
                     /locus_tag="AGOS_ADR090W"
                     /old_locus_tag="ADR090W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL195W (SEC31)"
                     /codon_start=1
                     /product="ADR090Wp"
                     /protein_id="NP_984186.2"
                     /db_xref="GeneID:4620335"
                     /translation="MVKLAEYPRTATFAWSPDKVPVLATGTASGTVDADFSSTATLEF
                     WEVGSAESGPQGSVTADAKFNDLDWSRDGAMLAGALENGVVEFFCARERRSVARVARH
                     TTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAAGYSPFGPGTAMTPIDEVQSLA
                     WNQSLAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPHSGLKNQLAVVEWHPSNSTRV
                     ATATGNDNEPVILVWDLRNANMPLQVMSQGHSKGILSLDWCKHDEKLMLSSGRDNTCI
                     LWNPEEAQKLTQYPTRGNWCFKTKFAPEAPDLFASASFDNKIQVQTLQNLANKLDLDE
                     TAFKQQESEADFWNNVSQSESKEKPVVTKIQAPAWHSKKSPAAHWAFGGKIVRITSDG
                     LGVSVSKPHIEGFEKNVMLDEALQSKNFVPIINKRLAQTVTPTNEEDWSLLESLSMDG
                     KDTYLQEALSFDDNEAVDSQPDTKDEDFFLNLTGQYEPSGEFELDAANPGITLNLLKG
                     ELSKAVNLALEKDLLLESLVIALNSDDDQIKQKVKNAYYTKYASNSQLARSLYAISER
                     KIEDLVDNLNVSQWKHIVMAIKTYATEQSKNSLLIRLGDRLLQAGQRQNAVTLYLAGQ
                     SLDKVASVWLRELPALESEMRSHKNTLNEAHLEALTEFVERFTVLSAYINEDGGAKLT
                     NEELVSKFLEFVSMASSSGDFELALKFLENLPGDNEQVKTEKQRVLIASGKCATTSAT
                     STRRGKYGSTTVAPGVPGMPAAPMPVVGMQPPANPLADRTASYGAPGYNVAAPMPPPN
                     GRPNPYAAPAPAYQMANPAAHGKYVNSASASPGHNTPRGSVSMPHNPYAPSTNGAGAV
                     SHNSYAPQHVQPAGQPQNMYGVPPQRNFMNQTQDKPPVNPAATNVLSGQSPHLNRKAN
                     NGWNDLPEIVKEKKSRAKPVSTAPVAVASMTGMQASPNVTGGTIPPPPITRVTSNTSI
                     AGSPMTPQKLSRKSSVVQTTALNAPVPVNPYAPPVTGRNAVQSPPLNPYAPSGAHAAA
                     PPTGTYSPHLAGQAIDHTHRATPLSNMAAPPQKAMPGPPPKSMARKSTTSEKDIDSAN
                     QLLSSIQKAPNGGPPPRKQVVAPQPSVHAASPVAEPVAIPPQQQLIIEFFKEELARVT
                     PLVPPEYNKQLKDCSKRLNILFTHIEKQDLLSAPTIEKLHTIVALLREHKYSDALAVH
                     VDIATNHVQEAGNWLTGVKRLIGLAEATSS"
     gene            <873337..>875331
                     /locus_tag="AGOS_ADR091W"
                     /old_locus_tag="ADR091W"
                     /db_xref="GeneID:4620336"
     mRNA            <873337..>875331
                     /locus_tag="AGOS_ADR091W"
                     /old_locus_tag="ADR091W"
                     /product="ADR091Wp"
                     /transcript_id="NM_209540.2"
                     /db_xref="GeneID:4620336"
     CDS             873337..875331
                     /locus_tag="AGOS_ADR091W"
                     /old_locus_tag="ADR091W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL194W (SNF3) and YDL138W (RGT2)"
                     /codon_start=1
                     /product="ADR091Wp"
                     /protein_id="NP_984187.2"
                     /db_xref="GeneID:4620336"
                     /translation="MLKSVEKLTLPQVISQRLTFHYRLRRKPEEIEENCISSETSDEK
                     HSKGCNDQKNASHYEQPVMVTDLRDDSEGFSIQETELERPAMRQSNKMSILVGIFVAV
                     GGFLYGYDTGLINSITEMSFVKKHFAPNHVNFTSMEMSILVSFLSLGTFIGALAAPLL
                     ADSYGRKSTVIFSTFIVFLVGTSLQVSATSMALLVAGRVASGVAVGLISVVVPLYQGE
                     AAQKWCRGAIICTYQWAITWGLLVSSAVSQGTYLRNDASSYRIPIALQYVWCIILGSG
                     MLLLPESPRYYVLRDQLDKAALSLSFLRGVPHDDAGLLEELVEIKANYDYEMSLKSSS
                     YLDCFRTSEHRPKQQIRMLSGILLQAFQQFSGINFIFYYGVNFFSSTGISKSYLVSFV
                     TYAVNVVFNIPGLFLVEYAGRRKLLLVGGVLMTISNFIIAIVGVSTDSVIAKKVMIVF
                     ICMFIAAFSATWGGVVWVMSAEMYPLGVRSKCAAICAASNWLVNFVCAMITPYLIDIS
                     SYTSRLGSTIFFVWGSLNAIGVMVVYLTVYETSGLTLEEINELYRRCPSSLASCAWNR
                     RIKSSPEDYHLTVTGRCAPSEHQDHVDLGNGLCLATYHRAPPSIISESSNSSSDSVVN
                     SGAGAGGPAAAPAGINAYMSDLMNNIVVNTHSTPAAGTST"
     gene            <875670..>876737
                     /locus_tag="AGOS_ADR092W"
                     /old_locus_tag="ADR092W"
                     /db_xref="GeneID:4620337"
     mRNA            <875670..>876737
                     /locus_tag="AGOS_ADR092W"
                     /old_locus_tag="ADR092W"
                     /product="ADR092Wp"
                     /transcript_id="NM_209541.1"
                     /db_xref="GeneID:4620337"
     CDS             875670..876737
                     /locus_tag="AGOS_ADR092W"
                     /old_locus_tag="ADR092W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL193W (NUS1)"
                     /codon_start=1
                     /product="ADR092Wp"
                     /protein_id="NP_984188.1"
                     /db_xref="GeneID:4620337"
                     /translation="MTSKVTKKVRESHSACDDQQHSSRARGTAAEGAPSNVVQPSLGD
                     LKKLAEYTLSTPTSNECINKRLRSTNVQEVKLGGLQFLFYKTLLLCLYMAYAFYRYFQ
                     YQYNRLRIKLLNLAYSPSNTPQLIRQDVLKLQKVPKRLAAILAYKSEGEVGGGVNGLI
                     NDGSNVVCWTVSAGIKHLSLYDHDGVLKANVHQFRQGVYDTLARYYGPNNVPKFAIRI
                     PHLNTVYFNKPEDETQVAEEPSRETHKVAIEVSLLSVRDGRETIVDLTKAMADLCKSG
                     DLKLEEITMKLVDTELTQLVGVEPDLLLYFGPHLDLQGYPPWHIRLTEFYWEEDNDEV
                     MYSVFIRGLIQYSTCKVNLGK"
     gene            <877251..>877835
                     /locus_tag="AGOS_ADR093W"
                     /old_locus_tag="ADR093W"
                     /db_xref="GeneID:4620338"
     mRNA            <877251..>877835
                     /locus_tag="AGOS_ADR093W"
                     /old_locus_tag="ADR093W"
                     /product="ADR093Wp"
                     /transcript_id="NM_209542.1"
                     /db_xref="GeneID:4620338"
     CDS             877251..877835
                     /locus_tag="AGOS_ADR093W"
                     /old_locus_tag="ADR093W"
                     /note="NOHBY425; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0F10318g"
                     /codon_start=1
                     /product="ADR093Wp"
                     /protein_id="NP_984189.1"
                     /db_xref="GeneID:4620338"
                     /translation="MKDAVSTGQNDGVSILLLGLAASGKTTLLRQLQLGNVSASTVDG
                     LPVETVAYRNVVLSSWDPSRAVDHAAFASSRHERCKALIFVVDAADRAGIDAARATLH
                     TLLDDCALRARPLLLLANKTDLPDALPDGELCDLLGLAGGLPRPWRLQAVSAARRTGI
                     YPGLEWLTATLESGRSGRPAQFAAARSIGAAVSD"
     gene            <878167..>879080
                     /locus_tag="AGOS_ADR094W"
                     /old_locus_tag="ADR094W"
                     /db_xref="GeneID:4620339"
     mRNA            join(<878167..878176,878533..>879080)
                     /locus_tag="AGOS_ADR094W"
                     /old_locus_tag="ADR094W"
                     /product="ADR094Wp"
                     /note="5'UTR intron"
                     /transcript_id="NM_209543.2"
                     /db_xref="GeneID:4620339"
     CDS             878535..879080
                     /locus_tag="AGOS_ADR094W"
                     /old_locus_tag="ADR094W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL192W (ARF1) and YDL137W (ARF2); 1-intron"
                     /codon_start=1
                     /product="ADR094Wp"
                     /protein_id="NP_984190.1"
                     /db_xref="GeneID:4620339"
                     /translation="MGVSFSKLFSNLFGHKEMRILMVGLDGAGKTTVLYKLKLGEVVT
                     TIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRIAE
                     AREVLQRMLNEDEIRNAVLLVFANKQDLPEAMSAAEITEKLGLHSIRQRPWYIQATCA
                     TSGEGLYEGLEWLSTNLKNQA"
     gene            <879520..>880105
                     /locus_tag="AGOS_ADR095W"
                     /old_locus_tag="ADR095W"
                     /db_xref="GeneID:4620340"
     mRNA            join(<879520..879522,879746..>880105)
                     /locus_tag="AGOS_ADR095W"
                     /old_locus_tag="ADR095W"
                     /product="60S ribosomal protein L35"
                     /transcript_id="NM_209544.1"
                     /db_xref="GeneID:4620340"
     CDS             join(879520..879522,879746..880105)
                     /locus_tag="AGOS_ADR095W"
                     /old_locus_tag="ADR095W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL191W (RPL35A) and YDL136W (RPL35B); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L35"
                     /protein_id="NP_984191.1"
                     /db_xref="GeneID:4620340"
                     /translation="MAGVKAFELRTKSKEQLEQQLISLKQELAALKVQKLSRPSLPKI
                     NTVRKSIARVLTVINQNQRQAVRELYKGKKYQPKDLRAKKTRALRRALTKFEAAQITE
                     KQRKKQIAFPQRKYAIKA"
     gene            complement(<880253..>883156)
                     /locus_tag="AGOS_ADR096C"
                     /old_locus_tag="ADR096C"
                     /db_xref="GeneID:4620341"
     mRNA            complement(<880253..>883156)
                     /locus_tag="AGOS_ADR096C"
                     /old_locus_tag="ADR096C"
                     /product="ADR096Cp"
                     /transcript_id="NM_209545.1"
                     /db_xref="GeneID:4620341"
     CDS             complement(880253..883156)
                     /locus_tag="AGOS_ADR096C"
                     /old_locus_tag="ADR096C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL190C (UFD2)"
                     /codon_start=1
                     /product="ADR096Cp"
                     /protein_id="NP_984192.1"
                     /db_xref="GeneID:4620341"
                     /translation="MASSVKSIITEVLRVTSDAEMARARKYTLVGAEVLGGPELALDA
                     VDGILVSQLTENEHLGEQPMAYLHGCFERCQQTKRLSKNNADAGVQATLQELERLVLG
                     YAVVCFQLEEFAIGGSLLTYVKGVVRDLDVYTDFMSAVIQRAIREDVIFDVCNGFFTA
                     LMEMIKDMNNSKNGKFDLNDPTYSSVLTLFELFVSFKPVAAIFTQLDGFYAPYDTKPN
                     HLERVTLLGPILTLSPMNPNVATRNYGDNLERTQQQTNLLHESLQAEHKVVLDRLFFI
                     MDKIVRGSTESRNGLLSYFAQIVNKNHLRRGDHAQHNKLSSNAFMTNITLLLVRFSQP
                     FLDSTCKKIDKIDVNYFNNLNLFIDLSQETRMNSDFKEADEFHDKNRKSEDNKPNFIS
                     DCFFLTLTYLHYGLGGTLLYDEKVTPQLKRMKQELQRIKDAANSNNSTDIFARFAAIQ
                     LPSLEKTYTMLQSIMDSLQGFFSNRALQLEVFEFICGVSTFLIRVIDPKHGFPFSQLE
                     LPLIPDQVGVENVDNAEYLRAHAQVPFKYYPEFVVEGAINYCLYISKYSSNPMFRNSR
                     LHSFVELATVILRCPELVSNPHLKGKLVQVLSIGASPLSESVPGFMMDIFENNELVIK
                     NIFYALLDFYVIVEKTGSSSQFYDKFNARYSISIVLEELYKLPKYRAQLLTQSQNNPD
                     FFIRFIARMLNDLTFLLDEGLTNLTEVHNISKELENRSRNLPPTREEETAELQAKLAA
                     AERQATSSCSLADKSMSLFNVFTKDIPRAFVTPEIVDRLAGMLNYNLVSLVGPKCREL
                     KVKDPSKYQFNPKSLLKSLSEVYINLSEQDEFISAVARDGRSFNKDLFDRLVHILGYK
                     TGMASPEQCEALLKFANATHMRKLAAEEEDMDMGDVPDEFLDPLMYTIMSEPVILPTS
                     KVTIDRSTIKAHLLSDSTDPFNRTPLKLEDVIPDHELKQRIEEFKASKKQGKQ"
     gene            <883962..>885482
                     /locus_tag="AGOS_ADR097W"
                     /old_locus_tag="ADR097W"
                     /db_xref="GeneID:4620342"
     mRNA            <883962..>885482
                     /locus_tag="AGOS_ADR097W"
                     /old_locus_tag="ADR097W"
                     /product="ADR097Wp"
                     /transcript_id="NM_209546.1"
                     /db_xref="GeneID:4620342"
     CDS             883962..885482
                     /locus_tag="AGOS_ADR097W"
                     /old_locus_tag="ADR097W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL189W (RBS1)"
                     /codon_start=1
                     /product="ADR097Wp"
                     /protein_id="NP_984193.1"
                     /db_xref="GeneID:4620342"
                     /translation="MTKPKGPPQADTSKLMPALLVALFQKPQDRQFVIALENELLRFV
                     ESPSMSYQLQPMNSYYRLLSHQVADYHGLSHVVSREQELCVVVYKEANAKADKGRGAR
                     GSQRTLLQELEPSVMYQFPPEYFAIAAMAAMNDALLHPGNNNVQAQQWARSPHAPQPS
                     RGAAARTPRREKPKGFKLLSRPGASAAKGADRAPHTGRGRSYESRYGWHPPSSPSVEP
                     DRPAKTPDLQEGGRVQQVSSPVPATPRRERGSEPIEDTQDDSPQPHEFETSRYALDRM
                     DDIPPVLLGAPVAVESPGPPIAVTQSPGTGPVHSYSSKPHRRAHNYRRNHTNQQAQKP
                     AKGSSYPGFPGFPVSRYVAYLPQNYLSQYPQGYYYLPANCMMPYSANGSPPLDYMFRP
                     AGPPYPMPMYALPPHGAGLHMPLQPGMQGVQVSAASPPPGQSHFPGNVYYPSSSSASG
                     TPYSRKSSTSSTLTRESHTTPSSPHLGSTRFSAESTYDRNPPADLSHSSTDCVPPS"
     gene            complement(<885711..>886316)
                     /locus_tag="AGOS_ADR098C"
                     /old_locus_tag="ADR098C"
                     /db_xref="GeneID:4620343"
     mRNA            complement(<885711..>886316)
                     /locus_tag="AGOS_ADR098C"
                     /old_locus_tag="ADR098C"
                     /product="ADR098Cp"
                     /transcript_id="NM_209547.1"
                     /db_xref="GeneID:4620343"
     CDS             complement(885711..886316)
                     /locus_tag="AGOS_ADR098C"
                     /old_locus_tag="ADR098C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL135C (RDI1)"
                     /codon_start=1
                     /product="ADR098Cp"
