GenomeNet

Database: RefSeq
Entry: NC_005786
LinkDB: NC_005786
Original site: NC_005786 
LOCUS       NC_005786            1519140 bp    DNA     linear   CON 14-SEP-2017
DEFINITION  Eremothecium gossypii ATCC 10895 chromosome V, complete sequence.
ACCESSION   NC_005786
VERSION     NC_005786.2
DBLINK      BioProject: PRJNA10623
            BioSample: SAMN03081415
            Assembly: GCF_000091025.4
KEYWORDS    RefSeq.
SOURCE      Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895)
  ORGANISM  Eremothecium gossypii ATCC 10895
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Eremothecium.
REFERENCE   1  (bases 1 to 1519140)
  AUTHORS   Dietrich,F.S., Voegeli,S., Brachat,S., Lerch,A., Gates,K.,
            Steiner,S., Mohr,C., Pohlmann,R., Luedi,P., Choi,S., Wing,R.A.,
            Flavier,A., Gaffney,T.D. and Philippsen,P.
  TITLE     The Ashbya gossypii genome as a tool for mapping the ancient
            Saccharomyces cerevisiae genome
  JOURNAL   Science 304 (5668), 304-307 (2004)
   PUBMED   15001715
REFERENCE   2  (bases 1 to 1519140)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1519140)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2012) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1519140)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 1519140)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2007) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   6  (bases 1 to 1519140)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2002) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE016818.
            On Aug 5, 2010 this sequence version replaced NC_005786.1.
            This genome has been completely resequenced to high accuracy (derf)
            and reannotated. Gene names have been  maintained, though some
            genes have been added, and many protein sequences have been
            corrected.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1519140
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /culture_collection="ATCC:10895"
                     /db_xref="taxon:284811"
                     /chromosome="V"
     source          48859..92111
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1539"
     source          62602..126444
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1581"
     source          102567..180841
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1047"
     source          168565..223717
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1442"
     source          209885..269862
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1767"
     source          233180..294714
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1771"
     source          294653..343542
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1653"
     source          296827..378526
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1722"
     source          371608..436193
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1441"
     source          374022..441571
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1662"
     source          479895..545835
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1262"
     source          506880..571542
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1720"
     source          668747..720871
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1242"
     source          680470..747540
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1318"
     source          722038..794830
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1543"
     source          758101..818503
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1180"
     source          828715..898210
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1702"
     source          880616..928951
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1578"
     source          916851..984111
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1134"
     source          966873..1018621
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1350"
     source          1018507..1051617
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1186"
     source          1020719..1073725
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1073"
     source          1055917..1102834
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1424"
     source          1073651..1126289
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1537"
     source          1094137..1152805
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1250"
     source          1165404..1236932
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1515"
     source          1220381..1274323
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1624"
     source          1238302..1307320
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1078"
     source          1312695..1355042
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1191"
     source          1358114..1431418
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1362"
     source          1408764..1474572
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1577"
     source          1448685..1516268
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1474"
     telomere        complement(1..508)
                     /note="Chromosome V left end terminal telomere repeat.
                     Composed of approximately 20 copies of a 24 base repeat
                     unit, and occasionally sequence varients of this repeat."
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_type=terminal
                     /rpt_unit_range=1..24
                     /rpt_unit_seq="ggtgtggtgtatgggtctctcagc"
     telomere        complement(509..1860)
                     /note="Chromosome V left subtelomeric sequence. Shares
                     some sequence similarity with other subtelomeric regions."
     gene            <1960..>3897
                     /locus_tag="AGOS_AEL345W"
                     /old_locus_tag="AEL345W"
                     /db_xref="GeneID:4620689"
     mRNA            <1960..>3897
                     /locus_tag="AGOS_AEL345W"
                     /old_locus_tag="AEL345W"
                     /product="AEL345Wp"
                     /transcript_id="NM_209868.1"
                     /db_xref="GeneID:4620689"
     CDS             1960..3897
                     /locus_tag="AGOS_AEL345W"
                     /old_locus_tag="AEL345W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIL014W (MNT3)"
                     /codon_start=1
                     /product="AEL345Wp"
                     /protein_id="NP_984515.1"
                     /db_xref="GeneID:4620689"
                     /translation="MAFFRGRLRPILGLITLAIVVSTCFLGLSLLTEEFNQGIVSSIH
                     QWSPPSWLVKPSNGAKSVNEAKPQSEDKPSSESKPQSEDNSSSEDKPDDAKSSLLDLL
                     TQEGPDVVALWDLQERCKRYFELTYRKEPAWSNQVPFLSRDIISDASYSAKLMERWRI
                     FADCFIEGNEPLSTTLDGRVDIFDFQQRMYPFLTKVRRWEEIWPMITDLNTGEQYQPG
                     HLKDGQRLTIDDNLSFWKNWQLFSKGRGITITAGAEHVEMLPRLLNVLDHIGNTLPIE
                     LINAADLPPTTIDKIAKYVQMKSNQTVRLVDCGKTLEHSYRSLITGFRHKWLAYIFNT
                     FEEAVFIDLDAVPFVDLEKLFEVEGYKSEGILMFRDRSYDGEKPDDCPKAMRIMMPSP
                     KEHTMWQHGSNYDKQVAEDELTKKPRDAGAATFYIKYMEGKSFHMAESGLIVMHKNKK
                     LPSLLISLMLHMTFETHLCSHGDKEYLWLGQLVSGENYYVDPRPPAIIGVPQLVSNHG
                     QVDEYKICSAQIAHMDDDGSILWVNGGLKNCKFDAVERDFEDYTEYFSKKYINKENLQ
                     KFYDLEVDMQMAFIPDFVDSDWVKAPECRAFTWCSTIKADSMEGAEYQSYIIKKGDPR
                     LREYNKIAEIWSKAPYLSSIA"
     gene            <5877..>7499
                     /locus_tag="AGOS_AEL344W"
                     /old_locus_tag="AEL344W"
                     /db_xref="GeneID:4620686"
     mRNA            <5877..>7499
                     /locus_tag="AGOS_AEL344W"
                     /old_locus_tag="AEL344W"
                     /product="AEL344Wp"
                     /transcript_id="NM_209869.2"
                     /db_xref="GeneID:4620686"
     CDS             5877..7499
                     /locus_tag="AGOS_AEL344W"
                     /old_locus_tag="AEL344W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL013W (DEP1)"
                     /codon_start=1
                     /product="AEL344Wp"
                     /protein_id="NP_984516.2"
                     /db_xref="GeneID:4620686"
                     /translation="MAVDSQGPTDEVDNTEGVTGFDAVRPNSNSDGKAQDLELSSRLT
                     EANLALVDGRVRLKGRAVDITERHGFLGEDDKSSVLSKVTSQEGDLELSELYISSDAE
                     TEKMENNTEESDVPNLSSLVEQMPPQQGSRTYIKDANSGADDAVRDLQDVDASLPNKG
                     KKRQLEEEGGYTGEETKVNSADGEDPQGDEQKFKKPRLPISSAAGQLPSLSGSEQHMA
                     TDIMETGLDPAQPEDENSEDNEVEEDDEEEDEDEEEDEEEEEEDIEGNANTKDTSIFK
                     EKKKVPAGDDEEEEEDDEEEEEEEEEEPSLIEREKLRQDALKDIIEIEYEFAELRQRL
                     YENEMAKLQTELQMCLEGSHPALQTYYQKIDSIRDFKLKRAYQRQKYELECIDKETRA
                     VRTFIHQNFYRQVSDLKHKLLNQTTQKWYDMNKERRDMDMLVSEIGYHVPVKIANKSL
                     SCITGYAAPAQLKGDGDPLPEDLECEGINFRFRNNPVDKLEVIVDRMRFNNQLSDFEG
                     LKKFFGGFPGAPSLNGLKDSEIYEDMQSLREQ"
     gene            complement(<7769..>8197)
                     /locus_tag="AGOS_AEL343C"
                     /old_locus_tag="AEL343C"
                     /db_xref="GeneID:4620687"
     mRNA            complement(<7769..>8197)
                     /locus_tag="AGOS_AEL343C"
                     /old_locus_tag="AEL343C"
                     /product="40S ribosomal protein S15"
                     /transcript_id="NM_209870.1"
                     /db_xref="GeneID:4620687"
     CDS             complement(7769..8197)
                     /locus_tag="AGOS_AEL343C"
                     /old_locus_tag="AEL343C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL040C (RPS15)"
                     /codon_start=1
                     /product="40S ribosomal protein S15"
                     /protein_id="NP_984517.1"
                     /db_xref="GeneID:4620687"
                     /translation="MSEAATPRKRTFKTYSYKGVDLEKMLEMPTEEFVKLAPARVRRR
                     FARGLSSKPAGLMKKLRAAKLATAENEKPAVVRTHLRNMIIVPEMIGSVVGVYNGKVF
                     NQVEIKPEMVGHYLGEFSITYTPVRHGRAGATTSRFIPLR"
     gene            <8703..>9020
                     /locus_tag="AGOS_AEL342W"
                     /old_locus_tag="AEL342W"
                     /db_xref="GeneID:4620685"
     mRNA            <8703..>9020
                     /locus_tag="AGOS_AEL342W"
                     /old_locus_tag="AEL342W"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="NM_209871.1"
                     /db_xref="GeneID:4620685"
     CDS             8703..9020
                     /locus_tag="AGOS_AEL342W"
                     /old_locus_tag="AEL342W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL039W (RPP2A)"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="NP_984518.1"
                     /db_xref="GeneID:4620685"
                     /translation="MKYLAAYLLLNAAGAAPSADKVKAVLESVGIEVEDDKVQAVISA
                     LENKSVEELIAEGTEKLSSVPTGGAGAAPAGGAAGAEEAAEEAVEEAAEESDDDMGFG
                     LFD"
     gene            <9427..>10608
                     /locus_tag="AGOS_AEL341W"
                     /old_locus_tag="AEL341W"
                     /db_xref="GeneID:4620688"
     mRNA            <9427..>10608
                     /locus_tag="AGOS_AEL341W"
                     /old_locus_tag="AEL341W"
                     /product="AEL341Wp"
                     /transcript_id="NM_209872.1"
                     /db_xref="GeneID:4620688"
     CDS             9427..10608
                     /locus_tag="AGOS_AEL341W"
                     /old_locus_tag="AEL341W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL012W (CYS3)"
                     /codon_start=1
                     /product="AEL341Wp"
                     /protein_id="NP_984519.1"
                     /db_xref="GeneID:4620688"
                     /translation="MGVLPTDKFATKAIHAGAHTDLHGSVIEPISLSTTFKQSSPGNP
                     VGAYEYSRGQNPNRQNLEEAIAALESAKYGLAFSSGSATTAVIVQSLPQGSHAISIGD
                     VYGGTHRYFTKVANAHGVETSFTNSLLEDLPKLVRDNTRLVWIESPTNPTLQVTDIQQ
                     VADTVKALNEDIILVVDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGALATN
                     STSLYERLAFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAAQSAQKIAEYLEQSEHV
                     VSVNYPGLPSHRGYQIAQKQHRDGLGGGMISFRVKGGAQGAALLSQSTRLFTLAESLG
                     GIESLLEVPAVMTHAGIPKEAREASGVYDDLVRVSVGIEDTDDLLEDIKQALSVVAES
                     I"
     gene            <10760..>11911
                     /locus_tag="AGOS_AEL340W"
                     /old_locus_tag="AEL340W"
                     /db_xref="GeneID:4620690"
     mRNA            <10760..>11911
                     /locus_tag="AGOS_AEL340W"
                     /old_locus_tag="AEL340W"
                     /product="AEL340Wp"
                     /transcript_id="NM_209873.1"
                     /db_xref="GeneID:4620690"
     CDS             10760..11911
                     /locus_tag="AGOS_AEL340W"
                     /old_locus_tag="AEL340W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL031C (SIL1)"
                     /codon_start=1
                     /product="AEL340Wp"
                     /protein_id="NP_984520.1"
                     /db_xref="GeneID:4620690"
                     /translation="MYWKKLLFAIASAAALAAVDPETEGSELQTICSGGECYPRLFKA
                     LQDWSTIKEGQQIPPGLDIRVDLSTGKKQARLPIPNEASNMENGIQVVDDSSDYEFTK
                     EFQLVRAQVASGAPDYNVVIKQLDDLVEYASDYTLGYKIITHEFTLLQELIFGQDVPI
                     SVKELSSRIIVACLRNNTPCLDFVNTRFPDFVRHLLQEAVDYGRQATDAVEARTQIKR
                     YLSIVEPLLINEPQPINEEALKQLYEVNDQTVQLKVLLIMARLYKGRSHNDDISKRSL
                     ESTDVQRWTTELSKAIQSKHLDDFHVRELFHGLYALKKEHGRAVKTYPTFLGWLAEET
                     EARKQRMTQDKQPRDLEQMEFDRLLIESRHMVFGNPMAHRIKNMEYDEL"
     gene            complement(<11942..>12643)
                     /locus_tag="AGOS_AEL339C"
                     /old_locus_tag="AEL339C"
                     /db_xref="GeneID:4620691"
     mRNA            complement(<11942..>12643)
                     /locus_tag="AGOS_AEL339C"
                     /old_locus_tag="AEL339C"
                     /product="AEL339Cp"
                     /transcript_id="NM_209874.1"
                     /db_xref="GeneID:4620691"
     CDS             complement(11942..12643)
                     /locus_tag="AGOS_AEL339C"
                     /old_locus_tag="AEL339C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL032W (OPI10)"
                     /codon_start=1
                     /product="AEL339Cp"
                     /protein_id="NP_984521.1"
                     /db_xref="GeneID:4620691"
                     /translation="MFAAIASGNPLQLSAEVPNSNGLQHTIILSETKPKSYSHITLFI
                     LPTVALPPEYSAIVYFKLSPQEDFQLFGELKASKPSAIFKVKLPTTAGAQGSDVSNGL
                     GEIDMEDGDSVAGTAHNISELIIGISIEPQEQAAFKLEEAKQAHKSTAQSGALVVSRN
                     QGGNIATPGQLSRAYPLLTQQLASKIVQHAYNFLSGFLDERNSVPIKKFEAWWEKFQK
                     RLQNDATFIDEVTSE"
     gene            complement(<12869..>14470)
                     /locus_tag="AGOS_AEL338C"
                     /old_locus_tag="AEL338C"
                     /db_xref="GeneID:4620692"
     mRNA            complement(<12869..>14470)
                     /locus_tag="AGOS_AEL338C"
                     /old_locus_tag="AEL338C"
                     /product="AEL338Cp"
                     /transcript_id="NM_209875.1"
                     /db_xref="GeneID:4620692"
     CDS             complement(12869..14470)
                     /locus_tag="AGOS_AEL338C"
                     /old_locus_tag="AEL338C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL033W (MSE1)"
                     /codon_start=1
                     /product="AEL338Cp"
                     /protein_id="NP_984522.1"
                     /db_xref="GeneID:4620692"
                     /translation="MVCTFAVRRYTASILRPRIGLLSGKQIAISRKPTRDVHPKTPAR
                     TRFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQ
                     WLGIQFDEGPGVNEVYGPYRQSDRSAIYKAHADKLLASGHAYRCFCSKERLENLRTSA
                     MALQPPTNVSYDRECANLSQEHIDHKLDQNVPFTLRFKSPAVYEPFEDLLHGRVDLQP
                     QTNPNDIRYDDPVLMKSDGLPTYHFANVVDDHLMKITHVIRGEEWLPSTPKHISLYRA
                     FGWTPPKFVHIPLLTTAADKKLSKRKGDASVMALKAKGVLPEALLNFSVLFGWAPPRE
                     LATANHECFTLGEFERLFNLNNLTKGNAKVDEKKLWFFNKHYLSARLKDEHQVSIEAR
                     NLTQILSKKYPGLDETKTKQLLKAVGGHLTVIDELESQFHYLLSKPVYENEFSDRFIK
                     ACEPSQVARVLSSIASLLDNSNLNDLVAEVSTRENVPKKAVFEAMRFALSGSVPGLKL
                     PVLISTLGLEETKARLNEAAQYLVT"
     gene            complement(<14612..>17905)
                     /locus_tag="AGOS_AEL337C"
                     /old_locus_tag="AEL337C"
                     /db_xref="GeneID:4620693"
     mRNA            complement(<14612..>17905)
                     /locus_tag="AGOS_AEL337C"
                     /old_locus_tag="AEL337C"
                     /product="AEL337Cp"
                     /transcript_id="NM_209876.2"
                     /db_xref="GeneID:4620693"
     CDS             complement(14612..17905)
                     /locus_tag="AGOS_AEL337C"
                     /old_locus_tag="AEL337C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL034W (SMC5)"
                     /codon_start=1
                     /product="AEL337Cp"
                     /protein_id="NP_984523.2"
                     /db_xref="GeneID:4620693"
                     /translation="MASTVDLGRSLRQRDDDQDGDLASLAGHKRLRRNTVQYAHFQEG
                     AIVSIRLTNFVTYSLAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKR
                     VEDFIKNGTAESTIEIQLRNSRNVSGLPMISAEDEAINVRTVLMKARRKCAYYINGEP
                     VSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLLEQTVRSVDASLLGLLEQ
                     LKTSQQEELSLNREVELGQKKLEKLMTHKESLENQVRALEEYERKKEEIDIHKRLLPY
                     VRVKNHKRQLKDLKSEYERVKQELKEFLKDKKPFKIASNALLSEVENSQRQKQGKESE
                     YIQVKSTQRSLIEELGKQRTEVEDLKKKVTYYRTRRENIRRKVEKAEQDIASRQQLLG
                     SLVLPTQEEMDNYEQQRVDLYEQESAFEQKVEEMDSKVRALNRELTTIKSKLERRKKE
                     LASNDSLNALRGQTGRLEEVKKACEFVRIHPEMKGKVLEPPIVAIKAPNERIASYLTT
                     CIDWHTSISLTMVDSASYREFNDTILKNFQVNLRELANTETSYPYPLEYIRQLGFDCY
                     LSDFVTGDPAVLQMLKEQQRIHTIPVSTRNLDTRIIDDLRTPDKQGRLKFRRVIAGDY
                     VYDFKRSRYGNKQIFSTDVQVKKAQFYIEGGMSDGMKQNIERELHELRERYRNIQKEV
                     ESTAQQKKQFHIPLAEVQRKLQDLQKAIHEQNHKRIIQSRTMSEIQNIEQKLEEFRRD
                     MNKDVSEAISNCEAQIQSNLISQGEQLRLIVMNLSRLQEAQESVVRMGIKHIELRNRE
                     RSLNEVIGFFNAKEEELRGKYDEAKKAYAEVKDTAEFQAWMKEIRSYTDTERDELSVW
                     ANKYEEQNTFTLENILETIAKLETEIQMINHDESSVTILRQTVTDIKGLQAKLPTQME
                     RLGLLRRGMLDMRNNLEPRLDELVENISQRFRKLFSNVGSAGEICLLKPDLYSEWKIE
                     IRVKFRDVAELKKLDSHTQSGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRNE
                     RIVHKAMVENACAENTSQYFLITPKLLTNLHYHERMRIHCVFAGSWIPDPAEREEMVH
                     YGELTSYKL"
     gene            <18240..>20306
                     /locus_tag="AGOS_AEL336W"
                     /old_locus_tag="AEL336W"
                     /db_xref="GeneID:4620694"
     mRNA            <18240..>20306
                     /locus_tag="AGOS_AEL336W"
                     /old_locus_tag="AEL336W"
                     /product="AEL336Wp"
                     /transcript_id="NM_209877.2"
                     /db_xref="GeneID:4620694"
     CDS             18240..20306
                     /locus_tag="AGOS_AEL336W"
                     /old_locus_tag="AEL336W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL011W (SWC3)"
                     /codon_start=1
                     /product="AEL336Wp"
                     /protein_id="NP_984524.2"
                     /db_xref="GeneID:4620694"
                     /translation="MARLRSRTATTEKDATESSKVPVPRRRRGQHEDTEEPDTYGLED
                     DEKSSGRPFRILEKLPCSAEPPRYDVLTHALSVRDSAVLYNSLLASRRTWIKAEMFEL
                     YWSKQYMNMKERERMLKEGIDPDDIDQSAAREKMHKLCDGILTGGPHTLPVRLFILKN
                     DEIEQKWQFMQESRKKEKEVRRKREAEEKERRREERKRLQQLKKERKLKEVEHTKKEK
                     IERKRENDTERDQLRKGRKDNKGPSVLSRMGTTIKSKGLTTFSKAQQQEIDNQKMIAN
                     LNLLAQRDPALNKLMIAVANGQAPPADVERFKVFIERARNMEPPPNWKPRLSSRPVIK
                     RTEEPTVEQQESASQTPSTPLPRKASPESSQVDNLSSPPHGSDPNSSFTEASMSDSRG
                     ELSETKSGGSLVPDSTGSSGQALDKGPTDASGSANDLSRPGATLSSTDGAPPLKQETI
                     PVRDMGDKNADKPLEAHGAISEKGTTITIKAEEGTAPRQKRKYTKRKKEVEDEDKSMQ
                     LTTFQQKYLNGADILFEYLENSNMRFLFPKDAILEQLENEESYLMSWIVVHNKKEIEQ
                     FKLKVLKGLNKNKPNEEETEVQPCLFNVYEHPNCPEVLYTPMTVTLSNIPKKFTPIIL
                     NSVNPAESVRAYMSTILARGRRLNGFNLWYQLDAYDDKDLAESLRCELKEYEQGFKSK
                     RQKKQL"
     gene            complement(<20342..>21739)
                     /locus_tag="AGOS_AEL335C"
                     /old_locus_tag="AEL335C"
                     /db_xref="GeneID:4620695"
     mRNA            complement(<20342..>21739)
                     /locus_tag="AGOS_AEL335C"
                     /old_locus_tag="AEL335C"
                     /product="AEL335Cp"
                     /transcript_id="NM_209878.2"
                     /db_xref="GeneID:4620695"
     CDS             complement(20342..21739)
                     /locus_tag="AGOS_AEL335C"
                     /old_locus_tag="AEL335C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL010C (MDM10)"
                     /codon_start=1
                     /product="AEL335Cp"
                     /protein_id="NP_984525.2"
                     /db_xref="GeneID:4620695"
                     /translation="MIEYMEYVLRQFERTTSWDRDYSYENITATSDNLLQFEIPDSLN
                     LQISNQSTPNTFNTFELSNRSIINGSLSYLYTDCGQLDKIVQNSLKVPLQQRVDTYQC
                     LRPGRTLGTSFRSQMLLYGRMYWPGSILEAMYCKRLTPQSQLVLKSLLSAAGESSILT
                     LYWQRNAPWGSQDIVFSTNELLLGYRFLHNLSPGRSHEGSPHGQSTLSLGAEFWLGIS
                     NLLPGCSTALRYCTHATNTGKPITLTLSLNPLFGHISSSYSVKFSPGTTFCSKYDFNV
                     YSIESNLSFGCEFWKSSAAAHKQATNEEETSIEVATETPVSDPRYCGAVPGARSFDQI
                     RPFAELPSDNQLYHQLMMPNSSNALIDNVNLPFPSPLLRYPPEKSVTDKFAAMIDATQ
                     FTSVLKMSSSLRDKNLRLLWEGKYKGFLVSAGAELTTIPLEAPKTINEITAQQVPRPL
                     WLRPAKFGIQIQYST"
     gene            <21873..>22847
                     /locus_tag="AGOS_AEL334W"
                     /old_locus_tag="AEL334W"
                     /db_xref="GeneID:4620696"
     mRNA            <21873..>22847
                     /locus_tag="AGOS_AEL334W"
                     /old_locus_tag="AEL334W"
                     /product="AEL334Wp"
                     /transcript_id="NM_209879.1"
                     /db_xref="GeneID:4620696"
     CDS             21873..22847
                     /locus_tag="AGOS_AEL334W"
                     /old_locus_tag="AEL334W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL009W (SPO7)"
                     /codon_start=1
                     /product="AEL334Wp"
                     /protein_id="NP_984526.1"
                     /db_xref="GeneID:4620696"
                     /translation="MILPSSRAAVLQTSGSSLPSGDSSPSRGHYRSTSETFKALLDRR
                     LWQDYGCDSTDMSESIWRDDDGAEAEAHLRRVRRTNRAGASVMRRRRSSSKTSSKNLK
                     STTDISPASKIFRNLLILEDDLRRQAKEQELLKWQFTLFLSTLMGVAGFAFYELYFSQ
                     DTVQGLYRVMLQFLFVFIMITVVLFHLSGEYRRTIVIPRKFFTNTNKGIRQFNIKLVK
                     VKSSFGDRATDSARLAARRVAGAQLWLLHLLVPAAHLPRLALYHFWRGVAVRSQARIG
                     AVDVKLVLYPRAFSAEIREGWEIYRDEFWAREGARRRRLVNQLSPKAD"
     gene            complement(22986..23002)
                     /locus_tag="AGOS_AgSNR50"
                     /db_xref="GeneID:9487574"
     ncRNA           complement(22986..23002)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR50"
                     /product="AgSNR50"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR50; start and end coordinates are
                     approximate; similarity is partial. In synteny."