                     /protein_id="NP_984194.1"
                     /db_xref="GeneID:4620343"
                     /translation="MQEETEFEQFEENDPRINYKVRAKKTLEEYKQLDAEDESLAKWK
                     ESLGLSSDVLPLEFPGDTRKVVIKAIQLLVDTDAEPITFDLSTEESIKELASKRYKIR
                     EKSVYKLKITFKVQHEIITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTAKKPVYEVEL
                     PESEAPSGFLARGNYNAVSKFIDDDQANHLTLNWSVEIVKK"
     gene            complement(<886712..>887800)
                     /locus_tag="AGOS_ADR099C"
                     /old_locus_tag="ADR099C"
                     /db_xref="GeneID:4620344"
     mRNA            complement(<886712..>887800)
                     /locus_tag="AGOS_ADR099C"
                     /old_locus_tag="ADR099C"
                     /product="ADR099Cp"
                     /transcript_id="NM_209548.1"
                     /db_xref="GeneID:4620344"
     CDS             complement(886712..887800)
                     /locus_tag="AGOS_ADR099C"
                     /old_locus_tag="ADR099C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL134C (PPH21) and YDL188C (PPH22)"
                     /codon_start=1
                     /product="ADR099Cp"
                     /protein_id="NP_984195.1"
                     /db_xref="GeneID:4620344"
                     /translation="MDIDNDVPMKDAMEDQLDQAIDEDSGVGSVSYFNASSGRTVSGI
                     ADTKSSKPLELTASSISQLDQWIEHLAKCQVLSEEDVGKLCKMAVDVLQFEENVQPVS
                     VPVTICGDVHGQFHDLIELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRY
                     PNRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFC
                     LHGGLSPMIETVDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQD
                     ISQQFNHTNDLSLIARAHQLVMDGYAWSHQQSVVTIFSAPNYCYRCGNQAAIMEVDEN
                     HNRQFLQYDPSVRPGEPTVSRKTPDYFL"
     gene            complement(<888164..>888466)
                     /locus_tag="AGOS_ADR100C"
                     /old_locus_tag="ADR100C"
                     /db_xref="GeneID:4620345"
     mRNA            complement(<888164..>888466)
                     /locus_tag="AGOS_ADR100C"
                     /old_locus_tag="ADR100C"
                     /product="ADR100Cp"
                     /transcript_id="NM_209549.1"
                     /db_xref="GeneID:4620345"
     CDS             complement(888164..888466)
                     /locus_tag="AGOS_ADR100C"
                     /old_locus_tag="ADR100C"
                     /note="NOHBY426; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="ADR100Cp"
                     /protein_id="NP_984196.1"
                     /db_xref="GeneID:4620345"
                     /translation="MAHHLAGQRLAPGYPPLVKTKRTLRLIPLQNSVRPRAPPLLPPE
                     GQQNIQVTESPSLLAQARGIEQSRLQYQQLQTAITEDRIEETGPLTRYTFPQQKTQ"
     gene            <888671..>889444
                     /locus_tag="AGOS_ADR101W"
                     /old_locus_tag="ADR101W"
                     /db_xref="GeneID:4620346"
     mRNA            <888671..>889444
                     /locus_tag="AGOS_ADR101W"
                     /old_locus_tag="ADR101W"
                     /product="ADR101Wp"
                     /transcript_id="NM_209550.1"
                     /db_xref="GeneID:4620346"
     CDS             888671..889444
                     /locus_tag="AGOS_ADR101W"
                     /old_locus_tag="ADR101W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL186W"
                     /codon_start=1
                     /product="ADR101Wp"
                     /protein_id="NP_984197.1"
                     /db_xref="GeneID:4620346"
                     /translation="MHAFKEDLPHTVGFALDNEEITFPNYVPTHVQSLPHTSNGIRQL
                     VIDKQNQRVLPTYNRLLDRMEDALVRWRPPASSHVGSSLAIHGTHPYQKELPEPKALG
                     RDLSESIEQMKQILQNCWPTRDLHTDATDDSETLSDYSLPRAGSATANSAKPNGPSFE
                     TLSLSRRTPVAFPIKAAGARADPPPDDLQSTLNTYKFPVPSYYLPLSLQRQCQQPSTR
                     APASDAEQSTPWEAWCQFWKEFWVDLHSLLVCQIDEELY"
     gene            <889698..>891551
                     /locus_tag="AGOS_ADR102W"
                     /old_locus_tag="ADR102W"
                     /db_xref="GeneID:4620347"
     mRNA            <889698..>891551
                     /locus_tag="AGOS_ADR102W"
                     /old_locus_tag="ADR102W"
                     /product="ADR102Wp"
                     /transcript_id="NM_209551.2"
                     /db_xref="GeneID:4620347"
     CDS             889698..891551
                     /locus_tag="AGOS_ADR102W"
                     /old_locus_tag="ADR102W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL185W (VMA1)"
                     /codon_start=1
                     /product="ADR102Wp"
                     /protein_id="NP_984198.2"
                     /db_xref="GeneID:4620347"
                     /translation="MAGALENARKEIKRISLEDHNENEYGQIYSVSGPVVVAENMVGC
                     AMYELVKVGHHNLVGEVIRLDGDKATIQVYEETAGVTVGDPVLRTGKPLSVELGPGLM
                     ETIYDGIQRPLKAIKEQSQSIYIPRGVDAPALSREVKWAFKPGKLGVGDHISGGDIFG
                     SIFENSLLEDHKILLPPRARGTITWIAPAGEYTVDETVLEVEFDGKKYSYSMFHTWPV
                     RVPRPVTEKLSADYPLLTGQRVLDSLFPCVQGGTTCIPGAFGCGKTVISQSLSKYSNS
                     DAIIYVGCGERGNEMAEVLMEFPELFTEVNGRKEPIMKRTTLVANTSNMPVAAREASI
                     YTGITLAEYFRDQGKNVSMIADSSSRWAEALREISGRLGEMPADQGFPAYLGAKLASF
                     YERAGKAVALGSPDRVGSVSIVAAVSPAGGDFSDPVTTSTLGITQVFWGLDKKLAQRK
                     HFPSINTSVSYSKYTNVLNKYYDSNYPEFPVLRDRIKEILSNAEELEQVVQLVGKSAL
                     SDKDKIVLDVATLIKEDFLQQNGYSTYDAFCPIWKTYDMMKAFVSYFDEAQKSVSNGA
                     NWAVLSEATGDVKHAVSSSKFFEPSRGEREVHAEFEKLFASIQERFAESTD"
     gene            complement(<891755..>891832)
                     /locus_tag="AGOS_ADR103C"
                     /old_locus_tag="ADR103C"
                     /db_xref="GeneID:4620348"
     mRNA            complement(<891755..>891832)
                     /locus_tag="AGOS_ADR103C"
                     /old_locus_tag="ADR103C"
                     /product="60S ribosomal protein L41"
                     /transcript_id="NM_209552.1"
                     /db_xref="GeneID:4620348"
     CDS             complement(891755..891832)
                     /locus_tag="AGOS_ADR103C"
                     /old_locus_tag="ADR103C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL184C (RPL41A) and YDL133C-A (RPL41B)"
                     /codon_start=1
                     /product="60S ribosomal protein L41"
                     /protein_id="NP_984199.1"
                     /db_xref="GeneID:4620348"
                     /translation="MRAKWRKKRVRRLKRKRRKVRARSK"
     gene            complement(<892186..>893106)
                     /locus_tag="AGOS_ADR104C"
                     /old_locus_tag="ADR104C"
                     /db_xref="GeneID:4620349"
     mRNA            complement(<892186..>893106)
                     /locus_tag="AGOS_ADR104C"
                     /old_locus_tag="ADR104C"
                     /product="ADR104Cp"
                     /transcript_id="NM_209553.1"
                     /db_xref="GeneID:4620349"
     CDS             complement(892186..893106)
                     /locus_tag="AGOS_ADR104C"
                     /old_locus_tag="ADR104C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL183C"
                     /codon_start=1
                     /product="ADR104Cp"
                     /protein_id="NP_984200.1"
                     /db_xref="GeneID:4620349"
                     /translation="MKSTTIKKVVTAYSRMAEPRRTQEYLADPLKIVAVPVTTQRCFF
                     YFKHTDDYLDRGSRLVRAEQRVTRKVARTWAKMESSRNVVTVRVVGWVNVLLAQVPWR
                     ERSLASFPSESYILKRVHLQGKEETEKRLTLREAQACEAGVAAAPIVVYFPRSVISES
                     VLNDELVRLLREGKQTHMRYLIYCLLALPLTIPIALVPLVPNIPGFYLAYRAYCNFKA
                     YSGARHLESMMQGDMQPLRFADLQEYSALMADNVAPATPGESERMLLDQALLPRILDN
                     LQIHELRRHIETAMRQEAMRLEEQAQHKAE"
     gene            <893517..>894872
                     /locus_tag="AGOS_ADR105W"
                     /old_locus_tag="ADR105W"
                     /db_xref="GeneID:4620350"
     mRNA            <893517..>894872
                     /locus_tag="AGOS_ADR105W"
                     /old_locus_tag="ADR105W"
                     /product="ADR105Wp"
                     /transcript_id="NM_209554.2"
                     /db_xref="GeneID:4620350"
     CDS             893517..894872
                     /locus_tag="AGOS_ADR105W"
                     /old_locus_tag="ADR105W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL133W (SRF1)"
                     /codon_start=1
                     /product="ADR105Wp"
                     /protein_id="NP_984201.1"
                     /db_xref="GeneID:4620350"
                     /translation="MPAGPNREDEEQSMATKSGSTSRKVQKRPSLTQLNGRRAEEDMV
                     RATSLNAYSLKPTTVPPFALDAQFKRLRVRDSLGVSGDMLANGGQRFKDPFLVSYDSQ
                     WSEFVNVIDAEGGHGKRHKASHGTHSHSTLSSTSDSSGLSPLKNEKLRAITEHSPTRR
                     GSSQSVLTDLESNWGGEERLNAIFEAPILHDYEFKDQKDRNEWTKYISQLKHFYYGSI
                     FKSGGSSRGGSNSESDDDDEVGRIQAFVERHKLEFRRKKLYWLQFEQRKKQQWGPQMR
                     RLLIDSQYLPLSFRLIIIMLTCVALGLAVRIFQNSHNRIEDTSPLTVPQQPSTIMAIV
                     VNTVAIVYLAYIAYDEFAGKPLGLRNPLGKMRLILLDLLFIIFSSANLSLAFNTLYDK
                     TWVCTGLEDSPNRIPKIDYICRKQRALSAFLFLVVVMWVITFTISILRVVERVSSLSP
                     R"
     gene            <895193..>897589
                     /locus_tag="AGOS_ADR106W"
                     /old_locus_tag="ADR106W"
                     /db_xref="GeneID:4620351"
     mRNA            <895193..>897589
                     /locus_tag="AGOS_ADR106W"
                     /old_locus_tag="ADR106W"
                     /product="ADR106Wp"
                     /transcript_id="NM_209555.2"
                     /db_xref="GeneID:4620351"
     CDS             895193..897589
                     /locus_tag="AGOS_ADR106W"
                     /old_locus_tag="ADR106W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL132W (CDC53)"
                     /codon_start=1
                     /product="ADR106Wp"
                     /protein_id="NP_984202.2"
                     /db_xref="GeneID:4620351"
                     /translation="MNDKLPRADDLEATWNFVEPGIGQILGRDGSPHAGRVQKLLSAA
                     MYMDVYTAIYNYCVNKSRSTGHFQSDSAQRQSNQSSILVGGEIYEKLKAYLHDYIVNL
                     SKDPDETFLQFYVRRWKRFTIGAVFLNHAFDYMNRYWVQKERSDGKRNIFDVNTLCLM
                     TWKQVMFDQHCQGLVDEILQQLTLQRDGRIVNQTDITTAIKSFVALGIDPSDLKKLNL
                     NVYIQNFETAFLNSTREYYRKMSQEYLQTHSVTDYIFEAHSRIAEEESKIVLYLDDHT
                     RKPLSDTLNEVLIAEHAEELKSEFILLLKSRDETKISTLYELMQRDFTLLPELAKSFE
                     EHVEDVGQSEVRKLLESHKEASNSDSGKKAAPLSPRDYIKTLIDVHVVFSVLTDECFQ
                     KSPLFARALDSASRRYINNNQFALAPGSSKNTTSKTPEMLAKYSDQLLKKNKNGTDGD
                     KDMSVDDIMTIFKFLTDKDAFEYHYRKNLAKRLIHGTSTSEENEEMVIQRLQSENSME
                     YTGRITKMFQDVRLSKQLGQEFDSQIKSEPDYSKERYPEFQPFVLAETMWPFPYQEVE
                     FKLPQELVAEHQKLVDLYVKKHSGRVLKWLWPLSRSELRADIGRPGRPPFHFTVTLFQ
                     MAILLMFNENDTLSFEQIQEGTNLTTQHIILSMLPFIKMKLLHQSPPGLESMGLLGTQ
                     YKLNLPYKLAKSKVNFAAGVKGDVSLSGSGKADNMDSDNINKELNKERQLFLEACIVR
                     IMKAKRVVSHATLVNECIAESHQRFNAKVSLIKKAIDNLISKEYLQRSRDGESYEYLA
                     "
     gene            <898181..>899570
                     /locus_tag="AGOS_ADR107W"
                     /old_locus_tag="ADR107W"
                     /db_xref="GeneID:4620352"
     mRNA            join(<898181..898196,898258..>899570)
                     /locus_tag="AGOS_ADR107W"
                     /old_locus_tag="ADR107W"
                     /product="ADR107Wp"
                     /transcript_id="NM_209556.2"
                     /db_xref="GeneID:4620352"
     CDS             join(898181..898196,898258..899570)
                     /locus_tag="AGOS_ADR107W"
                     /old_locus_tag="ADR107W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL131W (LYS21) and YDL182W (LYS20); 1-intron"
                     /codon_start=1
                     /product="ADR107Wp"
                     /protein_id="NP_984203.2"
                     /db_xref="GeneID:4620352"
                     /translation="MSQGNEFHQVTEATTALNNFQQNPYGPNPADYLSNVGSFQLIDS
                     TLREGEQFANAFFSTEKKIEIARALDDFGVDYIELTSPVASEQSLRDCQAICKLGLKA
                     KILTHIRCHMDDAKVAVGTGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEYVK
                     SKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLK
                     SVVSCDVECHFHNDTGCAIANAYTALEGGAKLVDVSVLGIGERNGITPLGGLMARMIV
                     AAPDYVKSKYKLHKIRDIENLVAEAVEVNVPFNNPITGFCAFTHKAGIHAKAILANPS
                     TYEILNPNDFGMTRYIHFANRLTGWNAIKSRVDQLNLHLTDDQVKEVTAKIKQLGDVR
                     PLNIDDVDSIIKAFHAQIATPRVTARPANREEEINGFDLEAPPQKKTKIL"
     gene            complement(<899612..>900511)
                     /locus_tag="AGOS_ADR108C"
                     /old_locus_tag="ADR108C"
                     /db_xref="GeneID:4620353"