                     /transcript_id="NR_149395.1"
                     /db_xref="GeneID:9487574"
     gene            <23514..>25474
                     /locus_tag="AGOS_AEL333W"
                     /old_locus_tag="AEL333W"
                     /db_xref="GeneID:4620697"
     mRNA            join(<23514..23537,23606..>25474)
                     /locus_tag="AGOS_AEL333W"
                     /old_locus_tag="AEL333W"
                     /product="AEL333Wp"
                     /transcript_id="NM_209880.2"
                     /db_xref="GeneID:4620697"
     CDS             join(23514..23537,23606..25474)
                     /locus_tag="AGOS_AEL333W"
                     /old_locus_tag="AEL333W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR014W (RTS1); 1-intron"
                     /codon_start=1
                     /product="AEL333Wp"
                     /protein_id="NP_984527.2"
                     /db_xref="GeneID:4620697"
                     /translation="MMRGFKQKLIKKTTGSSSSTQKKKDKETGKKPGSANGAAGAVGG
                     SGGRATVDKKEQKGSGAKQPKAKDAGKSGAGAAPKVKVAAKKEERSYPTMIAAAVSPG
                     STSGPPSPKEAEAASPNGIDIPRSSHSFERLPTPTKLNPDTDLELIKTPQRHSSSRFE
                     PSRYTQISKLPGFDDVPPEEQISLFIAKVDQCNIMFDFSDPSFDIHGKEIKRITLQEL
                     IEFIVTNRFTYTEEMYGHVVNMFKVNLFRPIPPPVNPIGDVYDPDEDEPVNELAWPHM
                     QCVYEFFLRFVESPDFNHQIAKQFIDQEFILKLLELFDSEDIRERDCLKTTLHRIYGK
                     FLSLRSFIRRSINNIFLQFVYETERFNGIAELLEILGSIINGFALPLKEEHKVFLVRI
                     LIPLHKVRCLSLYHPQLAYCIVQFLEKEPMLTEEVIMGLLRYWPKVNSTKEIMFLNEI
                     EDIFEVIEPLEFIKVEVPLFVQLAKCISSPHFQVAEKVLSYWNNEYFLNLCIENAEVI
                     LPIIFPALYELTSQLDLDSQTDEEGNPNQDPYMLVEQAINSGSWNRAIHAMAFKALKI
                     FLETNPVLYENCNSLYLSSLKESQKRREKREENWNKLQEYVRNLHISSVDNPVAVDRI
                     GTGDLH"
     gene            <25995..>26612
                     /locus_tag="AGOS_AEL332W"
                     /old_locus_tag="AEL332W"
                     /db_xref="GeneID:4620698"
     mRNA            <25995..>26612
                     /locus_tag="AGOS_AEL332W"
                     /old_locus_tag="AEL332W"
                     /product="AEL332Wp"
                     /transcript_id="NM_209881.1"
                     /db_xref="GeneID:4620698"
     CDS             25995..26612
                     /locus_tag="AGOS_AEL332W"
                     /old_locus_tag="AEL332W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL008W (FUN14)"
                     /codon_start=1
                     /product="AEL332Wp"
                     /protein_id="NP_984528.1"
                     /db_xref="GeneID:4620698"
                     /translation="MNTNLFIRNPCGTRLFFGNLCRLVAPSYRSQMMGSAIRARAVSL
                     TKNAGITSPRMMLFTSITATGLLMPLFKSPIIRNDAYMGVHDVKYPQVGYGAGVTSKE
                     VRRGRLNGKLDYRQLCLGSIAGVALGIVVGKISHALVFITGLGLLALQWLQSRGIVDK
                     GTTRGLSRYLISTGREKIDLNTLFWEKPSFKISFLLTFVLAALNV"
     gene            <26839..>27468
                     /locus_tag="AGOS_AEL331W"
                     /old_locus_tag="AEL331W"
                     /db_xref="GeneID:4620699"
     mRNA            <26839..>27468
                     /locus_tag="AGOS_AEL331W"
                     /old_locus_tag="AEL331W"
                     /product="AEL331Wp"
                     /transcript_id="NM_209882.1"
                     /db_xref="GeneID:4620699"
     CDS             26839..27468
                     /locus_tag="AGOS_AEL331W"
                     /old_locus_tag="AEL331W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR107C (YTH1)"
                     /codon_start=1
                     /product="AEL331Wp"
                     /protein_id="NP_984529.1"
                     /db_xref="GeneID:4620699"
                     /translation="MSLVHPDTSNYPFRFAPFLRQEYSFSLDPDRPVCQYYNSKEGAS
                     SCPNGTLCPNKHVLPIFQNKIVCKHWLRGLCKKNDQCEYLHEYNLRKMPECVFFTKNG
                     YCTQSPECQYLHIDPTSKVQQCEDYRMGFCPLGTACPCKHVKKIICPKYVTGFCPLGR
                     DCDWEHPPFYVPNELSKIRIKRDDEINTKKLDEEKERRLNAIINGELVI"
     gene            complement(<27520..>28548)
                     /locus_tag="AGOS_AEL330C"
                     /old_locus_tag="AEL330C"
                     /db_xref="GeneID:4620700"
     mRNA            complement(<27520..>28548)
                     /locus_tag="AGOS_AEL330C"
                     /old_locus_tag="AEL330C"
                     /product="AEL330Cp"
                     /transcript_id="NM_209883.2"
                     /db_xref="GeneID:4620700"
     CDS             complement(27520..28548)
                     /locus_tag="AGOS_AEL330C"
                     /old_locus_tag="AEL330C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR106W (ISR1)"
                     /codon_start=1
                     /product="AEL330Cp"
                     /protein_id="NP_984530.2"
                     /db_xref="GeneID:4620700"
                     /translation="MSAWASQEAAKEEEAVGDFARMLERRDAGLLARVLSRAQTGPEA
                     YVRGLWRAEVGLERWRLTRVLGCGSVACVFELGDGALALKVPTSRRKAPVLLHEVLIY
                     SHLAQQAGGRLAERHVVPFHGVAAVTRREYRRLRGGEVVPALVLERMDTTLEAVHRRA
                     AVSKGQWWRYARDLVAALQFLRESCVVHGDIKTANVLVRGQDAFLADFTSAAVCDAAP
                     EPLTTTLEYCAPGLIGGGQPTHSTDVYAAGLCLLALITRFEPFRELSMMKSHSSAPTH
                     SLHETQWLMNAISKGDPIKYNVLSQDLYDRWAEELHFLRRFFVPAAQDALSRWLAESN
                     ARVAEHAF"
     gene            <29316..>30224
                     /locus_tag="AGOS_AEL329W"
                     /old_locus_tag="AEL329W"
                     /db_xref="GeneID:4620701"
     mRNA            <29316..>30224
                     /locus_tag="AGOS_AEL329W"
                     /old_locus_tag="AEL329W"
                     /product="AEL329Wp"
                     /transcript_id="NM_209884.1"
                     /db_xref="GeneID:4620701"
     CDS             29316..30224
                     /locus_tag="AGOS_AEL329W"
                     /old_locus_tag="AEL329W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR086C (PIL1)"
                     /codon_start=1
                     /product="AEL329Wp"
                     /protein_id="NP_984531.1"
                     /db_xref="GeneID:4620701"
                     /translation="MHRTYSLRNSRAPTASQLQNPPPPPSTTKNRFFGKGGLANTFRK
                     NTAGAFGPELSRKLSQLVKIEKNVLRAIEVAANERRDAAKQLSLWGLENDDDVSDITD
                     KLGVLIYETSELDDQFIDRYDQYRLTLKSIRDIEGSIQPSRDRKAKITDKIAYLKYKD
                     PQSPKIEVLEQELVRAEAESLVAEAQLSNITRSKLKAAFNYQFDSLIEHSEKLALIAG
                     YGKALLELLDDSPVTPGETRPAYDGYEASKQIIIDAEAALNDWTLDTAAVKPSLSIRR
                     DYDEEFEEGDDGEQWEQDATEEQVAA"
     gene            <30723..>33212
                     /locus_tag="AGOS_AEL328W"
                     /old_locus_tag="AEL328W"
                     /db_xref="GeneID:4620702"
     mRNA            <30723..>33212
                     /locus_tag="AGOS_AEL328W"
                     /old_locus_tag="AEL328W"
                     /product="AEL328Wp"
                     /transcript_id="NM_209885.1"
                     /db_xref="GeneID:4620702"
     CDS             30723..33212
                     /locus_tag="AGOS_AEL328W"
                     /old_locus_tag="AEL328W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR105C (COG4)"
                     /codon_start=1
                     /product="AEL328Wp"
                     /protein_id="NP_984532.1"
                     /db_xref="GeneID:4620702"
                     /translation="MAADGDPIALHTISDDVLAAKLARYKKLMNNFATLSQATKLEKV
                     INRDHRETEQELQEIIEESQTRDNQEIRKLELRRTNLTSSLGKFHATLEQLSGSSESA
                     RQISARIRMIERERTLVHKTLQFIEQCRQLKYSISVVSSALEKNDHRLAANTIEKIRT
                     LPPEVVESEFANRVVPCSEIPEQPAQLLKDWTSRLSEVFTEQFQHAAKAQDVEQLTSY
                     FELFPKIGYAELGLEVYSKYVCDIIAGQSRKIMTGSTERRHMFYSKALLHLFKTVSTI
                     INSHSQVISGCYGAKYMVHIMDKVQKEADLQAGIIWDTFMDVRRIEYLLAEIREWHEA
                     QAQANKNHLHGAKPNSRPPPSSINELTMLISEYSAIFQHWSMYCRFFALKWDEFSQNT
                     ATELELPSLISEGKFSAKVTDSMSGFEQLVRHQLYRSFANAVDLEELPSLNDYLGPTP
                     YDHEDLSSYPISSILEDLVLLIRVNLIATVNTGQKALLYKFSEALMRFIQTEFLIKVL
                     QSRFKNIQPRLNPSLVLKKYLPSSDPTSVGMRSLSPKPVTQDTGKLSQFGFNFKSAAT
                     STLTNLQSNIQSVYTDEESVLKLHHFLICVNTLSIGEVFFKRLLITEILEDQPQLLHS
                     NFPFGRDATDVESVLRTLFGNIQTQGGKLLKWSLLQLFENMLKGKLKRLVAPMFVSGT
                     DQEYICTAHDFENLSTLNLFLTQWKELILPFSNVLYKTAYIELISQMIDYLCEALEEK
                     IWGIQCNELGGLKLDRELSLMITSLCGQHYFLREKFTRLSQLVLVLGLDDDDFDPATG
                     DIKEETLSSINWILSAPERVRARNMRVDKRS"
     gene            <33827..>37231
                     /locus_tag="AGOS_AEL327W"
                     /old_locus_tag="AEL327W"
                     /db_xref="GeneID:4620703"
     mRNA            <33827..>37231
                     /locus_tag="AGOS_AEL327W"
                     /old_locus_tag="AEL327W"
                     /product="AEL327Wp"
                     /transcript_id="NM_209886.2"
                     /db_xref="GeneID:4620703"
     CDS             33827..37231
                     /locus_tag="AGOS_AEL327W"
                     /old_locus_tag="AEL327W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR104C (FHL1)"
                     /codon_start=1
                     /product="AEL327Wp"
                     /protein_id="NP_984533.2"
                     /db_xref="GeneID:4620703"
                     /translation="MEFERQENTSLPRASIQAIGALSVATDDLPKKHIDYPTREPGKY
                     PLRADEESKIGYASYDSEKPSEGADVSCTNESSGDAEHASDRPAESNADKTASEVKSA
                     NAGEGFASDRVPDSREGEKLKGKRLNSDLQPTTAVDSSHADGLTNFPLVQEQEVAKNE
                     PPTTPGPPKGTDSIGLAAREVSQASHGGEKEDLKPDGSAYMEVAGSGDAPITPTPNST
                     PLKNIPKPAGSIGTDDTRLMASDMEQGQDQQELLNRLQRPSMSYGPNTRRRSSLILKE
                     HDSKTPDIRAASTLQTTELKLELPENLDHEDFSKLFKLDAKNDDDLFSAEDLLAHGIG
                     SQRRSSEDDAAATRHKLDIEQSPRGSVSLTPEILDNKHMCTKTEDTNTSNEEGLSPRQ
                     HVAAKKTGDSSQQLSISNNSMANPHTVKSSTHDGSVKFNYTTHLENTPASIIQGKNHL
                     FYARRHNSLTPMVSQPTNKHSPATFKPSPESERQTSTDINAGNHTEHSDGHILPAGQF
                     MTSSHGSNLAEEQSKISAYACLDFQNFTFYVQTLQVIIGRRSENDFAHKVDVNLGPSK
                     SISRRHAKIFYNFGTERFELSIMGKNGAFVDDTFVERGITVPLRNKSKIQIGQIPFQF
                     VLPEQEGKEKHVIPSKIKDTPTVKTESVKDPLDSQIKAPDISVTSKKKEKKPSKPPKP
                     PKKVYSLEEIPPEYRTKPTCSYSNLITTCLRKYSSPKGMSLSEIYAGIRELYPYYKYC
                     PDGWQSSVRHNLSLNKSFRKVSKEGKGWLWGLDEEYIAEREKQRKKQAEAQAAKAKAA
                     ELKQLQLQARKQATVSNNLASFTKQPNISQTLAANRSEKRILQDDNQRTMKYLQQQLI
                     LLTKDRKGLEKPVMAQILTQALAMTINQVTQAAKNKGITGNPLTALIDKNPQHLNLIL
                     TAAVNAATVKVTDGKVKKLVNMSPVSQVSAQNPALIAKQGSSKRASPPALRNILQKPP
                     TPSIANPTSSSTLKAGEPFDPTSLSKFFQPKQPVRLSVAGTPGHAGSRSNNGNLLPRK
                     RSASDTESSDDDSDTSVNEDSSDEDSGDSSDDNTGSSDSGTAGDDTSSSSTSDNGDDD
                     DDDDDDDDDDDDDDDDDDDDDDDDDEDDDDDDEDDDDDDQSSNITD"
     gene            complement(<37423..>38280)
                     /locus_tag="AGOS_AEL326C"
                     /old_locus_tag="AEL326C"
                     /db_xref="GeneID:4620704"
     mRNA            complement(<37423..>38280)
                     /locus_tag="AGOS_AEL326C"
                     /old_locus_tag="AEL326C"
                     /product="AEL326Cp"
                     /transcript_id="NM_209887.2"
                     /db_xref="GeneID:4620704"
     CDS             complement(37423..38280)
                     /locus_tag="AGOS_AEL326C"
                     /old_locus_tag="AEL326C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR103W (PRE2)"
                     /codon_start=1
                     /product="AEL326Cp"
                     /protein_id="NP_984534.2"
                     /db_xref="GeneID:4620704"
                     /translation="MQSIVESLRRSPLEQELYEDQSELQEDFVVGRVPFQRLTPRISV
                     APVDRPYEFLRAHTDDSKNPDCRIKIAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQ
                     TVKKVIEINPFLLGTMAGGAADCQYWETWLGAQCRLHELKEKERISVAAASKILSNLV
                     YEYKGAGLSMGTMICGYTKKEGPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYR
                     WDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTENGWVYHGNHDVGALFWEIKEK
                     EKSFNNVLG"
     gene            <38620..>39144
                     /locus_tag="AGOS_AEL325W"
                     /old_locus_tag="AEL325W"
                     /db_xref="GeneID:4620705"
     mRNA            <38620..>39144
                     /locus_tag="AGOS_AEL325W"
                     /old_locus_tag="AEL325W"
                     /product="60S ribosomal protein L11"
                     /transcript_id="NM_209888.1"
                     /db_xref="GeneID:4620705"
     CDS             38620..39144
                     /locus_tag="AGOS_AEL325W"
                     /old_locus_tag="AEL325W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR102C (RPL11A) and YGR085C (RPL11B)"
                     /codon_start=1
                     /product="60S ribosomal protein L11"
                     /protein_id="NP_984535.1"
                     /db_xref="GeneID:4620705"
                     /translation="MSAKAQNPMRELKIEKLVLNISVGESGDRLTRASKVLEQLSGQT
                     PVHSKARYTVRTFGIRRNEKIAVHVTIRGPKSEEILERGLKVKEYQLRTKNFSETGNF
                     GFGIQEHIDLGIKYDPSIGIYGMDFYVVMGRPGGRVSRRKRCRSTVGNSHKTSKEDTI
                     AWFKQRYDADVLDK"
     gene            complement(<39212..>39805)
                     /locus_tag="AGOS_AEL324C"
                     /old_locus_tag="AEL324C"
                     /db_xref="GeneID:4620706"
     mRNA            complement(<39212..>39805)
                     /locus_tag="AGOS_AEL324C"
                     /old_locus_tag="AEL324C"
                     /product="AEL324Cp"
                     /transcript_id="NM_209889.1"
                     /db_xref="GeneID:4620706"
     CDS             complement(39212..39805)
                     /locus_tag="AGOS_AEL324C"
                     /old_locus_tag="AEL324C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR101W (SNT309)"
                     /codon_start=1
                     /product="AEL324Cp"
                     /protein_id="NP_984536.1"
                     /db_xref="GeneID:4620706"
                     /translation="MADDVIDWLPYVDTLDQRYLNEVEKTVTAELAAIEQQELHPRIA
                     ELFPAVRHHWDEQYGLYKDNVVGLEGSNKRAAEDGVLSELKRRCPGIDISVYNDDSED
                     PVLLATIAGYRYHQDLVVTQLLPQTLENQWAINNAYLEGAEAAVRRQLQEQEQQIAQL
                     DRHRQELQQREALRFRYLERQWRDRLHGNLERAAGNI"
     gene            <39991..>40905
                     /locus_tag="AGOS_AEL323W"
                     /old_locus_tag="AEL323W"
                     /db_xref="GeneID:4620707"
     mRNA            <39991..>40905
                     /locus_tag="AGOS_AEL323W"
                     /old_locus_tag="AEL323W"
                     /product="AEL323Wp"
                     /transcript_id="NM_209890.1"
                     /db_xref="GeneID:4620707"
     CDS             39991..40905
                     /locus_tag="AGOS_AEL323W"
                     /old_locus_tag="AEL323W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR084C (MRP13)"
                     /codon_start=1
                     /product="AEL323Wp"
                     /protein_id="NP_984537.1"
                     /db_xref="GeneID:4620707"
                     /translation="MHTVSVALSKRFIRSLATQVQSAPKDGGDFVRYLEYLKTSKDMR
                     PLLYRPRNAAKLLTMDLGGGEIPTPRDPIQLPSVLTYAQLLDQMESAEQLQKHFVELR
                     QVHKKALWEHLSAQHLQHILLRATFGLHCFGPTLTAVYQLKPLFARAKNTTAYDVDHL
                     FNTILTCRLHTNSLLQEIDPVVATKKVAMSWENTNVRQTSTGLSAELLTALSKQVGGE
                     IPVPTELKVPVILPSIDVDACSMGKAAAFVSAHRIRYLQARTATTFGSTNEAVMAFVS
                     CYRAALERTGRVDFYDLCVAALAPKQEP"
     gene            <41234..>43048
                     /locus_tag="AGOS_AEL322W"
                     /old_locus_tag="AEL322W"
                     /db_xref="GeneID:4620708"
     mRNA            <41234..>43048
                     /locus_tag="AGOS_AEL322W"
                     /old_locus_tag="AEL322W"
                     /product="AEL322Wp"
                     /transcript_id="NM_209891.1"
                     /db_xref="GeneID:4620708"
     CDS             41234..43048
                     /locus_tag="AGOS_AEL322W"
                     /old_locus_tag="AEL322W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR083C (GCD2)"
                     /codon_start=1
                     /product="AEL322Wp"
                     /protein_id="NP_984538.1"
                     /db_xref="GeneID:4620708"
                     /translation="MSTDADVASTQRENAADANPRESSAEREATAPSVSEEHKLSNKE
                     LKELKKQEKAAKRAAKKQASGITIEQQQQQAQLKKEKKQHQREQQMSGAKKGRSGNPG
                     IPIADKKSTLFGHLETTEERRASLLAVISAISSNGASKITATGLMIPTVASAMASSAA
                     PALAAGHTGAAGPANPEVSAQAMASMSLDEESSFVPGLLSVLPIAIEEDFKNPQLMSS
                     VKELVANKDMLHPAVVLLTSEFGAYKIVGSIPRCLAMLEVFQIVIREYKTPEGTTLSR
                     NLTHYLSHQIDFLKKARPLSVTMGNAIRWLKQEISLIDPATSDVQAKELLCEKIAQFA
                     REKVELADQLILENASQHIDNDSTILTYGCSKVLTDLFIYNAVDLGKNFNIIIVDSRP
                     LFEGRKMAEVLRKRGLNITYVMITSLATIFSMDIDYVFLGAHSILSNGFLYSRVGTAM
                     LAMSAKRRNIPVIVACESLKFSQRVQLDSVTFNELADPNILVDINTDNPVKRRSNKGF
                     LLQRFVKESQALMKQKDEQDTKQNKNGKAKFITDDNKKSDSDKAILADWQDLPSLNIY
                     NIMYDLTPPEYIKKVVTEFGALPPSSVPVILREYKGSA"
     gene            complement(<43119..>43547)
                     /locus_tag="AGOS_AEL321C"
                     /old_locus_tag="AEL321C"
                     /db_xref="GeneID:4620709"
     mRNA            complement(<43119..>43547)
                     /locus_tag="AGOS_AEL321C"
                     /old_locus_tag="AEL321C"
                     /product="mitochondrial 54S ribosomal protein MRPL51"
                     /transcript_id="NM_209892.1"
                     /db_xref="GeneID:4620709"
     CDS             complement(43119..43547)
                     /locus_tag="AGOS_AEL321C"
                     /old_locus_tag="AEL321C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR100W (MRPL51)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein MRPL51"
                     /protein_id="NP_984539.1"
                     /db_xref="GeneID:4620709"
                     /translation="MVVKALRQISVGQNGVGAFIFPCKKITLQYCNWGGSSQGLRDFL
                     TSKRLAKWAEKYPQIQFEVVAKAGHPVLKAEYINGLNKAICVRNLNVDHVELKLKLLR
                     ESSGAQLRHYPKNANVLSLNQSVRGVWSPLHVDPALRHRV"
     gene            <44085..>47045
                     /locus_tag="AGOS_AEL320W"
                     /old_locus_tag="AEL320W"
                     /db_xref="GeneID:4620710"
     mRNA            <44085..>47045
                     /locus_tag="AGOS_AEL320W"
                     /old_locus_tag="AEL320W"
                     /product="AEL320Wp"
                     /transcript_id="NM_209893.2"
                     /db_xref="GeneID:4620710"
     CDS             44085..47045
                     /locus_tag="AGOS_AEL320W"
                     /old_locus_tag="AEL320W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR097W"
                     /codon_start=1
                     /product="AEL320Wp"
                     /protein_id="NP_984540.1"
                     /db_xref="GeneID:4620710"
                     /translation="MSTQLDPTEEHYLKRELLRLELNTEFGQFNDAEALRMFGAPFSA
                     DAPRKHGGGGLKGSLPLSLKRRLGGKSGGHETAHVADTEFPLLRHFLHTVVMTCPLLS
                     QDLAASSHFWQSKVQAFFEHFMSMPFSSSYDREELTKRRKLAIKMSKLVLLFYNSGVG
                     ARQEQQYYAALEPLNLPTGDMQGGLGQFIMPTRESIQYAITQEPVYFNGIDINVIAVV
                     DEECLLGDSLAHASSQQSWIKSAFNIPSRMLSRLAEAGMPRRKVFLIKVQREGSQGEF
                     QYVARHYDDLKHLYASLRKEFPGKKIPALIEENRIPICISKQPFDTKFKSAGSGNQTD
                     VDCILGADPLDQQPSPPSVSSLYRGYENSRGSVSNGDADEQTTSSDASSTSYIILEME
                     AMRTALRQYLRAICQDAEVSASLSLTKFLFKRTIDKRAFTPEILEDIESRELMDVYNL
                     ENQVKFQKMAFDRTVKLQSSLKSLKDTILQDNDYIMRLFREFKEKEDPSDLSEPLRDF
                     FEWCKIYISATTYQVFLGNDNCYDFYYHVRRLHKLMPYTVMSKIMKYTNPMSIMKTMM
                     DLFMARPFGGQSLLQTIFSNILSDDLKVQEKMIEDLEMYVTSETIHGSEVARVLQKCI
                     FDNEQGEYIDMDAVYEFAKAKDLPLVLVILMQCHKTKLLSSTALEEVKNSFKYWKTMK
                     SMELSMVSTNSSITDCPGLYFSHIKELLHIYIKERDIRVMKLLWQESELPALLKSIVS
                     LFYEPLVKLFKVARVDVAMANFEKFMDELISLLDDVITGKHGLATRVNVVEKIHGLVD
                     KHEDIFYKFIHEIYVNDTENIFEGLITWISDVSAFLQNSKWGEVSERVDLMALLHAHS
                     DIVDVPTLRKQLADMVDQKRKAQEIYSKIVNLKAATADSKGDGSLQQRIDDGWKQMNN
                     AVLPQDAINFGIDDRDLVDLDIDVGDFDYLHNEEQELQDEYRTILNKQVDTSEIERFN
                     KLVFRNTLKELLNV"
     gene            complement(<47139..>47705)
                     /locus_tag="AGOS_AEL319C"
                     /old_locus_tag="AEL319C"
                     /db_xref="GeneID:4620711"
     mRNA            complement(<47139..>47705)
                     /locus_tag="AGOS_AEL319C"
                     /old_locus_tag="AEL319C"
                     /product="AEL319Cp"
                     /transcript_id="NM_209894.1"
                     /db_xref="GeneID:4620711"
     CDS             complement(47139..47705)
                     /locus_tag="AGOS_AEL319C"
                     /old_locus_tag="AEL319C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR081C (SLX9)"
                     /codon_start=1
                     /product="AEL319Cp"
                     /protein_id="NP_984541.1"
                     /db_xref="GeneID:4620711"
                     /translation="MVAKKRTQLRAKAMRQRRNSSEAMETEELPPDPKAFLHQLRESK
                     REKQLNRSQSFLNRLRDQAGNGGISKSALRRRKKRMKEELKPRMEDLLTSLKEEGVLE
                     EDESGELAAVTGVTAITASNGYSGLHDTAEACGTVRIRKNEPSIRTQRGAKLLTTKEQ
                     ERFTKVISNERFRSSPFETLREIIKSRK"
     gene            <48135..>48680
                     /locus_tag="AGOS_AEL318W"
                     /old_locus_tag="AEL318W"
                     /db_xref="GeneID:4620712"
     mRNA            <48135..>48680
                     /locus_tag="AGOS_AEL318W"
                     /old_locus_tag="AEL318W"
                     /product="AEL318Wp"
                     /transcript_id="NM_209895.1"
                     /db_xref="GeneID:4620712"
     CDS             48135..48680
                     /locus_tag="AGOS_AEL318W"
                     /old_locus_tag="AEL318W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR082W (TOM20)"
                     /codon_start=1
                     /product="AEL318Wp"
                     /protein_id="NP_984542.1"
                     /db_xref="GeneID:4620712"
                     /translation="MSQTVSRVFALTTATVVAVAAGYALYFDYQRRHNPGFRKNLKRS
                     LKKQRAQEHAEHEEAKQATMAHVGEYLTMELIKEPIPQDSNEKQASFKVNVEEGEMLA
                     KVPGKELESALKFYRALAMYPSPAELLGIYQRSIPEAVYEYIVLMIAILPPVNVSSFL
                     SGSASTASVHAQPQEAVGIDE"
     gene            complement(<48857..>49398)
                     /locus_tag="AGOS_AEL317C"
                     /old_locus_tag="AEL317C"
                     /db_xref="GeneID:4620713"
     mRNA            complement(join(<48857..49298,49352..>49398))
                     /locus_tag="AGOS_AEL317C"
                     /old_locus_tag="AEL317C"
                     /product="AEL317Cp"
                     /transcript_id="NM_209896.2"
                     /db_xref="GeneID:4620713"
     CDS             complement(join(48857..49298,49352..49398))
                     /locus_tag="AGOS_AEL317C"
                     /old_locus_tag="AEL317C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR098C; 1-intron"
                     /codon_start=1
                     /product="AEL317Cp"
                     /protein_id="NP_984543.2"
                     /db_xref="GeneID:4620713"
                     /translation="MSLVKNSTHLLLYSFAFGGTAFYGYVFSPIAFKTLDRETFSSIQ
                     NRMLELVFKVQTVAPIVIGLTAPFPLATPTLATLLPATATGAVNLFWLLPWTRRVKRE
                     RRQAAKELSGDELEAVDAPLRKEFGRSHGLSLLFNMLHTASMLAYGVFLSKSLFKYVR
                     RV"
     gene            49710..49783
                     /locus_tag="AGOS_t0089"
                     /db_xref="GeneID:4620714"
     tRNA            49710..49783
                     /locus_tag="AGOS_t0089"
                     /product="tRNA-Val"
                     /codon_recognized="GUU"
                     /db_xref="GeneID:4620714"
     gene            50062..50133
                     /locus_tag="AGOS_t0090"
                     /db_xref="GeneID:4620715"
     tRNA            50062..50133
                     /locus_tag="AGOS_t0090"
                     /product="tRNA-Asp"
                     /codon_recognized="GAC"
                     /db_xref="GeneID:4620715"
     gene            <50307..>51464
                     /locus_tag="AGOS_AEL316W"
                     /old_locus_tag="AEL316W"
                     /db_xref="GeneID:4620716"
     mRNA            <50307..>51464
                     /locus_tag="AGOS_AEL316W"
                     /old_locus_tag="AEL316W"
                     /product="AEL316Wp"
                     /transcript_id="NM_209897.1"
                     /db_xref="GeneID:4620716"
     CDS             50307..51464
                     /locus_tag="AGOS_AEL316W"
                     /old_locus_tag="AEL316W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR038C (KAE1)"
                     /codon_start=1
                     /product="AEL316Wp"
                     /protein_id="NP_984544.1"
                     /db_xref="GeneID:4620716"
                     /translation="MVNLNKVQPRSGGDHYLALGIEGSANKLGVGILKHPMLSQHKQG
                     SLSHDCQAEILSNIRDTYITPPGEGFLPRDTARHHRNWVVRLVRRALVEAGIEDPRLL
                     DVICFTKGPGMGAPLHSVVVAARTMSMLWDVPLVAVNHCIGHIEMGREITKAENPVVL
                     YVSGGNTQVIAYSENRYRIFGETLDIAIGNCLDRFARTLKIPNDPSPGYNIEQLAKQC
                     KNKDRLVELPYTVKGMDLSMSGILAHIDSLAKDLFRRNTKNYKLFDRETGKQLVTVED
                     LCYSLQEHLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQQMMASMCQSRADGQVH
                     ATDERFCIDNGVMIAQAGLLQYRMGDIVKDFSETVVTQRFRTDEVYVSWRD"
     gene            <51726..>52598
                     /locus_tag="AGOS_AEL315W"
                     /old_locus_tag="AEL315W"
                     /db_xref="GeneID:4620717"
     mRNA            <51726..>52598
                     /locus_tag="AGOS_AEL315W"
                     /old_locus_tag="AEL315W"
                     /product="AEL315Wp"
                     /transcript_id="NM_209898.1"
                     /db_xref="GeneID:4620717"
     CDS             51726..52598
                     /locus_tag="AGOS_AEL315W"
                     /old_locus_tag="AEL315W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR037C (SPC34)"
                     /codon_start=1
                     /product="AEL315Wp"
                     /protein_id="NP_984545.1"
                     /db_xref="GeneID:4620717"
                     /translation="MSESLSYCLDQIKESADSIATLYFKPPGIFQNALVHNSKTSYAE
                     IITRLIRDADPVDEMSLYMTDKGGKLRRKDGKQGVYDHLTERAATLKRARLLGAPEET
                     PIVHVPKEFYLKQHDIITKKKQRQNRDFLFDEFSKESGGMFEVLIKKFAGDQQVRNLL
                     LALQNGSVITGEDASSRRKTMFVEDFSVELILRLLREIVTQWPLNEHRTKYEHLLQTY
                     HDISDATNKLRAQIADQEHRLQSQDALSEEPDADDDDVAHPTSGVSYLIQQELDEIDA
                     LERELEQLRRDSRT"
     gene            <52979..>55126
                     /locus_tag="AGOS_AEL314W"
                     /old_locus_tag="AEL314W"
                     /db_xref="GeneID:4620718"
     mRNA            <52979..>55126
                     /locus_tag="AGOS_AEL314W"
                     /old_locus_tag="AEL314W"
                     /product="AEL314Wp"
                     /transcript_id="NM_209899.1"
                     /db_xref="GeneID:4620718"
     CDS             52979..55126
                     /locus_tag="AGOS_AEL314W"
                     /old_locus_tag="AEL314W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL112W (MDV1) and YKR036C (CAF4)"
                     /codon_start=1
                     /product="AEL314Wp"
                     /protein_id="NP_984546.1"
                     /db_xref="GeneID:4620718"
                     /translation="MSSGTSGDQISHFGKTLTTTASLVFGSQSMEDTILSYSSPYKKI
                     LHDTITSSGGTSSLMKVERSGRMFTPFRTRNSAFQDIFHASSGRGYFKNGFSDTRTSF
                     QVLSYLSDAMLADIPSSESAAATSGKLVTEKGEKGKKKRAETAHARGPSLYQGFEASL
                     PTINQTITTHQKKQIMNRDIKSIRESDATPEDVGQDVDIEKGEEETTHDEFTLPKGIK
                     PEHLSNSYSIKNLKGAVQTITDNLDLLEIQKNLAASEIRELDLKMEKLKLMRDLVFRR
                     VAKIEQNELFLEKHLMNIRERIDMIEEYNLDNDTDAEKAYEEATSAPEDTKDQYSELP
                     DANTAESGETVVQEPQVNLASAQKSLKKRSKQTGYSHKNHEKKVQQHEFRHLRKTYPT
                     LQQYYEPGANILSFDSAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASI
                     TGHLATVSCMQMDQYNTLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEI
                     TALSFEANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNND
                     HPIIGAIQCYDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGS
                     LDNSIRIWDLRTGTLADTFSYEHPVTCLQFDLNKIVVANQEGTVKVYNRQEKKHWFCG
                     GDEHSENAVEYVRYKDGYLVEGRANGDINAWAI"
     gene            complement(55373..55483)
                     /locus_tag="AGOS_t0091"
                     /db_xref="GeneID:4620719"
     tRNA            complement(join(55373..55416,55446..55483))
                     /locus_tag="AGOS_t0091"
                     /product="tRNA-Leu"
                     /codon_recognized="UUG"
                     /db_xref="GeneID:4620719"
     gene            complement(<56360..>56692)
                     /locus_tag="AGOS_AEL313C"
                     /old_locus_tag="AEL313C"
                     /db_xref="GeneID:4620720"
     mRNA            complement(<56360..>56692)
                     /locus_tag="AGOS_AEL313C"
                     /old_locus_tag="AEL313C"
                     /product="AEL313Cp"
                     /transcript_id="NM_209900.1"
                     /db_xref="GeneID:4620720"
     CDS             complement(56360..56692)
                     /locus_tag="AGOS_AEL313C"
                     /old_locus_tag="AEL313C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR244C-A"
                     /codon_start=1
                     /product="AEL313Cp"
                     /protein_id="NP_984547.1"
                     /db_xref="GeneID:4620720"
                     /translation="MGWFNSSKAAEDQTRAPDKASRQRCWESRDAYFECLDSINVVNA
                     LDPTATPQVRRNCGKQEDSFHQNCVTSWIKYFKEKRVSDSKRDAMVAKLEEQGARRIE
                     LGYVPPSK"
     gene            complement(<57124..>58110)
                     /locus_tag="AGOS_AEL312C"
                     /old_locus_tag="AEL312C"
                     /db_xref="GeneID:4620721"
     mRNA            complement(<57124..>58110)
                     /locus_tag="AGOS_AEL312C"
                     /old_locus_tag="AEL312C"
                     /product="AEL312Cp"
                     /transcript_id="NM_209901.1"
                     /db_xref="GeneID:4620721"
     CDS             complement(57124..58110)
                     /locus_tag="AGOS_AEL312C"
                     /old_locus_tag="AEL312C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR244W"
                     /codon_start=1
                     /product="AEL312Cp"
                     /protein_id="NP_984548.1"
                     /db_xref="GeneID:4620721"
                     /translation="MKSTLLLSAAAAAVAQGATINQSKAQEVQTGTCAFPHGKGMVAV
                     QTEGKNAGWAMHSDQECKPGTWCPYACPAGQLMGQWNPQVTAYTYPGSMEGGLFCDES
                     GNLQTPYPDKPYCYDGKGTVIAENKAGADVAFCQTVLPGNEEMLIPTLVGGGSSQTLA
                     VPGTDYWAGTAAHYYVNPPGVSVKDACIWGTKENARGNWAPYVTGANQDAEGNTFVTV
                     GWNPIYLEPETPFRNVKPSYGLRIVCDNEEDCVGLPCGIDPSVNGVNEIQGSGSTGAG
                     GANFCVVTAKKGAKARVEVFSTGGNAKRSLEHTHNRGNLSDIHRTVTTIAMN"
     gene            59814..59895
                     /locus_tag="AGOS_t0092"
                     /db_xref="GeneID:4620722"
     tRNA            59814..59895
                     /locus_tag="AGOS_t0092"
                     /product="tRNA-Ser"
                     /codon_recognized="UCU"
                     /db_xref="GeneID:4620722"
     gene            59901..59972
                     /locus_tag="AGOS_t0093"
                     /db_xref="GeneID:4620723"
     tRNA            59901..59972
                     /locus_tag="AGOS_t0093"
                     /product="tRNA-Asp"
                     /codon_recognized="GAC"
                     /db_xref="GeneID:4620723"
     gene            <60023..>60913
                     /locus_tag="AGOS_AEL311W"
                     /old_locus_tag="AEL311W"
                     /db_xref="GeneID:4620724"
     mRNA            <60023..>60913
                     /locus_tag="AGOS_AEL311W"
                     /old_locus_tag="AEL311W"
                     /product="AEL311Wp"
                     /transcript_id="NM_209902.1"
                     /db_xref="GeneID:4620724"
     CDS             60023..60913
                     /locus_tag="AGOS_AEL311W"
                     /old_locus_tag="AEL311W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR114C"
                     /codon_start=1
                     /product="AEL311Wp"
                     /protein_id="NP_984549.1"
                     /db_xref="GeneID:4620724"
                     /translation="MCGRYALAWNQDQLYDQLKLQHVPVNQSRLEFSPSYNIAPTQMA
                     PVYHGQTLELMNWGVVPRRSHASETNQRYSTFNARSEKLLESQLWEPLCARTRCAVPI
                     TGYYEWQSRTSGRQPYFVHRKDKQVLFLAGMYSRAESASGSGTLSYTIVTAPAPRELA
                     WLHDRMPVVLRPESPQWADWLDAGRVQWDAEDLVRVLTPQFDAMLAWHAVTPDVGRVA
                     NNSARLMRPLPPRPSVVDMLRASARGAAARPQDKASRKRQGLRRPGRQLPPAGRPAGP
                     LPQTRAPCSDEPLPQRPRRP"
     gene            complement(<60741..>61961)
                     /locus_tag="AGOS_AEL310C"
                     /old_locus_tag="AEL310C"
                     /db_xref="GeneID:4620725"
     mRNA            complement(<60741..>61961)
                     /locus_tag="AGOS_AEL310C"
                     /old_locus_tag="AEL310C"
                     /product="AEL310Cp"
                     /transcript_id="NM_209903.1"
                     /db_xref="GeneID:4620725"
     CDS             complement(60741..61961)
                     /locus_tag="AGOS_AEL310C"
                     /old_locus_tag="AEL310C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR113W (FOL3) and YKL132C (RMA1)"
                     /codon_start=1
                     /product="AEL310Cp"
                     /protein_id="NP_984550.1"
                     /db_xref="GeneID:4620725"
                     /translation="MELGLGRITQVLRQLHSPHERMRVLHVAGTNGKGSVCAYLAAVL
                     RAGGERVGRFTSPHLVHPRDAITVDGEVIGAATYAALKAEVVAAGTCTEFEAQTAVAL
                     THFARLECTWCVVEVGVGGRLDATNVVPGGRKLCAITKVGLDHQALLGGTLAVVAREK
                     AGIVVPGVRFVAVDGTNAPSVLAEVRAAAAKVGAEVHETGGAPVCTVSWGAVAASALP
                     LAGAYQVQNAGVALALLDHLQQLGEISVSHAALERGLKAVEWPGRLQQVEYDLGGVHV
                     PLLFDGAHNPCAAEELARFLNERYRGPGGSPLIYVLAVTCGKEIDALLAPLLKPHDRV
                     FATSFGAVESMPWVAAMASEDVAAAARRYTAHVSAVADPLDALRAAAAARGDANLVVC
                     GSLYLVGELLRREH"
     gene            <62036..>62377
                     /locus_tag="AGOS_AEL309W"
                     /old_locus_tag="AEL309W"
                     /db_xref="GeneID:4620726"
     mRNA            <62036..>62377
                     /locus_tag="AGOS_AEL309W"
                     /old_locus_tag="AEL309W"
                     /product="AEL309Wp"
                     /transcript_id="NM_209904.2"
                     /db_xref="GeneID:4620726"
     CDS             62036..62377
                     /locus_tag="AGOS_AEL309W"
                     /old_locus_tag="AEL309W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR112C (MED11)"
                     /codon_start=1
                     /product="AEL309Wp"
                     /protein_id="NP_984551.2"
                     /db_xref="GeneID:4620726"
                     /translation="MPQPDSVKARLAALDRIDDELCAVLQHAQATIGALAELKRGHAA
                     LQPQLEQHVRDYYRTLEHSTVALRNEIRELDAAVGTQLLPVNIGKRAVGQDQEKLSEQ
                     LAQMDKYVGSM"
     gene            <62529..>63713
                     /locus_tag="AGOS_AEL308W"
                     /old_locus_tag="AEL308W"
                     /db_xref="GeneID:4620727"
     mRNA            <62529..>63713
                     /locus_tag="AGOS_AEL308W"
                     /old_locus_tag="AEL308W"
                     /product="AEL308Wp"
                     /transcript_id="NM_209905.1"
                     /db_xref="GeneID:4620727"
     CDS             62529..63713
                     /locus_tag="AGOS_AEL308W"
                     /old_locus_tag="AEL308W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR111C"
                     /codon_start=1
                     /product="AEL308Wp"
                     /protein_id="NP_984552.1"
                     /db_xref="GeneID:4620727"
                     /translation="MYASGHGNGARAPAGGRRGSVDGAGELQGLVLDQITKIQERQQR
                     LDERLDKLAREQEEFYLNGYKKMDQGFKDVSKCLQEVRAMKEVFKEIIGVMTGERVRF
                     VDHSNESCDAAEAQGVNQSELLVDNMRRQLQQRQSDWIRDRLALETRPGYGVKNEFEG
                     ERSVEQMLVQRQQELADVSDGRVPPDDFPTYRMNRAIRSVTDLAREYYEGLRGKPSVM
                     SLERRFGSTWRNSSKERTFFHKRMCIINKINDIKDNPVKYQLPQDITRKMAIRVVENM
                     RLGNNCFKGRRCCLTLSQLYVYLSKKMDTSSDYSLELRQVGKTTRELITQERIRSLEP
                     PSRDSPMESPPDGIPGRPVMIAVSSAPASLPPFEFTPVVASSVEDSNDLEENGEEEDV
                     DY"
     gene            complement(<63871..>64710)
                     /locus_tag="AGOS_AEL307C"
                     /old_locus_tag="AEL307C"
                     /db_xref="GeneID:4620728"
     mRNA            complement(<63871..>64710)
                     /locus_tag="AGOS_AEL307C"
                     /old_locus_tag="AEL307C"
                     /product="AEL307Cp"
                     /transcript_id="NM_209906.1"
                     /db_xref="GeneID:4620728"
     CDS             complement(63871..64710)
                     /locus_tag="AGOS_AEL307C"
                     /old_locus_tag="AEL307C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL130C (SHE2)"
                     /codon_start=1
                     /product="AEL307Cp"
                     /protein_id="NP_984553.1"
                     /db_xref="GeneID:4620728"
                     /translation="MPIPDMSSQYPHQQEDMSQEEEPRGRKPQSMVDQEKQDYLDFIV
                     PRLQITGKILQLTEEVIQEQANYISRYIDFLNKYINYQRKVSTLRFERATLIKYVKKL
                     RFLNDFLYTYNADVNMITEPLQKLVRPLGSFFIRYLEIIDLLNYYLTQSLRNETISKT
                     LNQDLVLSQECIAMADKTYRVYVKFVQWFIESSSSVTTGDLTMEIVQFTRKCAVEDGI
                     DLGETDDVLLQEVQLVTSSEEFEDLLEKWQQVLHFQCADLDDTFNDNIRHWSELFDKK
                     KEK"
     gene            complement(<65142..>69020)
                     /locus_tag="AGOS_AEL306C"
                     /old_locus_tag="AEL306C"
                     /db_xref="GeneID:4620729"
     mRNA            complement(<65142..>69020)
                     /locus_tag="AGOS_AEL306C"
                     /old_locus_tag="AEL306C"
                     /product="AEL306Cp"
                     /transcript_id="NM_209907.2"
                     /db_xref="GeneID:4620729"
     CDS             complement(65142..69020)
                     /locus_tag="AGOS_AEL306C"
                     /old_locus_tag="AEL306C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR109W (MYO5) and YKL129C (MYO3)"
                     /codon_start=1
                     /product="AEL306Cp"
                     /protein_id="NP_984554.2"
                     /db_xref="GeneID:4620729"
                     /translation="MAIIKRGVRQKTQPPAKRTTNIKKATFDSGKKKEVGVSDLTLLS
                     KISDEHINENLKRRFENGSIYTYIGHVLISVNPFRDLGIYTDQVLETYKGRNRLEVPP
                     HVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSSHEASIGRIK
                     DMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGQITNYLLEKQRVVG
                     QIKNERNFHIFYQFSKGASDRYRKTYGVQLPEQYVYTSASGCTSVDTIDDLNDYEATL
                     EAMNVIGLSQAEQDEIFRLLSAILWIGNVTFMEDDEGNAKIADTSITDFVAYLLQVDA
                     GLLVKSLVERTIETTHGMRRGSIYNVPLNIVQATAVRDALAKAIYNNLFEWIVDRVNV
                     SLQALPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQEEYAK
                     EQIQWTPIKYFDNKVVCELIEAKRPPGIFAALNDSVATAHADSNAADQAFAQRLNLFT
                     SNPHFELRSSKFVIKHYAGDVTYDIGGMTDKNKDQLQRDLVELLNSTSNTFLATIFPD
                     TGDKDSKRRPPTAGDKIIRSANELVDTLSKAQPSYIRTIKPNQTKSPLDYDDRQVLHQ
                     VKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPQCSYAGDYTWQGNTLDAVNLILR
                     DTSIPVTEYQLGVTKVFIKTPETLFALENMRDKYWHNMASRIQRAWRRFLQRRIDSAI
                     RIQRAIREMKHGNQFEQLRDYGNKLLGGRKERRAMSLLGYRAFLGDYLSCNELKSKGA
                     FVKRKAGINDHVVFSINGQALHSKFGRSAQRLPKTFILTPSHFYIIGKTLVNNQLTYA
                     VDYKIDVRQIVYVSLTNLQDDWVGIFVSNSTQPDPLINTYFKTELITHLKKLNNRIEI
                     KIGPTIEYQKKPGKIHAVKSQINENAPPLGDIYKSSTIMVRRGRPGNCSQRKKPLSTR
                     LPDTYTTRETGYKNAGHPTNIRQVQEPTHISHSQQHTSSNLGFVYSLNPSAVNHPRPV
                     PSGSVGTTSTPPKQAASAAQAAYNPHKLGGNMDNSSAAYGNASALPNSAPSQAPKPAS
                     RPVPKPAPRPGPKPGPKPGPKPGPKPAPKPMPRPAKSVENSVPRPNAIEQGKTAPPPP
                     PPPPPPPAAVPSEPVYEAAFDFPGSGSPNEFPLKKGDRIYVTRQEPSGWSLAKALDGS
                     KEGWVPTAYIVESKAAFSQLEQPVASSAPLGNSGVATREAGTTSAATAAASAATPTAF
                     SAGLADALAARANKMRHEDSGSDDNADDDW"
     gene            complement(<69382..>71388)
                     /locus_tag="AGOS_AEL305C"
                     /old_locus_tag="AEL305C"
                     /db_xref="GeneID:4620730"
     mRNA            complement(<69382..>71388)
                     /locus_tag="AGOS_AEL305C"
                     /old_locus_tag="AEL305C"
                     /product="AEL305Cp"
                     /transcript_id="NM_209908.1"
                     /db_xref="GeneID:4620730"
     CDS             complement(69382..71388)
                     /locus_tag="AGOS_AEL305C"
                     /old_locus_tag="AEL305C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR108W (ILV2)"
                     /codon_start=1
                     /product="AEL305Cp"
                     /protein_id="NP_984555.1"
                     /db_xref="GeneID:4620730"
                     /translation="MLRRVTVRQLANVRALARATRPLAVARAFSGAAGRLGAEAQEAP
                     RRRAPGPRGETEPQGAAGAHEMDHSMIGFSGGEIFHEMMRRHNVDTVFGYPGGAILPV
                     YDAIYNSDAFNFVLPKHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVVTPMADALA
                     DGVPMVVFTGQVPKAAIGTDAFQEADVVGISRSCTKWNVMVNHVEELPRRINEAFEIA
                     TSGRPGPVLVDLPKDVTAAILRSPIPLASALPSTTLAQLTRQAADIDGVRSLADASRL
                     INMAQKPVLYVGAGILNSTRGPEFLRELAEKAQIPVTTTLQALGAFDQEDSKSVDMLG
                     MHGSAAANLTVQNADLIIALGARFDDRVTGNIAKFAPEAQRAAREQRGGIVHFEISPK
                     NINKVVDAQVAVEGDVTANLEKLLPLIKPVAERKEWLGQIASWKSEYPYDYSRETPGS
                     RIKPQTVITRLSEIANATGKEVIVTTGVGQHQMWAAQHWTWKKPRTFITSGGLGTMGF
                     GLPAAIGAQVAKPDAIVIDIDGDASLNMTLMEMSSAVQAGAPVKILLLNNEEQGMVTQ
                     WQSLFYEHRYSHTHQLNPDFVKLADAMGFKAMRLEAQSDMEPMLQEFINCKEPVLLEV
                     AVEKKVPVLPMVPAGKALHEFIYFDPEVERQQAELRSRRTGGKH"
     gene            complement(<71671..>72582)
                     /locus_tag="AGOS_AEL304C"
                     /old_locus_tag="AEL304C"
                     /db_xref="GeneID:4620731"
     mRNA            complement(<71671..>72582)
                     /locus_tag="AGOS_AEL304C"
                     /old_locus_tag="AEL304C"
                     /product="AEL304Cp"
                     /transcript_id="NM_209909.1"
                     /db_xref="GeneID:4620731"
     CDS             complement(71671..72582)
                     /locus_tag="AGOS_AEL304C"
                     /old_locus_tag="AEL304C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL128C (PMU1)"
                     /codon_start=1
                     /product="AEL304Cp"
                     /protein_id="NP_984556.1"
                     /db_xref="GeneID:4620731"
                     /translation="MRFPSAMTVFALLDRALAAQDSSAKYTALPGYFQLFPHEGAGSV
                     AAPPAADPVNFVHAQSWEELFASVPSDAKLLIFQRHAEGLHNAAEARYGHEAWDDYWS
                     KIDGDEYGTWVDAQLTPKGHQQASASSEHVGALVRALGMPERLYSSPLRRCLETFIEA
                     WAPVAQYISEPVLDLYVREGLRETLGVHTCDRRVPHSQAVAAYQGHRLANSTLQLHYE
                     PYYTEPDTLWTVAHRETTPEIRNRVTKALDRILDRPERYIFVTAHSEMMDAALHALHH
                     PRVNHVPNAGILYLVVGHIRTPAQASG"
     gene            complement(<72783..>73112)
                     /locus_tag="AGOS_AEL303C"
                     /old_locus_tag="AEL303C"
                     /db_xref="GeneID:4620732"
     mRNA            complement(<72783..>73112)
                     /locus_tag="AGOS_AEL303C"
                     /old_locus_tag="AEL303C"
                     /product="AEL303Cp"
                     /transcript_id="NM_209910.1"
                     /db_xref="GeneID:4620732"
     CDS             complement(72783..73112)
                     /locus_tag="AGOS_AEL303C"
                     /old_locus_tag="AEL303C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR107W (SPG4)"
                     /codon_start=1
                     /product="AEL303Cp"
                     /protein_id="NP_984557.1"
                     /db_xref="GeneID:4620732"
                     /translation="MAGGIFEPFSVYNRSKHSKSGIVGGNHSNIGAGRTMLLFADEYR
                     EPKAQADAAHGAAVQAAGTGSEPASRKGSVGEGPNMVDLSTLSQAEFERLKATLRKGA
                     PNNRVNF"
     gene            <73455..>74783
                     /locus_tag="AGOS_AEL302W"
                     /old_locus_tag="AEL302W"
                     /db_xref="GeneID:4620733"
     mRNA            <73455..>74783
                     /locus_tag="AGOS_AEL302W"
                     /old_locus_tag="AEL302W"
                     /product="AEL302Wp"
                     /transcript_id="NM_209911.1"
                     /db_xref="GeneID:4620733"
     CDS             73455..74783
                     /locus_tag="AGOS_AEL302W"
                     /old_locus_tag="AEL302W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR332W (MID2) and YGR023W (MTL1)"
                     /codon_start=1
                     /product="AEL302Wp"
                     /protein_id="NP_984558.1"
                     /db_xref="GeneID:4620733"
                     /translation="MCSGGCAVPATQAAVCWRMVIAFLKSQSTVSGFIRLHRVADRWI
                     SRAVAAPQTLQPRYWLSRQHKSIHEIGGHSSGTHMRTFRLLLVAGALNVVLAQMMNNS
                     LSSSGSRPTALTPLPSSAESRTSSSGRVSTLSSAASSSEESSSAASSSSEESSSATSS
                     RAEESSSAESSSTSSSTSSESGSSESGSSSASVVSSTSANRMSSSSTSNSSETSSTEA
                     EPTPTSTSTSSSVTLPTSTTPPSTEATPTAIAPTSRMDTVTQTVQTEFMSDGSTFRTT
                     SLKIVTLLVDGSSTLTITASESQTTAPSRGLSKKDKNIIIGCVVGICVPLLIVIACVV
                     FYTCVREDRTNFINSDGKVITAYSTSRLSKWWSTLLGRKIDKYESDTPLGSTPLHDDE
                     RIHLKSSSAHHSSPLSMHGLDSRARSSHELMLDEERYYDNDGNELNGKKY"
     gene            <75105..>77978
                     /locus_tag="AGOS_AEL301W"
                     /old_locus_tag="AEL301W"
                     /db_xref="GeneID:4620734"
     mRNA            <75105..>77978
                     /locus_tag="AGOS_AEL301W"
                     /old_locus_tag="AEL301W"
                     /product="AEL301Wp"
                     /transcript_id="NM_209912.2"
                     /db_xref="GeneID:4620734"
     CDS             75105..77978
                     /locus_tag="AGOS_AEL301W"
                     /old_locus_tag="AEL301W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL167C (PMR1)"
                     /codon_start=1
                     /product="AEL301Wp"
                     /protein_id="NP_984559.2"
                     /db_xref="GeneID:4620734"
                     /translation="MGSVGKMSDNPFDSYLNRSKDDSSMETKSLASEAFLKPNASLEY
                     CTMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDP
                     LILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCH
                     LIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKS
                     CTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMN
                     SIEKPKTPLQMAMDRLGKDLSYVSFFLIGIIFLLGVIQGRSWLEMFQISVSLAVAAIP
                     EGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKI
                     WCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHG
                     KYLGNPTDIALLEVLQKFDLVDERPTTTRVDELTFNSKRKYMAVKVDSPANSGKHIIY
                     VKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTN
                     KPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQ
                     IGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIV
                     AMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFN
                     NIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGVEPVD
                     HEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIYVFIKEMTEDGQVTARDTTMTF
                     TCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQLCAIYIPFFQNIFKT
                     ERLSLGDLIYLIVISSSVFIADEVRKYYAKKNTHQDAYYFSMV"
     gene            complement(<78173..>79429)
                     /locus_tag="AGOS_AEL300C"
                     /old_locus_tag="AEL300C"
                     /db_xref="GeneID:4620735"
     mRNA            complement(<78173..>79429)
                     /locus_tag="AGOS_AEL300C"
                     /old_locus_tag="AEL300C"
                     /product="AEL300Cp"
                     /transcript_id="NM_209913.1"
                     /db_xref="GeneID:4620735"
     CDS             complement(78173..79429)
                     /locus_tag="AGOS_AEL300C"
                     /old_locus_tag="AEL300C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL169W (SUA5)"
                     /codon_start=1
                     /product="AEL300Cp"
                     /protein_id="NP_984560.1"
                     /db_xref="GeneID:4620735"
                     /translation="MQRSFSFLRRSGFHSAMSYNTKVLRVDPSAIHFSATAHIDGSLP
                     RISDPETEKHLLEAARLIRDDGETVAFPTETVYGLGGSSLNDASVRNIYKAKNRPSDN
                     PLISHVSSIAQLNRRIYQQDREGDVLRNIPVVYHELVRQLWPGPLTILLPINEETALS
                     VLTTAGQPTFAVRIPADPVARALIALSDTPIAAPSANVSTRPSPTAAEHVYHDLKGKI
                     PLILDGGSCRVGVESTVIDGLVNPPMLLRPGGFTYEEIIELGGEQWSHCKVENRMTVG
                     SGEKVRTPGMKYKHYSPRASTVAFAPINDDLPTSERMKIVTSEIMKYMTSHGTDKRQK
                     VGLLTSIMFPNNLLESITDEVDVVVYSLGSSGKEVQSNLFAMLRRLDEEDEVDLIFVE
                     GISDRNEGLAVMNRLRKAAGGNVVSF"
     gene            80103..80173
                     /locus_tag="AGOS_t0094"
                     /db_xref="GeneID:4620736"
     tRNA            80103..80173
                     /locus_tag="AGOS_t0094"
                     /product="tRNA-Gly"
                     /codon_recognized="GGC"
                     /db_xref="GeneID:4620736"
     gene            <80283..>81032
                     /locus_tag="AGOS_AEL299W"
                     /old_locus_tag="AEL299W"
                     /db_xref="GeneID:4620737"
     mRNA            <80283..>81032
                     /locus_tag="AGOS_AEL299W"
                     /old_locus_tag="AEL299W"
                     /product="AEL299Wp"
                     /transcript_id="NM_209914.1"
                     /db_xref="GeneID:4620737"
     CDS             80283..81032
                     /locus_tag="AGOS_AEL299W"
                     /old_locus_tag="AEL299W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL161C (YIP5)"
                     /codon_start=1
                     /product="AEL299Wp"
                     /protein_id="NP_984561.1"
                     /db_xref="GeneID:4620737"
                     /translation="MNSTRYDPVDSDDILFSADDDGFDAAEHVATGTSMSAGDPQLGG
                     GLFNTLAPYYAVTSEQLFHKTRSSLMLQKVQTLEMGNAATEIYSTVWIILSASIALYV
                     SRGLRTVLSEILRGQEDGGSHGQYQILVHVLWLFATYVVAVPLVFKLVVQYAFSEALH
                     GLELVQWYGFGCLVWIPLTPISLVLGLLPEGWAGLAHLILAIAGGAYSFMVIYIQLKD
                     DLSELSRGRAVMAMMAVMHLVFVLLIKLLIL"
     gene            complement(<81183..>82196)
                     /locus_tag="AGOS_AEL298C"
                     /old_locus_tag="AEL298C"
                     /db_xref="GeneID:4620738"
     mRNA            complement(<81183..>82196)
                     /locus_tag="AGOS_AEL298C"
                     /old_locus_tag="AEL298C"
                     /product="AEL298Cp"
                     /transcript_id="NM_209915.2"
                     /db_xref="GeneID:4620738"
     CDS             complement(81183..82196)
                     /locus_tag="AGOS_AEL298C"
                     /old_locus_tag="AEL298C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR009W (SUT2) and YGL162W (SUT1)"
                     /codon_start=1
                     /product="AEL298Cp"
                     /protein_id="NP_984562.2"
                     /db_xref="GeneID:4620738"
                     /translation="MLSSIAIDNQHADKTLPPLLLLPPVIHTEAQAAGGTGATTPVSS
                     YDAGLAGYGAGYEEGEADAAAEHKPVSPYSETSTTSSSLERLAFLATRKGDGSGQYGA
                     APDAYYVGRQAPAYQTPFYGGTVAPGAARSLTPNGAPRLQYEATYNTPRSPESARGVS
                     MSPLMSESASGFQRGDVQRTGSPPNSLLQEPTVITASKYKRQRTGPSCDICRSKKIKC
                     DATITILFQDASVTGSFNEMLHAPVNVSELANEWLSQIPDEVRQALLTKELTLLKHVD
                     KLIAFKPCTSCSKRKNCFCTFSKGFTRADINVYTNLCVKFGKRSSIDQFSLNDYRNCG
                     YQV"
     gene            <83369..>86056
                     /locus_tag="AGOS_AEL297W"
                     /old_locus_tag="AEL297W"
                     /db_xref="GeneID:4620739"
     mRNA            <83369..>86056
                     /locus_tag="AGOS_AEL297W"
                     /old_locus_tag="AEL297W"
                     /product="AEL297Wp"
                     /transcript_id="NM_209916.2"
                     /db_xref="GeneID:4620739"
     CDS             83369..86056
                     /locus_tag="AGOS_AEL297W"
                     /old_locus_tag="AEL297W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL163C (RAD54)"
                     /codon_start=1
                     /product="AEL297Wp"
                     /protein_id="NP_984563.2"
                     /db_xref="GeneID:4620739"
                     /translation="MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVPL
                     NSERTRHGERYGVRATRRAVTTYAEEGGARSEENDVGGKRIDALSAQRLSKDAQRLAG
                     IERTLRRSFSVPIKGYVPRHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGE
                     IPDETPREEPAQKENDGGNEEQARPTRRTATHPEKLSNGLRNKTLRELLGTVTETPKF
                     PSVPVVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQDDGTGKD
                     PGSKDSEPIVVEVLEETPTPTPTPTPTPSPEILDANAAMTRESNRGAYGCIMADEMGL
                     GKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDALSPLAID
                     GRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLMLADEG
                     HRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKN
                     FEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFV
                     NLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAGSTN
                     LIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQT
                     LDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLI
                     GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKIYQRQSMKMSL
                     SSCVVDEKEDVERLFSSDNLRQLFQFDSNTICDTHATYHCKRCRDGKQMIKAPAMLYG
                     DATTWNHLNHDALLKTNDHLLRNEHQFNDISYVFQYISH"
     gene            <86308..>87627
                     /locus_tag="AGOS_AEL296W"
                     /old_locus_tag="AEL296W"
                     /db_xref="GeneID:4620740"
     mRNA            <86308..>87627
                     /locus_tag="AGOS_AEL296W"
                     /old_locus_tag="AEL296W"
                     /product="AEL296Wp"
                     /transcript_id="NM_209917.1"
                     /db_xref="GeneID:4620740"
     CDS             86308..87627
                     /locus_tag="AGOS_AEL296W"
                     /old_locus_tag="AEL296W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL164C (YRB30)"
                     /codon_start=1
                     /product="AEL296Wp"
                     /protein_id="NP_984564.1"
                     /db_xref="GeneID:4620740"
                     /translation="MDELLSRAGSQAVSFAIKSSVSLASTYAIKQFTKFLTGVPQQDA
                     SRLQKLRRQLETRIDIINNAIVLIKLCVVRGNTNLKSTLSLILDLKDELAEFNGDMEM
                     LSSASVAGKLPASKNGKAGVDAVSLMEAKMSELIHRIELVIPLINLSMTTSGVSSSMK
                     LPSNVSPSLLLQASNYVVKSNEQALADNYEKDVQVGPLFSVTVYDIFDKSSKIIWKET
                     MARCDLRIVRISSNIPDRGVEYNYHLELKENFDDDRYHDIKEDKPRKLHWNVEQITRL
                     FFTMSGKLLNLEERDSPVLVLKLVKSLGGESGESNESLHWLAVGEYEPASDLRDSDDD
                     IPSPANADAEAPGQDSDNEDSYDSAQEDGTELEISSSLSLLEYIIKLTSLQNHDQASI
                     LDVKDERLSLYLNDENPNSVKRQPVVEDVTAKFSKISMKDELPVNKA"
     gene            complement(<88055..>89689)
                     /locus_tag="AGOS_AEL295C"
                     /old_locus_tag="AEL295C"
                     /db_xref="GeneID:4620741"
     mRNA            complement(<88055..>89689)
                     /locus_tag="AGOS_AEL295C"
                     /old_locus_tag="AEL295C"
                     /product="AEL295Cp"
                     /transcript_id="NM_209918.1"
                     /db_xref="GeneID:4620741"
     CDS             complement(88055..89689)
                     /locus_tag="AGOS_AEL295C"
                     /old_locus_tag="AEL295C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR008W (HAA1) and YGL166W (CUP2)"
                     /codon_start=1
                     /product="AEL295Cp"
                     /protein_id="NP_984565.1"
                     /db_xref="GeneID:4620741"
                     /translation="MVLLNGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTTCA
                     HCKELKKNRNAHPSGVCTCGREEKRRQLRAAKEEARVRGRRCRCADREACVCHKTRRR
                     RDDGEAGSASEQSSVDGHVMGSPHEPWDAASAASSLPPELSLESATPLGLEPLHAMKP
                     ITPLTRTHVGEVSIPLHEYVPAELDNSVQSANPLLNLNDRICLQDGAGREERLSFFAD
                     TSKARPNYSELKQRRLARAVDGTYAQSMRSASSTELASPAASASSASLLHTLNSSDSL
                     SSYLTAGGSAYYSTHYQDMLHHSFSHLGSMPLAPSPQSSATATHLTGGDQPPTSQFLD
                     SPDPAYRHPAYRHPASILHPPTGQAGDATAPAQCQVAPAMVQPVRQRSVSIHRNHRYE
                     KFPTSNPSQPKDSPLGPVAVLAAHSFQDLSSVGQSTRQDAFAYSNHSVVANDRQPSLP
                     RNPAPDSTFTAEFNQLLSESSNCLELDSIFSGNSVLWNGETLTSEARATLEGDVPSVS
                     EDARDDSQANSAQNGPEVLSLADTEYADLDSLITNL"
     gene            complement(<89998..>91098)
                     /locus_tag="AGOS_AEL294C"
                     /old_locus_tag="AEL294C"
                     /db_xref="GeneID:4620742"
     mRNA            complement(<89998..>91098)
                     /locus_tag="AGOS_AEL294C"
                     /old_locus_tag="AEL294C"
                     /product="AEL294Cp"
                     /transcript_id="NM_209919.1"
                     /db_xref="GeneID:4620742"
     CDS             complement(89998..91098)
                     /locus_tag="AGOS_AEL294C"
                     /old_locus_tag="AEL294C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YER145C (FTR1)"
                     /codon_start=1
                     /product="AEL294Cp"
                     /protein_id="NP_984566.1"
                     /db_xref="GeneID:4620742"
                     /translation="MSEKVFNVAVFFVVFRECLEAAVIVSVLLSFVNQSLGTNSPALR
                     KKLWWQVWLGVALGFLVCLIIGGAMIGVYYRYNSDIYGKSEDLWEAIFCFIATIMISV
                     MGLPMLRISKLQTKWRVKLAQALLEVPERKRDRFRFGALMKRYAMFLLPCITVLREGL
                     EAIVFVAGVGATSQGAAASSYPLPVIVGLIAGAAVGTLLYYGASRSSMQIFLIFSTCL
                     LYLIAAGLCSRGAWYAETYRFNMATGGDASESGSGNGSYNILQTVYHINCCNPSLDKG
                     WDIFNALLGWQNTGYLASILAYNLYWLVIIAIVSLMIYDERRGHLPFTRHRLRDLNPL
                     RRRRKELSAAEQDELFERAGRLGFEPDGRVAN"
     gene            complement(91402..91472)
                     /locus_tag="AGOS_t0095"
                     /db_xref="GeneID:4620743"
     tRNA            complement(91402..91472)
                     /locus_tag="AGOS_t0095"
                     /product="tRNA-Gly"
                     /codon_recognized="GGC"
                     /db_xref="GeneID:4620743"
     gene            complement(<91553..>92110)
                     /locus_tag="AGOS_AEL293C"
                     /old_locus_tag="AEL293C"
                     /db_xref="GeneID:4620744"
     mRNA            complement(<91553..>92110)
                     /locus_tag="AGOS_AEL293C"
                     /old_locus_tag="AEL293C"
                     /product="AEL293Cp"
                     /transcript_id="NM_209920.2"
                     /db_xref="GeneID:4620744"
     CDS             complement(91553..92110)
                     /locus_tag="AGOS_AEL293C"
                     /old_locus_tag="AEL293C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR008W (FAR7)"
                     /codon_start=1
                     /product="AEL293Cp"
                     /protein_id="NP_984567.2"
                     /db_xref="GeneID:4620744"
                     /translation="MEQEPHVIFMNPQTENLQNLYELVEKLARQLNKNKEQRQRLLRE
                     VDVLASKAQRGLGTSDFRKDARVVEEFLKRRGAGTGGGDGVESLRAQNSRLRALLAEK
                     QCNNDATLGLLAHHENSLALVVRLLREDVFQHHAALVARCRRAFNERLCAAEDSEFRA
                     YLENATSLQALIDISRVYQALLRLP"
     gene            <92361..>94250
                     /locus_tag="AGOS_AEL292W"
                     /old_locus_tag="AEL292W"
                     /db_xref="GeneID:4620745"
     mRNA            <92361..>94250
                     /locus_tag="AGOS_AEL292W"
                     /old_locus_tag="AEL292W"
                     /product="AEL292Wp"
                     /transcript_id="NM_209921.2"
                     /db_xref="GeneID:4620745"
     CDS             92361..94250
                     /locus_tag="AGOS_AEL292W"
                     /old_locus_tag="AEL292W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR007C (REC8)"
                     /codon_start=1
                     /product="AEL292Wp"
                     /protein_id="NP_984568.2"
                     /db_xref="GeneID:4620745"
                     /translation="MANYPSILLQYEDTEGTGHSGVSIAWLLSNFGTGSVTLASSGGT
                     GGSMKCKRRDILNVSIPETCKVISENGAELPLRFSSNLLYGVTVCYSKKTDFILSDVV
                     QMKGQLQRKLFGLESALRQGRIPEGAKDTVSAQEFLADDPLFDVAQWGNVRLELDGPD
                     GTRSLEIRQQDFLQELNNQDGSFVEAQAGRRGRLGSVDEELASIDMDLNFEIDDLVSE
                     DGRRRDELASERSEDEARFELNFNDPFEESQNQLPDVIEGSLLQEDEDMAPDAKHPRE
                     EDQAADAEQSPEPETKKRKIAGGAVGLGRLVCDEKISLATETLRDNHNKYAENMEMGR
                     KSGGVSVKGSAPGWHQLLAVQEQPVFLQKAFCDLLGSRNEDERMAHMERGRALARSSV
                     PSSRSSSVMSTEQGRRMGPGFDTMRRGSSQSDTQSNLLPVFLEDDQMQHDTQLDADDE
                     ALRGTDFMNADLLPSSIGRTTSRYGTADSGEHMDILRNTMQIQARNIASKRTDTASSQ
                     QSNVKHSSIDSEMKVAHSAGLDDQTRKFYEYIKERADFVGKTTRSHEPYHKKLLFEDL
                     IPSKVSQEDPENPHDYKAVSKRIAATAFLSLLNLASKELVRLETFDLEDKCEVMKGDD
                     LIIYC"
     gene            complement(<94484..>96139)
                     /locus_tag="AGOS_AEL291C"
                     /old_locus_tag="AEL291C"
                     /db_xref="GeneID:4620746"
     mRNA            complement(<94484..>96139)
                     /locus_tag="AGOS_AEL291C"
                     /old_locus_tag="AEL291C"
                     /product="AEL291Cp"
                     /transcript_id="NM_209922.1"
                     /db_xref="GeneID:4620746"
     CDS             complement(94484..96139)
                     /locus_tag="AGOS_AEL291C"
                     /old_locus_tag="AEL291C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR008W (RSC4)"
                     /codon_start=1
                     /product="AEL291Cp"
                     /protein_id="NP_984569.1"
                     /db_xref="GeneID:4620746"
                     /translation="MPPRKRKISEAADSAAEQVAVQRRYVAGKQPRAQEPLPKVDNRA
                     PLDPEEELFRDEDWSIPKLNLYITYTLDDLVEAYKPIFKDFIKLPSRKFHPGYFYKIE
                     QPISINEIKNRDYEYKDGEKQFLLDVELIRKNCYAYNETDSLIVKNSMQAVNYIKNEV
                     LKAKNITKNYLINDLIKERLLKVLEQLLESTELFIAQAMGNPTEGLDGELKLCHPFLE
                     LVSQEDFPDYYEVIHKPISLEMIKNNLQLGYYTKIYDFYVDVQLLFQNAQVFNDPETL
                     IYQDSQRLLRVFHKLMSDSFFPELKDSSERGEIKLEYDKVEYEQYLANTGQEDDNGSD
                     DDNNDDYDFNHYEGLGNGYNRSLLPSDYLLGPSKTEEKGKNAKAEEQEQPGVLKFNVI
                     KIAAAQCPNENSAIKVDAAEPFKMIDNIQLCSSTAIYEQSTRPLQGTLPAIDQSWVDF
                     YFDGKVLKENNNKFVITLPPIQTAITFKVRLNSRISEQIQALFMVNKEKVNPTPTMSM
                     EDNERRPRYDVRLAEGLNCLEFSMQDLKKSKVEAVKFWINVLP"
     gene            complement(<96325..>96744)
                     /locus_tag="AGOS_AEL290C"
                     /old_locus_tag="AEL290C"
                     /db_xref="GeneID:4620747"
     mRNA            complement(<96325..>96744)
                     /locus_tag="AGOS_AEL290C"
                     /old_locus_tag="AEL290C"
                     /product="AEL290Cp"
                     /transcript_id="NM_209923.2"
                     /db_xref="GeneID:4620747"
     CDS             complement(96325..96744)
                     /locus_tag="AGOS_AEL290C"
                     /old_locus_tag="AEL290C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR007W (MEH1)"
                     /codon_start=1
                     /product="AEL290Cp"
                     /protein_id="NP_984570.2"
                     /db_xref="GeneID:4620747"
                     /translation="MGIVFSCCSEAQDGEHDPLLDNQVAYGSQGNLDEDRQALELELQ
                     QKLLEREQELTVIVNNTNDKLIDISMMSNSGIVIQSHDMDEQDADSMPASVFVALDAA
                     RIPPEVKAQLAQLHKGVFHAAGTEVDTKDHEPLVVTL"
     gene            <97074..>97817
                     /locus_tag="AGOS_AEL289W"
                     /old_locus_tag="AEL289W"
                     /db_xref="GeneID:4620748"
     mRNA            <97074..>97817
                     /locus_tag="AGOS_AEL289W"
                     /old_locus_tag="AEL289W"
                     /product="AEL289Wp"
                     /transcript_id="NM_209924.1"
                     /db_xref="GeneID:4620748"
     CDS             97074..97817
                     /locus_tag="AGOS_AEL289W"
                     /old_locus_tag="AEL289W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR006C (MRPL13)"
                     /codon_start=1
                     /product="AEL289Wp"
                     /protein_id="NP_984571.1"
                     /db_xref="GeneID:4620748"
                     /translation="MLCARAPAVARFRALHTGPVTKDLFSWLKRGKSKEEAVEKPADT
                     KELIGKIESGSSGTQSVARKVLKLKLEPSDFVGMDEAQLARQLHRERLEKVQFRRWLS
                     QEKLSKPEELRTLVAAAYETTFGAPGDAAALEQRFPDLRSMFIFAKHMQASTGYIMPD
                     AQLTRLHTPAAVAQWYERNVLTGKLQKFREELPNAIDLSDADLPVNVVVREHVLPKVQ
                     RKTLNAVLREVSALETSKAKAALERAKAT"
     gene            <98045..>98974
                     /locus_tag="AGOS_AEL289WA"
                     /db_xref="GeneID:9487575"
     mRNA            <98045..>98974
                     /locus_tag="AGOS_AEL289WA"
                     /product="AEL289W-Ap"
                     /transcript_id="NM_001355326.1"
                     /db_xref="GeneID:9487575"
     CDS             98045..98974
                     /locus_tag="AGOS_AEL289WA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR005C"
                     /codon_start=1
                     /product="AEL289W-Ap"
                     /protein_id="NP_001342260.1"
                     /db_xref="GeneID:9487575"
                     /translation="MYVLVLLFFLAAGRQAFGQLVDVLDDCPLVYSKLLKLQPNIGGC
                     ARGLEECLFGRIMGNTRLCATCLGILDGGEREARCECFQCLLDNFVYGCTRQPCVREA
                     VRGAQRPDAPTSHLRPQRLLPRALLADETLHRQLYSDKYRSVVSVLVDAINSNRGRGN
                     VRCGGSTDGTAGYAMGNWSDAGDDRSSNHSTLDRAATAAEAMNTTYVSRSPSSKGGHA
                     FVVSVAAATLAVFSIFGFSGANSFLRRTTQPHEAPASASSGALTLFGDVDLDYLGDSD
                     IEGEQLEALSVPIPLSGQSSLDMFDALNEARIF"
     gene            <99089..>100180
                     /locus_tag="AGOS_AEL288W"
                     /old_locus_tag="AEL288W"
                     /db_xref="GeneID:4620749"
     mRNA            <99089..>100180
                     /locus_tag="AGOS_AEL288W"
                     /old_locus_tag="AEL288W"
                     /product="AEL288Wp"
                     /transcript_id="NM_209925.1"
                     /db_xref="GeneID:4620749"
     CDS             99089..100180
                     /locus_tag="AGOS_AEL288W"
                     /old_locus_tag="AEL288W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR004C (ECM9)"
                     /codon_start=1
                     /product="AEL288Wp"
                     /protein_id="NP_984572.1"
                     /db_xref="GeneID:4620749"
                     /translation="MTLDLTKQLYETITTGEHPNVQLRLQPPQPGYEGIVAIPNDGST
                     EVVCFQEAFCEIFLECHKIIANCLGDRGGPLPRETFMATVGLLFTSYENRSALNLHER
                     LFLEKMDSSGGTETLDREIRYVEALLTSNIGKLNKSSSLWLWYRKLVLLQREKCSSVG
                     TRVIEVCKRSAELHFANYYCWNTLRWYYDVLEWSHEDVAPVREMVRKFAFSHLRDVSA
                     WDALSYLYSDGGAYTSSDYTRIAQSFGLDAQLKTPLETAVQIRCEKATEVARELIRFI
                     DTCEVCEWNAYRCLYLLLQYSNCNIAELVTQWQQELDSFERNVILVRGYPKLPQLAPG
                     DDILEQKRQKQMMNKKRLLHMVHKAQDGE"
     gene            complement(<100320..>101669)
                     /locus_tag="AGOS_AEL287C"
                     /old_locus_tag="AEL287C"
                     /db_xref="GeneID:4620750"
     mRNA            complement(<100320..>101669)
                     /locus_tag="AGOS_AEL287C"
                     /old_locus_tag="AEL287C"
                     /product="AEL287Cp"
                     /transcript_id="NM_209926.2"
                     /db_xref="GeneID:4620750"
     CDS             complement(100320..101669)
                     /locus_tag="AGOS_AEL287C"
                     /old_locus_tag="AEL287C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR001W (OSH7) and YKR003W (OSH6)"
                     /codon_start=1
                     /product="AEL287Cp"
                     /protein_id="NP_984573.2"
                     /db_xref="GeneID:4620750"
                     /translation="MVISKALKNLGGYAGLTAGPEVERGVSSAANAQAPASSQGGQVL
                     DTDDIDENDESGQNILMSIISQLKPGSDLTRITLPTFILEKKSMLERITNQLQYPNIL
                     LDAHAEKDELLRFVKVVKWYLSAWHIAPKAVKKPLNPVLGEYFTAYWDLPNKQQAFYI
                     AEQTSHHPPKSLYFYMIPESNIRVDGATIPRSKFLGNSTAAVMEGLSVLQFLDIIDPR
                     TGKPEKYTLTQPNMYARGILFGKMRLELGDHMLIKGPRFHVDIEFKTKGFISGTYDAI
                     EGVVKDYNDKSYYEITGKWNDVMHIRDLRVKGAPVEVFFDVHSSVPLKPKVRPIEEQG
                     EYESRRLWKPVTDALAIRDHKVATDEKFKIEDYQRTLAKRRAEEGVEFHPKLFRPVKP
                     GSDLEFYIYKNIPEGDDPEQQIKSILEIAPILPGQAFTEKFSIPAYEKHELQKRESL"
     gene            102290..102383
                     /locus_tag="AGOS_t0098"
                     /db_xref="GeneID:4620753"
     tRNA            join(102290..102326,102349..102383)
                     /locus_tag="AGOS_t0098"
                     /product="tRNA-Gln"
                     /codon_recognized="CAG"
                     /db_xref="GeneID:4620753"
     gene            complement(<102552..>104429)
                     /locus_tag="AGOS_AEL286C"
                     /old_locus_tag="AEL286C"
                     /db_xref="GeneID:4620754"
     mRNA            complement(<102552..>104429)
                     /locus_tag="AGOS_AEL286C"
                     /old_locus_tag="AEL286C"
                     /product="AEL286Cp"
                     /transcript_id="NM_209927.2"
                     /db_xref="GeneID:4620754"
     CDS             complement(102552..104429)
                     /locus_tag="AGOS_AEL286C"
                     /old_locus_tag="AEL286C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR054W"
                     /codon_start=1
                     /product="AEL286Cp"
                     /protein_id="NP_984574.2"
                     /db_xref="GeneID:4620754"
                     /translation="MSFQLFARTPAGPQIFEAYPSFQQVESPEVSGFITSKTSPCGRF
                     LAVSSENGVRVFKNERFQELLLELALKDVYDLEFSPGGSYLSTWERPHVDNEQHDNVK
                     IWFLNEDEPSAEQPKFQYQAKTQNAWSLQFSKLDNYALKRFGKELRIAKLDHSSPEFN
                     FNQPYARLVPEGHLSTYLISPAEHPTICTFSAEKEGKPAQLTIYPITEGNIQKKIASK
                     MFFKADSCQLKWNDLGNAVLCLAITDFDASNKSYYGENTLYLLSFQGVNGSLGGDSVR
                     VPLGKEGPIHDFTWSPTSRQFGVIYGYMPATITFFDLKGNAVHSLAEQRKNTMIFSPS
                     GRYILIAGFGNLQGAVEILDRHDKFKCFSKFDAANTSTCKWSPGGEFILTATTSPRLR
                     VDNGLKVWHVTGKLCFVNEYTELLEASWRNACKYRPKRPDSHVILNWDSSKVEAAKDP
                     AIVPSQLEVHPSVSAYSLKNPNKKNGGSSVSKPVGAYKPPHARRAAASNTSSPKSSVP
                     GMTFKPTKSVVPGMAPKETKSAAKNRKKRENTGIRKGPDSDGGSSNGTTPEPKEPPKV
                     NKETSPEEKKIRSLLKKLRAIESLKMRQADGDKLEDTQILKIQTEQAVLQELDYLGWK
                     P"
     gene            <104700..>105572
                     /locus_tag="AGOS_AEL285W"
                     /old_locus_tag="AEL285W"
                     /db_xref="GeneID:4620755"
     mRNA            <104700..>105572
                     /locus_tag="AGOS_AEL285W"
                     /old_locus_tag="AEL285W"
                     /product="AEL285Wp"
                     /transcript_id="NM_209928.1"
                     /db_xref="GeneID:4620755"
     CDS             104700..105572
                     /locus_tag="AGOS_AEL285W"
                     /old_locus_tag="AEL285W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR053C"
                     /codon_start=1
                     /product="AEL285Wp"
                     /protein_id="NP_984575.1"
                     /db_xref="GeneID:4620755"
                     /translation="METPAGDAHGKGCGGSNERLCPSLAGRFRRAGQEPWERANPYTS
                     QAGSYIEYWTQGRSQHRADETKRRRLDMLNRVVLQRQMLGPLRGHWRSMGGGPSAEEL
                     RRRANMGEMLTYLQEKVPLLLSETIEDARLAPDVVLRLMPLSRPYLPEFHGHAQYKTV
                     WKGLQMVVNTFVVRQPCAIGVRNLHVDEANRLIRISWATTEGPEGEAAPSAQAGGTDH
                     EELRRHLGHRLDEQWVRSLARGTHVKTRVVSGVFLFELDPTNERICSHIVDNVTMIDE
                     TEEDQGAKKGAFAV"
     gene            complement(<105716..>107155)
                     /locus_tag="AGOS_AEL284C"
                     /old_locus_tag="AEL284C"
                     /db_xref="GeneID:4620756"
     mRNA            complement(<105716..>107155)
                     /locus_tag="AGOS_AEL284C"
                     /old_locus_tag="AEL284C"
                     /product="AEL284Cp"
                     /transcript_id="NM_209929.2"
                     /db_xref="GeneID:4620756"
     CDS             complement(105716..107155)
                     /locus_tag="AGOS_AEL284C"
                     /old_locus_tag="AEL284C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR052W (FMP48)"
                     /codon_start=1
                     /product="AEL284Cp"
                     /protein_id="NP_984576.2"
                     /db_xref="GeneID:4620756"
                     /translation="MHGNHRYKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDN
                     PEQLQKVAALVHNEYAILRRLGTHRNICQLLDFYEDADTYVFVLEYCAYGDLYDFIKA
                     IRERPTMRINFHSFLFQLCSAISYCHSKDVSHRDIKPENVLMDDRGQVKLTDFGLSQI
                     GSVSKDYCIGTEKYLAPETFLREYHNTFATDYWSLGITIFCLMFGSCPFESASTAAPK
                     RSANFQRFLRDPHRFVESYYLDAMFAELAPPASLGSLVGLCNADCAPSYWLELPKDRI
                     LFLCAIANLVITHLVNVDPAARDMHAFWEKVNALFLENGSGRMLQKEALVPQPKSCEN
                     DGGEANVPASPISRSQTQYTSDQGSNYMNPHAFGTAAHAAGTGASSVALTATPSLCDW
                     LHTTPAAPRSVGADPYQDLLDAAVEDAIRQGSLAGFDQKGLEQDSRDGHGTGSCDGDL
                     WSLSELRPYSTMATATSHETENKCRGWIF"
     gene            complement(<107858..>108463)
                     /locus_tag="AGOS_AEL283C"
                     /old_locus_tag="AEL283C"
                     /db_xref="GeneID:4620757"
     mRNA            complement(<107858..>108463)
                     /locus_tag="AGOS_AEL283C"
                     /old_locus_tag="AEL283C"
                     /product="AEL283Cp"
                     /transcript_id="NM_209930.1"
                     /db_xref="GeneID:4620757"
     CDS             complement(107858..108463)
                     /locus_tag="AGOS_AEL283C"
                     /old_locus_tag="AEL283C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR356W (ATG33) and YGR049W (SCM4)"
                     /codon_start=1
                     /product="AEL283Cp"
                     /protein_id="NP_984577.1"
                     /db_xref="GeneID:4620757"
                     /translation="MSVCLVVTKSVATATLGIYTGMVVTRQLVLSPQEWIGVRKSAQK
                     NAFGGSELYSLASGALASVSTLFFGVSYFGAPVHWRHPYLLYCALGIPLTWALATVGN
                     CERTHLLAKLLGCGAGAGHTSAAEEEDTTSAGEEHDDIISEDSIVDLSRHTSSEDHSA
                     AKDATACAAAAPGCAFARYTSALVAVLVFAANVVGCLGEAL"
     gene            <108796..>110706
                     /locus_tag="AGOS_AEL282W"
                     /old_locus_tag="AEL282W"
                     /db_xref="GeneID:4620758"
     mRNA            <108796..>110706
                     /locus_tag="AGOS_AEL282W"
                     /old_locus_tag="AEL282W"
                     /product="AEL282Wp"
                     /transcript_id="NM_209931.1"
                     /db_xref="GeneID:4620758"
     CDS             108796..110706
                     /locus_tag="AGOS_AEL282W"
                     /old_locus_tag="AEL282W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR190C (RPC82)"
                     /codon_start=1
                     /product="AEL282Wp"
                     /protein_id="NP_984578.1"
                     /db_xref="GeneID:4620758"
                     /translation="MNGSMGAAGGQVENERAAEVPVSTLEMRTLSPETFLYTEVARSH
                     LGERAGRVIELLLNKGRLSVSELVHLAPELGSKSVRTVLVSLIQLRCVQYLEETTVSG
                     RKITYYYFNEDGFQLMLYAGDIVAAVESQFEADDAKEIAAQIVQNVLALGSLTTKDYM
                     QSLASDVSVNDVASMFVKLVELGFLVPLSNVHYMPLADLWDVLYKKEYNAIPKNSTLS
                     DAKKRAETKAKTKVQFNTLLKNVEMSNVLMTDMQTSMRRVQDNLPLTFNFGRYMKHRR
                     SRQLVQFARSRVGSVPAMIYKVALKITEQCARALSDPLCETGLMQELEEQLAIQEDMA
                     LDDEKLPGVTFNAVDISRNLPNNIDLRGTLTSMQRRSQERSTHQGQSHKRLKAEDGMA
                     VAVNHLATVEEEAEGDELLHGSDDDMDMFFDEGDSDPKSVSLINGHLKLLSTGSVPFL
                     IESRPGLFYVPYSKLMPILKEAVYDAIIASTLGPSAHRILRCVRDNSLVSEKVINNTA
                     LMREKDIRSVIATLVKYNAVDILEVPRTADRAASRAVFLFKINEKHAYDFMKQNLAWN
                     IANSIHKTEILKEENFTLLSKAQRDDVKGREAELLLPSELNQLKMVNERELNGHARKI
                     RLLSMWEVFKML"
     gene            complement(<110771..>114943)
                     /locus_tag="AGOS_AEL281C"
                     /old_locus_tag="AEL281C"
                     /db_xref="GeneID:4620759"
     mRNA            complement(<110771..>114943)
                     /locus_tag="AGOS_AEL281C"
                     /old_locus_tag="AEL281C"
                     /product="AEL281Cp"
                     /transcript_id="NM_209932.2"
                     /db_xref="GeneID:4620759"
     CDS             complement(110771..114943)
                     /locus_tag="AGOS_AEL281C"
                     /old_locus_tag="AEL281C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR189W (SKI3)"
                     /codon_start=1
                     /product="AEL281Cp"
                     /protein_id="NP_984579.2"
                     /db_xref="GeneID:4620759"
                     /translation="MAPNVKQCLKGAKQALAAQDWATAVEYSLQVLDVDARSYYAHVF
                     LGKAYSMEGNWKESLKHYDCAIEENPRELVAWKGLFVLLRDANGMLSHEEYFQRCSEY
                     AEVLVTLQLPQIELIDQLRDYVRQHPDAEEAYLWQLRPGMPLAEQLGRNLLEPQEALK
                     RLLSKVNAREEREVARLVSRERLKLSKNDTDYTFKLNSVAWQVYESSPVDELYEQLVN
                     VIYDDAERRQMEHQWLEHRIKLLSAMPSGDKPAFYLQVKTMVDDMVLVDHDSSLAWRL
                     HLEWQDCVSVYDLDLERISMFIRKFPTEPLGVLLLAWICSKFSNYDAKLFYKMTFGEK
                     EEINTVSGELEEPGENLHPEFANAVDTGSQERLSETDVVQVLRDLQHLQKSILAHRIV
                     SQYFVNLEEYEFVLPYIKNGITLVAQAIRDLGARLINAKRDLSLDYATVYTYLESPKY
                     HSIALSLFDKVLADDPQNYRAKLKKSHILIERKQWDEAYALLKGVVDRHPHLYDAHSA
                     FGWCQLQLGDTESALETFQLIINNVKSSDGTSSQFISSVHWRTAQALITKQQHEDPSG
                     NEFIKIAFQHLVQSLKITDLFAPGYSLLGHIYEVYFQDLTRAFRCYVKAFELDAGDLV
                     AAKYMVEYYSDLCNWQAAANICDRVIKNDMHLNSVNWPYRVLGVYYLELQQEAESIEW
                     FQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELSPEHKYAGLFLAISLCQ
                     LSEFEKSLEALRKLVNKYPQEAIFKERLSATLVEHALQFFDQGYLIKAATCAAEVISI
                     IEGIVSEQVEYTTNMWITLSKALNIFISTRSQFDNLPLAKLTSILDKCPLKNTEEVDL
                     IDMTSFENLLNGDSDLNISVALQFLILSSKCCIATSDYENLSRTVRASLWYNLALAEL
                     TAYLILKEMRYCDAATYCFKRSIKYQSNFFASWVGLGISSMNLNYRVSQHCFIKANAL
                     APKEPTIWFNMSLLALKCHDVEFAKLVLNQLHGLAPQMPHSWFAKALTLEKEGDINES
                     TRMFAYAFLISNGRYKPVQLLYAKAALNRHIANNEDERDIEPNLELSTIAYGLGQYLK
                     KCPDDLLALQCAILTYERLCKFTAASHLINDVALILENRFEKSQDERELINYGIIKTQ
                     LARTQLGLAKFENAIEDASLALGILEGNDTPDAKRALLSNYIVLGLGHYFSGDFDQAL
                     EFFKILLSDYGNSSEVTLMISRTIYNFGGEEAIDIALQELSEYRTTHGLDLLVVITMA
                     VICLMENKVDQLSILMKDLANLPLKGILSDKYKDVPLVMDEISRALNLRAPSKILWQR
                     SAFFTPNNADVWKQLDYTTSNRITHSGQCKVTANHLSNTCFKLGTLSKTQLGIYLCPW
                     NKEGVKLLHDHF"
     gene            <115074..>115550
                     /locus_tag="AGOS_AEL280W"
                     /old_locus_tag="AEL280W"
                     /db_xref="GeneID:4620760"
     mRNA            <115074..>115550
                     /locus_tag="AGOS_AEL280W"
                     /old_locus_tag="AEL280W"
                     /product="AEL280Wp"
                     /transcript_id="NM_209933.1"
                     /db_xref="GeneID:4620760"
     CDS             115074..115550
                     /locus_tag="AGOS_AEL280W"
                     /old_locus_tag="AEL280W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR188C (MLC2)"
                     /codon_start=1
                     /product="AEL280Wp"
                     /protein_id="NP_984580.1"
                     /db_xref="GeneID:4620760"
                     /translation="MSLTNNQPVNLSQYTQEQIKTLKDAFQLLDEDGDGVISAQDLDK
                     IWQSLGKKMSSSEIAEMLGRSELDQVTFPVFLSLMSGSLGALPDEGDIRDALELFSKP
                     GDPDLNCDAGELREYLRISGFAVDEAFERLLRSFVAQSVTGQQLFKGKRFLDAVSE"
     gene            complement(<115594..>116115)
                     /locus_tag="AGOS_AEL279C"