     mRNA            complement(<899612..>900511)
                     /locus_tag="AGOS_ADR108C"
                     /old_locus_tag="ADR108C"
                     /product="ADR108Cp"
                     /transcript_id="NM_209557.1"
                     /db_xref="GeneID:4620353"
     CDS             complement(899612..900511)
                     /locus_tag="AGOS_ADR108C"
                     /old_locus_tag="ADR108C"
                     /note="NOHBY427; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0F10010g"
                     /codon_start=1
                     /product="ADR108Cp"
                     /protein_id="NP_984204.1"
                     /db_xref="GeneID:4620353"
                     /translation="MSDVVRLGGLHEGPVLACDSAPDGRTVVTCGLDQRIGVWDLDGE
                     APYILETGDVASCVRWLGGQKLAIGCADGHVCIYDLTTGERLRKLAHHTRVVNQLAGG
                     QNGNFVSVGDDGRLNWWDERAASGRPAAFVATDFPLLSAAVCPVSAGRVYTSGIEPVV
                     RAYEQRRSEDAVWKTQTGHRSGVTSLCTSAHGEEVCALGFDDSVSFYGQQAGQRLRRG
                     FALPARNTGRLLARCAFVEDKRYVAAYGYVVDVTSEVVVSDELASLHAGAVIDTVYKE
                     GSRQLLSTSADGTALVKTWEAGG"
     gene            <900705..>900959
                     /locus_tag="AGOS_ADR109W"
                     /old_locus_tag="ADR109W"
                     /db_xref="GeneID:4620354"
     mRNA            <900705..>900959
                     /locus_tag="AGOS_ADR109W"
                     /old_locus_tag="ADR109W"
                     /product="ADR109Wp"
                     /transcript_id="NM_209558.1"
                     /db_xref="GeneID:4620354"
     CDS             900705..900959
                     /locus_tag="AGOS_ADR109W"
                     /old_locus_tag="ADR109W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL181W (INH1) and YDL130W-A (STF1)"
                     /codon_start=1
                     /product="ADR109Wp"
                     /protein_id="NP_984205.1"
                     /db_xref="GeneID:4620354"
                     /translation="MLSAARTELRKTSLRLGTMARFYSPEGSTGAPRGQSADDAFSKR
                     EKANEDFYIKKHEREQLAQLREQLQKQQQKIDNLEEQLRK"
     gene            901209..901281
                     /locus_tag="AGOS_t0078"
                     /db_xref="GeneID:4620355"
     tRNA            901209..901281
                     /locus_tag="AGOS_t0078"
                     /product="tRNA-Met"
                     /codon_recognized="AUG"
                     /db_xref="GeneID:4620355"
     gene            complement(<901382..>902272)
                     /locus_tag="AGOS_ADR110C"
                     /old_locus_tag="ADR110C"
                     /db_xref="GeneID:4620377"
     mRNA            complement(<901382..>902272)
                     /locus_tag="AGOS_ADR110C"
                     /old_locus_tag="ADR110C"
                     /product="ADR110Cp"
                     /transcript_id="NM_209559.1"
                     /db_xref="GeneID:4620377"
     CDS             complement(901382..902272)
                     /locus_tag="AGOS_ADR110C"
                     /old_locus_tag="ADR110C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL093W (TRM10)"
                     /codon_start=1
                     /product="ADR110Cp"
                     /protein_id="NP_984206.1"
                     /db_xref="GeneID:4620377"
                     /translation="MTPETNNDETLSRPKPRAALPPVPEGMSKSQWKKQWKKEQFELN
                     KPLYAKIRKEKKQKAREQRRERLQKALEENGGEIPEELRRTPRVNVNQKDSGIKVIID
                     CAFDELMNEKEIVSLSTQITRAYSANKRENHFADVKVTSFNKRLKERFDCGLKGANYD
                     AWKHFEFTDESALPTTNAVYLTADTDETLETLEPGTTYIVGGIVDKNRHKALCYNKAK
                     ELGIPTRRLPIGEYIKLCGRKVLTTTHVIQIMLRYFDNHDWKEAFESVLPARKLAELA
                     DHAQESNSSSPAEEQDAQDI"
     gene            <902599..>903564
                     /locus_tag="AGOS_ADR111W"
                     /old_locus_tag="ADR111W"
                     /db_xref="GeneID:4620356"
     mRNA            <902599..>903564
                     /locus_tag="AGOS_ADR111W"
                     /old_locus_tag="ADR111W"
                     /product="ADR111Wp"
                     /transcript_id="NM_209560.1"
                     /db_xref="GeneID:4620356"
     CDS             902599..903564
                     /locus_tag="AGOS_ADR111W"
                     /old_locus_tag="ADR111W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL094C (RFC4)"
                     /codon_start=1
                     /product="ADR111Wp"
                     /protein_id="NP_984207.1"
                     /db_xref="GeneID:4620356"
                     /translation="MTSLATKLELPWVEKYRPKLLKDVVGNDETVERLQQIARDGNMP
                     HMIISGLPGIGKTTSIHCLAHELLGDAYSQAVLELNASDDRGIDVVRNQIKQFAQKKC
                     TLPPGKHKIIILDEADSMTSGAQQALRRTMELYSNTTRFAFACNQSNKIIEPLQSRCA
                     ILRYSKLSDEQVLKRLFEIIKAENVQYTNDGLEALIFTAEGDMRQAINNLQSTVAGFT
                     LVNGDNVFKIVDSPHPLVIKKMLLSATLDESLNYLRELWGKGYSAVDIITTCFRVMKN
                     LTEIKEPLRLEMIKEIGFTHMRILEGVGTYLQLCGALARIHQLKT"
     gene            <903800..>905533
                     /locus_tag="AGOS_ADR112W"
                     /old_locus_tag="ADR112W"
                     /db_xref="GeneID:4620357"
     mRNA            <903800..>905533
                     /locus_tag="AGOS_ADR112W"
                     /old_locus_tag="ADR112W"
                     /product="ADR112Wp"
                     /transcript_id="NM_209561.2"
                     /db_xref="GeneID:4620357"
     CDS             903800..905533
                     /locus_tag="AGOS_ADR112W"
                     /old_locus_tag="ADR112W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR484W (VPS52)"
                     /codon_start=1
                     /product="ADR112Wp"
                     /protein_id="NP_984208.2"
                     /db_xref="GeneID:4620357"
                     /translation="MDALGKVLGVKDLVFDKQPLADPVHTFLAFPRDSELQTESSLAL
                     ERKILESKEQLLEETLSDVIPQLKDYIHNFQSRLDALTKDLNFIKGKSTELNRLLREN
                     SSKLAEISPLVNDLVISPEVVQQLLYGKIDASYIESISYLNDKLAIYDQYKNKETPSD
                     YPELCELLHLLKQVCIERSKRFIVVRIKRLRNREPVPSQQIQKELLDVREIFQFISQN
                     NLSLALELRQAYTYTIRWYYKEYFARYIRSLTILQFANITQQYALGQGLSTASSGSSY
                     SSYLLGRSILDSSSNNIGEMVAQYFQVSKRLSVLRQEDNTVMVSQIAENNKMKYYLET
                     GFRNLNLAILDNCGAELNFLNEFFHLDPGSGEELRGLLEQIFQPTFENAIQYTEQLVR
                     NTFDIYGVLLAICLAHYLQFEAQKRKVPVMDDFLNSQLLLLWPKFQRLVDFQCESLRQ
                     IPATTAVAQVAGASKDPLVTPHELTVQFSKFLAGILILSSFHRERIDEKAEPLYNSVT
                     RIRSEFENTITRCSRKSSSPGKFLAVNYMYLLNALQQNLGYINQDDNEPLILKDTRDH
                     LGRLIEMHTSG"
     gene            <905684..>907810
                     /locus_tag="AGOS_ADR113W"
                     /old_locus_tag="ADR113W"
                     /db_xref="GeneID:4620358"
     mRNA            <905684..>907810
                     /locus_tag="AGOS_ADR113W"
                     /old_locus_tag="ADR113W"
                     /product="ADR113Wp"
                     /transcript_id="NM_209562.1"
                     /db_xref="GeneID:4620358"
     CDS             905684..907810
                     /locus_tag="AGOS_ADR113W"
                     /old_locus_tag="ADR113W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL095C (HMI1)"
                     /codon_start=1
                     /product="ADR113Wp"
                     /protein_id="NP_984209.1"
                     /db_xref="GeneID:4620358"
                     /translation="MKALTTSQSRVVTHPYEPCTTVNVVAGPGSGKTVTLLHKVYNLV
                     YEGIVAPNEILILSLTNKAVDNINEKLMETFQEADCNLRWSAEERVEILEQIDVNTFH
                     SLANKVVLENEGLVNIIEENGWRSLMRLAGKSYKGRSRHDWTPRAFARMIQDYKEGRI
                     QPDRIDAEAILELMKTCKVFTNEDLIHFCAKFLADADPQTASGITGQLLNDYKVIIVD
                     EVQDLYPLLFPMLELIAAKKQLILFGDEHQSIYGFLGSNKLFMKQISSMRPAEKMFTY
                     ELYDNFRSTPEIIDLAQSVMGRKMPPANLDQYGLHKKLQCGIKPISFTLEDPLEELCF
                     LTDQICQLVCSSAKLSDIAILTRTNEHMDRIARGLKIFGLPVEKLTAQPQWMNDPRIL
                     FLIDIMKLLAAVCQEEGATDESHNLKMKTDFSVVVTLGEGRRVGPSLINSIYNGARAK
                     GTSCWELINSIEYRKSLPLRRQKIVATYLNALSPLLVRSKFQELNVPLDLMNELSQLI
                     ERMDIPLFQVQNEEQLQEFRDNLLEFYQILKLCSYSRPADVPLIAWFVKTFLEQTVQL
                     QKNVVNKLSGRNTIKLSTIHSSKGLEFPIVFLLGRLDKPVWSDNNTLYVGMTRARNLL
                     YMTNINHPKTKAITNNEHPYMIDNAFFWKYYNNDLGRPYKPNLASRAQNYKQLLDKYR
                     ITTLHKRSFVTQCIPILRLSRRILIN"
     gene            complement(<907837..>909921)
                     /locus_tag="AGOS_ADR114C"
                     /old_locus_tag="ADR114C"
                     /db_xref="GeneID:4620359"
     mRNA            complement(<907837..>909921)
                     /locus_tag="AGOS_ADR114C"
                     /old_locus_tag="ADR114C"
                     /product="ADR114Cp"
                     /transcript_id="NM_209563.1"
                     /db_xref="GeneID:4620359"
     CDS             complement(907837..909921)
                     /locus_tag="AGOS_ADR114C"
                     /old_locus_tag="ADR114C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR485C (VPS72)"
                     /codon_start=1
                     /product="ADR114Cp"
                     /protein_id="NP_984210.1"
                     /db_xref="GeneID:4620359"
                     /translation="MAANGDDSGFLVATRARRANAGNQLMKLLEREHNRELQMDDDDG
                     DINLLFEEEEDDGEFLLADQRQRENDDLFSDSDEDSSESGSGDEDGELGRHERKRRHA
                     LQKRKPPVIKKSRDGSAAKRYKPSYEQPDAKSLLVETRRTSSRTSVVRNKMEVYEKLA
                     QAEVRRKEIQERIKKQKEAQLEPELTQEDRLRIAEETERINLQSLNKYKEQEVSKKQS
                     RLAIQQRQKMKFKAGETILTWLTTQWSVTPMMEVYDREYWEQMVSKRQKRKRKYVRRK
                     KEKPLSDKEKPVDSTLAMQEQTPNPTAEEPASERDGKVATNVPTTIAAKNNPTGADKV
                     TSSDDLDTPALVTDSAPLPAENTALQLTDSEPPRSTGAEAISRPQSSSPMLFENSMAR
                     HISFVEKDEVAIIHVDDPPSNISTSRDQSHELDTPAMDGDYKKFDEGSGSASQGHSPN
                     AEASYTELSNGSLDNEFDESDAAQSGDSQKKDWVPPEDVETEEDVVYEGPDQLVGKNF
                     LLFTVFPDEPYNIASINELKAPLFGDQWAKPLHSRAYNVESYAKISWESHPHKKEEPT
                     LIPDLSILDKFPEFGEYDKKLSKDVTVTTNKEMKVDIRTEAPSGVFLPNGIRKRCLIT
                     NKDSQYFDPKNGVPYADVEAIKTIQDLQDAIGEGTKDDPRPRYKWFGYGRGGIYLDVQ
                     QRPAKGVPDGFS"
     gene            <910066..>911007
                     /locus_tag="AGOS_ADR115W"
                     /old_locus_tag="ADR115W"
                     /db_xref="GeneID:4620360"
     mRNA            <910066..>911007
                     /locus_tag="AGOS_ADR115W"
                     /old_locus_tag="ADR115W"
                     /product="ADR115Wp"
                     /transcript_id="NM_209564.1"
                     /db_xref="GeneID:4620360"
     CDS             910066..911007
                     /locus_tag="AGOS_ADR115W"
                     /old_locus_tag="ADR115W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL096C (COQ3)"
                     /codon_start=1
                     /product="ADR115Wp"
                     /protein_id="NP_984211.1"
                     /db_xref="GeneID:4620360"
                     /translation="MLKRTLPLLTKFNPKLLGHSAPAAGAAGPSPSIGSSTSTSADEI
                     SHFQQLAPTWWDTNGSQRILHKMNLSRMDFIQRILSEQMKVTTPDVYVPGFNYKAHLP
                     AAVSEQIQSELNTEVRSLLRQQRLQVLDVGCGGGILAESLGRQPYVEKVYGIDLTPDC
                     IAAARAHRDKDPVLREKIQYDVLPLEEVEGQFDVVTMFEMLEHVENPSAVLEHAWRRL
                     RPEGILFVSTINRNLLSWFTTICMAEHVLRVVPKGTHHLEKYLDATEVQDWFQQHTPG
                     AHRILDLKGNMYVPMWGWVEHDLSSIGNYCMAVKKLR"
     gene            complement(<911023..>911808)
                     /locus_tag="AGOS_ADR116C"
                     /old_locus_tag="ADR116C"
                     /db_xref="GeneID:4620361"
     mRNA            complement(<911023..>911808)
                     /locus_tag="AGOS_ADR116C"
                     /old_locus_tag="ADR116C"
                     /product="ADR116Cp"
                     /transcript_id="NM_209565.1"
                     /db_xref="GeneID:4620361"
     CDS             complement(911023..911808)
                     /locus_tag="AGOS_ADR116C"
                     /old_locus_tag="ADR116C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR486C (VPS60)"
                     /codon_start=1
                     /product="ADR116Cp"
                     /protein_id="NP_984212.1"
                     /db_xref="GeneID:4620361"
                     /translation="MTAMPAIQDRTTDALLTRTHPTEEQRAPRALKSSDGLFFNEMNR
                     LFGYNNKRTSDQLLQESSKAMDQAQQGLNGRISQLDTQIAQLNFQLQGLQKKIAGMGS
                     AVAQRPLRQRALKLLNKRKQLETSRDQLDSQLWSMSQAQMTTENLKNTAVTVNALAQT
                     NKALRQQYKQINVERLQTMQDEMADLMEQGEELQQVLAMGGTEIDDISESELDAELEA
                     LGDGELDFGAEADPVDLPAYLGGAPQFVDEDATDEPAGLQTAT"
     gene            <912043..>913323
                     /locus_tag="AGOS_ADR117W"
                     /old_locus_tag="ADR117W"
                     /db_xref="GeneID:4620362"
     mRNA            <912043..>913323
                     /locus_tag="AGOS_ADR117W"
                     /old_locus_tag="ADR117W"
                     /product="ADR117Wp"
                     /transcript_id="NM_209566.1"
                     /db_xref="GeneID:4620362"
     CDS             912043..913323
                     /locus_tag="AGOS_ADR117W"
                     /old_locus_tag="ADR117W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL097C (WRS1)"
                     /codon_start=1
                     /product="ADR117Wp"
                     /protein_id="NP_984213.1"
                     /db_xref="GeneID:4620362"
                     /translation="MGVEKVAEMLGELSTESEREQKVTPWDVAGAVDENGVAQAIDYE
                     KLLKQFGTKPVSEETLARFTAVTGHQPHHFLRKGMFFSERDFGRILDLYEQGRPFFLY
                     TGRGPSSDSMHLGHMVPFIFSKWLQEVFDVPIVIELTDDEKFLFKQKLQIGDVKSFAR
                     ENCKDIIAVGFKPENTFIFSDLDYMGGGFYETVVRVSRQITGSTAKAVFGFTDSDCIG
                     KFHFASIQIASAFPSSYPEVLGLPPKTPCLIPCAIDQDPYFRVCRDVADKLKFTKPSL
                     LHSKFFPALQGSTTKMSASDDTTAIFMTDTPKQIQKKINKYAFSGGQVSIEDHRKYGG
                     NPDVDVAYQYLSFFKDDDELLKKCYDDYKSGELLSGEMKKLCIETLQQFVKEFQERRA
                     KVDDATLDAFMKPHKLVWGQRERKVPPKPKTEKA"
     gene            complement(<913445..>914083)
                     /locus_tag="AGOS_ADR118C"
                     /old_locus_tag="ADR118C"
                     /db_xref="GeneID:4620363"
     mRNA            complement(<913445..>914083)
                     /locus_tag="AGOS_ADR118C"
                     /old_locus_tag="ADR118C"
                     /product="ADR118Cp"
                     /transcript_id="NM_209567.1"
                     /db_xref="GeneID:4620363"
     CDS             complement(913445..914083)
                     /locus_tag="AGOS_ADR118C"
                     /old_locus_tag="ADR118C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR487C (RIB3)"
                     /codon_start=1
                     /product="ADR118Cp"
                     /protein_id="NP_984214.1"
                     /db_xref="GeneID:4620363"
                     /translation="MTSPCTDIGTAIEQFKQNKMIIVMDHISRENEADLICAAAHMTA
                     EQMAFMIRYSSGYVCAPMTNAIADKLDLPLMNTLKCKAFSDDRHSTAYTITCDYAHGT
                     TTGISARDRALTCNQLANPESKATDFTKPGHIVPLRARDGGVLERDGHTEAALDLCRL
                     AGVPEVAAICELVSERDVGLMMTLDECIEFSKKHGLALITVDDLKAAVAAKQ"
     gene            complement(914724..914795)
                     /locus_tag="AGOS_t0079"
                     /db_xref="GeneID:4620364"
     tRNA            complement(914724..914795)
                     /locus_tag="AGOS_t0079"
                     /product="tRNA-Cys"
                     /codon_recognized="UGC"
                     /db_xref="GeneID:4620364"
     gene            <915381..>917627
                     /locus_tag="AGOS_ADR119W"
                     /old_locus_tag="ADR119W"
                     /db_xref="GeneID:4620378"
     mRNA            <915381..>917627
                     /locus_tag="AGOS_ADR119W"
                     /old_locus_tag="ADR119W"
                     /product="ADR119Wp"
                     /transcript_id="NM_209568.1"
                     /db_xref="GeneID:4620378"
     CDS             915381..917627
                     /locus_tag="AGOS_ADR119W"
                     /old_locus_tag="ADR119W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR284W and YJL070C"
                     /codon_start=1
                     /product="ADR119Wp"
                     /protein_id="NP_984215.1"
                     /db_xref="GeneID:4620378"
                     /translation="MARQMAQPDLSGVSKLSLDDLDIDQPPAEFDQQILMGMPMHMEW
                     RALNIPPFPDVEALRRKYINGSRQDNRSNYKYDLQNWFLYPEPLPKFWKFEHDRRLQL
                     PIAERVSFQEPEFSSGFAARLHAEGFRYTGEYFNLDKYAERFQAISVNPPHNKVSLQL
                     PTFEVFMDDLRQMANAVAAPDFISAAEKRLSYLENRYDLFQHLRSRTENLEIKAVRHR
                     DFYNTRKVDPNMVLHGCIPQRQLNEFICEKLNLEPDRVVHVDRQGKNWTLRNIFQGNY
                     VGICDFQSSNEDIRLKIVDDEFMEWYKNYYLPNYQCAWVSQLSSSDLSLGSALDLPHR
                     MYYMIAKVFLDFDNDISGEYLAEMVIKYVIHSLEKSKYQLVHLSVDFQFQQPSWWLKF
                     SSWVCRWKLVSFNIRWNVRVKREYSRLYKLGFLNDFETYLDYIFGPLIYDANIQNIEL
                     QCFLSTVVNIDFVLESSDENNVQTENTVFPPSSWQSHGENPPLAYYMYYFHWRLAHVN
                     AARHSRKQNSILLRSCPQPDQNRASQTNIDVTEQTESLLCNLLLCNGGLLQGEVLWST
                     IPTLTYIYYLLQIPVVVAPLSPFKAQSLNLEGGIQQNTLEFNTGSGYHYRENPFMRMH
                     RIGMRVVLSSNMVLFNNSYTAEPVLEEYSVAASIYLLSAADLSEFVRDSIISSGFEGF
                     YKRHWIGVVTSATEYTSEIIGSVDIWYDESANTAEKHNVPNIRRIYRMGTLTTEKEFY
                     NKVFRNSR"
     gene            complement(<917814..>919442)
                     /locus_tag="AGOS_ADR120C"
                     /old_locus_tag="ADR120C"
                     /db_xref="GeneID:4620365"
     mRNA            complement(<917814..>919442)
                     /locus_tag="AGOS_ADR120C"
                     /old_locus_tag="ADR120C"
                     /product="ADR120Cp"
                     /transcript_id="NM_209569.1"
                     /db_xref="GeneID:4620365"
     CDS             complement(917814..919442)
                     /locus_tag="AGOS_ADR120C"
                     /old_locus_tag="ADR120C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL071W (ARG2)"
                     /codon_start=1
                     /product="ADR120Cp"
                     /protein_id="NP_984216.1"
                     /db_xref="GeneID:4620365"
                     /translation="MLFRRLLTTKVGYHTPNYVNRRLILSVLKSTATRREAKDYLTKY
                     GDPAVAYHCVLYLRGTKTFSAGLINDFAIMLGRLRLLGIRPLVVLSPSKHVMTESEIL
                     RETFYKHGLQSIPINEPMASGTRETILQNGASYNSIIPIIMPFVYHQQRAKRMLAEDE
                     VAFMRELVAYMPCRIDKFFIINRYGGIPSSERHDNSHVFVNLSQEYGSLAEVLKQQIT
                     DLRHEMDDGLLAERRATDGSYKEFQYTTLTESLTDLELMSAVLSLLLPSSTGLITSMH
                     SAVTNSRYNPLLYNVLTDRSLVSSSLPSFKRDPISDNAWYELPACGAKIGTQRANPIF
                     STTVLKQGVDIKLYDYSTLTKENSVGFHELLSTAGSAQLPAHKRVNLTKLKGIIEHSF
                     DRNLDMSHYLKRINGKIASIIVIGDYEGIAILTYEGPEKRPFAYLDKFAVLPHLRGSL
                     CISDVIFNLMFKKFGDELVWRSRRENVVNNWYFQRSVGVLDLSIDIGHGPKKDNIFKL
                     FYYGGKKGTQFYDFDRLREYITYVRDIEPSWSRK"
     gene            <919799..>920434
                     /locus_tag="AGOS_ADR121W"
                     /old_locus_tag="ADR121W"
                     /db_xref="GeneID:4620366"
     mRNA            <919799..>920434
                     /locus_tag="AGOS_ADR121W"
                     /old_locus_tag="ADR121W"
                     /product="ADR121Wp"
                     /transcript_id="NM_209570.1"
                     /db_xref="GeneID:4620366"
     CDS             919799..920434
                     /locus_tag="AGOS_ADR121W"
                     /old_locus_tag="ADR121W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL072C (PSF2)"
                     /codon_start=1
                     /product="ADR121Wp"
                     /protein_id="NP_984217.1"
                     /db_xref="GeneID:4620366"
                     /translation="MALPRNLQDTFSLQEVQFLVENEPIKIMPRITTKPIRRKAASTP
                     SAGSSVRWKLITTDDHNVNNMVAMSSTEVSLWLALLLKQQGKCSIVAPAWLTIKQLDS
                     FIEFELQNTSRFANLPWNWLIIAHLLFQKAADDFRDPVHILRAKIQDLREARLGKIAK
                     GLQHLNESHLQLDNLSLSEINEMRPFAVGVMDKLRDIHAAAADREQYANNI"
     gene            complement(920526..920623)
                     /locus_tag="AGOS_t0080"
                     /db_xref="GeneID:4620379"
     tRNA            complement(join(920526..920569,920587..920623))
                     /locus_tag="AGOS_t0080"
                     /product="tRNA-Leu"
                     /codon_recognized="CUA"
                     /db_xref="GeneID:4620379"
     gene            <921605..>922177
                     /locus_tag="AGOS_ADR121WA"
                     /db_xref="GeneID:9487911"
     mRNA            <921605..>922177
                     /locus_tag="AGOS_ADR121WA"
                     /product="ADR121W-Ap"
                     /transcript_id="NM_001355317.1"
                     /db_xref="GeneID:9487911"
     CDS             921605..922177
                     /locus_tag="AGOS_ADR121WA"
                     /note="NOHBY455; No homolog in Saccharomyces cerevisiae;
                     Similar to Cryptosporidium parvum gene cgd6_1620"
                     /codon_start=1
                     /product="ADR121W-Ap"
                     /protein_id="NP_001342259.1"
                     /db_xref="GeneID:9487911"
                     /translation="MQVWHLSRLFHIPYFNRSPLKLQAAPEQQLLIRDRINKEGYVEV
                     QLEERTDNINVKALRSTKKLGSPNAVPDGSYEERADEVDVSISEFITFRNQLQESNKR
                     SGPYSSANIRVRRAQRRSNRMQDPSQRIQVVGSGKWQSRRTESLVNMAEIDLAEPQDD
                     DQYNDKDNRRSKYVVRHGWGLKKGTGTAKC"
     gene            complement(<922927..>924054)
                     /locus_tag="AGOS_ADR122C"
                     /old_locus_tag="ADR122C"
                     /db_xref="GeneID:4620556"
     mRNA            complement(<922927..>924054)
                     /locus_tag="AGOS_ADR122C"
                     /old_locus_tag="ADR122C"
                     /product="ADR122Cp"
                     /transcript_id="NM_209571.1"
                     /db_xref="GeneID:4620556"
     CDS             complement(922927..924054)
                     /locus_tag="AGOS_ADR122C"
                     /old_locus_tag="ADR122C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YAL018C"
                     /codon_start=1
                     /product="ADR122Cp"
                     /protein_id="NP_984218.1"
                     /db_xref="GeneID:4620556"
                     /translation="MSFAGSLIISAISGVIYKYGGQEFQAIEEVPMGLRELTVGFVQD
                     RILLITSRATNIATNATPDFFRDQAYRYPVRALIRSCTTRRYFVVNISIFVFYSAIYV
                     VITVIYFLTIFPVYLGLSVILGPAGIVMAWLHMLLHTNNLAMMVLRMSQVSRYTLKNA
                     LKVNGNIELLENPPVPVKLFYPLDTPYFWMNHFPWKMLEYMGGAFTMVVLLLVSAIPV
                     FGPVFFNILISPFVTRLYLAKYLRLRGFNNIQREERFYDNFGQYVAFGLVATCLEIPP
                     FLSGITYATNNIAVALWDPEKEPSFLSAEDDDDDETDDDDDDDDEDDDDDDEDDEDDD
                     DDEDDDDEDDDDEDDEDDDEAVSDSSSSSDDSPSEKEELSP"
     gene            <924768..>926330
                     /locus_tag="AGOS_ADR123W"
                     /old_locus_tag="ADR123W"
                     /db_xref="GeneID:4620380"
     mRNA            <924768..>926330
                     /locus_tag="AGOS_ADR123W"
                     /old_locus_tag="ADR123W"
                     /product="ADR123Wp"
                     /transcript_id="NM_209572.1"
                     /db_xref="GeneID:4620380"
     CDS             924768..926330
                     /locus_tag="AGOS_ADR123W"
                     /old_locus_tag="ADR123W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR286W (APE3)"
                     /codon_start=1
                     /product="ADR123Wp"
                     /protein_id="NP_984219.1"
                     /db_xref="GeneID:4620380"
                     /translation="MKYFKLVLTAGACAQAFLVPERWADAMAEAIAPVARNPLLFNEE
                     PKLVPDLFRQDKPLVSSEKLQEMITVGQLNSSAWELYRIATMSTPEYGHPTRVIGSAG
                     HNGTVEYILEELGKLGDYYDVSVQNFGALVGELRSYNLTYMNDTEVPWSNVLHYSPSV
                     ELFQGKLLHVPNLGCDEDDYRALVVGANEIALIERGECEFRRKSILAGTFGFKAAIIY
                     NNDPEEGGISGTLGNPDEHMISTFGVSYDVGNSLVAAISLDPTFSLNAMVDSTVKEIT
                     TQNVIADTKGGDPENIVSLGAHSDSVFAGPGINDDGSGTISLLTVAKHLANFSVKNKV
                     RFAWWSAEEEGLLGSEYYVSQLSPEENQKIRLFMDYDMMASPNYEYEVYDANNRENPA
                     GSEELKNLYIDYYTSHGLNYTLVPFDGRSDYVAFIQNGIPGGGVATGAEKINALNNDP
                     FDKCYHQLCDDTGNLNFEAFMVNTKLIAHAVATYGASLEDYPLRSTDGLMTLAATTQS
                     PRFHYKGNSLIY"
     gene            complement(<926544..>928379)
                     /locus_tag="AGOS_ADR124C"
                     /old_locus_tag="ADR124C"
                     /db_xref="GeneID:4620381"
     mRNA            complement(<926544..>928379)
                     /locus_tag="AGOS_ADR124C"
                     /old_locus_tag="ADR124C"
                     /product="ADR124Cp"
                     /transcript_id="NM_209573.2"
                     /db_xref="GeneID:4620381"
     CDS             complement(926544..928379)
                     /locus_tag="AGOS_ADR124C"
                     /old_locus_tag="ADR124C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL073W (JEM1)"
                     /codon_start=1
                     /product="ADR124Cp"
                     /protein_id="NP_984220.2"
                     /db_xref="GeneID:4620381"
                     /translation="MRKSVLFFLLPFYVHCEKVECDLQEASALMQSLAIDKSSLSSYH
                     SIIPMVEQCKGPSWDRMKNEVYYKSGLIHLSVGQELKAMESFEKVIASGEPSFKMLSE
                     ERLHELYKKMALWSHIEDDDNDKLAYYALLDNITQADGDEVYQALESISPLDYQLRVN
                     HTDVLLEELADSLDLNTAQRVVENYMLLADKYATSISLTDRLELQYRVSVVQWFVLNS
                     PPVASLKKCLSLDMDYKPCTDLMKLWNKWNKNVKVSASALTDAQEYFGIQNQNWDNII
                     NLMVKDQKPLIKLEAPFTNNYALFQKVAEKHVLELLNNRPLSNSPAQRKYTKLPDPTE