                     /old_locus_tag="AEL279C"
                     /db_xref="GeneID:4620761"
     mRNA            complement(join(<115594..116038,116096..>116115))
                     /locus_tag="AGOS_AEL279C"
                     /old_locus_tag="AEL279C"
                     /product="AEL279Cp"
                     /transcript_id="NM_209934.1"
                     /db_xref="GeneID:4620761"
     CDS             complement(join(115594..116038,116096..116115))
                     /locus_tag="AGOS_AEL279C"
                     /old_locus_tag="AEL279C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR187W (RPO26); 1-intron"
                     /codon_start=1
                     /product="AEL279Cp"
                     /protein_id="NP_984581.1"
                     /db_xref="GeneID:4620761"
                     /translation="MSDYEEAFNDGPEHFEDFEQEHFSDDGFEQEAEFQDGETKDING
                     TTVVTGGTGVEDFQQQEQHRRRTLKEKAIPKEERTTTPYMTKYERARILGTRALQISM
                     NAPVFVDLEGETDPMRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL"
     gene            <116279..>117709
                     /locus_tag="AGOS_AEL278W"
                     /old_locus_tag="AEL278W"
                     /db_xref="GeneID:4620762"
     mRNA            <116279..>117709
                     /locus_tag="AGOS_AEL278W"
                     /old_locus_tag="AEL278W"
                     /product="AEL278Wp"
                     /transcript_id="NM_209935.2"
                     /db_xref="GeneID:4620762"
     CDS             116279..117709
                     /locus_tag="AGOS_AEL278W"
                     /old_locus_tag="AEL278W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR186C (PZF1)"
                     /codon_start=1
                     /product="AEL278Wp"
                     /protein_id="NP_984582.2"
                     /db_xref="GeneID:4620762"
                     /translation="MCSCQAIWSWIDQSDQSGCVLFASVAQPLGRHRNLGAPSLEQVK
                     IGGKSSPDRAHLTIIGCAARSRGKGMEAHKLVHGLEELPVDEVTDYALSRTTSAGSTV
                     SLSSVESTASSTRRKTHYCDYEGCYKAFTRPSLLTEHQQTAHQGIRAYQCEQCGRGFT
                     KKSHLERHLFSHSETKPFSCTVCGKGVTTRQQLRRHEITHTKSFKCPHEGCGEAFYKH
                     PQLRSHVLAVHEQKLTCTHCDKRFQRPYRLKTHIAKHHGPASQFRYQCTNAGCVQCFE
                     TWSALQQHLHTDHPKLPCGVCGKLCVGETGLQMHMTVHDESRVIKNWKCSVCSDTTYA
                     KMADLLAHYMETHGDAIPKELIEHVNAESPAVVHVDEQQREDPEIVRPQKRRKNSDNT
                     IMGSLQTEEKIRKLIESGRTGLSLLLNTAGRKKRCPYLGCSRVFKTEDKYDLHISKHK
                     INDLKVKLLEDKLKTEAAAGKDPACG"
     gene            complement(<117929..>119908)
                     /locus_tag="AGOS_AEL277C"
                     /old_locus_tag="AEL277C"
                     /db_xref="GeneID:4620763"
     mRNA            complement(<117929..>119908)
                     /locus_tag="AGOS_AEL277C"
                     /old_locus_tag="AEL277C"
                     /product="AEL277Cp"
                     /transcript_id="NM_209936.2"
                     /db_xref="GeneID:4620763"
     CDS             complement(117929..119908)
                     /locus_tag="AGOS_AEL277C"
                     /old_locus_tag="AEL277C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR185W (ATG13)"
                     /codon_start=1
                     /product="AEL277Cp"
                     /protein_id="NP_984583.1"
                     /db_xref="GeneID:4620763"
                     /translation="MAMESECNVVELIGGFFLKATLLVCQPRTGAIEGDGEEDRTFNI
                     SSAADAGVAEAVRAWTAYDGAQELPPLVIEMFLDLRRLGPQHTVVLKDQDGNPWNVCK
                     GGKKSEIMLERWLVELDVGNEEARPEEPPNAAEIYKQLVLLFRYLYTLTQLLPANELY
                     ARLHGPSNQGEAAMPLINIGTRILDGSKPILSKGRVGLSRSIIATYTNVINETNVASH
                     LEQKKITPISTGYGSLRITVSYRRDCNFDVNEVLDYEGNNCSSSSVVDTHTKPGVGPL
                     SSLRRVSIHSNRSMSISPQTVYSGTVIPDPSPQRKSSSSRIQPFKAGSVGSGSLAIAR
                     NPSGSSAVATLRAQRSGSASISTHVADQAVGEPSSVGSGGSKYSSSFGKIRRQSSMRR
                     SGSLELPAAKQAKPGERGSDELLDFVKMLEEKQELNVKKLYGTTTDISSSLVRFQSMK
                     SNNDTLSEDLSMSYSLEPTHAPQVRYRSNSHSPIPSISPSVQYTSIPMRLSQSRNVSQ
                     TELASRKNSAERLKTLISSRTGSFSESRRQSNAGQEDILEDEDDEAEEILLSKSHLSN
                     PTGTRLQSMSPQSLKSISSYNRAAVPFKPVSNFSCPTTMATPAHAKLHKASISSSPDN
                     QSGLVKKDHEHSTMTGGDDDDDLLFFMSDMNLSSQ"
     gene            complement(<120334..>124890)
                     /locus_tag="AGOS_AEL276C"
                     /old_locus_tag="AEL276C"
                     /db_xref="GeneID:4620764"
     mRNA            complement(<120334..>124890)
                     /locus_tag="AGOS_AEL276C"
                     /old_locus_tag="AEL276C"
                     /product="AEL276Cp"
                     /transcript_id="NM_209937.1"
                     /db_xref="GeneID:4620764"
     CDS             complement(120334..124890)
                     /locus_tag="AGOS_AEL276C"
                     /old_locus_tag="AEL276C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR184W (GDB1)"
                     /codon_start=1
                     /product="AEL276Cp"
                     /protein_id="NP_984584.1"
                     /db_xref="GeneID:4620764"
                     /translation="MAVPKASSCMTSEASFRSQQRAQTAMKTVLLRLDDNGEPVRGEV
                     GKGVLTLPCLPVGRDAGEDSGLRVRLVVAAGSPVTRDGLVWTNCPPERNTKFQRNKFY
                     KHLLSAGFLEDSCVDVDVYVPGSYCYYVSFRNEREQLETTRRFYFVVPPVLSLGEQLV
                     PMNTLAVQSVVSKWMGTDWEPIFRKISGKGYNMVHFTPLQARGESNSPYSIYDQLQFD
                     LAHFHSAEDVSRMVGKLHRDYRMLAMTDVVFNHTANNSAWLLEHPEAGYNGETAPHLL
                     AAIELDRQLLQFSRDLAALGYPTNLRTVDDLLRVLDGIKTHVLSELKLWEYYVVDVQS
                     TLTELAHMWEKVDAIDEGVPNQYREDLHWIATYTCQRAAQPGFGSLAGRFSNKIDADK
                     FISILKGLYGASWRPGHLDSAHKILDEINLPLYKEYDADIGEILEQLYNRIRYLRLDS
                     NGPQLGPITEQDPLTEPYFTWVEAKDGKQYALANNGWIWNGNPLVDFASEKSKSYLRR
                     EVIVWSDCVKLRYGASPHDSPYLWSRMTQYIEMNAKIFDGFRIDNCHSTPLHVGEYFL
                     DLAREINPNLYVAAELFSGDEALDCLYVERLAISSLIREAMQAWSEEELSRIVHRHGG
                     RPIGSYKYMPLTYFSSPKEGENYNGVTKSIDNEYTLPVVCTATAPHALFMDCTHDNET
                     PYQKRTLQDTLPTAALVAFCSSAIGSVYGYDEIFPRLLDVVTEDRTYSVVEGDGISMV
                     KAQLSNIRKLVASSMGDIEDSEMHVHHDGQYITFHRTNSKTVEGWFLVARSKFREGDP
                     EQRLPDITLAGVKCELEFSYALEQTGDVPDDNGKVILGIPTRLSELSGFEVKYEPDSN
                     VSTISMPGYFPQGSIAVFKTSMVGMDDELEGFISAGITRATQNLNLYSLNSVLYRCKA
                     EEMDRTGNKNSVYNIPGYGDLVYCGLQGWVSVLKDIIPENNLAHPLSEHLRNGTWAPD
                     YIVNSLDWYNNEPGVKDIQNWFRTKFERIKSLPYYLIPRYFALVVGIAYVACHRKAMS
                     LMTNTIGTSTMFIQQLAMVSVQMVSNISSASLLPDRTVPSMAAGLPHFSTHYMRCWGR
                     DVFISLRGLLLVTGRFEDAKMHILAFAKTLKHGLIPNLLAAGKDPRYNARDAAWFFIQ
                     SIQDYISIVPNGEQILEERVTRRFPLDDTYIPYDDPAAFSYSSSIRDIIFEILSRHAL
                     GIKYREANAGPRLDSVMSDRGFNVEIHVDWSTGLIHGGSQYNCGTWMDKMGESKLAGT
                     YGVPGTPRDGAAVEINGLLKSALRFVLELHSRGLFPHTAVPRADGSLISFVAWNDLLQ
                     ANFERKFYVPEDPSEDSSFDIDPSLVNRRGIYKDLCHSGKPYEDYQLRPNFTIAMTVA
                     PELFSPQRAQRALAIADRVIRGPVGMRTLDPSDYNYYPDYNNGQDSTNPHTARGRNYH
                     QGPEWIWCYGYFLRAYARFSAAPASALHQRLQQRLRNHRTWLVTSPWAGLTELTNRDG
                     AYCHDSSPTQAWSASCLLDLLYDV"
     gene            complement(<125220..>126017)
                     /locus_tag="AGOS_AEL275C"
                     /old_locus_tag="AEL275C"
                     /db_xref="GeneID:4620765"
     mRNA            complement(<125220..>126017)
                     /locus_tag="AGOS_AEL275C"
                     /old_locus_tag="AEL275C"
                     /product="AEL275Cp"
                     /transcript_id="NM_209938.1"
                     /db_xref="GeneID:4620765"
     CDS             complement(125220..126017)
                     /locus_tag="AGOS_AEL275C"
                     /old_locus_tag="AEL275C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR183W (DPM1)"
                     /codon_start=1
                     /product="AEL275Cp"
                     /protein_id="NP_984585.1"
                     /db_xref="GeneID:4620765"
                     /translation="MSIENSVVVPAYHERPNIKPLATRLFAALGNADSKKTELIFVDD
                     NSQDGSVEEVEALAKQGYNVRIIVRTDERGLSSAVLKGFYEAKGEYLVCMDADLQHPP
                     ESVPLLLDSLRTHPFVLGTRYAPGVGIDKDWPLYRRVISSSARMMARPLTTASDPMSG
                     FFGLQRRYLVNDDAKGINSEGFKIALDLLVKLPLPADRPIGEVPFSFGLRTEGESKLS
                     GKVIVQYLKQLRELYAFKFGTSNLFLFLFFWAILAVYLFIQLASALA"
     gene            complement(<126262..>126570)
                     /locus_tag="AGOS_AEL274C"
                     /old_locus_tag="AEL274C"
                     /db_xref="GeneID:4620766"
     mRNA            complement(join(<126262..126513,126562..>126570))
                     /locus_tag="AGOS_AEL274C"
                     /old_locus_tag="AEL274C"
                     /product="AEL274Cp"
                     /transcript_id="NM_209939.1"
                     /db_xref="GeneID:4620766"
     CDS             complement(join(126262..126513,126562..126570))
                     /locus_tag="AGOS_AEL274C"
                     /old_locus_tag="AEL274C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR182W (SMX3); 1-intron"
                     /codon_start=1
                     /product="AEL274Cp"
                     /protein_id="NP_984586.1"
                     /db_xref="GeneID:4620766"
                     /translation="MPDLNPTNPKPFLRQLVDQYIVVTLKFNNTRYRGKLMSTDNYFN
                     IRLTEAEEFIGDVSKGMVGDLFIRCNNVLWIGEDLTRAEQQH"
     gene            complement(<126705..>127877)
                     /locus_tag="AGOS_AEL273C"
                     /old_locus_tag="AEL273C"
                     /db_xref="GeneID:4620767"
     mRNA            complement(<126705..>127877)
                     /locus_tag="AGOS_AEL273C"
                     /old_locus_tag="AEL273C"
                     /product="AEL273Cp"
                     /transcript_id="NM_209940.1"
                     /db_xref="GeneID:4620767"
     CDS             complement(126705..127877)
                     /locus_tag="AGOS_AEL273C"
                     /old_locus_tag="AEL273C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR459W (GAB1)"
                     /codon_start=1
                     /product="AEL273Cp"
                     /protein_id="NP_984587.1"
                     /db_xref="GeneID:4620767"
                     /translation="MNRREKQVVIACVGSRLLISLAFPSLQQQLDNAVEFSTPVTSFR
                     SLQEGVFLLQNNLPVYDGGVVHHLPLLVTLMSVVTADVAYSVLYAVMDALVAYQLMAI
                     SRQFKQLSTPSWVPGALYVVNPLVLLSCVSRSTVLFSNLALTTALLAALRDEALLAAV
                     AIAAAGYLSFYAGFLVVPLLAVLQRGRLLTAVVAALCLALFQLASYRLSDNSWVYLRS
                     SYGVIITFSKLMPNLGLWWYFFIEMFDFFIPFFKAVFNIFAVAFITPFSIRFWQQPFY
                     AFVLCLGWITLTKSYPTLGEGGFFLSFVPFFQPLFIYLRHSVVSTLLFMHAIILSPTF
                     YHLWVDLGSGNSNFFYAISLLYALALASVIIDLCWSMLRIEYDRGNPVINVKLTQL"
     gene            <128350..>130620
                     /locus_tag="AGOS_AEL272W"
                     /old_locus_tag="AEL272W"
                     /db_xref="GeneID:4620768"
     mRNA            <128350..>130620
                     /locus_tag="AGOS_AEL272W"
                     /old_locus_tag="AEL272W"
                     /product="AEL272Wp"
                     /transcript_id="NM_209941.1"
                     /db_xref="GeneID:4620768"
     CDS             128350..130620
                     /locus_tag="AGOS_AEL272W"
                     /old_locus_tag="AEL272W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR181C (SEC23)"
                     /codon_start=1
                     /product="AEL272Wp"
                     /protein_id="NP_984588.1"
                     /db_xref="GeneID:4620768"
                     /translation="MDFEQNEDINGVRFSWNVFPASRTDANKNVVPVGCLYTPLKEIE
                     ELAVVSYNPVVCGGPHCKAVLNPYCEIDVRSNVWACPLCGTRNHLPQHYANMSQEAMP
                     AELNSTTVEYITNRPVQVAPIFFYVVDVTAEEENLQALKDSIITSLSLLPPNALVGLI
                     TYGNVVQLHDLSCTAIDKCNVFRGDREYQLQQLVEMLTGEKSGGNLSAGPQMKITPFS
                     LNRFFLPLEHVEFKLTQLLENLRPDQWTIPPGHRPLRATGSALNIATLLLQGCYRHVA
                     ARICLFASGPGTVAPGMIVSSELKDPLRSHHDIDSDNAKHHKKACKFYNQLAERAAEN
                     GHTIDIFAGCYDQVGMSEMKKLTDSTGGVLLLTDAFSTAIFKQSFIRLFSKDEEGYLT
                     MAFNASMCIKTSADLKLQGLIGHASPVNVDAQNVSDSEIGIGGTSTWKMASLSPHHSY
                     AIFFEIANTAATASLMGDRPKLAYTQFITAYQHASGTNRVRVTTVANQMLPFGNPAIA
                     ASFDQEAAAVLMARVAVDKADSDDGADVIRWIDRTLIKLCQKYADYNKGDPRSFRLAP
                     NFSLYPQFIYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSMEE
                     EPQPVLLDSVSVKPNTILLLDTFFYILIYHGEQIAQWRKAGYQDDPQYADFKSLLEEP
                     KLEAAELLVDRFPLPRFIDTEAGGSQARFLLSKLNPSDSYQNQSAAGSTIVLTDDVSL
                     QNFMIHLQDVCVNGQN"
     gene            complement(<130780..>131871)
                     /locus_tag="AGOS_AEL271C"
                     /old_locus_tag="AEL271C"
                     /db_xref="GeneID:4620769"
     mRNA            complement(<130780..>131871)
                     /locus_tag="AGOS_AEL271C"
                     /old_locus_tag="AEL271C"
                     /product="AEL271Cp"
                     /transcript_id="NM_209942.2"
                     /db_xref="GeneID:4620769"
     CDS             complement(130780..131871)
                     /locus_tag="AGOS_AEL271C"
                     /old_locus_tag="AEL271C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR180W (AOS1)"
                     /codon_start=1
                     /product="AEL271Cp"
                     /protein_id="NP_984589.2"
                     /db_xref="GeneID:4620769"
                     /translation="MEEHTSTAGDANRPAKAYEQMEGEQKLDNDEIALYDRQIRLWGM
                     AAQARMRNTRVLLVNFGALGGEVAKNLVLSGIGSLTILDNRVAAAEDLGSQFLLAEED
                     LGRLRAEVGAARLRDMNPRVSLAVDARNVTEQPAEYFAGHDLVVATDCSRADLEKINA
                     ACRARGVPFYAGGLHGLWGYVFVDLVQFDSTEEKAVTVDAPITALGSVSERREVVTVR
                     REHEEDPRSAREIVTTRNYYRPFSEVLAQGTLAGRLTPRQLRRLLPALPLTLAAFLHG
                     HGNDDVASFEAEVKKMCHQLGSSPSNVPAECTELFLRQIGVELPPVAAVIGGAMAQDI
                     INTMGKRQSPLNNFVVLDGITLDMQIFEL"
     gene            <132026..>133939
                     /locus_tag="AGOS_AEL270W"
                     /old_locus_tag="AEL270W"
                     /db_xref="GeneID:4620770"
     mRNA            <132026..>133939
                     /locus_tag="AGOS_AEL270W"
                     /old_locus_tag="AEL270W"
                     /product="AEL270Wp"
                     /transcript_id="NM_209943.2"
                     /db_xref="GeneID:4620770"
     CDS             132026..133939
                     /locus_tag="AGOS_AEL270W"
                     /old_locus_tag="AEL270W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR179C (HDA3)"
                     /codon_start=1
                     /product="AEL270Wp"
                     /protein_id="NP_984590.2"
                     /db_xref="GeneID:4620770"
                     /translation="MDLLKILDTAPEPAIVDARTMGVSGDTSGDYWLPAPMCLYQKEL
                     TDQIVSLHYSDILKYFETSDYKEDIVLQSMKTMCLNSQLVATHPYLLIDHFMPKSLLT
                     KDIPGHLSETSGKFCVLRDLMNLVQEYAMETLLVCRPGRTMDLLEALLLGNKVNIRRH
                     DGQSIKTKQKKTRYACTCHLVPSEAAKAIALERDTRLGLVICVDPTVDTRAPHIQSIL
                     AQQQRKYGRTVPTIRVAVINSIEHCELFFGKTLDRNTRDYLVNVSAAMVVLRDVVGTL
                     PPDLRPIYSQNLRYLIDWLDTPERPWPLPDVYPVKVYTAMDVERSLLTEVKYSQNNDS
                     LEDAFTNGKKRNHRSHGQGNGGNAPISYYQIKRLKNDYIGNPLKQDMEQLTGISNNKC
                     KDGLLDYHLSSGTLTHKLLQAIGSVYENLQLQDVELSHFAAVEQNQTAIFESHKEALS
                     TIKKQLEDAISKKQRNNTLVDEYLKNSQNERDQLEVLEADISDLLGQLDGRHQGFKQL
                     WDDLNQTENTLALYRTNANAKRSEASYMEEELIRAEKSVAESENEQTQLLRDVEHLEA
                     LIQDCREKDKQQQQVIKNKSKDMEDDITQKKEAVLALQNQLGTIMEYLKQLQTPRVRS
                     PSNGHRSKHRGYV"
     gene            complement(<133996..>135363)
                     /locus_tag="AGOS_AEL269C"
                     /old_locus_tag="AEL269C"
                     /db_xref="GeneID:4620771"
     mRNA            complement(<133996..>135363)
                     /locus_tag="AGOS_AEL269C"
                     /old_locus_tag="AEL269C"
                     /product="AEL269Cp"
                     /transcript_id="NM_209944.1"
                     /db_xref="GeneID:4620771"
     CDS             complement(133996..135363)
                     /locus_tag="AGOS_AEL269C"
                     /old_locus_tag="AEL269C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR178W (PRP4)"
                     /codon_start=1
                     /product="AEL269Cp"
                     /protein_id="NP_984591.1"
                     /db_xref="GeneID:4620771"
                     /translation="MVELHEIRVDHDHLIGDKGETVADVLNRQEFSKERFVPTLDEDV
                     RAALRLLDKPEEIPEEDNHDRRERLAELLSSDKQLQKRIEESGFLKRASPGEVSDGDE
                     LDEEFYTPASRELVEVRKFLVGYSLDCAARRLAAQRARQGLGVKAYLQQRRAEGKRLA
                     TFELVGSQLVADKHVSQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKI
                     GGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFEELRGHAGRVSRVKVHPSGRLAASASF
                     DLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIM
                     KLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALDVKFKK
                     NNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLK
                     QWCAK"
     gene            <135460..>136428
                     /locus_tag="AGOS_AEL268W"
                     /old_locus_tag="AEL268W"
                     /db_xref="GeneID:4620772"
     mRNA            <135460..>136428
                     /locus_tag="AGOS_AEL268W"
                     /old_locus_tag="AEL268W"
                     /product="AEL268Wp"
                     /transcript_id="NM_209945.1"
                     /db_xref="GeneID:4620772"
     CDS             135460..136428
                     /locus_tag="AGOS_AEL268W"
                     /old_locus_tag="AEL268W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR176C (BET2)"
                     /codon_start=1
                     /product="AEL268Wp"
                     /protein_id="NP_984592.1"
                     /db_xref="GeneID:4620772"
                     /translation="MKLLKEKHISFIKSLDKKHEDFEYWVTEHLRLNGIYWGLTALCC
                     LGAKDAFDREDIIAFVKRCWDKRTGGFAAYEGHDAHLLTTLSGIQVLATYDALDTLTP
                     QEVEQCVNFIEGNQMADGSFQGDRFGEVDTRFVYTALSSLSILGRLSAKVVDPAVEFI
                     KRCYNFDGGFGLCPGAESHAAQAFTCIGALAIVGRLGDLSARQLEDIGWWLCERQVPE
                     GGLNGRPSKLPDVCYSWWVLSTLAILGKADWIDHEKLGDFILASQDPKSGGISDRPEN
                     QVDVFHTLFGIAGLSLMKHDGLVPIDPIYCMPYDITEKFKKYPYET"
     gene            complement(<136477..>138510)
                     /locus_tag="AGOS_AEL267C"
                     /old_locus_tag="AEL267C"
                     /db_xref="GeneID:4620773"
     mRNA            complement(<136477..>138510)
                     /locus_tag="AGOS_AEL267C"
                     /old_locus_tag="AEL267C"
                     /product="AEL267Cp"
                     /transcript_id="NM_209946.1"
                     /db_xref="GeneID:4620773"
     CDS             complement(136477..138510)
                     /locus_tag="AGOS_AEL267C"
                     /old_locus_tag="AEL267C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR175W (DPB2)"
                     /codon_start=1
                     /product="AEL267Cp"
                     /protein_id="NP_984593.1"
                     /db_xref="GeneID:4620773"
                     /translation="MDRGSALPAEISPQLLRPLAYRVLSKKYGLHIKSDGLAQLAKFI
                     GNAFGVDWRRSAETMQFLERFAAIWREQERGLFVDALGVDAVTQELRERNKTAKQRRP
                     ARARETTLDALVRPTEAYSAVESSGGDVTATEPMDEDTVREEPLDWTHYFKVIDTFSQ
                     QQFTYDVTKRRYRLVQQRESAAGPLSTLLRIPSLEANLAQFPTRYHLVRDRVLRNASF
                     QNDDVYNPLSSMQQLQQQLDAGGAPLASTAYMSITQIKNLLGRDGKNFLLLGLIRKDS
                     KGFWSLEDPSGSIEIDISETYPTKGTYYVPGCIVLAEGIYSSAGNRFRVSSITHPPGE
                     RREAFLEAIGNLDLLGIHGPSNESYISRLDKELKIRLHYLEKELTDHRFVFLGGNIFL
                     DDTMTETALAKLFDVLEHDPPTVLVLPGSFTSTPIYPSSDSKSSSSTAAYRANFDALA
                     KLLSKYERLINETTFVFIPGDNDPWGSMAYLGVAGTLPQHPIPGDFVTKVNRICKHVV
                     WGSNPTRIAYLSQELVIMRDDMCNRFKRNSIIFPTVEEEQKQEYMLLQQELQDDERSS
                     DLSISQLIKSRDQLPASVQESRKIVKTILDQQHLSPFTSQVRPITWDYDYTLHLSPIP
                     STMIICDPTAPKYDVTYNGCKSINPGSFLHKRSVNYTEYTPSLRKATEEEIVV"
     gene            <138834..>139820
                     /locus_tag="AGOS_AEL266W"
                     /old_locus_tag="AEL266W"
                     /db_xref="GeneID:4620774"
     mRNA            <138834..>139820
                     /locus_tag="AGOS_AEL266W"
                     /old_locus_tag="AEL266W"
                     /product="AEL266Wp"
                     /transcript_id="NM_209947.1"
                     /db_xref="GeneID:4620774"
     CDS             138834..139820
                     /locus_tag="AGOS_AEL266W"
                     /old_locus_tag="AEL266W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR457C (NBP1) and YPR174C"
                     /codon_start=1
                     /product="AEL266Wp"
                     /protein_id="NP_984594.1"
                     /db_xref="GeneID:4620774"
                     /translation="MLEPLKNIVSDFWLKTDTRKREYGSLDEWKQQRGQERIGRPRRR
                     ASTRYKVTKPSAVHQSALPLPVERPGAAAVRRNERTWWDRLCGVFSAEQRDLHGMRDA
                     FANYRLPPTEELEGRRRRGTASQRIARSETFKKRVLEKMYDDRMLEQLRAGSRGRRPE
                     RPALPGSDADQVVLLQNRLHKLERQLFETQKELELAKKKLMFAHEKTKLFESLLDDAN
                     VDDDYVKSRRRITNLRATTDNQPALRSLSPSPQRPYPVNPLFTSSPIRQVNDSPRKQI
                     NKPDDFYAKYPTIPKTELLNKQPSENAAAGRAKESLSPVRIDYSKYSSPRRK"
     gene            <140033..>141328
                     /locus_tag="AGOS_AEL265W"
                     /old_locus_tag="AEL265W"
                     /db_xref="GeneID:4620775"
     mRNA            <140033..>141328
                     /locus_tag="AGOS_AEL265W"
                     /old_locus_tag="AEL265W"
                     /product="AEL265Wp"
                     /transcript_id="NM_209948.1"
                     /db_xref="GeneID:4620775"
     CDS             140033..141328
                     /locus_tag="AGOS_AEL265W"
                     /old_locus_tag="AEL265W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR173C (VPS4)"
                     /codon_start=1
                     /product="AEL265Wp"
                     /protein_id="NP_984595.1"
                     /db_xref="GeneID:4620775"
                     /translation="MSTGDFLGKGIELIQKAIDLDTATQYQDAYTAYYNGLDYLMLAL
                     KYEKNPKSKDLIRAKFTEYLSRAEQLKEHLDSEQQKAQDQPRRAAASQDGGAGGGGHE
                     EDGEEKKLRGALSGAILTEKPNVRWEDIAGLEGAKEALKEAVILPVKFPHLFKGNRKP
                     TSGILLYGPPGTGKSYLAKAVATEANSTFFSISSSDLVSKWMGESERLVKQLFNMARE
                     NKPSIIFIDEVDALTGSRGEGESEASRRIKTELLVQMNGVGNDSTGVLVLGATNIPWQ
                     LDSAIRRRFEKRIYIPLPDFAARTRMFELNVGETPCALTKEDYRTLGKYTEGYSGSDI
                     AVVVKDALMQPIRKIQMATHFKNVSDDPSVRKLTPCSPGDEDAIEMSWVDIEAEELQE
                     PALTIKDFLKAIKTSRPTVNEVDLQKQEEFTRDFGQEGN"
     gene            complement(<141450..>142025)
                     /locus_tag="AGOS_AEL264C"
                     /old_locus_tag="AEL264C"
                     /db_xref="GeneID:4620776"
     mRNA            complement(<141450..>142025)
                     /locus_tag="AGOS_AEL264C"
                     /old_locus_tag="AEL264C"
                     /product="AEL264Cp"
                     /transcript_id="NM_209949.2"
                     /db_xref="GeneID:4620776"
     CDS             complement(141450..142025)
                     /locus_tag="AGOS_AEL264C"
                     /old_locus_tag="AEL264C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR172W and YLR456W"
                     /codon_start=1
                     /product="AEL264Cp"
                     /protein_id="NP_984596.2"
                     /db_xref="GeneID:4620776"
                     /translation="MNSLPDHILHLLKTSKYVHLATASSDGVPSVSLMNYAYLAPESS
                     ETEGDTHYIVFATSAVTEKYKNITTNPNVSLLIHDWVTAKKLSLRKNSTSASLSGGAG
                     SEAEEAPSRLLNILQELNQSELSQMSATLKGLAEVIDSSSPDFVLYRDALLKANPDAK
                     CFVLGDDVVIVKAQITGAKVSDTSNNTAIYY"
     gene            complement(<142263..>143264)
                     /locus_tag="AGOS_AEL263C"
                     /old_locus_tag="AEL263C"
                     /db_xref="GeneID:4620777"
     mRNA            complement(<142263..>143264)
                     /locus_tag="AGOS_AEL263C"
                     /old_locus_tag="AEL263C"
                     /product="AEL263Cp"
                     /transcript_id="NM_209950.1"
                     /db_xref="GeneID:4620777"
     CDS             complement(142263..143264)
                     /locus_tag="AGOS_AEL263C"
                     /old_locus_tag="AEL263C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR455W"
                     /codon_start=1
                     /product="AEL263Cp"
                     /protein_id="NP_984597.1"
                     /db_xref="GeneID:4620777"
                     /translation="MNSKDIRTGDRVLCKVGDFPPWPAVVVPQRFLSKLVYSGKRSKS
                     YVCVAFFNDDSYYWKEPRHLTLLTDKMCTDWMKNSKSKDEALIGAYQQAIEYKRLFDF
                     MKERLVQEEREEILEDVKDIPAGEDPFEPKPTTRRTGSTKSSVSRKRARSVSAPGNSA
                     PLSHTDGLGPAGDTKAAHPILASASSPSFSKTSSLSKRRKLDYDNRVSIAQLLRNKLQ
                     RNLVQRNEPPSEKEYKESDRMFRTIINKLSNDPPFFDYKALRVSKLYKLLKVIAQDEN
                     LARYHDDCNKILATWAPLIVQIKQEKQMAQQLDTSTTDDISLVSDVKVGEQSSKSLN"
     gene            complement(<144491..>146908)
                     /locus_tag="AGOS_AEL262C"
                     /old_locus_tag="AEL262C"
                     /db_xref="GeneID:4620778"
     mRNA            complement(<144491..>146908)
                     /locus_tag="AGOS_AEL262C"
                     /old_locus_tag="AEL262C"
                     /product="AEL262Cp"
                     /transcript_id="NM_209951.2"
                     /db_xref="GeneID:4620778"
     CDS             complement(144491..146908)
                     /locus_tag="AGOS_AEL262C"
                     /old_locus_tag="AEL262C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR171W (BSP1)"
                     /codon_start=1
                     /product="AEL262Cp"
                     /protein_id="NP_984598.2"
                     /db_xref="GeneID:4620778"
                     /translation="MPGIRDTPGRDPDLDVYLSRVEQLDLERSRSLNRGTASVPEERF
                     TSTIGTERYDPADRKKAHLLLEGHYDTRRYEFTGSDKVSEIAYESAYNYEKTFSPKKG
                     SAYHTARGISPIRTPGRSSNYSIPPPKESYVSSEKKYLVTEEEYDLLQRLKREHGHMD
                     YLSLKETYPPKYSGYYSGSSYGYDYIPRSSSPVNYEENRYPSMLSSIYNSEMPYNSRI
                     KPHYESRSHGYYRPAPLYSTDYSHTLSERSLLVPTPSTATSSIFSRDHAPTLFDKQVT
                     PQSPIAYGDKQPFPNTPPAEPNMTSFQAGSSPTDNILPSSGKEVDGTASNSPVESMSA
                     APGKAMNNSTPTLAGLSTPSPSESVSPIKQKPRASESGSPIKKEPQESSSQVPKKRIS
                     VSYLESLEKSRVTTNNLSGGVRSQPNIIPGRSEGMISSMMKKNSGTPVQPRTPSMSLA
                     SLRKGSENVVSSFLKKTAPMQPAPSTRPQRSPTRTTRDITETLIESALKITGTPTKQS
                     RCGAPPIPVKPKKLTQIPKVEEEPDLEDTLKSIQLNKTDATREKSKLSEQKGEIHIPK
                     LRSVKRDSSQLPEQKISLPELKPVKLEPKREPSLPEALNAINNLKPALEPSRSPSPNS
                     VAISKLPALAPHSKVGNPTALPEALTKRSQLTKSHPSPERKPSIPEALTKMSMLNKPP
                     AAAAKASDVPEALAKVAKLNKAPPVPKRKISMPEALKKAQELRNNKTNLLLEANLKRK
                     HTPPLGQLSEAGSVPTPKAFPDRSDSTLSVVRLLKGEQSQGDKLQHVTKARDRGPRRR