                     FQTSLDVLLCLAFDMKSSSKNANKFCDRALKQVLTPKEHSLISNYLTKVNSPDGIPEL
                     LKTAYETYPHLAFHLVKRVAAKLVGLERKGANADVSQHWNILSSFIGNHKKVAETGRN
                     KFTAQLFKHINRAIGRQRQKQEQDQQQFFERQYQQQFFRQQQQQQQQQQPHQPPSTKK
                     NYYKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVL
                     SDESKRKEYDMLRSGGGSQHAGGNGQQFYRNSGPMFNFKKGFKPF"
     gene            complement(928525..928624)
                     /locus_tag="AGOS_t0081"
                     /db_xref="GeneID:4620382"
     tRNA            complement(join(928525..928560,928589..928624))
                     /locus_tag="AGOS_t0081"
                     /product="tRNA-Trp"
                     /codon_recognized="UGG"
                     /db_xref="GeneID:4620382"
     gene            <929018..>929635
                     /locus_tag="AGOS_ADR125W"
                     /old_locus_tag="ADR125W"
                     /db_xref="GeneID:4620557"
     mRNA            <929018..>929635
                     /locus_tag="AGOS_ADR125W"
                     /old_locus_tag="ADR125W"
                     /product="ADR125Wp"
                     /transcript_id="NM_209574.2"
                     /db_xref="GeneID:4620557"
     CDS             929018..929635
                     /locus_tag="AGOS_ADR125W"
                     /old_locus_tag="ADR125W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR052W (FAR3)"
                     /codon_start=1
                     /product="ADR125Wp"
                     /protein_id="NP_984221.2"
                     /db_xref="GeneID:4620557"
                     /translation="METFSDSFDYILQLTKTLSSQCWNNRQETLKLEQLLKRLAKQTH
                     ISYEQFTNEPSAEASKIYDENAQLTEEERLVQENYQLVYQIEQQEYLNTRFWILIGQI
                     NELIVSIRNFIVEQRSIRPKAEAEFIERNVTECEEKLVTNQMRLLQAEENSTEAIAAL
                     LKELVQVCSEVNWSNVPRDSRSFQRLLQNMEKVQKVHNITLIPDI"
     gene            complement(<929645..>931720)
                     /locus_tag="AGOS_ADR126C"
                     /old_locus_tag="ADR126C"
                     /db_xref="GeneID:4620383"
     mRNA            complement(<929645..>931720)
                     /locus_tag="AGOS_ADR126C"
                     /old_locus_tag="ADR126C"
                     /product="ADR126Cp"
                     /transcript_id="NM_209575.2"
                     /db_xref="GeneID:4620383"
     CDS             complement(929645..931720)
                     /locus_tag="AGOS_ADR126C"
                     /old_locus_tag="ADR126C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL072W (STB6) and YMR053C (STB2)"
                     /codon_start=1
                     /product="ADR126Cp"
                     /protein_id="NP_984222.2"
                     /db_xref="GeneID:4620383"
                     /translation="MDIAQHNSRGSRKVVNDGEAETHGGWIKYVVPDFRAVFRSQSAL
                     EDCSYQEVALGGYELYVVEQWVYERQATTVVVTYTGNAQDVLHGVDLRVPKDEGAWPE
                     LLRQWWRQVAAYSTQQEPGEGRQVIITNISQVPSTLNLLHVEGGDLRSVWPRYQVNFN
                     LKRLGCAGRSALLCAEPLPASLDKFLQLYKISMRDFEQAKRSVVQLVQLIQLILGYFG
                     VLGREFQDGILCQRTEAALEEWWAVYGTTYLAVERPRKESVLGPLSVSAVVSLLLACY
                     FKLVVADVSSLKDPLDESSMFSAVYAFQRRHGLEKTACLDLRTVSKLFEVTSKTFNTD
                     IFKFKRVVKSTVQDIAGKGNPIHLSSDILTTDLEKLVSRLRCGASLRAFWSGKGLPQG
                     TLWNDFTTAKYEYGSRVSETTVRGVNTTQEDELIHSDSESPTDSNPYNLETSESPHAG
                     STYTYHSAEVIDRALYRAELYRRSSSPDLGIPKTPQPPSNRPRSASMSLVEDVFNEWS
                     MPFEPAVVRLARDTLKVEALAAQKQPYDEDLAAVLEKRIDDLTAAVERVRNKATDMRS
                     EKTLLASKNGHLLKEMKELESLAAKFTYDVQVLDIRMRDIDEGIGQFGLRLQKIEEQL
                     SARYSYHLAKTEQLDTDEDLAQAARLVLDRQKPRYKSVVMAMVAWFAPLVSGDWNPFL
                     RLLPRFKAN"
     gene            <932079..>934712
                     /locus_tag="AGOS_ADR127W"
                     /old_locus_tag="ADR127W"
                     /db_xref="GeneID:4620384"
     mRNA            <932079..>934712
                     /locus_tag="AGOS_ADR127W"
                     /old_locus_tag="ADR127W"
                     /product="ADR127Wp"
                     /transcript_id="NM_209576.2"
                     /db_xref="GeneID:4620384"
     CDS             932079..934712
                     /locus_tag="AGOS_ADR127W"
                     /old_locus_tag="ADR127W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR054W (STV1)"
                     /codon_start=1
                     /product="ADR127Wp"
                     /protein_id="NP_984223.2"
                     /db_xref="GeneID:4620384"
                     /translation="MFLSMRAEEAMFRSADMTYIELYIPLEIAREVVCVLGNLGSVML
                     KDMNKDLSTFQRGYVNQVRRFDEVERQVGYMEGVVRRHKNETWRYLYRHLQREEQQEY
                     PGREHPTLAQLIGSMHTHSIDSVDEVAEEIMQFEGRVRQLDQSLVAMRERLSKLVHER
                     RVMFTCEHFLEVNPGIGERLPTRPAGFEADEFELTRVGEEDEETASQLSFDISDDAET
                     QLPGDMRTLLEPVYRHQYLLTGSIERAKVEALNKILWRLLRGNVFFQNFPVSVSPVEE
                     DDTDLETDCFIVFTHGEVLLSKAKKVIESLNGTIYPFMQDGATVQELNDKIADLKQIC
                     STTEQTLHTELFLVANQLPMWNAIIKREKYIYSALNLFRQESQGLVAEGWLPTYDLPG
                     VQAALKDYGESVGSANSAVLNVISTTRTPPTFHRTNKFTQAFQSIVDAYGIATYKEVN
                     PGLATIVTFPFMFAVMFGDAGHGALMLIAALYLVLNEKKLGAMKRGEIFDMAYTGRYV
                     ILLMGIFSIYTGIMYNDIFSKSMHLFSTGWKWPSNFQEGEMIEAQKVGVYPFGLDYAW
                     HGSDNSLLFTNSYKMKLSILLGFIHMSYSYIFSYLNYHYKGSRIDIVGNFIPGLIFMQ
                     SIFGYLSWAIIYKWSKDWIKDELPAPGLLNMLINMFLSPGVVDEKLYTGQSFLQVILL
                     LAALVCVPWLLLYKPLMLKRQNDIALSKGFRSLRDQRVHEILLEAQENAGEDMLVADY
                     ENEDESSEEFNFGDVMIHQVIHTIEFCLNCISHTASYLRLWALSLAHAQLSTVLWSMT
                     IQNSFSDSNPGSFFSVTKVVVLFAMWFVLTVCILVLMEGTSAMLHSLRLHWVEAMSKF
                     FEGEGYAYEPFSFKAINSDDE"
     gene            complement(<934858..>937461)
                     /locus_tag="AGOS_ADR128C"
                     /old_locus_tag="ADR128C"
                     /db_xref="GeneID:4620385"
     mRNA            complement(<934858..>937461)
                     /locus_tag="AGOS_ADR128C"
                     /old_locus_tag="ADR128C"
                     /product="ADR128Cp"
                     /transcript_id="NM_209577.1"
                     /db_xref="GeneID:4620385"
     CDS             complement(934858..937461)
                     /locus_tag="AGOS_ADR128C"
                     /old_locus_tag="ADR128C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL073W (LHS1)"
                     /codon_start=1
                     /product="ADR128Cp"
                     /protein_id="NP_984224.1"
                     /db_xref="GeneID:4620385"
                     /translation="MKLGKVALVWLAGALHGTAAAGALLGVDYGQQFGKAVVVAPGAP
                     LEIVLTPEAKRKDENGVCVREVMGRVERAYGSAASAAAARQPESALLHTKGLLGRRAA
                     EELGWWRRGHPGVQVADTGRGGVGFAVVGETVSAEETVAMALQQYVRRAEELVAEKRA
                     RDKVTQLALTVPEYFAVEQRNALLDAAALVPAEQTYLVSEGLSVAVDFALKGAFEAGR
                     AYHYVVYDAGAGSAKATLVTIAQPAEGPLRVELVGFGHSKAVSGARFTQTIADIIEER
                     FLAAQPALRAAQLEASARSRTKVLQAAERAKLILSVNSEAPVSIESLFEDIDFKTVLH
                     REEVEKRMAPVLDLVCSPIEEALAGQFGPVRVSVDQLDAVILTGGSSRVPSVQDRLAK
                     CVGEALISKSVNADEAAVNGVAIRGAQLSKIFRTRPLEVIDRSIYAYGAKVVGQDAPI
                     EIFPVGSVYPATASVRLPASQDDFTDALELELYEGERLFKKLSVRQTKDKFTQELCPM
                     GVTYNATFGLNANRIPVPVKVEALCWGNPEVVTDQEDTADALPQKVKSVKLDVKETYT
                     YLEPLRNKALTEAKIRLSKWDRAEEEELRKQDLLNSLESLIYSTREWLETPEVLDNGA
                     HDYVEKLTELVSTNLEWLDYESSNATFDDINNRLQEIMSLYKLLSHYLSIDAKVLDLP
                     VFELLRKNVSEAISTFNAFDDTAVAQANELEDNFNSLGLNVTREYTKLKVPKNLQYNS
                     TFAESELAALGKILSELEPILTPDAFDTIDREQLVKLFMKSEGHLNSIEEMQKFRERA
                     HAYRLRELNSLYTRKLRAAKRKEEKSKEAASSSTTDFADEAKATSTQQPADASTSSAD
                     SSTSDIDHDEL"
     gene            <937825..>939567
                     /locus_tag="AGOS_ADR130W"
                     /old_locus_tag="ADR130W"
                     /db_xref="GeneID:4620387"
     mRNA            <937825..>939567
                     /locus_tag="AGOS_ADR130W"
                     /old_locus_tag="ADR130W"
                     /product="ADR130Wp"
                     /transcript_id="NM_209579.2"
                     /db_xref="GeneID:4620387"
     CDS             937825..939567
                     /locus_tag="AGOS_ADR130W"
                     /old_locus_tag="ADR130W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL074C (MUD2)"
                     /codon_start=1
                     /product="ADR130Wp"
                     /protein_id="NP_984226.2"
                     /db_xref="GeneID:4620387"
                     /translation="MSSNLENLRSRIMASINSKKEEKKVPTGPRAAMGASEGAGSNES
                     GSSGGWQGGERAGRGAERGEMRGERGDGWGRGGEGAARRGGHQTASNSMPLGAPSRFG
                     GGGEARRGPGGGEGGWSAPGYDTRRGGRVGSRYGGRFDGGPGRIGKPAGGRGYSGPGR
                     FRDGAGRGAPAARGLGRKARAGPPFAREWVPDEREVDWSRVPALEERPRLRPTRWDVT
                     PRGFEHVPAERAKLSGLFPLPGQPQELDRMTLEGIAEKGALNRRTKILFEDPTKPNLA
                     QCKLNRTLVLSGEGVGDLDRVAACVSDMLKNITLEGEHVLSSCEQRKGALVLELNSEE
                     SATLVLAAQAYLKNQLNSHIVWQRPEEYVARLDAEEPICDRNLIAMLGVPLQSASEVP
                     GWLQEQDITYSWLHSVEVARQGANIFTQAVLYTPASAEAPLPSPQGVQVLQPNASELT
                     QNYSDISYQSFSKVVAVQTHKPSKVVCLLNAVDPLELKNERYYREVHDAVMFGTPVLN
                     CGPVESVKIPVPGPDFRNNFESVSLQIGKIFIKFKELSGAERAMLMLAGMRFCERTII
                     CSYYSERDFDMDLF"
     gene            complement(<939568..>940482)
                     /locus_tag="AGOS_ADR131C"
                     /old_locus_tag="ADR131C"
                     /db_xref="GeneID:4620388"
     mRNA            complement(<939568..>940482)
                     /locus_tag="AGOS_ADR131C"
                     /old_locus_tag="ADR131C"
                     /product="ADR131Cp"
                     /transcript_id="NM_209580.1"
                     /db_xref="GeneID:4620388"
     CDS             complement(939568..940482)
                     /locus_tag="AGOS_ADR131C"
                     /old_locus_tag="ADR131C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR055C (BUB2)"
                     /codon_start=1
                     /product="ADR131Cp"
                     /protein_id="NP_984227.1"
                     /db_xref="GeneID:4620388"
                     /translation="MEKFISHPPLIVHSSLSQLRYLVLAEGVGVEPEERRQRCYVWSI
                     LSRTDMEGATSRYMRLAQRGPPPAAVYKKIQNDTFRTFSTDSGFRERVSEESLTRCLS
                     CFAWLQELEGDRGPVRIATYVQGMNVLLAPLLYSCPAEPMAFRLFETVCQRMIPAYLD
                     HSLSGVHTGARLLDECLKIVDPKLSKFLSDNLLTAEIYGVPSILTLSSCQKPLDQVCR
                     LWDFMFAYGFHMNLLFIVAQLVKMRTEIMQSDSPMNLLRQFPDFDADEIIRLGVGFVA
                     KIPSGLYELLVRHLTEPGIDLSSYDGLD"
     gene            <940763..>942643
                     /locus_tag="AGOS_ADR132W"
                     /old_locus_tag="ADR132W"
                     /db_xref="GeneID:4620389"
     mRNA            <940763..>942643
                     /locus_tag="AGOS_ADR132W"
                     /old_locus_tag="ADR132W"
                     /product="ADR132Wp"
                     /transcript_id="NM_209581.1"
                     /db_xref="GeneID:4620389"
     CDS             940763..942643
                     /locus_tag="AGOS_ADR132W"
                     /old_locus_tag="ADR132W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR058W (FET3)"
                     /codon_start=1
                     /product="ADR132Wp"
                     /protein_id="NP_984228.1"
                     /db_xref="GeneID:4620389"
                     /translation="MKGLLSSVVLLAAAWTHVSAEEHVFHWKTGMGKANPDTLKERPV
                     ITCNGEYPWPAVRVKQGDKVSVLLENGFEKWNTSLHFHGMFQNGTNQMDGPEMVTQCP
                     IPPGGSMWYNFTVEGNKGTFWYHSHTAGQFQDGMKGVFVIDEANSTFAYNFDKEMTLE
                     LSEWYHDVAVDKIPEFLHLYNPTGAEPIPQNLIINNTRNLTWKVEPDTTYLLRLVNTG
                     GFVSQYFWIEDHEMEVVEVDGVYVEKNVTNMLYITSAQRYSVLVHTKNETSRNFAIMQ
                     KMDDTMLDVMPDDLQLNATSYMIYNDQLPNPEEHRVGELEFLDDIYLVPIDEHRVPML
                     EDATAKIEVTVDMDNLMDGRNYAFFNNITYTEPKVPTLMTVLSAGDKATNPLVYGTNT
                     NAHVLEHNDIVEIVINNKDTGRHPFHLHGHVFQVVARGPTAADQDDLDAADPIEYPGE
                     DEGREYPMTRDTVYVNGKSYVVLRFKADNPGVWFFHCHLEWHMIQGLSLTIIEAPLEI
                     QRTASQKLTDSTIGACQAAHVPHIGNAAAHTEDLLDLSGQNVQQKSIPEGFTPKGIVA
                     MFFSCLAAVLGLITIAVYGLMDMKDAEGRVIEDLGVDPVVLSKGSLADEGSVSTSSDV
                     KK"
     gene            <942934..>944181
                     /locus_tag="AGOS_ADR133W"
                     /old_locus_tag="ADR133W"
                     /db_xref="GeneID:4620390"
     mRNA            <942934..>944181
                     /locus_tag="AGOS_ADR133W"
                     /old_locus_tag="ADR133W"
                     /product="ADR133Wp"
                     /transcript_id="NM_209582.1"
                     /db_xref="GeneID:4620390"
     CDS             942934..944181
                     /locus_tag="AGOS_ADR133W"
                     /old_locus_tag="ADR133W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL075C"
                     /codon_start=1
                     /product="ADR133Wp"
                     /protein_id="NP_984229.1"
                     /db_xref="GeneID:4620390"
                     /translation="MGDCCRCSQQWHVASNGAKSIKEGASGGTGRKHARRYKFQFYKH
                     LQFQGTRYQVVTSRPYLIERYGERKAATIRSFVKCIHRKINDDVTRISDERVTHGVSK
                     WEKSKLFLLLVTLSQRGGPEYWLDKTNGCQSRAGGDGARKSDEVEEGGSRRGQRLVCT
                     LVEQIMRENITEDYDESVHDENYVFSSIWANFMEGLINHYLEKVIIPKSELKVCQQLY
                     KPMMKIISLYNEYNELMDKSERNGFFPAQEEVCESGGVEQLSERAEDDVSTDQKLVKA
                     QKLLWQARQDIPKTISKELTLLSEMYSTLSADEQDYALDEFVCCAEEYIEVEYLPALI
                     DLLFQNCGTLLFWKIMMVLEPFFYYIEEVDDSNERDEDDDESGSSVPTPANSEATHRP
                     AKPDPRMVTLEKICEVAARQKWI"
     gene            complement(<944224..>945378)
                     /locus_tag="AGOS_ADR134C"
                     /old_locus_tag="ADR134C"
                     /db_xref="GeneID:4620391"
     mRNA            complement(<944224..>945378)
                     /locus_tag="AGOS_ADR134C"
                     /old_locus_tag="ADR134C"
                     /product="ADR134Cp"
                     /transcript_id="NM_209583.1"
                     /db_xref="GeneID:4620391"
     CDS             complement(944224..945378)
                     /locus_tag="AGOS_ADR134C"
                     /old_locus_tag="ADR134C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL077W"
                     /codon_start=1
                     /product="ADR134Cp"
                     /protein_id="NP_984230.1"
                     /db_xref="GeneID:4620391"
                     /translation="MMLSGLVYLLLAQVAVGRREYVRVQTTTTTTEELHPWHRTIYGT
                     VKEIVTPTVIAGVTFSLKPDPTPDPLKPWVSLKKDGAPQTIKPEVKKGRTIKGPPDYS
                     TYFKQVSTTTYSYEELQAHNMDPNDVHEEEVFTEEDDTYTSLNPLIRCTPDRYFNKGL
                     AKDVSSAPFCTPREHVDWYAGQTYFITWYTHFFWDKALDAPAEQARVMLYYVKKGQLR
                     QKREPIKPFFRGQWIKNIDGLFAITIDEEWLQGQGTRQLMLTVQPSTVADEEFDPVEH
                     GILVRLALPNRVFKAGKQDLKMLDSGMTDETWYYLLLTLPTIVVFVAALVYFFLQWNR
                     RYTDFSDISRAAIAKKHRIIGKFKDMPRFRNMRNHRYDELPQHNKSSKQS"
     gene            <945528..>945884
                     /locus_tag="AGOS_ADR135W"
                     /old_locus_tag="ADR135W"
                     /db_xref="GeneID:4620392"
     mRNA            <945528..>945884
                     /locus_tag="AGOS_ADR135W"
                     /old_locus_tag="ADR135W"
                     /product="ADR135Wp"
                     /transcript_id="NM_209584.1"
                     /db_xref="GeneID:4620392"
     CDS             945528..945884
                     /locus_tag="AGOS_ADR135W"
                     /old_locus_tag="ADR135W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR059W (SEN15)"
                     /codon_start=1
                     /product="ADR135Wp"
                     /protein_id="NP_984231.1"
                     /db_xref="GeneID:4620392"
                     /translation="MSVSYNGGLTGLTALVRNNLVHYQQWSDVEVVPLRDREALRGRP
                     AQKLSNDDEEIGVEYVLPVELSQYRSSGVTLEALDKVFSQLPASCKRVVLAISSDDGT
                     VVYYTVYQGLQRPRKN"
     gene            complement(<945887..>946741)
                     /locus_tag="AGOS_ADR136C"
                     /old_locus_tag="ADR136C"
                     /db_xref="GeneID:4620393"
     mRNA            complement(<945887..>946741)
                     /locus_tag="AGOS_ADR136C"
                     /old_locus_tag="ADR136C"
                     /product="ADR136Cp"
                     /transcript_id="NM_209585.1"
                     /db_xref="GeneID:4620393"
     CDS             complement(945887..946741)
                     /locus_tag="AGOS_ADR136C"
                     /old_locus_tag="ADR136C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR060C (SAM37)"
                     /codon_start=1
                     /product="ADR136Cp"
                     /protein_id="NP_984232.1"
                     /db_xref="GeneID:4620393"
                     /translation="MATIHLWGVDGAPALISPESIALFWLVNTCEVECTVVFSNNAHL
                     SPREELPLYVGEDGSAAYEYPEIVEQLLGRELGLEERSLVCWAAERCGALSDYQLYLN
                     RKNYEQYTRRVFSQLLPWPLWYNTPVQRRERARAQRGGTPAPAHDAEKELAQHSKTLQ
                     ATRELRERGEKALADAAAEMEYAAALDRALQPWIAVRGAAATLGPAELLFAAHLYVQQ
                     QLPDGARVTAHLRAHYPALCDGLLRACELHACAPRAAAVAVRAPTAAETPSVPRELYR
                     YVTSYWTI"
     gene            <946876..>948861
                     /locus_tag="AGOS_ADR137W"
                     /old_locus_tag="ADR137W"
                     /db_xref="GeneID:4620394"
     mRNA            <946876..>948861
                     /locus_tag="AGOS_ADR137W"
                     /old_locus_tag="ADR137W"
                     /product="ADR137Wp"
                     /transcript_id="NM_209586.1"
                     /db_xref="GeneID:4620394"
     CDS             946876..948861
                     /locus_tag="AGOS_ADR137W"
                     /old_locus_tag="ADR137W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR061W (RNA14)"
                     /codon_start=1
                     /product="ADR137Wp"
                     /protein_id="NP_984233.1"
                     /db_xref="GeneID:4620394"
                     /translation="MSGNETPDAGTVKSVSPSSGGSSLPARPTLRERDPNDIENRLRD
                     QIEEDPTQILLYIELIKYYVGKQQVAEIREVFGQLHELFPLESFLWTIHLNWELEQEE
                     SGQVETLLAKCLSGELMNNDIYLWSTYLGYVRRKNNTVTGGEEARGTVLKAYELVMEK
                     CAVFEPRSMQFWQDYLQFLEQWKPVSKWEEQSRVEILRKLYKRLLCLPVESLERYWEK
                     YTQWEQEVNQLTARKFIGELSASYMNARSLYQEWSNLTKGLRRSLPTKLNQATQQNLP
                     APGQYDEYQLQIWTKWIQWELDNKLDLPEVVLRQRVEYVHRQAVQHMCFAPEIWYNYA
                     MFVDENEHEKVLEIAVRCNPGSLSLTFKLAEYLELNNKIEALEERFQHCIARISMELQ
                     VMNDTTMDPDKILRQTRKLTFAYCVYMTTMKRVTGLSAARKVFSKCRKLKKDISYEIY
                     VENAYMEYYNNSDVTTPCRVLEFGLKYFQDNGNYINKYLDFLILVKQDAQIKSLFESC
                     IDKIYNLDQLKEIYKKVINYESKFGNLNNVYELERRFFEKFPEAEKIEVFTDRYQLQG
                     ENLLKRLEFPYLMDEYGIPVLSGYAVKRSLHSAGIVFDDNGSSKRQRQEQTEAVPMEI
                     IELLKVLPKRQYFKTIVLDPHKLADFLSDKVTIPPCD"
     gene            complement(<948942..>950273)
                     /locus_tag="AGOS_ADR138C"
                     /old_locus_tag="ADR138C"
                     /db_xref="GeneID:4620395"
     mRNA            complement(<948942..>950273)
                     /locus_tag="AGOS_ADR138C"
                     /old_locus_tag="ADR138C"
                     /product="ADR138Cp"
                     /transcript_id="NM_209587.2"
                     /db_xref="GeneID:4620395"
     CDS             complement(948942..950273)
                     /locus_tag="AGOS_ADR138C"
                     /old_locus_tag="ADR138C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR062C (ARG7)"
                     /codon_start=1
                     /product="ADR138Cp"
                     /protein_id="NP_984234.2"
                     /db_xref="GeneID:4620395"
                     /translation="MKSSLSLCQRAANAASKYERYVPSCGVFPLGFKVGSIATGVKKN
                     GQLDLGVILSTYEREGGATAAAVFTTNKFKAAPVVASKERLAKSEGRGISAIVVNSGC
                     ANAVTGAVGLENANKVVQLVEQQLGRKDTTLLMSTGVIGQHLSMDKIEHGLGTLLNND
                     DAFGNDFSSWLSLSKAMMTTDTFPKLISSRFTLPGGTTYTLTGISKGAGMICPNMATL
                     LGFIGTDLPISPSALQNILSSAVDRSFNCISVDGDMSTNDTIYMLASGAIDTDLITES
                     SESFPLIKAQVTELAQNLAQLVVRDGEGSTKFVTVHVKRALNFADAKVIAKTISNSSL
                     VKCALYGQDANWGRILCAIGYAQLGDCASLDESTLNVSFVGVGDSKGAELNLVVDGVP
                     NVNINESKAATMLADTDLKIVVDLGTGTEECNFWTCDLSHEYISINADYRS"
     gene            complement(<950583..>952259)
                     /locus_tag="AGOS_ADR139C"
                     /old_locus_tag="ADR139C"
                     /db_xref="GeneID:4620396"
     mRNA            complement(<950583..>952259)
                     /locus_tag="AGOS_ADR139C"
                     /old_locus_tag="ADR139C"
                     /product="ADR139Cp"
                     /transcript_id="NM_209588.1"
                     /db_xref="GeneID:4620396"
     CDS             complement(950583..952259)
                     /locus_tag="AGOS_ADR139C"
                     /old_locus_tag="ADR139C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YDR536W (STL1)"
                     /codon_start=1
                     /product="ADR139Cp"
                     /protein_id="NP_984235.1"
                     /db_xref="GeneID:4620396"
                     /translation="MIKESFSRTATGGFSGRALRLAVTITAVTGFSLFGYDQGLLSGL
                     INGEQFNHEFPATLEQGDNDRHATVVQGAVTSCYELGCFFGSLYVMVDGERRGRKPLI
                     IMGSLLTILGTVVSVAAFREHWGLGQFVIGRVVTGLGTGLNTSTIPVWQSEMSKPKNR
                     GLLVNLEGSVIAVGTMIAYWIDFGLSYVDSSVQWRFPVAMQIVFAVLLLVGIVQLPES
                     PRWLMAHGRTAESKYVLGKLDNLDPSDDSVLAEAAAIEDAVNRFKHEKRSLKDALTGG
                     RGQNLQRTLVACSTQFFQQFTGCNAAIYYSTVLFHKTINLEYRLSLILGGVFSTVYTL
                     ATIPSFFLIETVGRRKLFLIGALGQGFSFTITFACLINDTKNNAKGAAVGLFLFIIFF
                     GMTILSLPWIYPPEISSMKVRSITNAMSTCTNWLCNFAVVMFTPIFIHEAGWGCYLFF
                     AVMNFLYVPIIFFFYPETAGRSLEEIDIIYAKSFVDGTQAWRVAANLPKLSLKEVEEY
                     GIQLGLYNNEHDFKDEMKVITEAEGQVPRSSISDSNMESSSTGNGIMKKP"
     gene            complement(<952706..>954835)
                     /locus_tag="AGOS_ADR140C"
                     /old_locus_tag="ADR140C"
                     /db_xref="GeneID:4620397"
     mRNA            complement(<952706..>954835)
                     /locus_tag="AGOS_ADR140C"
                     /old_locus_tag="ADR140C"
                     /product="ADR140Cp"
                     /transcript_id="NM_209589.1"
                     /db_xref="GeneID:4620397"
     CDS             complement(952706..954835)
                     /locus_tag="AGOS_ADR140C"
                     /old_locus_tag="ADR140C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL078W (DRH2)"
                     /codon_start=1
                     /product="ADR140Cp"
                     /protein_id="NP_984236.1"
                     /db_xref="GeneID:4620397"
                     /translation="MQGAKSKSYRKLPAVQQRAGPKVVEFRDDEEDQFDGMARRLNAS
                     QLRQRAAELLKVRETLPVYRHQQSIMEHLNSNPVTILIGETGSGKSTQLPQLLLAQLK
                     EEDKKGAIAVTQPRRVAAVSLATRVAQEHGCNLGDEVGYSVRFDSCAHPSRTRLKYLT
                     DGMLLRELIQDKNLRKYRYVVIDEAHERTILTDLILGFLKQLLRTTRPDLRVLVMSAT
                     LQGDKFSAFFDGAPVLFVEGRKFPVEIRYLSQPCEDVVDAVVRCCVQINSGEQLGDLL
                     CFMPGQEEIDKAVGVLAKISEHLDPGVPRITALPLYAALPPAEQAKVFLPLKGFRRKI
                     ILSTNIAETSVTIAGVKYVVDTGLRKCKVWRHQLGLATLLTVPISKASASQRAGRAGR
                     ESAGKCFRLYREADYEQLPGQSEPEIVRCDATAPLLMLKQIGVDDLLNWTWLEHPGRD
                     SIVQGLQELYQLGALDDSGAITDDGRKMALLPLAPHLSRVLLEARRNHCLPAVLDIVA
                     CLSVDNLLLSPPPEARDEVNARRAAACPRGARYGDLLMLKELYDHYAALPAPDRADWC
                     RRLCASARGFRAAAKTRAQLHRYAAALLHWRPEPAAPAADLHAPQIAAVVKSFLAGFA
                     RNTAIRMPDRSYRTTSHGEPISIHPSSLLFFSTYAAADRPSAPAPAILYVEYVFTSKG
                     YARGVTRVELDWLQELQPRALGKRSAR"
     gene            <955026..>955826
                     /locus_tag="AGOS_ADR141W"
                     /old_locus_tag="ADR141W"
                     /db_xref="GeneID:4620398"
     mRNA            <955026..>955826
                     /locus_tag="AGOS_ADR141W"
                     /old_locus_tag="ADR141W"
                     /product="ADR141Wp"
                     /transcript_id="NM_209590.2"
                     /db_xref="GeneID:4620398"
     CDS             955026..955826
                     /locus_tag="AGOS_ADR141W"
                     /old_locus_tag="ADR141W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR063W (RIM9)"
                     /codon_start=1
                     /product="ADR141Wp"
                     /protein_id="NP_984237.1"
                     /db_xref="GeneID:4620398"
                     /translation="MMGGMSVVEWLLLGSTTLALLFQSFATFSVPLSNGVTLSHFNGY
                     KFGVFGWCDTTHTHCTPLKLGYSAEDGFLFAGQDELSLPTQAKYSLSKLLVVHPLALC
                     SMVVLWLMVVLSQCYKHSDRRLTIIILWSFLTYMETLLCFLVDVLLFVPYLDWPGWLM
                     LVSAVLVVFSSSIACLRRRTLTSQRIEKGAKEDLELYPLYGGALGAGVVSDSESPHRP
                     YTEGSIISVTSRASSRLLPSASELETPREELTLMDPSIKCHIERSPMS"
     gene            <955933..>957303
                     /locus_tag="AGOS_ADR142W"
                     /old_locus_tag="ADR142W"
                     /db_xref="GeneID:4620399"
     mRNA            <955933..>957303
                     /locus_tag="AGOS_ADR142W"
                     /old_locus_tag="ADR142W"
                     /product="ADR142Wp"
                     /transcript_id="NM_209591.1"
                     /db_xref="GeneID:4620399"
     CDS             955933..957303
                     /locus_tag="AGOS_ADR142W"
                     /old_locus_tag="ADR142W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR064W (AEP1)"