                     LPSGTSK"
     gene            complement(<147147..>147518)
                     /locus_tag="AGOS_AEL262CA"
                     /old_locus_tag="AEL262C-A"
                     /db_xref="GeneID:4620779"
     mRNA            complement(join(<147147..147255,147312..147442,
                     147501..>147518))
                     /locus_tag="AGOS_AEL262CA"
                     /old_locus_tag="AEL262C-A"
                     /product="AEL262C-Ap"
                     /transcript_id="NM_209952.1"
                     /db_xref="GeneID:4620779"
     CDS             complement(join(147147..147255,147312..147442,
                     147501..147518))
                     /locus_tag="AGOS_AEL262CA"
                     /old_locus_tag="AEL262C-A"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR170W-B; 2-intron"
                     /codon_start=1
                     /product="AEL262C-Ap"
                     /protein_id="NP_984599.1"
                     /db_xref="GeneID:4620779"
                     /translation="MKPVVSKGKAWFCTVLSAFGVIILSVIGHLFNIKHEAFVGSIND
                     PKDGPAVAHTVFLAAAVYLVFFVFCGSQIYMGRKSSSIELR"
     gene            147668..147741
                     /locus_tag="AGOS_t0099"
                     /db_xref="GeneID:4620780"
     tRNA            147668..147741
                     /locus_tag="AGOS_t0099"
                     /product="tRNA-Ile"
                     /codon_recognized="AUU"
                     /db_xref="GeneID:4620780"
     gene            complement(<147826..>149352)
                     /locus_tag="AGOS_AEL261C"
                     /old_locus_tag="AEL261C"
                     /db_xref="GeneID:4620781"
     mRNA            complement(<147826..>149352)
                     /locus_tag="AGOS_AEL261C"
                     /old_locus_tag="AEL261C"
                     /product="AEL261Cp"
                     /transcript_id="NM_209953.2"
                     /db_xref="GeneID:4620781"
     CDS             complement(147826..149352)
                     /locus_tag="AGOS_AEL261C"
                     /old_locus_tag="AEL261C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR169W (JIP5)"
                     /codon_start=1
                     /product="AEL261Cp"
                     /protein_id="NP_984600.2"
                     /db_xref="GeneID:4620781"
                     /translation="MGKKKNSKAYSEELTDTTRPLLEFRYGNPLFAIACHPEQSVIVS
                     GLATGHMFCHKYNAAELKEAQLKRLRKHDAGSKDDRKKLWEVVEVPGVETSGVSLLWT
                     TKRHKGSVRCICFDADGTHIYSVGTDNVLKKADTLTGKVVKKCVLDPGQNVKYTKLVK
                     SATHPLVLLGDENGNVTVLNSESLEQTNLIKSIHNGDAINDIFHFAKKSVYRYISLGQ
                     TTLAHWDSRESNEGDFAIAADDKQAKRKVILSDDQEDEILCGTFVDPEDGEVLVCGMG
                     EGVLTVWRPKKNGLADQLTRIKVKKNESIDCIVPTLEDDGCVWCGCSDGNIYKVHVNR
                     GTIIEVRKHSKLDEVTFLDLDSEYRLLSGGLDKAKLWDSEKSEQLTPGSDADDRVSNS
                     SPSAGKSSESDSNDSENDATSSGGSSDEDSSSDESEHSDASDVEEELVGLTREQIIAE
                     LDKDLVEESEDVEDVRSQRKRKHGADLPTNANGKKQKGKNIKPERSMKTHGIRRFEGL
                     "
     gene            complement(<149467..>149922)
                     /locus_tag="AGOS_AEL260C"
                     /old_locus_tag="AEL260C"
                     /db_xref="GeneID:4620782"
     mRNA            complement(<149467..>149922)
                     /locus_tag="AGOS_AEL260C"
                     /old_locus_tag="AEL260C"
                     /product="AEL260Cp"
                     /transcript_id="NM_209954.2"
                     /db_xref="GeneID:4620782"
     CDS             complement(149467..149922)
                     /locus_tag="AGOS_AEL260C"
                     /old_locus_tag="AEL260C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR168W (NUT2)"
                     /codon_start=1
                     /product="AEL260Cp"
                     /protein_id="NP_984601.2"
                     /db_xref="GeneID:4620782"
                     /translation="MDQQDLNKLQTNLSDAEIRLASIIESFIELGVSVYDFPGTQEST
                     QGMVTNLKRNVERIKLLNQHANDPDSQLRNMNIPLEVLQYIEDGRNPDVYTREFVEAI
                     RRSNQYQRAKMHALKKLRDSLAEKIGEEFPDLVPQVQGIIERANGSRDK"
     gene            <150321..>151118
                     /locus_tag="AGOS_AEL259W"
                     /old_locus_tag="AEL259W"
                     /db_xref="GeneID:4620783"
     mRNA            <150321..>151118
                     /locus_tag="AGOS_AEL259W"
                     /old_locus_tag="AEL259W"
                     /product="AEL259Wp"
                     /transcript_id="NM_209955.1"
                     /db_xref="GeneID:4620783"
     CDS             150321..151118
                     /locus_tag="AGOS_AEL259W"
                     /old_locus_tag="AEL259W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR167C (MET16)"
                     /codon_start=1
                     /product="AEL259Wp"
                     /protein_id="NP_984602.1"
                     /db_xref="GeneID:4620783"
                     /translation="MLRNNKYELNDGLVVTDSQLDCWNMTAAKLTSPAEVLHWAVTTF
                     PHLYQMTAFGLTGLATIDMLSKLPALEEQMVPLIFIDTLHLFPQTLSLLHQVEDRYYK
                     PLSQSIHIFRPAGVSTEKEFAEKYGSCLWETDEDKYDFIAKVEPAHRAFRSLGVGAVL
                     TGRRRSQGGSREQLNFVEVDEVNAVLKINPFVTWSFDQVWSYILDNRIPYNELLNYGY
                     KSIGDYHSTLPVVDGAGERSGRWKGKAKTECGLHTASKYARYLLEQK"
     gene            complement(151141..151212)
                     /locus_tag="AGOS_t0100"
                     /db_xref="GeneID:4620784"
     tRNA            complement(151141..151212)
                     /locus_tag="AGOS_t0100"
                     /product="tRNA-Glu"
                     /codon_recognized="GAG"
                     /db_xref="GeneID:4620784"
     gene            <151679..>153314
                     /locus_tag="AGOS_AEL258W"
                     /old_locus_tag="AEL258W"
                     /db_xref="GeneID:4620785"
     mRNA            join(<151679..153139,153195..>153314)
                     /locus_tag="AGOS_AEL258W"
                     /old_locus_tag="AEL258W"
                     /product="AEL258Wp"
                     /transcript_id="NM_209956.2"
                     /db_xref="GeneID:4620785"
     CDS             join(151679..153139,153195..153314)
                     /locus_tag="AGOS_AEL258W"
                     /old_locus_tag="AEL258W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR186W (PCH2); 1-intron"
                     /codon_start=1
                     /product="AEL258Wp"
                     /protein_id="NP_984603.2"
                     /db_xref="GeneID:4620785"
                     /translation="MVRYTVDCCLKEDVLALIIPMLHEIGDEGNMDPTATFQEILVRT
                     VTRRLQKLEEDELLDREHCAYDFLLNGQGAVSLASTPTKAQESFIRSLVKVVMHDFAT
                     GGNNQVIDYQGNLLISFCIEKLYIEKATGAPSFGVEADDLVWMVADALGKGQKLQTMI
                     DHARGKEFDINFYATPERFSISFASAISDEFDKIDLKDDESGHERTLTPLDPSISWLP
                     FSPETFQLVRVHFLPSREYEGAWEALYFDDDIKGQLFNYATIALKMSHFIPEETLSVN
                     TGGNRLLLVHGPPGTGKTTICKALCHKLAIRLHSGLLPKNKSVPSVILVELACSKVFS
                     RWFGESSKNIDTIFKDLEKLIKDGINDNQFVCLLIDEVETIAFSRSSLINKNETTDAI
                     RVVNTLLTQLDNMKKYKNFLTLATSNLLDSMDPAFIDRADGIFNVPTPSTQGCQNILE
                     LNISKLLTAGVIHASKEHMLYSPVVQAALQPIVSRCADLRLSGRTMGKLPLKALSENF
                     TNLPVDLKDFIVALASVI"
     gene            <153596..>154429
                     /locus_tag="AGOS_AEL257W"
                     /old_locus_tag="AEL257W"
                     /db_xref="GeneID:4620786"
     mRNA            <153596..>154429
                     /locus_tag="AGOS_AEL257W"
                     /old_locus_tag="AEL257W"
                     /product="AEL257Wp"
                     /transcript_id="NM_209957.1"
                     /db_xref="GeneID:4620786"
     CDS             153596..154429
                     /locus_tag="AGOS_AEL257W"
                     /old_locus_tag="AEL257W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR187W (GDT1)"
                     /codon_start=1
                     /product="AEL257Wp"
                     /protein_id="NP_984604.1"
                     /db_xref="GeneID:4620786"
                     /translation="MKTINRVLIAALFISVVSAAATREQEVDDLHSSSTLKDLLMAVS
                     MVGVSEIGDKTFLIAALMAMRHPRLLVFSAASTSLALMTVLAGIIGGTFTSLVPQRYT
                     QFAAGILFFIFGYKLALESLETPKDAGVEGELAEVEEEIAIHDMNTNLNETESGGVIK
                     DKRTLVNNRYLNDMLLKVGDRLALYFSPVWIQTFVMVFLGEFGDRSQISTIAMASSSQ
                     YWIVILGATIGHLICTAVAVIGGKLLAKRISMRTVNLGGAISFIIFGIVYTYESFHNP
                     N"
     gene            complement(<154535..>155050)
                     /locus_tag="AGOS_AEL256CA"
                     /old_locus_tag="AEL256C-A"
                     /db_xref="GeneID:9487883"
     mRNA            complement(<154535..>155050)
                     /locus_tag="AGOS_AEL256CA"
                     /old_locus_tag="AEL256C-A"
                     /product="AEL256C-Ap"
                     /transcript_id="NM_001355325.1"
                     /db_xref="GeneID:9487883"
     CDS             complement(154535..155050)
                     /locus_tag="AGOS_AEL256CA"
                     /old_locus_tag="AEL256C-A"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR188C (NTC20)"
                     /codon_start=1
                     /product="AEL256C-Ap"
                     /protein_id="NP_001342261.1"
                     /db_xref="GeneID:9487883"
                     /translation="MSSLEAQLEDRRQRLILLKEKYGSTVEHPIDGTIKRRTPATGAD
                     NEIPGSLEDDTDAGDGARRTGGVKYENVTVRSLAHSFEREILAKHGEMNDYNPDEDPR
                     SREKQLGNRVVRAHRRSIQQALDELQQSTDRTLKRIVRKRYFQDAGKDSHEGDSYNEG
                     NDESSGYDRSS"
     gene            complement(<155337..>160937)
                     /locus_tag="AGOS_AEL256C"
                     /old_locus_tag="AEL256C"
                     /db_xref="GeneID:4620787"
     mRNA            complement(<155337..>160937)
                     /locus_tag="AGOS_AEL256C"
                     /old_locus_tag="AEL256C"
                     /product="AEL256Cp"
                     /transcript_id="NM_209958.2"
                     /db_xref="GeneID:4620787"
     CDS             complement(155337..160937)
                     /locus_tag="AGOS_AEL256C"
                     /old_locus_tag="AEL256C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL082C (MOT1)"
                     /codon_start=1
                     /product="AEL256Cp"
                     /protein_id="NP_984605.2"
                     /db_xref="GeneID:4620787"
                     /translation="MASQASRLDRHVILLESGSTQVVRNVAADQLGDLARQHPDEILV
                     LLSRVYPYLLSRRWETRVTAARAVGAIVAHARLWDPNGEGGELAGEETRQLEALGRYE
                     WRGLQDDSALYSLAQWELGKIFKAGRTLLAARSDAYAAEESKKQAVLAEYVLEPAVKR
                     EGVEAPMSPAESKKSARMLAMAKRRRKIQAKTTSKKPLDLSQSSVARNLMNQDAAADG
                     SNEDEDSGNNNNSSNHNNNDNNDSSHSNTASPQQVPVQLNNPRLEITEQPDSNKIMIE
                     SMVAPLLEKQQRVSGLVWQFQGIFELLLDNLMNDSWEIRHGAALGIREIVKRHATGVG
                     RIKGKTRQENDLRNKRALEDLATRLLTIFALDRFGDFVNDTVVAPVRESAAQALAALL
                     IHLEDDLSVKIFSVLEQLVLQDPRYVGSPTKIWEATHGGLLGIRYFVSIKTDFLFTNN
                     LLDNVVNIVLYGLNERDDDVQSVAAAILTPITSEFIKLEPSTIDLVVSAIWNSLSQLE
                     DDLSSSVASVMDLLAKLCQHQEVLDVLHHKASTHPMEWSFKSLVPKLYPFLRNTITNV
                     RRSVLNLLQAFLSIEDETSKQWINSKIFRLIYQNILLEQHDDILEQSFHVYRTMLEIY
                     KSKNPDKSLDHIFSKHLAPILHLLITPIGEQGKNYSMEAQYLLKPSQSYQFNTERKRS
                     SMTALNKSDIPMPLHTEHVNIDAPMIAGDVTLLGADVIFKTRVLAAKALGYTLAAFQE
                     STVKSFFETALLSCLDLPYATPRMLVSITVAEYCSRWTFLHPETAFPPSFVADYFGPI
                     FMEYLFDPSKLPVFRELVPSLKALRTQCQSLMTTFVEVGMLSPQRLPQLAIIVKGEAE
                     AGPEAFYIETAEKVCDEHYEKLYQYMSNSCKILAKKPLEDARYRIQQAIDVAKEVRRS
                     RNSNILASYASATLLFDGLPKKLNPFIRSLMDSIKEEQCEILQKRSGDSVIYLIMELV
                     KNGKVNVANKVVKNLCGFLCVDTAEVPEFSPNMHYTDSILTLIREANSLAVQDNASIK
                     LMTKEAQIKRRGAMHTLSCLLLQLGPNALTQVPQLKASIFDPLLSFGDLDSDSDSIEP
                     EVGQQLVDALGVLRALFTYMDPVIHLEHVFTRLHDLLKYLTSRYSVVRYSAARTLAEL
                     AVANPTQVIPFIIKEVLPLMNNAGSVIARQSGTELVYHLCQSMGSDILPYIVFLVVPL
                     LGRMSDPAPDVRSLATTTFASIIKLVPLEAGIADPEGLPEELLRGRERERDFIQQMMD
                     PSKAKPFSLPVAIKATLRKYQQEGINWLAFLNHYHLHGILCDDMGLGKTLQTICIIAS
                     DQYLRQEDYKTTKSVETRPLPSLIVCPPSLTGHWEQEFEQYAPFLTVLVYAGGPSTRY
                     PLRGKLGDADIVVTSYDVARNDIDIISKHDYNYCVLDEGHIIKNSQSKLAKAVKSIRA
                     NHRLILTGTPIQNNVVELWSLFDFLMPGFLGSEKAFQERFAKPIAASRNSKTSSKEQE
                     AGALALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQRQLYKDFAKKQKN
                     IVERDIENTMELESKNHIFQALQYMRKLCNHPSLVLSKDHPQYNQVQDYLSQTGMDIH
                     DIAHAPKLGALRNLLLECGIGVQDVDQNSISLPSSENVISQHRALIFCQLKDMLDMIE
                     NDLFKKYLPSVTYMRLDGSVESRDRQKVVRKFNEDPSIDCLLLTTKVGGLGLNLTGAD
                     TVIFIEHDWNPMNDLQAMDRAHRLGQKKVVNVYRIITKGSLEEKIMGLQKFKMNIAST
                     VVNQQNAGLASMDTHQLLDLFDTDNSLAQVKEEKAGAISDDVTNETGLTGKAKEAVSE
                     LKELWDSSQYEEEYNLDNFIKTLR"
     gene            <161376..>162143
                     /locus_tag="AGOS_AEL255W"
                     /old_locus_tag="AEL255W"
                     /db_xref="GeneID:4620788"
     mRNA            join(<161376..161382,161584..>162143)
                     /locus_tag="AGOS_AEL255W"
                     /old_locus_tag="AEL255W"
                     /product="40S ribosomal protein S9"
                     /transcript_id="NM_209959.1"
                     /db_xref="GeneID:4620788"
     CDS             join(161376..161382,161584..162143)
                     /locus_tag="AGOS_AEL255W"
                     /old_locus_tag="AEL255W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR189W (RPS9B) and YPL081W (RPS9A); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S9"
                     /protein_id="NP_984606.1"
                     /db_xref="GeneID:4620788"
                     /translation="MPRAPRTYSKTYSTPKRPYESARLDAELKLAGEYGLKNKREIYR
                     ISFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKIE
                     DFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNVPSFMVRLDSEKHIDFAV
                     TSPFGGGRPGRVARKRAAAAAGGAEDEE"
     gene            <162786..>163440
                     /locus_tag="AGOS_AEL254W"
                     /old_locus_tag="AEL254W"
                     /db_xref="GeneID:4620789"
     mRNA            join(<162786..162796,162969..>163440)
                     /locus_tag="AGOS_AEL254W"
                     /old_locus_tag="AEL254W"
                     /product="60S ribosomal protein L21"
                     /transcript_id="NM_209960.1"
                     /db_xref="GeneID:4620789"
     CDS             join(162786..162796,162969..163440)
                     /locus_tag="AGOS_AEL254W"
                     /old_locus_tag="AEL254W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR191W (RPL21A) and YPL079W (RPL21B); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L21"
                     /protein_id="NP_984607.1"
                     /db_xref="GeneID:4620789"
                     /translation="MGKSHGYRSRTRYMFQRDFRKSGTIPLSTYLKVYKVGDIVDIKA
                     NGAIHKGMPHKFYQGKTGVVYNVTKSSVGVIIYKMVGNRYIEKRLNLRVEHIKHSKCR
                     QEFLERVKANAAKKAEAKAQGVAVQLKRQPAQPRESRVVSTEGNIPQTLSPVPYETFI
                     "
     gene            <163893..>164990
                     /locus_tag="AGOS_AEL253W"
                     /old_locus_tag="AEL253W"
                     /db_xref="GeneID:4620790"
     mRNA            <163893..>164990
                     /locus_tag="AGOS_AEL253W"
                     /old_locus_tag="AEL253W"
                     /product="AEL253Wp"
                     /transcript_id="NM_209961.1"
                     /db_xref="GeneID:4620790"
     CDS             163893..164990
                     /locus_tag="AGOS_AEL253W"
                     /old_locus_tag="AEL253W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR192W (RIM2)"
                     /codon_start=1
                     /product="AEL253Wp"
                     /protein_id="NP_984608.1"
                     /db_xref="GeneID:4620790"
                     /translation="MTKRDLSKLESEALESIPYLASDEKGSNLKDATSLILENKKENH
                     PHVAPWVHFVAGGIGGMAGAIITCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLM
                     HFRETVGIIQNVYTQEGFRSLFKGLGPNLVGVIPARSINFFTYGVTKDTASRLLNDGQ
                     EAPWIHFLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNE
                     GILGLYKGLSASYLGSVESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEW
                     CQRSGSAGAAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFAS
                     MYSGLTPHLMRTVPNSIIMFGTWELVIKLLA"
     gene            complement(<165107..>165778)
                     /locus_tag="AGOS_AEL252C"
                     /old_locus_tag="AEL252C"
                     /db_xref="GeneID:4620791"
     mRNA            complement(<165107..>165778)
                     /locus_tag="AGOS_AEL252C"
                     /old_locus_tag="AEL252C"
                     /product="AEL252Cp"
                     /transcript_id="NM_209962.1"
                     /db_xref="GeneID:4620791"
     CDS             complement(165107..165778)
                     /locus_tag="AGOS_AEL252C"
                     /old_locus_tag="AEL252C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR193C (MED8)"
                     /codon_start=1
                     /product="AEL252Cp"
                     /protein_id="NP_984609.1"
                     /db_xref="GeneID:4620791"
                     /translation="MSQTSPLSEQADSSLKYDYSNVPAQALDAIRMRLAQLTHSLSKI
                     RDDMSKADLPQWYSLQAQLSVTLTQLSSLTSTLQHFEDTLECTVPYPLPSFPTTAHEG
                     LLTTLMRKKQIPEVENWIKDAIDHSGLDLEGRNWDEIESAIQRDKSTTARALDFINQE
                     YSNYSFQGLYTAEELSKNVGDPQSMIYRSATSNAKPKAPFSVDSILTFMYQGTMKTEE
                     TSIAK"
     gene            complement(<166113..>166971)
                     /locus_tag="AGOS_AEL251C"
                     /old_locus_tag="AEL251C"
                     /db_xref="GeneID:4620792"
     mRNA            complement(join(<166113..166752,166901..>166971))
                     /locus_tag="AGOS_AEL251C"
                     /old_locus_tag="AEL251C"
                     /product="AEL251Cp"
                     /transcript_id="NM_209963.2"
                     /db_xref="GeneID:4620792"
     CDS             complement(join(166113..166752,166901..166971))
                     /locus_tag="AGOS_AEL251C"
                     /old_locus_tag="AEL251C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL078C (ATP4); 1-intron"
                     /codon_start=1
                     /product="AEL251Cp"
                     /protein_id="NP_984610.2"
                     /db_xref="GeneID:4620792"
                     /translation="MAFRALTTKAAARPLLALGPRSVAMGARYMSTPAPQDPKSKAAA
                     ILDSLPGSTALSKTGILATSAAAAIYAISNELYVLNAETILLCTFTGFSFLIAKLVAP
                     AYKEYADKRMQHVSGILNSSRNKHVAAVKERIESVSELKNVTETTKVLFEVSKETLEL
                     EAKAFELKQKVDLATEAKAVLDSWVRYEASVRQLQQKQIAESVIGKVQAELANPKFQD
                     KVLQQSVADVEKLFASLK"
     gene            complement(<167239..>168492)
                     /locus_tag="AGOS_AEL250C"
                     /old_locus_tag="AEL250C"
                     /db_xref="GeneID:4620793"
     mRNA            complement(<167239..>168492)
                     /locus_tag="AGOS_AEL250C"
                     /old_locus_tag="AEL250C"
                     /product="AEL250Cp"
                     /transcript_id="NM_209964.1"
                     /db_xref="GeneID:4620793"
     CDS             complement(167239..168492)
                     /locus_tag="AGOS_AEL250C"
                     /old_locus_tag="AEL250C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR195C (MSI1)"
                     /codon_start=1
                     /product="AEL250Cp"
                     /protein_id="NP_984611.1"
                     /db_xref="GeneID:4620793"
                     /translation="MSVKFSAEEVPQVSSEISDELQQRYTNWKKNTKLLYDYLNTNST
                     KWPSLTCQFMPDLEVPTDKHRLLLSSFTSSQLPEDEAVYISELSTMRHVPWSSLNNFD
                     MDEMEFKVDNQAKLPNKNLVETVRIQFPSGDCNRACYMPQNPDIIGAIASTGAVNIFD
                     RTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEALSLAWNWQKAGIIASSYSNGLI
                     KVWDITRYQKSQPTISNPELRILQDKAGTNDVSWMVHHSSILAACGESNTIGLLDTRA
                     PDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIALWDCRAFSKPLSVFNHGDS
                     VSALQWNPNLPTIVATAGQGDGLIKIWDTSREPEDSLLFVHGGHMLGVNDIAWNYHDP
                     WLMCSVANDNSVHVWKPAANLVQAK"
     gene            complement(<168790..>170457)
                     /locus_tag="AGOS_AEL249C"
                     /old_locus_tag="AEL249C"
                     /db_xref="GeneID:4620794"
     mRNA            complement(<168790..>170457)
                     /locus_tag="AGOS_AEL249C"
                     /old_locus_tag="AEL249C"
                     /product="AEL249Cp"
                     /transcript_id="NM_209965.1"
                     /db_xref="GeneID:4620794"
     CDS             complement(168790..170457)
                     /locus_tag="AGOS_AEL249C"
                     /old_locus_tag="AEL249C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR196C (PGI1)"
                     /codon_start=1
                     /product="AEL249Cp"
                     /protein_id="NP_984612.1"
                     /db_xref="GeneID:4620794"
                     /translation="MATTNTFSDFKLASELPAWAKLQELYEKKGKTLSLKEAFATDEQ
                     RFQKYSRTFSNHDGSKILFDFSKNLVDDEILGALAQLAREANVTQLRDQMFNGEHINS
                     TEDRAVYHVALRNRANKPMYVDGKNVAPEVDAVLQHMKEFSEQVRSGAWKGYTGKSIK
                     DVVNIGIGGSDLGPVMVTEALKHYAGPLKVHFVSNIDGTHLAETLKEVDPETTLFLVA
                     SKTFTTAETITNATSAKNWFLSKTGNNPAHISKHFAALSTNETEVAKFGIDTKNMFGF
                     ESWVGGRYSVWSAIGLSVALYIGFDQFEDFLKGAEAVDKHFTSTPIEDNIPLLGGLLS
                     VWYNNFFDAQTHLVVPFDQYLHRFPAYLQQLSMESNGKSVTRGNVFANYSTGSILFGE
                     PATNAQHSFFQLVHQGTKVIPSDFILAAQSHNPIENNLHQKMLASNFFAQAEALMVGK
                     DEAQVKAEGATGGLVPHKVFSGNRPTTSILVQKITPANLGALIAYYEHVTFTEGAIWN
                     INSFDQWGVELGKVLAKVIGKDLDTTGETTSHDASTNGLINQFKAWL"
     gene            complement(<170668..>171039)
                     /locus_tag="AGOS_AEL248C"
                     /old_locus_tag="AEL248C"
                     /db_xref="GeneID:4620795"
     mRNA            complement(<170668..>171039)
                     /locus_tag="AGOS_AEL248C"
                     /old_locus_tag="AEL248C"
                     /product="AEL248Cp"
                     /transcript_id="NM_209966.1"
                     /db_xref="GeneID:4620795"
     CDS             complement(170668..171039)
                     /locus_tag="AGOS_AEL248C"
                     /old_locus_tag="AEL248C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL077C and YBR197C"
                     /codon_start=1
                     /product="AEL248Cp"
                     /protein_id="NP_984613.1"
                     /db_xref="GeneID:4620795"
                     /translation="MDPGNTSPSAESISSGRGAPRRDVRTLPTPAAGTGVATPQVDRK
                     DRLWTEIDVLDDVKRMAAMDTAERGFPDDFEARLQHLRRSQAALLDATRMPAANIDAQ
                     RQRILDIMRKLEGLRDLDEGT"
     gene            <171150..>171992
                     /locus_tag="AGOS_AEL247W"
                     /old_locus_tag="AEL247W"
                     /db_xref="GeneID:4620796"
     mRNA            <171150..>171992
                     /locus_tag="AGOS_AEL247W"
                     /old_locus_tag="AEL247W"
                     /product="AEL247Wp"
                     /transcript_id="NM_209967.1"
                     /db_xref="GeneID:4620796"
     CDS             171150..171992
                     /locus_tag="AGOS_AEL247W"
                     /old_locus_tag="AEL247W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL076W (GPI2)"
                     /codon_start=1
                     /product="AEL247Wp"
                     /protein_id="NP_984614.1"
                     /db_xref="GeneID:4620796"
                     /translation="MKRQKVRGAEVWPEWRRLLWLRQPYPDNFTDPRFLTTLQEITAG
                     QLRSQEFSRYLDVVLDFLTFHHRLTNTLLIYVVFTLLYRYHYSPIALAALTTLCASLS
                     FRVLEHLKSSMIVTFTMLTLAPVLKTLSRTTSSDSIWNLSCWLTIIYVLSYSWTQSSL
                     VPTNILLSNVTVLASRLNTTPEVFCFLLICIELNILLPSYERNLRLQGRYATYGCIVM
                     FTHAIVYTFVTMTLGWTYTAPLLVLSVAFIFIAPGYFIYWQRHHYKGHEVLATWDAKK
                     PIFD"
     gene            complement(<172078..>174525)
                     /locus_tag="AGOS_AEL246C"
                     /old_locus_tag="AEL246C"
                     /db_xref="GeneID:4620797"
     mRNA            complement(<172078..>174525)
                     /locus_tag="AGOS_AEL246C"
                     /old_locus_tag="AEL246C"
                     /product="AEL246Cp"
                     /transcript_id="NM_209968.1"
                     /db_xref="GeneID:4620797"
     CDS             complement(172078..174525)
                     /locus_tag="AGOS_AEL246C"
                     /old_locus_tag="AEL246C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR198C (TAF5)"
                     /codon_start=1
                     /product="AEL246Cp"
                     /protein_id="NP_984615.1"
                     /db_xref="GeneID:4620797"
                     /translation="MNSKLNNRSTRPAHRQEAHMSQKGQKQPTKPAPSSIRPGQQQGS
                     SSSQAAKPSSGFSASDLNRIVLEYLNKKGYHRTEQMLRAESSRTLTPSNKSSVASSTL
                     PAPATSATQEVTTNGKPASNPPMPLKRDANGNLVQQAQVTPQHYFRAYAMLKNWVDSS
                     LDMYKPELSRIIYPIFIYVFLTLVSKAPVQARRFFDKYSEDYKALHGTEINKLFSVNS
                     VDHIKENELAQGFQSNKYRVTISRTTLNLLLYFLNENESVGGSLLISIINQNLEPNAV
                     DNIISQDTLTDGIKDISAGAIDVDNHNSVPVKLGPFPRDQEFTKEVEVELMRKDEQEI
                     EENPDENRKTLVEEYKSMTGATAAVAPVGAQPEAPATQKGDESDDASEKKEHDEKAGE
                     KGTAPSSSGQPAVPIPAGTLPLNAPVGLPLSTTATDLINPMMESPLPGALPLPPKTAL
                     DLKLEIQKVRESRDAIKMDNLQTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQD
                     SYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTV
                     RLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAG
                     HLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRW
                     LTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDL
                     KKFTNEPSLEPEQPYSGYLGDMEASVNQDVKEYGRRRTVFPTQDLMASFHTKKTPIYT
                     VKFTRTNLVLAGGAFTE"
     gene            <175276..>177414
                     /locus_tag="AGOS_AEL245W"
                     /old_locus_tag="AEL245W"
                     /db_xref="GeneID:4620798"
     mRNA            <175276..>177414
                     /locus_tag="AGOS_AEL245W"
                     /old_locus_tag="AEL245W"
                     /product="AEL245Wp"
                     /transcript_id="NM_209969.1"
                     /db_xref="GeneID:4620798"
     CDS             175276..177414
                     /locus_tag="AGOS_AEL245W"
                     /old_locus_tag="AEL245W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL075W (GCR1)"
                     /codon_start=1
                     /product="AEL245Wp"
                     /protein_id="NP_984616.1"
                     /db_xref="GeneID:4620798"
                     /translation="MDTINLSTNLHDWLEDPMLQVSDSRGAGSVGASTTLSPPGMKHL
                     ELSQSNPTPSPRSSVSMNRGSHCRSGLYELVQRVPLDENSLLAYVLQQYFHVHEKKEA
                     ELLTLVDIILDQTYPHSLTLRKLRYDSTYFRYFGTISRENDITRCPVFYVSLYFYMTW
                     GLPARKQISWDTFSTIPLLSNPPGDEYGPGASCSKPESQNHSMSNKITRSVSVPAQLK
                     QSVYPWLAQLKEDMNQKDRVNYKLYSLIELFQYLSECIVQDIAFLECTGQLPAVRELL
                     REGNQKLFGSAMFAKYKEEMRQQLDGEVVNKDWHNSILLRMEEKFNQLTAKTAQDNTK
                     LNSEISDLKGKLNSMSSMISQLLESQRQLISRSSSHVPALSGTAVSALDKALQQPLSL
                     NDTASALAPISVLPSLSQQHLADGKRKLPLPSAPSPLDHSAGATLKKFRFEDRVLEGT
                     AGTPNNLGSPLEPLLSRAISSPRIPITSLTTQIPPTLAAATPPLHVRPQNTRILQEPR
                     QAADPTTAAMTLTQDCINTVMADELELQKAPLDESVHNLAVNNTASSNGGPNESIKYK
                     LSRDNKTIWDLYTEWYKGFDGKPSIKSLIERYGWRRWKVSDDSHFFPTRRIIINYIEK
                     ECDRGVAMGKYPSTLDREAVRKLVAKDLENFRVTNSLTLNSLSLYFRNLTREQREICI
                     YNNFTDWSLLILPEEEKTKYCKRKQGSSSE"
     gene            <177892..>179964
                     /locus_tag="AGOS_AEL244W"
                     /old_locus_tag="AEL244W"
                     /db_xref="GeneID:4620799"
     mRNA            <177892..>179964
                     /locus_tag="AGOS_AEL244W"
                     /old_locus_tag="AEL244W"
                     /product="AEL244Wp"
                     /transcript_id="NM_209970.1"
                     /db_xref="GeneID:4620799"
     CDS             177892..179964
                     /locus_tag="AGOS_AEL244W"
                     /old_locus_tag="AEL244W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL074W (YTA6)"
                     /codon_start=1
                     /product="AEL244Wp"
                     /protein_id="NP_984617.1"
                     /db_xref="GeneID:4620799"
                     /translation="MGQEKFVIPGNITLLQALTLLHSIVSAQFENTSKDMRASLASAA
                     RKDDTLLECQRALEETRGYLIDGSSRIKTHYRIDLVAGSLPEDVQGRIDDLRILEQDI
                     KTSQQALNDMLGDTKKRVPQVHRHAFSSIFRKTRFGSDRRLQRTQAAEDAEAHEVAEL
                     KRQRELQEDRKRQEELEREKRAKEEEDKRLEEAIKKHLEMELAQRFDRPRSEGTTQHN
                     RCNGKFPPRLSLDMRGSPKVELPVMRRSLDLGASYSTKLEGSSINKAALLAWYKDKEK
                     NVKTDPSKKENKERRVPPPPAKYEYTKPVIRRPQLKFSQPQGSRNKVKAKVLETVPPD
                     GLRSPSPKRGSNSDKSPVIESSPNPTTDSNSPQEISLLEKNIKDVMRSLKGVDTHSCE
                     QIINEILVVDYDVRWEDIAGLTIAKKCLKETVVYPFLRPDLFRGLREPISGMLLFGPP
                     GTGKTMIARAVATESNSTFFCISASSLLSKYLGESEKLVKALFYLAKRLSPSIIFIDE
                     IDSLLTSRSDNENESSRRIKTELLVQWSSLTSATAKETREGEEARRVLVLAATNLPWA
                     IDDAAIRRFSRRLYIPLPEYETRLYHLKKLMALQKNELSESDFQLIARMTEGYSGSDI
                     TALAKEAAMEPIRELGDNLINVNFDTIRSVLPVDFHRAMVTIKKSVSPDSLIKFDNWA
                     TEYGSIGS"
     gene            <180186..>181547
                     /locus_tag="AGOS_AEL243W"
                     /old_locus_tag="AEL243W"
                     /db_xref="GeneID:4620800"
     mRNA            <180186..>181547
                     /locus_tag="AGOS_AEL243W"
                     /old_locus_tag="AEL243W"
                     /product="AEL243Wp"
                     /transcript_id="NM_209971.1"
                     /db_xref="GeneID:4620800"
     CDS             180186..181547
                     /locus_tag="AGOS_AEL243W"
                     /old_locus_tag="AEL243W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR199W (KTR4)"
                     /codon_start=1
                     /product="AEL243Wp"
                     /protein_id="NP_984618.1"
                     /db_xref="GeneID:4620800"
                     /translation="MLCLRKCLRRPILLLAIALTGIVCFLIYRINHILEVRAYFANTV
                     ESVGATLSDIASKTTHADRASEFDALIEKLTTPLHSGAELSGATREEGLRAYARFMDQ
                     PIDEPKGTPLVRPGTDAAGKAPATILCLVRNKDLEGIRSSITELEKAFNGKFKYPYTF
                     LNDEPFTPEFKEAIQKLIPEHESEFATIDKEFWSIPEAINREKYDVQKLKLLTLKVGH
                     AEEDSYHLMCRFYSRYFYKVPELAKYRYVWRLEPNVNFHSELNYDVFQFMKAANKIYG
                     FTISLYDNPWSVESLWDHTMDFVRAHPHYLNQAGATDWLRENIQKSENFKITRGYSTC
                     HFWSNFEIIDLEFLRSEAYEQFVEYLDQTGGFFYERWGDAPVRSLALALFANASDIHW
                     FRDIAYNHLPYFNCPTFLPDSRRSFGTCKSGKFSNWDELNVENCAGNWILHAMTDADR
                     AAY"
     gene            <181838..>183679
                     /locus_tag="AGOS_AEL242W"
                     /old_locus_tag="AEL242W"
                     /db_xref="GeneID:4620801"
     mRNA            <181838..>183679
                     /locus_tag="AGOS_AEL242W"
                     /old_locus_tag="AEL242W"
                     /product="AEL242Wp"
                     /transcript_id="NM_209972.1"
                     /db_xref="GeneID:4620801"
     CDS             181838..183679
                     /locus_tag="AGOS_AEL242W"
                     /old_locus_tag="AEL242W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL072W (UBP16)"
                     /codon_start=1
                     /product="AEL242Wp"
                     /protein_id="NP_984619.1"
                     /db_xref="GeneID:4620801"
                     /translation="MLHRVTYPSSVYDGTLSINKVGSFLYGTDNIPQRLLLCGTLALS
                     YYILGPTIYTWLFPGSSAMFQSSTRKDKHTTGLANNRNDCFANSSIQAWASLPAVSVY
                     LNEIMEIRKEVLRRMVRSSDGAHDGAAADEWGEVKAPSPEHKSEAHDMHDSGDHVGQM
                     NLSNGVDVRMHAALADILYQLQQPVAKSTFISLQPLLHTLELIYSAKLSRGQNDAHEF
                     TQLLLETLEKEHTELSLMLKGDKRLEGLAVPAFPIRGSLADNLVCLRCGGSSKVNVHQ
                     FSMHTLPVPNATSADLRDMLFDNQTETIDDYTCVSCQIRAILATEKNRGRQGVDSTEL
                     AIIEELARLAPSISINEDMPPHLAAYVSAYNKDHCITAALKSTIVKRTVSVDSPRVLI
                     LHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVRAVRYKLCAMIKHIGTH
                     SQGHYACFRHKPDFRKDPRTGEIIIRSDVISSDAVPQPAPRMPVPYASSKPSALGRLA
                     ALLKTVTGEPPSTVTTNEEPVSKPDASAEQDSSGASSASSSGVSSAATKVLPRPQGRP
                     RKLKALRRTTTHPWWCISDSYVSECKTSFLLSETKLVYMLYYQRIEP"
     gene            <183867..>185704
                     /locus_tag="AGOS_AEL241W"
                     /old_locus_tag="AEL241W"
                     /db_xref="GeneID:4620802"
     mRNA            join(<183867..183875,184064..>185704)
                     /locus_tag="AGOS_AEL241W"
                     /old_locus_tag="AEL241W"
                     /product="AEL241Wp"
                     /transcript_id="NM_209973.1"
                     /db_xref="GeneID:4620802"
     CDS             join(183867..183875,184064..185704)
                     /locus_tag="AGOS_AEL241W"
                     /old_locus_tag="AEL241W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR200W (BEM1); 1-intron"
                     /codon_start=1
                     /product="AEL241Wp"
                     /protein_id="NP_984620.1"
                     /db_xref="GeneID:4620802"
                     /translation="MLKGFKLKKDSSQATKGRITSADISAPTQDGSNIAFHMNRLRSL
                     SNTSNRGGKNGAVAGAVDVPIILKALYTYHAQSPGELSFNKGELFQVNGEDGEWYEVT
                     STEGGRKGMVPKSYFEQVSKSRVVSTHSILTSPQQVQMPVKTGSLYAIVLYDFKAEKS
                     DELSAFAGENLFICAHHNFEWFIAKPIGRLGGPGLVPVGFVSIIDINSGYATGNNVKD
                     DIASVNLPTVQEWKNNIAKYKASNISLGSVEQHQQQQQQQQQQQRVSVVPSVQPFQYT
                     QAQSFDNIVPVGAAVESFLLEGEKYWFHVVCDLEDGSSHSLKRYYEDFYDLQVQLLDA
                     YPAEAGKLRDSNGQWTKRIMPYIPGPVPYVTDSITKKRKDDLNIYVKELIALPPHISH
                     SPLVKSLFAIRNNGFDRVLLKDYGNSTVVRSDDPVALTGAKLAQQEESTLTGSDLKER
                     MGELSLNDKTPPIGSPQAAGSQLKSNKIKFYYKDDIFALLLSPTITLVELKTKIAPRI
                     DSETFQLFVKAGDDVGTEITSNEDLSGVIQEKQKIMVLDVQ"
     gene            complement(<185853..>186323)
                     /locus_tag="AGOS_AEL240C"
                     /old_locus_tag="AEL240C"
                     /db_xref="GeneID:4620803"
     mRNA            complement(<185853..>186323)
                     /locus_tag="AGOS_AEL240C"
                     /old_locus_tag="AEL240C"
                     /product="AEL240Cp"
                     /transcript_id="NM_209974.1"
                     /db_xref="GeneID:4620803"
     CDS             complement(185853..186323)
                     /locus_tag="AGOS_AEL240C"
                     /old_locus_tag="AEL240C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL071C"
                     /codon_start=1
                     /product="AEL240Cp"
                     /protein_id="NP_984621.1"
                     /db_xref="GeneID:4620803"
                     /translation="MGAAQAGGAFKMKRPAVDPAGIATYKRQRLVADLENLRISEVPA
                     ARAAVVDSAGRGHGNALLADRIRDQVWEVLQRPRGEAALQQRMCRQIWQDTYNSHMQV
                     VRWVDWPARMFQIWLRWWQSQGTESSDVEMATDYESYEEEETPMDVDEDGDWKY"
     gene            <186675..>188330
                     /locus_tag="AGOS_AEL239W"
                     /old_locus_tag="AEL239W"
                     /db_xref="GeneID:4620804"
     mRNA            <186675..>188330
                     /locus_tag="AGOS_AEL239W"
                     /old_locus_tag="AEL239W"
                     /product="AEL239Wp"
                     /transcript_id="NM_209975.2"
                     /db_xref="GeneID:4620804"
     CDS             186675..188330
                     /locus_tag="AGOS_AEL239W"
                     /old_locus_tag="AEL239W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL070W (MUK1)"
                     /codon_start=1
                     /product="AEL239Wp"
                     /protein_id="NP_984622.2"
                     /db_xref="GeneID:4620804"
                     /translation="MAVAAMSDSPPLNAAVYESKHPNKKQYTQAGETYEDASSSTSLA
                     SKQSSTASGSQRDEMEKEVAQIEVLPMELSRLVDMFVDDLKQPKYVKPLSIFLLSGLF
                     QQFYTRFDASCGQYLAKQGRQLGTSASVENVGFSSARETLSTGLGGIFGRSRSGSGPH
                     KKRSSSLFGNDAANSQPLSPEEVQRHLKLQELNSMKIERYMDICERDVFQKIMEVGTS
                     VPGTGQETERRPVHAVDLFRNSPEFLEYDSLLTAKIRNLRVLVERGVLDLPAFLGMPR
                     SEGIDCTEFGIHLQTLVEERLSPMEKLAQLLAIHDKMTFLKDASSNDDYLSMLLYVII
                     LTPVHTLYLNVQFIKLFRYSRKLMGSEQYAVTNMTAALYFLENLTINDLPGTAKGHAK
                     PSDIFVLSHRVKLPDISRQAKPELPRTNSYKSLMGTTLDNSLRNIFGKIKSYTPPAPA
                     QTVFSSPTNQSNMHNNQLNCCCHAGKPCQGQIGSAQLSSTAELACCNDSHDSFKGGEN
                     SKRPLHIPECWRQLQNRDFDDLKVSELKQVFDAFQKLLHTLEH"
     gene            complement(<188371..>189333)
                     /locus_tag="AGOS_AEL238C"
                     /old_locus_tag="AEL238C"
                     /db_xref="GeneID:4620805"
     mRNA            complement(<188371..>189333)
                     /locus_tag="AGOS_AEL238C"
                     /old_locus_tag="AEL238C"
                     /product="AEL238Cp"
                     /transcript_id="NM_209976.1"
                     /db_xref="GeneID:4620805"
     CDS             complement(188371..189333)
                     /locus_tag="AGOS_AEL238C"
                     /old_locus_tag="AEL238C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL069C (BTS1)"
                     /codon_start=1
                     /product="AEL238Cp"
                     /protein_id="NP_984623.1"
                     /db_xref="GeneID:4620805"
                     /translation="MDSVEGLALGPVIWTASQEELLRQPYNHLVTQPGKNFRNTLIRV
                     FNGFYGLSERQVAAVTELVEMLHVASLLIDDIEDNSAWRRGVAAAHVVYGSPMTINTA
                     NYMYFVSMSLLGQLAAQRPAGPLQDLLKVFNEEMMNLHRGQGLDIYWRDTFTVPSEHD
                     YLRMVMHKTGGLFRLTVRIMEALREGPDGPGSTLVPLSNLLGVLYQVRDDYLNLTDSR
                     MSENKGFADDITEGKFSYPIIHGLQYARVHDPAGYDFLVSVLRQRTTDITTKRRVVRY
                     LADVSGSLAYTKQRIIELATLIKTKYIPASGTELCNVIDSLTSF"
     gene            <189550..>190152
                     /locus_tag="AGOS_AEL237W"
                     /old_locus_tag="AEL237W"
                     /db_xref="GeneID:4620806"
     mRNA            <189550..>190152
                     /locus_tag="AGOS_AEL237W"
                     /old_locus_tag="AEL237W"
                     /product="AEL237Wp"
                     /transcript_id="NM_209977.2"
                     /db_xref="GeneID:4620806"
     CDS             189550..190152
                     /locus_tag="AGOS_AEL237W"
                     /old_locus_tag="AEL237W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR201W (DER1)"
                     /codon_start=1
                     /product="AEL237Wp"
                     /protein_id="NP_984624.2"
                     /db_xref="GeneID:4620806"
                     /translation="MDVLFVQIMQGVQPVTRVYVLSMIGCIIAHNIGWIESTKYDFSL
                     IFHRRQYHKLLLSCFDVGSQFNAMDLAITMFQLSYDEQIIGNSKRFIWFIAVVAVLTT
                     SFAYIWDVKGEVLMVDMIKWNLTYYAARTNVAAAGQIGFIRVPSLLALLRIPIFLRVN
                     QCSFAMCSLSVLPGYVLYLMADAAERLYQIDLMRPPDEWF"
     gene            complement(<190213..>191040)
                     /locus_tag="AGOS_AEL236C"
                     /old_locus_tag="AEL236C"
                     /db_xref="GeneID:4620807"
     mRNA            complement(<190213..>191040)
                     /locus_tag="AGOS_AEL236C"
                     /old_locus_tag="AEL236C"
                     /product="AEL236Cp"
                     /transcript_id="NM_209978.2"
                     /db_xref="GeneID:4620807"
     CDS             complement(190213..191040)
                     /locus_tag="AGOS_AEL236C"
                     /old_locus_tag="AEL236C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL068C"
                     /codon_start=1
                     /product="AEL236Cp"
                     /protein_id="NP_984625.2"
                     /db_xref="GeneID:4620807"
                     /translation="MELRRSNRLRKTNKEAVAEEQSSSEEEGDGFRRSGERMKRRVRP
                     RRADATAGSGLRRDVEEALGVLPRPRYYFADGARARGAVRWGVESGAVDRTAGMLDGW
                     LSKHGENAVGPETAAAVARIARQLRQLGREVAAAPAEEDTASLLERVVADGTRQDEVC
                     QQLTGLIDGLAEAADEEWIAALARIHELDLQDIADMPAPRPPKRGAAAQAGPCSRRAD
                     LQFVINKWNKLLTRERNLALYWPSKAPRKDSGHMSPAAQALSQEDPRDKFRDVPLFS"
     gene            <191225..>191539
                     /locus_tag="AGOS_AEL235W"
                     /old_locus_tag="AEL235W"
                     /db_xref="GeneID:4620808"
     mRNA            <191225..>191539
                     /locus_tag="AGOS_AEL235W"
                     /old_locus_tag="AEL235W"
                     /product="AEL235Wp"
                     /transcript_id="NM_209979.2"
                     /db_xref="GeneID:4620808"
     CDS             191225..191539
                     /locus_tag="AGOS_AEL235W"
                     /old_locus_tag="AEL235W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR020C (HSP10)"
                     /codon_start=1
                     /product="AEL235Wp"
                     /protein_id="NP_984626.2"
                     /db_xref="GeneID:4620808"
                     /translation="MSFLKSAKSIVPLMDRVLVQRIKAEAKTASGLYLPEKNVEKLNQ
                     ATVLAVGPGYTDAQGRQVSPSVQVGDKVLIPQFGGSSIKLGKDDEVLLFRDSEILAKI
                     QE"
     gene            complement(<191568..>192773)
                     /locus_tag="AGOS_AEL234C"
                     /old_locus_tag="AEL234C"
                     /db_xref="GeneID:4620809"
     mRNA            complement(<191568..>192773)
                     /locus_tag="AGOS_AEL234C"
                     /old_locus_tag="AEL234C"
                     /product="AEL234Cp"
                     /transcript_id="NM_209980.2"
                     /db_xref="GeneID:4620809"
     CDS             complement(191568..192773)
                     /locus_tag="AGOS_AEL234C"
                     /old_locus_tag="AEL234C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR473C (PRP3)"
                     /codon_start=1
                     /product="AEL234Cp"
                     /protein_id="NP_984627.2"
                     /db_xref="GeneID:4620809"
                     /translation="MAEKEKKGLATEIHPALRSSNLNLLRSKRENPYLSSDAPRQRQP
                     KRRQPLAFYKPGEISQRAEEERQRRARELEEQQLLLRKQEEEEHIRREKIAAAELPDD
                     DETCYFDAISALPSIEWWDTKFCDGSQPAAHAKYTASYADLEDDSDCSDDEQEDERPS
                     IRFVKHPLPFQPSVTAAATIVPKIYLTKHEQRKVRRNQRKTARQMAEERIRLGLEPRP
                     PPKVRLNNMMHVYDSNTKIQDPTAWEHTVREQIEQRRQQHLRTNEERRLEARAQRAAQ
                     PAPAPDPGQDICRVYSLPPLADPKARYKLVTNARQLHLRGCCLHVPDGPALVVAIGPP
                     RACTFYDRLLTRRLAWHASAPALLWTGAAAGHTFRGWFMKQCAEPADLRRILLAAGGP
                     LFAHTPLPS"
     gene            complement(<192980..>195361)
                     /locus_tag="AGOS_AEL233C"
                     /old_locus_tag="AEL233C"
                     /db_xref="GeneID:4620810"
     mRNA            complement(<192980..>195361)
                     /locus_tag="AGOS_AEL233C"
                     /old_locus_tag="AEL233C"
                     /product="AEL233Cp"
                     /transcript_id="NM_209981.2"
                     /db_xref="GeneID:4620810"
     CDS             complement(192980..195361)
                     /locus_tag="AGOS_AEL233C"
                     /old_locus_tag="AEL233C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR475C (JIP4) and YOR019W"
                     /codon_start=1
                     /product="AEL233Cp"
                     /protein_id="NP_984628.2"
                     /db_xref="GeneID:4620810"
                     /translation="MLNFDYPQKDWYKDVRLCGCRQCCEAVRRKRQGSSGSCGMGEHG
                     QYLDEGYEGRGEHVRSSSAHSGSGGHFVPTISFDTVPIQGISPEEDEQDALHEHQRAY
                     GTSLDYTLEEYYNNEDTSYNHDYRSGGGYAGELSPLRSLSPSRYGSGAQLAKFDVLPD
                     GRRVRIDYPSKSTLLSDSFVLNKTHREWRSKWKARKAQIERRKLEEPQRWYRYPSILF
                     PETKVDLSDLPMINDEGVAYNSNQRANMKRIARVVRTPVGFPVSPRIVLCHVSGRKHT
                     WAAVDWVLQNFIADSDHLVVVANLPRLMSRFGYMSRSVSRSRSRSRSRSVRRTTGLNS
                     TSSFGSDVSESMTKNKDEEWCNGYTVGSIETILDHLIEYITFIIPEKLAIKVTVEVMI
                     GKTRQVLIEALNLHCPDLLVASTTKYKENDGLLDHRSKRLTTVLANYYPLPVFVVPAK
                     RMFLLGMQLESIVHGSDACNAAAPVSQQFSSEVGDSLAPFKPSLKTMHTSPAVMLHTE
                     SSVPEVEYGMDESEITSIDSELSDGVTEYAGTELLQQDPVGRVARMRETYRRRVQKTF
                     SKIDSDSTLQADERHFNKLDAVINASLKFNKELENSKSPSILELQRIITGGEKHTGFR
                     KKSMLDVLDLPSAKPRKQDPIPKPNLSAGDPTPRRTTRIKFEATVKDVDGSTAVQQSP
                     SDEVLREMSPLRQVQSLSQSNLMKYVSNNSLRKVRSANTNPVNSTKYNESTGSSGKRK
                     RGGFLSALFGGSGGGSASNTASPATSRRSSMSSSENSGGTSTGKRKKKWKLLK"
     gene            complement(<195584..>196515)
                     /locus_tag="AGOS_AEL232C"
                     /old_locus_tag="AEL232C"
                     /db_xref="GeneID:4620811"
     mRNA            complement(join(<195584..196309,196357..>196515))
                     /locus_tag="AGOS_AEL232C"
                     /old_locus_tag="AEL232C"
                     /product="AEL232Cp"
                     /transcript_id="NM_209982.2"
                     /db_xref="GeneID:4620811"
     CDS             complement(join(195584..196309,196357..196515))
                     /locus_tag="AGOS_AEL232C"
                     /old_locus_tag="AEL232C"
                     /note="NOHBY512; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F02662g;
                     1-intron"
                     /codon_start=1
                     /product="AEL232Cp"
                     /protein_id="NP_984629.2"
                     /db_xref="GeneID:4620811"
                     /translation="MTPTGGEVDFFLDSPFRLQKLMLVAPPSRTMDLLTAWIHRLWTC
                     LCLFFNQRQLKIAIVGLQNSGKTTLAALLTGHPFRADTIPTLGIDVRHATIGQTLLQV
                     YDLAGQARHRFLWDRCLDTTDLVVYVLDLSDDTAWEAAKHALQSVLVATNARRTPVLI
                     IGNKADLVAPPPILPPDDASPAPPGPSQQSHRSASVSSNARPFDISPYHWRFMTPLLS
                     HYDYDDIPTYVIDTSNHHLLLDLQVLSRELGLDLRNGILHLTNETVLAMDRDIGLFTV
                     SCRDGTGISDVIEWLMQL"
     gene            complement(<196551..>197366)
                     /locus_tag="AGOS_AEL231C"
                     /old_locus_tag="AEL231C"
                     /db_xref="GeneID:4620812"
     mRNA            complement(<196551..>197366)
                     /locus_tag="AGOS_AEL231C"
                     /old_locus_tag="AEL231C"
                     /product="AEL231Cp"
                     /transcript_id="NM_209983.1"
                     /db_xref="GeneID:4620812"
     CDS             complement(196551..197366)
                     /locus_tag="AGOS_AEL231C"
                     /old_locus_tag="AEL231C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR476C"
                     /codon_start=1
                     /product="AEL231Cp"
                     /protein_id="NP_984630.1"
                     /db_xref="GeneID:4620812"
                     /translation="MPLELADGGQPGPFAYDGHQAPLLGGTSGWLPLCAVCWRRVRAG
                     ILYSCPIPCPPLSLNLPPPMTSPQQRIIVQMNQERRLALEDYLTTYGRVPIGTKVNEV
                     RLADIELDHLTLRFRHSDVELEIEKTIALDPPLQHWDEAPARLDAMALEAAARRGLAA
                     VQVRGGAAPSALGWLLIGLIYLPAACYYEPRLLAWAVPGALLQRSVLQSVFAGVAVCH
                     IAECMLLLRPRLHTYRVPTDYRIEWYFFGLLEGYPAIRRFDRAARSLKSRPTT"
     gene            <197631..>199457
                     /locus_tag="AGOS_AEL230W"
                     /old_locus_tag="AEL230W"
                     /db_xref="GeneID:4620813"
     mRNA            <197631..>199457
                     /locus_tag="AGOS_AEL230W"
                     /old_locus_tag="AEL230W"
                     /product="AEL230Wp"
                     /transcript_id="NM_209984.2"
                     /db_xref="GeneID:4620813"
     CDS             197631..199457
                     /locus_tag="AGOS_AEL230W"
                     /old_locus_tag="AEL230W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR477W (SNF1)"
                     /codon_start=1
                     /product="AEL230Wp"
                     /protein_id="NP_984631.1"
                     /db_xref="GeneID:4620813"
                     /translation="MSNANHHHQQQKMYTGGRNMPHGMHRPGSIPIGQRIGKYQVIKT
                     LGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL
                     YDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSENEARRFFQQIISAVEYCHRHKIVHR
                     DLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVD
                     VWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYSIPKFLSQGAANLIKRMLIVNPL
                     NRITIHEIMEDEWFKVDLPDYLVPVDMKADATSKPGTDDERIDEALVAVLANTMSYDK
                     DEIYEALEDPNQTDPTVLEIRDAYLLLKENKSLIDGLRSNKQKLDQLDTFLSQSPPTF
                     ESHSQLGPGSGFQAALGGSQHGDQNPHQVKRLASRQRTYQLSFSEQQDEDSTIAILPS
                     SLPQIHRANMVAQGSPAAVKISPLSNKKSKTRWHFGIRSRSYPLDVMGEIYLALKNLG
                     AEWAKPSEEDLWTIRVRWKYDVGTQQNERIPDLMRMVIQLFQIETNNYLVDFKFDGWE
                     SSSGNPISSSSTDDEMSTFSAYPFLHLTTRLIMELAVNSQSS"
     gene            <199823..>201340
                     /locus_tag="AGOS_AEL229W"
                     /old_locus_tag="AEL229W"
                     /db_xref="GeneID:4620814"
     mRNA            <199823..>201340
                     /locus_tag="AGOS_AEL229W"
                     /old_locus_tag="AEL229W"
                     /product="AEL229Wp"
                     /transcript_id="NM_209985.2"
                     /db_xref="GeneID:4620814"
     CDS             199823..201340
                     /locus_tag="AGOS_AEL229W"
                     /old_locus_tag="AEL229W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR025W (HST3)"
                     /codon_start=1
                     /product="AEL229Wp"
                     /protein_id="NP_984632.2"
                     /db_xref="GeneID:4620814"
                     /translation="MPSLIQSQESFDEELPSVLEKKATPKPQLQTEKLKHIELDSDNV
                     DEELLSMINRQIGRSRKIMVLTGAGISCSAGIPDFRSSGGLYNMVKKQYPEVQIRSGQ
                     EMFDISLFREEEKISVFATFMDSLHSSAIQAKPTRAHEFIAHLKNRGKLLRCYTQNID
                     GLEEHLGLEMSHSVDPGASFNTQWKNLDVVQLHGDLNSLSCTQCFEVFNWTRSWKRIL
                     KAGELPPCPRCCAFNQERENQGKRLRNSVGILRPNIVLYGENHPSCEFITQGLNMDIA
                     KGKPDLLIIMGTSLKVDGVKKLVKSISRQVHERSGIVLLINSTTIGDCNWHGIIDYQI
                     LAECDAWVADLKKRLPDFFMTQQQVDKLRQLKREASELKKRQRKEQYLFPQAERRNIP
                     NTPPSTPSPTKRRRAAANTPSSTLRTLKETVVTLPPTQVPSLQRDQRDTTMNKIYMKL
                     IKDDDHYAKLTDMPEEELMQSVIAEKKAIAPSKNRKVKDSQSMDFDEVPTDVDEP"
     gene            <201524..>202108
                     /locus_tag="AGOS_AEL228W"
                     /old_locus_tag="AEL228W"
                     /db_xref="GeneID:4620815"
     mRNA            <201524..>202108
                     /locus_tag="AGOS_AEL228W"
                     /old_locus_tag="AEL228W"
                     /product="AEL228Wp"
                     /transcript_id="NM_209986.1"
                     /db_xref="GeneID:4620815"
     CDS             201524..202108
                     /locus_tag="AGOS_AEL228W"
                     /old_locus_tag="AEL228W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR478W (SNM1)"
                     /codon_start=1
                     /product="AEL228Wp"
                     /protein_id="NP_984633.1"
                     /db_xref="GeneID:4620815"
                     /translation="MRLMEMSTAVTTNNGMNRLEKDNFMRIHLQHKYTLLHHLSSADV
                     THLSGLYLKSFYNAVKRNRVVLPNIICDGDVKFCGSCGIVYVAGVNLQAHVQETSQED
                     GIVKKELVYKCLKCSHEKRFVLSQSDPPVPKAPFVAKWPSKENSKSSIAKSSGRERAK
                     KRKKNMLSNLLAAKKQHESTKGKVSLQLEDFMKS"
     gene            complement(<202256..>203830)
                     /locus_tag="AGOS_AEL227C"
                     /old_locus_tag="AEL227C"
                     /db_xref="GeneID:4620816"
     mRNA            complement(<202256..>203830)
                     /locus_tag="AGOS_AEL227C"
                     /old_locus_tag="AEL227C"
                     /product="AEL227Cp"
                     /transcript_id="NM_209987.2"
                     /db_xref="GeneID:4620816"
     CDS             complement(202256..203830)
                     /locus_tag="AGOS_AEL227C"
                     /old_locus_tag="AEL227C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR479C (PEX29)"
                     /codon_start=1
                     /product="AEL227Cp"
                     /protein_id="NP_984634.2"
                     /db_xref="GeneID:4620816"
                     /translation="MDSLRGHHTKERGSGHGRGECGVMQGMLLDKMMEKVLGMAIPPA
                     GEAGGGAIESRVQAGRARPGLSVPIMSRNFVQMNSRLSFPFQVVNEVIRIANWESTAC
                     TLSVGMLYSFVVLRPLVTLSSAPMFYILFAVMVPYYMQIHAPEPWEELGANPIPAAGP
                     ALKEPDLPRPVPELSKEFILNLTDLQNHMVLYVVCYDFITGLLAKFAFFADENVSAAA
                     FVGLLVLGVFNMLFIESLFRWIPLKLLLLACGWGFLIMLHPSCRDACFDYISSEETRL
                     KVLTMTNKIEQLINDYWDYCEPRETRQAAIFEIQKFDRRTKEWRTAGFSSDDYTLLSK
                     LRIAEEPIDSSATSLDDVKPPLDWKWLGKYDWVLDLEPRQWVTDGFVQYVDIDAETKW
                     VYDLNFDGTRGQYRRRRWIRLCTRNRSVQENANVDTIDDDNSDDYELVDYSGCTGVSQ
                     NSMHGSVKSCHSISEPTDQIVVERLRSHTLSPAANASVSSADSTASATIATPNKNVEQ
                     GSRAIKSLTDFLNING"
     gene            <204042..>205016
                     /locus_tag="AGOS_AEL226W"
                     /old_locus_tag="AEL226W"
                     /db_xref="GeneID:4620817"
     mRNA            <204042..>205016
                     /locus_tag="AGOS_AEL226W"
                     /old_locus_tag="AEL226W"
                     /product="AEL226Wp"
                     /transcript_id="NM_209988.1"
                     /db_xref="GeneID:4620817"
     CDS             204042..205016
                     /locus_tag="AGOS_AEL226W"
                     /old_locus_tag="AEL226W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR026W (BUB3)"
                     /codon_start=1
                     /product="AEL226Wp"
                     /protein_id="NP_984635.1"
                     /db_xref="GeneID:4620817"
                     /translation="MVSGEPGNVASAMAYVELKDVSKDYLSGVCLVDEEGSQLIVSSW
                     DGTASLYDWEKNKRMGRLSHEWPLTSVAVCAGTRRAYVGSAQGEVLELDWESERMVAL