                     /codon_start=1
                     /product="ADR142Wp"
                     /protein_id="NP_984238.1"
                     /db_xref="GeneID:4620399"
                     /translation="MRGLQAVGKVVSPAKKQSLANGMPLKRLNNHVPQPNQIMHPFLG
                     LTQTELGLLCCTECEPRIRSGKQIIPAMVRDPMKDQTEYTHAKLQFPLLTNISAWVKD
                     HAMYQYSSEKQLVSAATLPAFKAAETEIPEAIRAVCQPSAQSIEGIIAAGVVSTEDLF
                     QFLLETYPARAKTILPILLREYQKLPPAELHLEGTLHRALLAFEGQTVDKEDIEVLNR
                     LLDNYSTEFGRRYEQVLDATVLQQLLRFYISGSALTNSRTTLQFLLKRGVCPIPEVLD
                     AYFLLLEKAISVKSQPDLQARRLAKMACIAGCAPILKHTITATMLRVLTGCAAHTGEI
                     LHLVELAAGMPSCKEVLQENAVQLVNAVSSFAPSPAVENCTNISLLLQRLEQIYPDGL
                     PKQFVHAASQAYMHNGNWGAAAVIWNRYGVPEGLVEIPVVNIRCRFPGFRQEDRQHLE
                     TLLKSK"
     gene            <957543..>958979
                     /locus_tag="AGOS_ADR143W"
                     /old_locus_tag="ADR143W"
                     /db_xref="GeneID:4620400"
     mRNA            <957543..>958979
                     /locus_tag="AGOS_ADR143W"
                     /old_locus_tag="ADR143W"
                     /product="ADR143Wp"
                     /transcript_id="NM_209592.2"
                     /db_xref="GeneID:4620400"
     CDS             957543..958979
                     /locus_tag="AGOS_ADR143W"
                     /old_locus_tag="ADR143W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR065W (KAR5)"
                     /codon_start=1
                     /product="ADR143Wp"
                     /protein_id="NP_984239.2"
                     /db_xref="GeneID:4620400"
                     /translation="MLEILLFLCVIIQRSHINAEITHVVSHLAETALRQDTNFQLLSQ
                     DIIAKKFPILDSSCVRRALSDFLPQCLQYGFETVPSDVRTQAAVKLSICELQASGVDN
                     MPPECVGAVHFGACLRAMERTPQWWTTYSGNYQHLPSTCFENALPYEKEQLLSLFLNI
                     TDVYSNFQDDLVVDLEKYRANFEATVEASLRLMKASLMEGTHEIVNQLKDDLNYVNSK
                     LADMGETITEHTDNVRTVFNDISDELNDYDMAGQIAHLKEDTMSLWQKINSDMGTYHD
                     VQMSSLYNINAVFDTFYNRATESVQQVRTSVIESQLETLDLIADFNSLVRKSILPVLA
                     DELQPQLQEMSVSISRSLVGLSASYNEHLQAWSNRVNETLSEMESHLNNTMSQVEHMN
                     DSIETLENKVFVLVSLGNALTTYVKWIYTFSRALISGYGIVTLIMSMLVVRYSIKLNS
                     SWIKVLGRSTFILVAVVLGARTGSMLSY"
     gene            complement(<959010..>959897)
                     /locus_tag="AGOS_ADR144C"
                     /old_locus_tag="ADR144C"
                     /db_xref="GeneID:4620401"
     mRNA            complement(<959010..>959897)
                     /locus_tag="AGOS_ADR144C"
                     /old_locus_tag="ADR144C"
                     /product="ADR144Cp"
                     /transcript_id="NM_209593.1"
                     /db_xref="GeneID:4620401"
     CDS             complement(959010..959897)
                     /locus_tag="AGOS_ADR144C"
                     /old_locus_tag="ADR144C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YJL208C (NUC1)"
                     /codon_start=1
                     /product="ADR144Cp"
                     /protein_id="NP_984240.1"
                     /db_xref="GeneID:4620401"
                     /translation="MSYKQVISGIVGGGIAGALLAKGVSSVPSVNPPGSPVTDGALVD
                     PAGFFKYGFPGPVHDLQTRDSFVSCYDRRMRNPYWVVEHVTAQSLATKNGSRKNSIFK
                     EDEEIPETFRARLRDYFRSGYDRGHMVPAADSKFSQKAMDETFYLTNMSPQVGDGFNR
                     DYWARLEDYCRRLTYKYGSLRIVTGPLYLPKKDPVDGKFRVTYEVIGNPPSVAVPTHF
                     FKLVVAESDKLYATAFVLPNEPIPEDTKLGSFEVPINALERSTGLQFLQKAQYAHLPL
                     EEDLMKVIPYEPAAINGKV"
     gene            complement(<960219..>962126)
                     /locus_tag="AGOS_ADR145C"
                     /old_locus_tag="ADR145C"
                     /db_xref="GeneID:4620402"
     mRNA            complement(<960219..>962126)
                     /locus_tag="AGOS_ADR145C"
                     /old_locus_tag="ADR145C"
                     /product="ADR145Cp"
                     /transcript_id="NM_209594.1"
                     /db_xref="GeneID:4620402"
     CDS             complement(960219..962126)
                     /locus_tag="AGOS_ADR145C"
                     /old_locus_tag="ADR145C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL079W (SMY1)"
                     /codon_start=1
                     /product="ADR145Cp"
                     /protein_id="NP_984241.1"
                     /db_xref="GeneID:4620402"
                     /translation="MTMDGTSMHGTSSAADEGADDKMKVVVRLRPLPEGGSAAVVAAD
                     EGTVEFAGAADEARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTG
                     SGKSYTMFGPPGHRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEKVYDLLG
                     ESINKASSPKKNSDKRASLTVHESNTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYK
                     GSTDMNLESSRSHAIVKINLLKRDNLEGNIQKSDLFLVDLAGSEKVAKTNAVGATLEE
                     AKKINLSLSSLGNVINALTQKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDK
                     SNESETLTTLRFGSRAKHIKNKAIVNKSDLFLKKKLERKIAQLEKKEQDYKTRIELLE
                     HEVKELQATASHRPLPEEVDLLAENTKLRAQVDSLKVLLNPRTDSLDTEQHISVDDLL
                     TKLMEKCELVVELQSRLDDQADKEKALKKLMTDLKHTEAQLVEKNHQLAEQLAIAQLD
                     NLNLTNENMTLSKDIATIHRISKTRAERIQVLESTVRELSDMRLGNDLSLPSAFEAIK
                     EVNEPSSALSPTSLGWWGVFGPSRRSSTGSVHSGGLAKIPSNETRRSRKTGFNLHVVK
                     ASVPHEAESLD"
     gene            complement(<962382..>963518)
                     /locus_tag="AGOS_ADR146C"
                     /old_locus_tag="ADR146C"
                     /db_xref="GeneID:4620403"
     mRNA            complement(<962382..>963518)
                     /locus_tag="AGOS_ADR146C"
                     /old_locus_tag="ADR146C"
                     /product="ADR146Cp"
                     /transcript_id="NM_209595.1"
                     /db_xref="GeneID:4620403"
     CDS             complement(962382..963518)
                     /locus_tag="AGOS_ADR146C"
                     /old_locus_tag="ADR146C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL080W (VMA5)"
                     /codon_start=1
                     /product="ADR146Cp"
                     /protein_id="NP_984242.1"
                     /db_xref="GeneID:4620403"
                     /translation="MTSSPAKQLLLLSLPADARPAQHSDMDAQTWLLRELLGGRATVS
                     EFAVPEFKIGSLDALVLQSEELGRVDAQVHAALGKIEEALAALGEAPGPADPPSAFRW
                     DTRRYKLDRPIRDLIAELARECAQLDSDVRAAAAEHAAACSALAAADRHESGDLSVRA
                     LHDIVREEHCVLDSEYLTTALIAVPQARRPEFERAYETLAPHVVPGSAAVLASDSEFA
                     LYAVHLFRRSAPAFAAACRERGCVPRDFTYSPDAVRALHQERVASAARAQAARAALAR
                     LARTARADVRAAALHVLALRVFVESVLRYGLPPHFAARLLAVAPRDATPCRAALRDQF
                     GYLGGNAFSRDKRGRIQRHDAALSEYAALVDTDYEPFVLYSVPL"
     gene            complement(<963675..>965097)
                     /locus_tag="AGOS_ADR147C"
                     /old_locus_tag="ADR147C"
                     /db_xref="GeneID:4620404"
     mRNA            complement(join(<963675..964714,964896..>965097))
                     /locus_tag="AGOS_ADR147C"
                     /old_locus_tag="ADR147C"
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /transcript_id="NM_209596.2"
                     /db_xref="GeneID:4620404"
     CDS             complement(join(963675..964714,964896..965097))
                     /locus_tag="AGOS_ADR147C"
                     /old_locus_tag="ADR147C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL081W (TEF4); 1-intron"
                     /codon_start=1
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /protein_id="NP_984243.2"
                     /db_xref="GeneID:4620404"
                     /translation="MSQGTLYVKKTCRSMLPQSIVEHYNLDVSIVDADKNEEFEKKFP
                     LKRAPAFSCAAGNLTETMAITYYLVNLIQDEKAKAALLGSTLEEQAQVLRWESLTNTN
                     FIDDVASAFLYLEGIVPFNKRDMENRIASAERIAEVYEQRLRNYTYLATENVSVADIL
                     AVGGFELAFTNIWGAQWRAAHPAICRWFNTLANSPLLKKHIDLSKLVQEPKKVAAPKK
                     EKKEKKEQPKKKEQPKKEKEAAPAAEEPAEPKKPKHPLSLLPPATLNLEDWKRKYSNE
                     DTRPVALPWFWERYNPEEYSIWKVGYKYNDELTLTFMSNNLIGGFFNRLSASTKYMFG
                     CLVVYGENNNNGIVGAIMVRGQDAIPAFDVAPDWESYDYVKLDTSKEEDREFINDMWA
                     WDKPVMVDGVAREIADGKVLK"
     gene            complement(964778..964852)
                     /locus_tag="AGOS_AgSNR38"
                     /old_locus_tag="AgSNR38"
                     /db_xref="GeneID:4620405"
     ncRNA           complement(964778..964852)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR38"
                     /old_locus_tag="AgSNR38"
                     /product="AgSNR38"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR38; start and end coordinates are
                     approximate; Similarity is partial. In synteny."
                     /transcript_id="NR_149381.1"
                     /db_xref="GeneID:4620405"
     gene            <965732..>966997
                     /locus_tag="AGOS_ADR148W"
                     /old_locus_tag="ADR148W"
                     /db_xref="GeneID:4620406"
     mRNA            <965732..>966997
                     /locus_tag="AGOS_ADR148W"
                     /old_locus_tag="ADR148W"
                     /product="ADR148Wp"
                     /transcript_id="NM_209597.1"
                     /db_xref="GeneID:4620406"
     CDS             965732..966997
                     /locus_tag="AGOS_ADR148W"
                     /old_locus_tag="ADR148W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL082C (RRP14)"
                     /codon_start=1
                     /product="ADR148Wp"
                     /protein_id="NP_984244.1"
                     /db_xref="GeneID:4620406"
                     /translation="MSNSLEERLKSNSNAFDGLLSLIPAKYYYDDKTQEQWRASKKTK
                     TQTRLDKRKKLNPVEQDQESSSALEVKRKREEEAKPVVLPGEKLQQMNAVQQAATAQI
                     SEEDDAEAGEHEEVEHEDEETISVVFDDEGNAVDGKHAAAGDKPAEDKDTSGKEKRQK
                     NMEALRAKLQERIRQMKEKRKAPGTRVDGAPSSREAILAQRKKREELRKRRQEEERQR
                     QDDSGDESESDSESDMDDQPPTKQRKRDAELSAKDVIFQNIVFDDGSRATSDLQRLRR
                     TDRKKGPAKNDIKAHLKLAEARTSQLESKDELQQIMIKEKEKWKRAMLQAEGVRLKDD
                     EKLLRKALKRKEAKKRKSAIEWKEREQTVTTSISEKQKRREENLAIRKSNKGVKKSKQ
                     QKMKRKFTGAIVPKKRAGFEGRLKSGKRK"
     gene            <967205..>969781
                     /locus_tag="AGOS_ADR149W"
                     /old_locus_tag="ADR149W"
                     /db_xref="GeneID:4620407"
     mRNA            <967205..>969781
                     /locus_tag="AGOS_ADR149W"
                     /old_locus_tag="ADR149W"
                     /product="ADR149Wp"
                     /transcript_id="NM_209598.2"
                     /db_xref="GeneID:4620407"
     CDS             967205..969781
                     /locus_tag="AGOS_ADR149W"
                     /old_locus_tag="ADR149W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR066W (SOV1)"
                     /codon_start=1
                     /product="ADR149Wp"
                     /protein_id="NP_984245.2"
                     /db_xref="GeneID:4620407"
                     /translation="MLRRMLLASRANAPQFRQIRTRYPSMLHPDHFSPDKASSVIGNI
                     KNITDPEHFEEHEKPQLPSAAEQTDLISGNMLDVLTAHNPGFKRSQANLRRLKTQVSD
                     HALPTEHKIRAIFRYLLQESQDELSRLRELGPEKVNTVLQAHRENAYLRRKQQAKTAE
                     DLAGLMAQELLIKDAKGDSYLQNTEHLLLLLLHMLRSKSQVLEIEQIVEALETCKLIP
                     GTQNRLRGIFLSGRLLYSLGKVRMDPFNESFYIDALLYHGCYKDAWQLFESYKDRVNQ
                     RWWYELGMIVALRSNQVRKYDLLFKQTIDKFGESYIQPKVLKTAIKKKLYMGDFKSAN
                     RLTNFFMQIGGDLGFKKATNDGDTSNIPEFETEEQANQFLNALENPTYSDVMDIIQAH
                     LFRRNHAYAFKLFAQFLEQADSHSTDVAQLLVRLQMLMINDIQTLKKAIQPFLKPNTE
                     QEALSKLEESFNFSIEKTGLSDARRALDFLLFRNMEALTSQPTMTGVVYKYIVQNWAD
                     SKNDNSIDPSKKFQGIIKILLINNKEDAALQVLSKLEQSDGSGFYPRVNGHHYSLLAD
                     YYLKALKSTKSVLKRERLVDKVRTIMNRMEKFSIPFNATITASLIAFYREVPDIDECF
                     KLINSILVENSRSSEVAMNNVTPFFEMRLVTSKLYQEIWKTYRLYHSFSADWSLLEPS
                     AYRMGWKSYVLGAKRTLNSEPTLSMSELFRQMVELNNIMPTPKFYSNILITLAKGRDF
                     VTMIAVLQYMKTKHAVVLEDALRKYLYVSLERAYVELERKGISSGNSVLAFQSATALA
                     KEKVKSMIQEGQVLKKVHEDPIDDMVSQISSYIQRADPTGMELLPPLLRSLGLDMTPV
                     KQ"
     gene            complement(<969857..>971110)
                     /locus_tag="AGOS_ADR150C"
                     /old_locus_tag="ADR150C"
                     /db_xref="GeneID:4620408"
     mRNA            complement(<969857..>971110)
                     /locus_tag="AGOS_ADR150C"
                     /old_locus_tag="ADR150C"
                     /product="ADR150Cp"
                     /transcript_id="NM_209599.2"
                     /db_xref="GeneID:4620408"
     CDS             complement(969857..971110)
                     /locus_tag="AGOS_ADR150C"
                     /old_locus_tag="ADR150C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR067C (UBX4)"
                     /codon_start=1
                     /product="ADR150Cp"
                     /protein_id="NP_984246.2"
                     /db_xref="GeneID:4620408"
                     /translation="MSSVRVEYGYSVFRCKVTPGSLANDILQQALEHFKLDGGKQQWT
                     LSHGGKAVTLCLPFRQLNLPTGCALKLTSVSSGSVGTAAVTIKFQAMGVGVQIRQVST
                     GALVQDELRLTCQAAGWPMEPVGQFMVSLFSKTLTFDEVAGLTFRDLGVNEDVMIRLR
                     LPGSNTRKNSNASVGSVGARASSSRKSEGSGSSQRCKPEEPAQKTHSHTKKLHKVLAL
                     VPSRSSSTSKAPEKPLVEEDSEGDYELSEQDVLKYQSMLAKRAMGGPLLTKRLREEMD
                     NKTHKKVEQCNIRVRLPDLTHLEACFDKDDTMEDVYKLVSQSLASPSIEFTLTQSYPH
                     VKLERSKQKLVDDLQFSSSTLIVLDTSHPGPYLRKSLLEKSKKISAANKQLHDKEASS
                     SKTEHAPKEKLSLKKIPKWMKLSKK"
     gene            <971471..>972733
                     /locus_tag="AGOS_ADR151W"
                     /old_locus_tag="ADR151W"
                     /db_xref="GeneID:4620409"
     mRNA            <971471..>972733
                     /locus_tag="AGOS_ADR151W"
                     /old_locus_tag="ADR151W"
                     /product="ADR151Wp"
                     /transcript_id="NM_209600.1"
                     /db_xref="GeneID:4620409"
     CDS             971471..972733
                     /locus_tag="AGOS_ADR151W"
                     /old_locus_tag="ADR151W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR068W (AVO2)"
                     /codon_start=1
                     /product="ADR151Wp"
                     /protein_id="NP_984247.1"
                     /db_xref="GeneID:4620409"
                     /translation="MLPDPSIRLRNAIIEGKLIIVKQVLRRWPELLTNIDPSNGWSSL
                     HYAAYYGRYLICVQLIQQGHDRQGTLRTFTGSTSVHLALKNGHEQTTHVLLQSFPQTL
                     ASKDVGGRTPAHIACMQDYHTCLSLLSSAGADLSLTDNDGNTPLHIAMMYNSVNCIRL
                     LVLGSLSEEDYLRKNNDNWKPEQLAGTMETQRVFQNLVKEAHKQRESGVPRPAFLQTL
                     TLPGAHLKAEEQTCPSLLNVRVFHDASAEPDAGTNTQPQKEPTTLLPLLPAYPNQKPA
                     KGYPKTPTSNHFNTTLSSATNHSSSSLTRIRTFNDCSSSLSSETQSLRQRASGSQEGQ
                     WSVKNASGRYFHQGDTSLNAMSNLLPVNNTPRNRDAELINKYLVEDKDLRTPSPLPMH
                     VQHYTKSEKSSSGGHQSLLNIPISKVRI"
     gene            complement(<973306..>974304)
                     /locus_tag="AGOS_ADR152C"
                     /old_locus_tag="ADR152C"
                     /db_xref="GeneID:4620410"
     mRNA            complement(<973306..>974304)
                     /locus_tag="AGOS_ADR152C"
                     /old_locus_tag="ADR152C"
                     /product="ADR152Cp"
                     /transcript_id="NM_209601.1"
                     /db_xref="GeneID:4620410"
     CDS             complement(973306..974304)
                     /locus_tag="AGOS_ADR152C"
                     /old_locus_tag="ADR152C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL085W (MDH1)"
                     /codon_start=1
                     /product="ADR152Cp"
                     /protein_id="NP_984248.1"
                     /db_xref="GeneID:4620410"
                     /translation="MFCRVARRGFRADGVRAYRVSVLGANGGIGQPLSLLLKLNKRVT
                     DLRLYDLKGAKGVAADLSHIPTNSQVSGYTAENPEALREALTGADVVVVPAGVPRKPG
                     MTRDDLFAINAGVVQQLAGAIGQHAPGAAVLVISNPVNSTVPIMAAELRKLGVYDPRK
                     LFGVTTLDSIRASRFISEVQGTDPTRERVPVIGGHSGITIIPVLSQTQHTGIDKATRD
                     ALIHRIQFGGDEVVKAKNGAGSATLSMARAGAKFADAVLAGLAGEQGVVEPAFVDSPL
                     YKSEGIEFFASAVTLGPRGVEEVHPVGTLSAEEEEMLAKCKETLKQNIEKGINFAK"
     gene            complement(<974465..>974845)
                     /locus_tag="AGOS_ADR152CA"
                     /old_locus_tag="ADR152C-A"
                     /db_xref="GeneID:4620411"
     mRNA            complement(<974465..>974845)
                     /locus_tag="AGOS_ADR152CA"
                     /old_locus_tag="ADR152C-A"
                     /product="ADR152C-Ap"
                     /transcript_id="NM_209602.1"
                     /db_xref="GeneID:4620411"
     CDS             complement(974465..974845)
                     /locus_tag="AGOS_ADR152CA"
                     /old_locus_tag="ADR152C-A"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL086W (SRX1)"
                     /codon_start=1
                     /product="ADR152C-Ap"
                     /protein_id="NP_984249.1"
                     /db_xref="GeneID:4620411"
                     /translation="MSLQSSRLPITLVPLSQIRRPVAPVLDPQKIDAMVSTARGVPAA
                     SATCSLEDAAAMDGQLPPVDVMHVRHDSADYYFAFGGCHRLQAYDRMAQEGQEDVLVR
                     CKLLPATRAQMRTYVGASVDNLFN"
     gene            complement(<974946..>976298)
                     /locus_tag="AGOS_ADR153C"
                     /old_locus_tag="ADR153C"
                     /db_xref="GeneID:4620412"
     mRNA            complement(<974946..>976298)
                     /locus_tag="AGOS_ADR153C"
                     /old_locus_tag="ADR153C"
                     /product="ADR153Cp"
                     /transcript_id="NM_209603.1"
                     /db_xref="GeneID:4620412"
     CDS             complement(974946..976298)
                     /locus_tag="AGOS_ADR153C"
                     /old_locus_tag="ADR153C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR005C (GPA1)"
                     /codon_start=1
                     /product="ADR153Cp"
                     /protein_id="NP_984250.1"
                     /db_xref="GeneID:4620412"
                     /translation="MGCSVSTQTLEDENDPFIQDRRANDAIEQNLHQEKQRGKNEVKL
                     LLLGAGESGKSTVLKQLKLLHHGGFTHEERLQYSQVIWADAIQSMKILIIQARKMGIS
                     LDCDDPEKNRPLFECKRAVLQAKALDCIDPDMAGGPEFLNDYVLKYSERSENKRRVQS
                     TGKAEAFTPESGAPSSGIDMQELSLGLNEQSGHMGPSGLFVRAQPAAQPLPKRTSNVQ
                     VAAAIRKLWDNDRGIRQCFARSNEFQLEDSAAYYFDNIEKFARPDYVCTDEDILRGRI
                     KTTGITETRFNIGASKFNVLDAGGQRSERRKWIHCFQSITAVLFVLAVSEYDQMLFED
                     ERVNRMQEAIMLFDTLLNSKWFYNTPFILFLNKVDLFEDKVKRSPIRQHFPDYPGRVG
                     DAETGLKYFERIFLSLNRSKKPIYVHRTCATDTQSMKFVLSAVTDLIVQQNLKKSGIL
                     "
     gene            <976853..>977611
                     /locus_tag="AGOS_ADR154W"
                     /old_locus_tag="ADR154W"
                     /db_xref="GeneID:4620413"
     mRNA            <976853..>977611
                     /locus_tag="AGOS_ADR154W"
                     /old_locus_tag="ADR154W"
                     /product="ADR154Wp"
                     /transcript_id="NM_209604.2"
                     /db_xref="GeneID:4620413"
     CDS             976853..977611
                     /locus_tag="AGOS_ADR154W"
                     /old_locus_tag="ADR154W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL087C (CYT2)"
                     /codon_start=1
                     /product="ADR154Wp"
                     /protein_id="NP_984251.2"
                     /db_xref="GeneID:4620413"
                     /translation="MSGDDQPRCPVDHSAREAWMSSMSKGNPAGAEQPGAPSQSQATE
                     AQPTPSACPVDHSARSIWLKNAGQVTEDVECSSDKQADIPHYSTDVALPTEREQSSIP
                     RTGTEHNWVYPSQKQFFEAMLRKNWNPHAEDMKTVIPLHNSVNERVWNYIKMWEKDQG
                     GESCGGIKLTSFKGSAKELTPRAWFRSTVLGYTRPFDRHDWRVDRCGTEIDYVIDFYS
                     DDHPKLGPQILLDVRPKLNSFEGLKLRVLKALGL"
     gene            complement(<977760..>978029)
                     /locus_tag="AGOS_ADR155C"
                     /old_locus_tag="ADR155C"
                     /db_xref="GeneID:4620414"
     mRNA            complement(<977760..>978029)
                     /locus_tag="AGOS_ADR155C"
                     /old_locus_tag="ADR155C"
                     /product="ADR155Cp"
                     /transcript_id="NM_209605.1"
                     /db_xref="GeneID:4620414"
     CDS             complement(977760..978029)
                     /locus_tag="AGOS_ADR155C"
                     /old_locus_tag="ADR155C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR005C-A (TIM10)"
                     /codon_start=1
                     /product="ADR155Cp"
                     /protein_id="NP_984252.1"
                     /db_xref="GeneID:4620414"
                     /translation="MFGLGGQPQLSSQQKIAAAEAELDLVTDMFNKLVSNCHRKCIDM
                     NYNEGDLNKNESNCLDRCVAKYFETNVKVGENMQQLGQNFSPGKF"
     gene            complement(<978617..>980209)
                     /locus_tag="AGOS_ADR156C"
                     /old_locus_tag="ADR156C"
                     /db_xref="GeneID:4620415"
     mRNA            complement(<978617..>980209)
                     /locus_tag="AGOS_ADR156C"
                     /old_locus_tag="ADR156C"
                     /product="ADR156Cp"
                     /transcript_id="NM_209606.1"
                     /db_xref="GeneID:4620415"
     CDS             complement(978617..980209)
                     /locus_tag="AGOS_ADR156C"
                     /old_locus_tag="ADR156C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL088W (CAB3)"
                     /codon_start=1
                     /product="ADR156Cp"
                     /protein_id="NP_984253.1"
                     /db_xref="GeneID:4620415"
                     /translation="MGESSTAEATKGGGGGVGGSGSRTGDQPISILNNRSNSVKRATH
                     KHGGGGPQVAVAGGMGVGGTTAAVDARAAVGRATAVSERSLRGSPVRDGGSVGSAAAR
                     AFAEPVSAELLEQRIRLVTNGLDLSPDSSLVGSVSSLNSPLSVSKASAGVAAVSFTVP
                     GGTEKISHRGSISTRPGAKGEADSDTSTNSSRQNSLVHMPGDFIYFDSSFHIPLTPVS
                     PHQTSSTSSLGRKYSQHHSNKAVIGEETGPQVPFTKFFQKQDDEKIHILIGATGSVAT
                     LKVPLIIDKLFKIYTSDKVSIQLIVTQRAEHFLKGLKISKDVKLWRDEDEWFGFKRLG
                     DPVLHVELRKWADIFLVAPLSANTLAKVANGICDNLLTSVLRVWNPSTPVLVAPAMNT
                     FMYTHPVTKKHLLMLQEDAPYVQILKPVEKVLVCGDIGMGGMREWIEIVEILVKSISK
                     IRGAAAVGLQENEEEEETAGNYDDDDDDDERHPGDAETDETDDSAVSDEEDDEGDDAT
                     GSVQAHRAGAESKPPSGISPSV"
     gene            <981221..>982495
                     /locus_tag="AGOS_ADR157W"
                     /old_locus_tag="ADR157W"
                     /db_xref="GeneID:4620416"
     mRNA            <981221..>982495
                     /locus_tag="AGOS_ADR157W"
                     /old_locus_tag="ADR157W"
                     /product="ADR157Wp"
                     /transcript_id="NM_209607.2"
                     /db_xref="GeneID:4620416"
     CDS             981221..982495
                     /locus_tag="AGOS_ADR157W"
                     /old_locus_tag="ADR157W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL011C (CCE1)"
                     /codon_start=1
                     /product="ADR157Wp"
                     /protein_id="NP_984254.2"
                     /db_xref="GeneID:4620416"
                     /translation="MVLWAAPESKVAAMLSSSEAAVSASFQLATHGGDSEGWGSASST
                     DKYKSSTGICLVGWCFVSTVTLALGWSAKTGATSVRVRRGKLRAWQQQRMGAGVLERC
                     WERADARTLRAAALMLGAAYGSKKADARAQLAMQVARLRRLRDVRLRRGRVALLAVDP
                     GLVNFAYAQLYVGTGAPVVVAWDKLDLRISAASAAEAPEAMGEMVRGVVGRLLAHEPD
                     FVAIERQRARNPGSSAVAGAVLRTNLLEHGLHAVLPPLAALRGMPEPLVAASLPRRMA
                     DFWCGSGAERAADSKRLRILLARALLREAAVAASPGMLALGPALAAARDADVGSSRAF
                     SIHRALGLPAAPVRDLPVAPAKDDDLADALLHALAWATWLEVYEQLEAFAAARGSASG
                     DALVGYLHELVAGHYARTASLLRGSPQPATAA"
     gene            <982699..>983202
                     /locus_tag="AGOS_ADR158W"
                     /old_locus_tag="ADR158W"
                     /db_xref="GeneID:4620417"
     mRNA            <982699..>983202
                     /locus_tag="AGOS_ADR158W"
                     /old_locus_tag="ADR158W"
                     /product="ADR158Wp"
                     /transcript_id="NM_209608.1"
                     /db_xref="GeneID:4620417"
     CDS             982699..983202
                     /locus_tag="AGOS_ADR158W"
                     /old_locus_tag="ADR158W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIR022W (SEC11)"
                     /codon_start=1
                     /product="ADR158Wp"
                     /protein_id="NP_984255.1"
                     /db_xref="GeneID:4620417"
                     /translation="MNIRQQLTKFLGLFLTLASAFMFWKGLSVVTNSHSPIVVVLSGS
                     MEPAFQRGDILFLWNRERFNKVGDVIVYEVDAKSIPIVHRVVREHRDKNGRQLLLTKG
                     DNNAADDIALYGRKQSYLRRDKDIVGTVKGYLPKLGYVTILVSENQYAKFALMGMLAL
                     SSLLGSE"
     gene            complement(<983233..>984942)
                     /locus_tag="AGOS_ADR159C"
                     /old_locus_tag="ADR159C"
                     /db_xref="GeneID:4620418"
     mRNA            complement(<983233..>984942)
                     /locus_tag="AGOS_ADR159C"
                     /old_locus_tag="ADR159C"
                     /product="ADR159Cp"
                     /transcript_id="NM_209609.1"
                     /db_xref="GeneID:4620418"
     CDS             complement(983233..984942)
                     /locus_tag="AGOS_ADR159C"
                     /old_locus_tag="ADR159C"
                     /note=