                     QGVQCGLGISAMGSYGQFVVVGSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARV
                     VCMTTDGVYVFRTSDIDAAPERRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFG
                     DEGRKFAFRCHRMNLKDTQLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEE
                     LPKVEDSVVKLCCNRRALVIAASDDSFKTSAVVEDIALQRSRVYVKVF"
     gene            complement(<205065..>206498)
                     /locus_tag="AGOS_AEL225C"
                     /old_locus_tag="AEL225C"
                     /db_xref="GeneID:4620818"
     mRNA            complement(<205065..>206498)
                     /locus_tag="AGOS_AEL225C"
                     /old_locus_tag="AEL225C"
                     /product="AEL225Cp"
                     /transcript_id="NM_209989.2"
                     /db_xref="GeneID:4620818"
     CDS             complement(205065..206498)
                     /locus_tag="AGOS_AEL225C"
                     /old_locus_tag="AEL225C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR257C (RKM4)"
                     /codon_start=1
                     /product="AEL225Cp"
                     /protein_id="NP_984636.2"
                     /db_xref="GeneID:4620818"
                     /translation="MVDEFAEATAQFVQWLPKVGIEVAPEVRVEDLRDAGQNRSVVAS
                     GAVQEGATLFTIPRSALLNVHTSALRECAAGLPAALEEKIGHWEGLVMCVYYERCVLQ
                     ERSRWWPCLRLFPAVEEMDNLIYWNAEQRQLLTPSLVGSRIGDESAREMHARVLALAE
                     EWGLSELKEMSWDAFVHIASVIMAYSFDCRLNSDEEDDEEDDDGALDGGTVAADGCIK
                     SIVALAETLNSDTHLANANLTYDRDQLKMIAVKDIKAGEQVYNLYGSYSNAELLRRYG
                     YVEWTGSKYDYGEIELSAIRETISKELAVPDFPFDAVLALLEDKDGWAGELFDYNDIV
                     EESYDCYADGELAPDGAFLVQLLVALAQVPRAALGKGSTLSVRTRKISKKVMQLLESG
                     RITRKAADVLESVIRDRMQAYPPHAAVFDGQKPTDLQAMDPAPRREAMARCVLQCEVK
                     ALQKCALAISSNYKIISDDLLMGKLLN"
     gene            <206940..>208682
                     /locus_tag="AGOS_AEL224W"
                     /old_locus_tag="AEL224W"
                     /db_xref="GeneID:4620819"
     mRNA            <206940..>208682
                     /locus_tag="AGOS_AEL224W"
                     /old_locus_tag="AEL224W"
                     /product="AEL224Wp"
                     /transcript_id="NM_209990.2"
                     /db_xref="GeneID:4620819"
     CDS             206940..208682
                     /locus_tag="AGOS_AEL224W"
                     /old_locus_tag="AEL224W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR027W (STI1)"
                     /codon_start=1
                     /product="AEL224Wp"
                     /protein_id="NP_984637.2"
                     /db_xref="GeneID:4620819"
                     /translation="MTTAEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSN
                     RSACYASMRKFREALADAQECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALEL
                     DSSNKAAQDGLAQVQATQQQRMEQPDLGFGQMFQDPNLIQKLKNNPKTAEMMKDPQLV
                     AKVLQFQSNPQAISTELMRDPRLMTVMAAILGIDLSMDSPEPKSAAPADAPAPSAEQP
                     SEAKPEPTPAASQPAPAAEKEEEPEQMHVDDDRSKAEEAKAKGNELYKKRQFDEAIAN
                     YEKAWDLHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEGRELRADYKVIAKSFARL
                     GNAHYKLADLKKAIEYYEKSLTEHRTPEVLNKLRSLEKEQKKREAEAYIDPEKAEEAR
                     LQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQ
                     KDPNFVRAYIRKATAQIAVQEYAAAIETLDTAREKDAEVNNGSNTREIDQLYIKATQQ
                     RFQPANANESPEETYARAVKDPEVAAILQDPVMQSILSQAQQNPAALQEHMKNPQVFK
                     KIQTLIAAGIIRTR"
     gene            complement(<209080..>211491)
                     /locus_tag="AGOS_AEL223C"
                     /old_locus_tag="AEL223C"
                     /db_xref="GeneID:4620820"
     mRNA            complement(<209080..>211491)
                     /locus_tag="AGOS_AEL223C"
                     /old_locus_tag="AEL223C"
                     /product="AEL223Cp"
                     /transcript_id="NM_209991.2"
                     /db_xref="GeneID:4620820"
     CDS             complement(209080..211491)
                     /locus_tag="AGOS_AEL223C"
                     /old_locus_tag="AEL223C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR258C (HSP78)"
                     /codon_start=1
                     /product="AEL223Cp"
                     /protein_id="NP_984638.2"
                     /db_xref="GeneID:4620820"
                     /translation="MLRSVGRVPGYRVRGAATSWMHRPLAGGCWLPEHISVNPGNRPS
                     LADGHLSVWLAACRPFSSSVARYQANKNYRMDLGKQQEQSALEQYGINLTKLARAGKL
                     DPVIGRDQEISRAIQILSRRTKNNPVLLGRAGVGKTSLIDGLAQRIVKGEVPSSLMDK
                     ELVALDLGSLIAGAKYRGEFEERLKSVLDEIDKSEGQVIVFIDEVHMLLGLGKTDGSM
                     DASNILKPRLAKGMRCISATTFDEFKIIEKDPALTRRFQPVILDEPSVSDTISILRGL
                     KERYEVHHGVRITDTAIVSAAVLSNRYINDRFLPDKAIDLVDEACAVLRLQHESKPDS
                     IQAIDRAIMTMEIELESLRKEEDPVSLERADALKKSLKEKNDELEKLTKVWDKEKKEI
                     EAIKSAKATLEQAKIDLEIAQREGDYGKASELRYAKIPQLEKTISESEKSGSKNNILH
                     DAVTADDISAVVSKMTGIPVSSMFKGDKDRLLNMEQSLTKRVVGQDEAISAICQAVRL
                     QRAGLTSSKRPIASFMFLGPTGTGKTELTKALSEFLFDNESNVIRFDMSEFQEKHTVS
                     RLIGAPPGYVLSESGGQLTEAVRRKPYAVVLFDEFEKAHPDVCKVLLQVLDDGKLTDS
                     QGHHVDFRNTIIVMTSNVGQDILLNDSELTIDGKVSEKTKNKVIESVKRIYPPEFINR
                     IDELLVFNRLSKSVLRSIVDIRLKEVQQRLSDKRMVLALTDEAKDWLTERGYDPGYGA
                     RPLNRLIHKTILNPMALYLLKGQLRDGETVKVTVEADKLVIKPNHEESESTDSTGETH
                     AALDT"
     gene            complement(<212965..>213669)
                     /locus_tag="AGOS_AEL222C"
                     /old_locus_tag="AEL222C"
                     /db_xref="GeneID:4620821"
     mRNA            complement(<212965..>213669)
                     /locus_tag="AGOS_AEL222C"
                     /old_locus_tag="AEL222C"
                     /product="AEL222Cp"
                     /transcript_id="NM_209992.1"
                     /db_xref="GeneID:4620821"
     CDS             complement(212965..213669)
                     /locus_tag="AGOS_AEL222C"
                     /old_locus_tag="AEL222C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR028C (CIN5) and YDR259C (YAP6)"
                     /codon_start=1
                     /product="AEL222Cp"
                     /protein_id="NP_984639.1"
                     /db_xref="GeneID:4620821"
                     /translation="MESNRGSADAKASLEELEKKGLLGAAGVVVPDMAGVGGGVQQGM
                     AAMPVSVRAQYQQAMQEGAGAGGGAGSGGSQPPLIQLPSMTMPSLMYQLSHHPTHHGS
                     MPQIPVLKQHQQGQQEMGSGSSAGSTANGSAGLPLLSTTTSTQGIQAIQLNEGEHINS
                     QGQLIGRSGKPLRNTKRAAQNRSAQKAFRQRREKYIKDLEIKAKQYDKLEQEVLSLRR
                     ENEELKMRLADIEKLT"
     gene            complement(<214099..>214527)
                     /locus_tag="AGOS_AEL221C"
                     /old_locus_tag="AEL221C"
                     /db_xref="GeneID:4620822"
     mRNA            complement(<214099..>214527)
                     /locus_tag="AGOS_AEL221C"
                     /old_locus_tag="AEL221C"
                     /product="AEL221Cp"
                     /transcript_id="NM_209993.1"
                     /db_xref="GeneID:4620822"
     CDS             complement(214099..214527)
                     /locus_tag="AGOS_AEL221C"
                     /old_locus_tag="AEL221C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR260C (SWM1)"
                     /codon_start=1
                     /product="AEL221Cp"
                     /protein_id="NP_984640.1"
                     /db_xref="GeneID:4620822"
                     /translation="MGYIDSQVHAYHYHHDHEMALRWLKETFPLPDEIEMKGKSNAAS
                     SGTGANLTAPAPASTPVGPAPSSHIIGAAPAAHGLVNQYWDCFDDEEQWTMFHGLKMA
                     CNGDLFKDGVLLGNNFHRADRLAALAAATKPPPPNRAPTS"
     gene            complement(<214585..>216090)
                     /locus_tag="AGOS_AEL220C"
                     /old_locus_tag="AEL220C"
                     /db_xref="GeneID:4620823"
     mRNA            complement(<214585..>216090)
                     /locus_tag="AGOS_AEL220C"
                     /old_locus_tag="AEL220C"
                     /product="AEL220Cp"
                     /transcript_id="NM_209994.1"
                     /db_xref="GeneID:4620823"
     CDS             complement(214585..216090)
                     /locus_tag="AGOS_AEL220C"
                     /old_locus_tag="AEL220C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR261C (EXG2)"
                     /codon_start=1
                     /product="AEL220Cp"
                     /protein_id="NP_984641.1"
                     /db_xref="GeneID:4620823"
                     /translation="MRSYVTLAAVLATALVAVPINAESAKGDVLRSANGTQGDLDQIK
                     GISIGGWLVPEPFITPSVFETAVEWARDAGSNVSIIDEYTLCEALGPKTAKALLQQHY
                     DTWITVNDIREIKRHGFNLVRIPVGYWAWKKPDSEDEYVGNITYWDPYVGGIQLEYLK
                     KALSWCADTGLRALIDLHTAPGSQNGFDNSGQRLDEEDSLLWLNQTGTGELTSAVLHD
                     IFTHILDEFNDVVWAVEILNEPIAETIGVDKVIDFYNDTIQHYISLNKTKPLVIQSAF
                     EPAGFWDDYWNDTSVPVLVDYHYYHVFSRDQLSSDTMQRLVNVAHAASDVSDTMDAHS
                     SFIGEFSGAITDCAKWLNGLGVGARYDSTYYDTFPPKNSSWREPLGKCSSQRDISLWD
                     DSYKSAVRLFIEVQLRSFEHSTRGWIFWTWKTEGAGEWDYLKLVHHHLFPQPFDNYRF
                     FSDDGFIALQDAQPRNSAAPRSSAAGAPRPAVLALLPALCAAAALLVSDVM"
     gene            <217560..>219053
                     /locus_tag="AGOS_AEL219W"
                     /old_locus_tag="AEL219W"
                     /db_xref="GeneID:4620824"
     mRNA            <217560..>219053
                     /locus_tag="AGOS_AEL219W"
                     /old_locus_tag="AEL219W"
                     /product="AEL219Wp"
                     /transcript_id="NM_209995.1"
                     /db_xref="GeneID:4620824"
     CDS             217560..219053
                     /locus_tag="AGOS_AEL219W"
                     /old_locus_tag="AEL219W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR030W (DFG16)"
                     /codon_start=1
                     /product="AEL219Wp"
                     /protein_id="NP_984642.1"
                     /db_xref="GeneID:4620824"
                     /translation="MGGAHPTYLRLETVLQELSGARGCSIEMLTGGRLLLEGAYGRQE
                     RQVTRPAWYIKCADEQQYGPLEQALKAADLEQLPYQFEKDTFQRGSLMVAFTLSSVCA
                     GAWMLLLVLALLPVNNHNTRRRLVALYAVFYAVTQTVLLQMLTREIFEKQYRGNYQRS
                     YELNAVTQSAMLCTFRLITTIFANLTWVQIVHYMLHNYRKTTHRWVPRWLDTNSKRVQ
                     WLGSFLCLSHAIIWGLNLFLNVPVFIPEIGEYRRTNLPLYIPHIAFESLLFLLFAISL
                     CYYLYHDLGHSLMFHRQNREHHEDESVFTKLRLICQEYLSTIPVIVYNLVVFALYLVC
                     FFVNTIKYHSNLLWLFTLTTFLRLLITVNTWGLIGILERRERVVSKQTVLGRKINNKD
                     RFFADPYSNTDYRGDSVNGERRLQGVAGQRIGMFQAETAGISSVLSKMAGAVSAWFCW
                     CRAPSSPTAGEPGTPENMELQHIKTENESVDSGETELERNILFTHGA"
     gene            <219380..>223795
                     /locus_tag="AGOS_AEL218W"
                     /old_locus_tag="AEL218W"
                     /db_xref="GeneID:4620825"
     mRNA            <219380..>223795
                     /locus_tag="AGOS_AEL218W"
                     /old_locus_tag="AEL218W"
                     /product="AEL218Wp"
                     /transcript_id="NM_209996.1"
                     /db_xref="GeneID:4620825"
     CDS             219380..223795
                     /locus_tag="AGOS_AEL218W"
                     /old_locus_tag="AEL218W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR164C (DNA2)"
                     /codon_start=1
                     /product="AEL218Wp"
                     /protein_id="NP_984643.1"
                     /db_xref="GeneID:4620825"
                     /translation="MLTKGNKRSSSVSVSPQKSRSKSATEDGPSANLKPPTKKQNKKF
                     SYKFAPVNNLSTLEAACSPSSPSSGRASAAGRAAEQQLRNAENDKENKTWLSGVKDRH
                     SEESGSAKRDCHLGPASQYNGDGPSEEVIWMFSPGKQQRDPTPAEQVLPITIPDYSSG
                     TDDVGPLNNQSSTPIMSSRFKTILSLPHFYSNDAHARANMSRRHIRTGTRSATATPNF
                     ESKASTRDIDDIINDIAGDYVVHQTQLPSSPMKVGDIQGESREPSANTSEDNVRDDPL
                     QDNGRNTTPALHDITSSADDDDSLIDILTQNFSKPKTKQVIELQSVPEKHNTERSSST
                     GPFLSLASGLDSSSQLDPSDETSKAELLGSDANDDSLISYLEKKHVKGQPEVAVVPEP
                     SKEPVGVQNDAMKDTANNTETEDLNRWQRLAMCGYKRKGLARLVVLSVKEFNILSNPR
                     QKILTCLDSDGVKSTVIVRKPWVQMEFAPGDVIHIIEGKHSSNTRLLSDDKDPITGLI
                     NDNLLVQHPDLLLSATMIGNSIDCMRRAVLGAKIIEPGEPSIHITIGCIVHELLQEFL
                     RYRLNHDSIDDDFIESALTEVIEKYKLSILMCNETADSVREIIEQFHLPNIRSFVADY
                     VKESNSGCKVNVAGHSQKELLSISKAVDIEENIWSHMYGVKGFIDATVETSVGSSKRL
                     LAPLEIKTGKYKHISHEAQGSIYTLLLSDRYDIPVDFHLMYYSKTNDFVKHPTSMVSL
                     KHLLVLRNQLASKLKHNIAEIESRESLANLELHLPPLLKSSTCDTCHAKTHCMVINKL
                     TENGSIEDSGLAGSEYDDLTGHLSKNLARYREFYQKYIGLLHLEESSLNSNSKEMFLM
                     DSELREATSGRCISGLVIQEVSMVGDLYHYKFRRSSTSDVNVPMINSQLAVNESIYIS
                     DELGHFSLATGHVKDISDSYIVISCSRRFNLDNIRASGFSEDQQQVIESVLTETSLQH
                     TNVTERLTYRVDKYEHAVGLSMSRFNILNLFLPEIDPDKEYVNANGDRIRLNKWHGGD
                     GKTRRLLVEGQPPRFSKRPQFTYTPDETKFNKDQLKAIDKAIRCKDYALILGMPGTGK
                     TTLIAEIIRILARNGKNVLLTSYTHSAVDNILLKLLDSELQIARLGYKHRVHPGVRHL
                     VQSLEDVQTHEELVSSVDEFQVIATTCLGVNDSLLALRTKNFDYVILDEASQVSLPIA
                     LGPIRYGDRFLLVGDHYQLPPLVRNHIAKEDGLEDTLFQLLCDQHPSCMTELTLQYRM
                     NEDIMALSNELIYDGKLKCGDRSVAERALRIEVPKSITQPWLREALNPCKRVIMINYD
                     NIPSIRETADRDNIRNEGESRIVGLLVSGLLSCGASSADIGVMTLYRAQLRLLKSELA
                     PHSSTLEVLTADQFQGRDKECVIISTVRCNPSLNAGALLRELRRVNVAMSRAKSKLIL
                     VCSLATISSVPQLQGFLRLLHRNGWVYTLSPSTYP"
     gene            <224445..>226949
                     /locus_tag="AGOS_AEL217W"
                     /old_locus_tag="AEL217W"
                     /db_xref="GeneID:4620826"
     mRNA            <224445..>226949
                     /locus_tag="AGOS_AEL217W"
                     /old_locus_tag="AEL217W"
                     /product="AEL217Wp"
                     /transcript_id="NM_209997.1"
                     /db_xref="GeneID:4620826"
     CDS             224445..226949
                     /locus_tag="AGOS_AEL217W"
                     /old_locus_tag="AEL217W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR250C"
                     /codon_start=1
                     /product="AEL217Wp"
                     /protein_id="NP_984644.1"
                     /db_xref="GeneID:4620826"
                     /translation="MTIEKEVERRLADGLEGVVISGSPRQGGGEEQSEPSSAPTAEDS
                     DPEQTAVEDQRAERSQARHEEVPKGNTAISQLEQLENTNLLTVRIKWVNPENLMDDHK
                     SQLLNRNNDAILCSRGIPINPSIIENYEYFFDRKRLEILKEHADVYTFESGTEEFMRS
                     YEDGSSTWLYDLVVQAQFKAFQDLCAARNQIKENLEKSDHVEAWSISQNPHALTHPGN
                     LYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIK
                     ELNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLI
                     TPEQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDSQNE
                     DSPLKGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVVNKAVQNKTLYNNHSHYRTSST
                     RASISSRQSSLSGIPFFGPATPATSTLHHPPPPAFTMFAKPYSVSPTNSEVLLADRSP
                     ARSGSSNDGSPRVNTIPQVPLYGAQTQSHSPESLTAPGSRQGSLYLPSCPPMYTSAGT
                     LMSSHPQFGHSAAHAAAAAFGGLPIPTRDQQESNLYVKHIPLSWRDEDLNDFYSQYGE
                     IISAKIITVGGSKNEIGESKALEDVPVGTSRGYGFVCFKNPLDASRAMMATDRFQVGT
                     NHVLYVSFAQKRGKSVSAGSGSSAGSHQPMSSSGRSSSHGSYHHGHGGSRQSPYDSIM
                     GNYNPKFLNAMIQQQNQHLNGSPGTHSPTMMSQRNSWAPNQQAPYLVPVVMAPPPLTV
                     PRSSPAMSSPKRSPDYNGTADSTVIDATPECGTLDA"
     gene            complement(<227661..>229013)
                     /locus_tag="AGOS_AEL216C"
                     /old_locus_tag="AEL216C"
                     /db_xref="GeneID:4620827"
     mRNA            complement(<227661..>229013)
                     /locus_tag="AGOS_AEL216C"
                     /old_locus_tag="AEL216C"
                     /product="AEL216Cp"
                     /transcript_id="NM_209998.1"
                     /db_xref="GeneID:4620827"
     CDS             complement(227661..229013)
                     /locus_tag="AGOS_AEL216C"
                     /old_locus_tag="AEL216C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR249W (MGA1)"
                     /codon_start=1
                     /product="AEL216Cp"
                     /protein_id="NP_984645.1"
                     /db_xref="GeneID:4620827"
                     /translation="MQPKTFIHQLHHMLSDRSLETWIRWSAEDDHIFCLKPYDPEFPG
                     TVLKKNFKHGNVSSFVRQLHLYGFHKLQTGPGAASSGPAGDNEPPTHIIKSNKESMVW
                     YFTHPSGYFYKGACQPDLARIQRKSNGVGKDGKRKNGLSPVCVSILDPSTRGAASPAA
                     AAPPLEGAQRYTTPGYGDGMAHGVAPLHSTPAYADVAKRRSASSLDLLIHHPQSLPQQ
                     PLPAAAHQQQNPASHTPQPGPNHQPILRPSVFSVPQQLGTTAASPVASQHIASSNPPA
                     TPLEYYHYENNLQLLQRCMLTIVDILQVPPSQQNNIAKQNLNHLRSEILSMDSKWTTL
                     RSYQPYYTSPHSSLSSEASGPLHSNPHSSSTAISLSMQGQPVSSTQKSSIFSNPRLSV
                     ASSASLSNGGGSVSGSSQYGGYYQQESKAPAPVFPPLQQQSQYAYPPPQHHTNHSQSY
                     "
     gene            complement(<229443..>230489)
                     /locus_tag="AGOS_AEL215C"
                     /old_locus_tag="AEL215C"
                     /db_xref="GeneID:4620828"
     mRNA            complement(<229443..>230489)
                     /locus_tag="AGOS_AEL215C"
                     /old_locus_tag="AEL215C"
                     /product="AEL215Cp"
                     /transcript_id="NM_209999.1"
                     /db_xref="GeneID:4620828"
     CDS             complement(229443..230489)
                     /locus_tag="AGOS_AEL215C"
                     /old_locus_tag="AEL215C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR163W (SOL3) and YGR248W (SOL4)"
                     /codon_start=1
                     /product="AEL215Cp"
                     /protein_id="NP_984646.1"
                     /db_xref="GeneID:4620828"
                     /translation="MQGIRRYAAHASEGAPPDRSLDGSAYAGHTSCPDLFQISRAARL
                     FSAGARYGTVLQNVRAASLISELASSLKAAAAGEFNGGRWRGQPGQLQAMVAVYAYPD
                     TDALAQDLGEYIVAQQDAALAAHGQFAVAVSGGSLVGVLAAALLHGPAAARVRWAQWH
                     VFFCDERLVPLEHAESNYHALRTQLLDPLAAAGALGPVVHSFNEALLGQGANERIAEA
                     YEAQLPAALDLALLGAGPDGHTASLFPGPAHAWMLDERRARVLWCRDSPKPPADRITL
                     TLPALEAAAAVAFVAEGTAKRPVLERALVRRDPALPCAVVTARCARVAWFTTAATVQD
                     LPLQTAAYCASSRT"
     gene            complement(<230731..>231381)
                     /locus_tag="AGOS_AEL214C"
                     /old_locus_tag="AEL214C"
                     /db_xref="GeneID:4620829"
     mRNA            complement(<230731..>231381)
                     /locus_tag="AGOS_AEL214C"
                     /old_locus_tag="AEL214C"
                     /product="AEL214Cp"
                     /transcript_id="NM_210000.1"
                     /db_xref="GeneID:4620829"
     CDS             complement(230731..231381)
                     /locus_tag="AGOS_AEL214C"
                     /old_locus_tag="AEL214C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR247W (CPD1)"
                     /codon_start=1
                     /product="AEL214Cp"
                     /protein_id="NP_984647.1"
                     /db_xref="GeneID:4620829"
                     /translation="MAVALWYCPPANSPCYDTVNSLILSLQTLFPDAVLFEPHVTITS
                     QLRCDSADDAAAVLAAACAALRACRPQLDARGSPVVRFDAVAVGRRYFDKVHLACAHD
                     RFLYGVAQVIRELFVQDPPDPAAAADWVHSSFRPHLSLVYSDLYHVDQALLRVLRQRI
                     GDALGAALLPHPPAPGLQALWALQPPLDGWSIPGSFKVVRCEGPVRDWHVLAAADL"
     gene            <231601..>233316
                     /locus_tag="AGOS_AEL213W"
                     /old_locus_tag="AEL213W"
                     /db_xref="GeneID:4620830"
     mRNA            <231601..>233316
                     /locus_tag="AGOS_AEL213W"
                     /old_locus_tag="AEL213W"
                     /product="AEL213Wp"
                     /transcript_id="NM_210001.1"
                     /db_xref="GeneID:4620830"
     CDS             231601..233316
                     /locus_tag="AGOS_AEL213W"
                     /old_locus_tag="AEL213W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR246C (BRF1)"
                     /codon_start=1
                     /product="AEL213Wp"
                     /protein_id="NP_984648.1"
                     /db_xref="GeneID:4620830"
                     /translation="MAKCKNCGHTEIVVDLSNANNDRVCKACGVVSEDNPIVSEVTFG
                     ETSSGAAVVQGSFVAAGQAHAAFGPHGTSALESREATLNNARRKLQAVSHALQIPEYV
                     REAAFQWYQLALSNNFVQGRRSQNVIAACLYVACRKEKTHHMLIDFSSRLQVSVYSIG
                     ATFLKMVKVLHIVKLPLADPSLFIQHFAEKLDLGDKKIKVVKDAVKLAQTMSKDWMYE
                     GRRPAGIAGACLLLACRMNNLRRTHSEVVAVSHVAEETLQQRLNEFKNTKSGNLSIKQ
                     FRDTSTEEEVQQSDSKPPSFRRNRLKETKLKEKGPAEHLETSDQALARNPILSQVLGG
                     QEVTSKEVLFYLKQISERRERALSKRRDQGNNDSPDAHSQAGDKRSRGDASGSDYEDQ
                     DGSRLDSDASSEHSQGQIDGYSLETDPYRPRNLHLLPTSESLLSKVSDDPENLEDVDD
                     EELEAHILDEEASKLKERIWIGINGEYLLEQESKRLKLEADLASGNTSLKKKRSSKKR
                     KTDASNLLPEALAAADPTGIQPALQVAEASGDLTTAESVKNMLQKTSFSKKINYDAID
                     GLFGG"
     gene            <233566..>235737
                     /locus_tag="AGOS_AEL212W"
                     /old_locus_tag="AEL212W"
                     /db_xref="GeneID:4620831"
     mRNA            <233566..>235737
                     /locus_tag="AGOS_AEL212W"
                     /old_locus_tag="AEL212W"
                     /product="AEL212Wp"
                     /transcript_id="NM_210002.1"
                     /db_xref="GeneID:4620831"
     CDS             233566..235737
                     /locus_tag="AGOS_AEL212W"
                     /old_locus_tag="AEL212W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR245C (SDA1)"
                     /codon_start=1
                     /product="AEL212Wp"
                     /protein_id="NP_984649.1"
                     /db_xref="GeneID:4620831"
                     /translation="MVKKSRAAILPTNVILLQNLVKRDPESYREEFLQQYSHYESLRD
                     IFMMNSTTQDASSAGGSGSFADDESVGEFAELIGFVSQVCSCYPKETAGFPAELKQLL
                     LEHHRALPFQVKEKIIASLTMLRNKDVITPDMLIQTLFPLLVAYSSTQGSNIGLNSHA
                     KALRKTVYGNVVSLLKNCNTGSKNQKLNRSTQAICFNLLEQPDSQGLWATRLTRELWR
                     RGIWDDSRAVEIMTQAALHDDVKIAASGVLFFLDADREREENFEDKSDDDDVVDMQSL
                     RHKLKINKKSSKRGKKLENAVKQVKKKSNSANDQAYLNFSAIHLLRDPQGFAEKLFSK
                     HMSGKGGTKFSLEQKISLMQLTSRMIGTHKLLVLGIYSYFLKYLTPKQTDVTKILATA
                     AQSCHDLVPPEYLSVVVRKIADEFVSDGVSSEVCAAGLNSIREICSRAPLALDETLLR
                     DLVEYKSSKAKGVSMAAKGLLALYREVAPEMLQRKDRGKLASIELQQQRAAAAQPRRP
                     QFGADSGVSGIPGLELLAEWERTQDRPAADDDDANWEVASSDDDVDGEWVTVQSDRDY
                     DVDLSDSDLDLDDDEAAPAPAPAPAAPELAASRILTPADFAKLQELRTERGVAKLLGV
                     RNEDLVDSDALVGPVKYKQNKQERMERVLEGREGRDKFGSRKQKRGEQGRSTTNREKQ
                     RKKNFVMMIHKRGVQGKQKMSLRDKQKVLRAHITKQKKKGH"
     gene            <236041..>237294
                     /locus_tag="AGOS_AEL211W"
                     /old_locus_tag="AEL211W"
                     /db_xref="GeneID:4620832"
     mRNA            <236041..>237294
                     /locus_tag="AGOS_AEL211W"
                     /old_locus_tag="AEL211W"
                     /product="AEL211Wp"
                     /transcript_id="NM_210003.1"
                     /db_xref="GeneID:4620832"
     CDS             236041..237294
                     /locus_tag="AGOS_AEL211W"
                     /old_locus_tag="AEL211W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR244C (LSC2)"
                     /codon_start=1
                     /product="AEL211Wp"
                     /protein_id="NP_984650.1"
                     /db_xref="GeneID:4620832"
                     /translation="MMLSRRLAHGAHKAVRVQTRALSIHEYQSSELLRQYGIGTPRGQ
                     AASTAQQAYDAAAGLGHELVVKAQALTGGRGKGHFNTGLQSGVHMISSAEEARELAEQ
                     MLGNRLITKQSGAKGKPVSAVYVVERVKARHEAYLSILMDRQTKKPLIICSSQGGMNI
                     EEVAHSNPDAIKKFYVDVKKGLDAETAAAVARSLGFSQEAEADAADAVQKLYKIFREK
                     DATQIEINPLSEVEGQHTKVMCMDAKFGFDDNASFRQQEVYSWRDLTQEDPDEVVAKN
                     SDLNFVKLQGNIGCLVNGAGLAMATMDVIKLYGGDPANFLDCGGGATPETIETAFKLI
                     LSNTKVKAIFVNIFGGIVRCDYVAQGLVAATKNLDVKVPIVARLQGTNLEEGRRIIKE
                     SGLKIYGFDELDPAAEKVVGLAASS"
     gene            complement(<237342..>237722)
                     /locus_tag="AGOS_AEL210C"
                     /old_locus_tag="AEL210C"
                     /db_xref="GeneID:4620833"
     mRNA            complement(<237342..>237722)
                     /locus_tag="AGOS_AEL210C"
                     /old_locus_tag="AEL210C"
                     /product="AEL210Cp"
                     /transcript_id="NM_210004.1"
                     /db_xref="GeneID:4620833"
     CDS             complement(237342..237722)
                     /locus_tag="AGOS_AEL210C"
                     /old_locus_tag="AEL210C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR243W (FMP43) and YHR162W"
                     /codon_start=1
                     /product="AEL210Cp"
                     /protein_id="NP_984651.1"
                     /db_xref="GeneID:4620833"
                     /translation="MSTAAAGRAFRRFWQSETGPRTVHFWAPTLKWGLVVAGISDMQR
                     PVERVSGTQNLSLMATAVIWTRWSFVIRPKNYLLASVNFFLGLTASYQLARIARYRLR
                     EGDSAGEVLRYIVNGPRDPAGAAA"
     gene            <238290..>239702
                     /locus_tag="AGOS_AEL209W"
                     /old_locus_tag="AEL209W"
                     /db_xref="GeneID:4620834"
     mRNA            <238290..>239702
                     /locus_tag="AGOS_AEL209W"
                     /old_locus_tag="AEL209W"
                     /product="AEL209Wp"
                     /transcript_id="NM_210005.1"
                     /db_xref="GeneID:4620834"
     CDS             238290..239702
                     /locus_tag="AGOS_AEL209W"
                     /old_locus_tag="AEL209W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR161C (YAP1801) and YGR241C (YAP1802)"
                     /codon_start=1
                     /product="AEL209Wp"
                     /protein_id="NP_984652.1"
                     /db_xref="GeneID:4620834"
                     /translation="MGAFQAVVKKATKIKMAAPKQKYLKTILAGMETPAVLEEIMRAL
                     QVRVGDSAFTVVYKALVVVHVMMREGAKHVTLAYLAARRDFFELRGLLQGGAAAHSGV
                     HLVRRYVDYLRTRAAEYGRLECDYVRDGAARLKELGRSTVVLQHVESLETQITALLRN
                     KYSQHDLNNGMLMAAFQLLVLDILALYNALNEGIITLLESFFELQRADAQRTLDLYKR
                     FVQLTENVVKYLKMGKAVGLQIPVIKHITTKLIRSLEDHLREGEAGGPKAPPESSNAY
                     TETQKQLELVREQKRLLQEQLHLTSPLVQQLTAAPPAAPPAVAAAVTGYNPFFDAGAF
                     AQPQLQPQQTNNPFLTQAPAFQPVASGVSAQHAPLLPQHTAPMPLLVAQPTNPFATAA
                     PATNPFAAYNPAQMRYSYTQPELHQQQQQQQQLQQQQIQQQQLQQQQFQQQQFQQQQL
                     QQQQLQQQQLGYLNQNLIDI"
     gene            <240008..>242971
                     /locus_tag="AGOS_AEL208W"
                     /old_locus_tag="AEL208W"
                     /db_xref="GeneID:4620835"
     mRNA            <240008..>242971
                     /locus_tag="AGOS_AEL208W"
                     /old_locus_tag="AEL208W"
                     /product="AEL208Wp"
                     /transcript_id="NM_210006.1"
                     /db_xref="GeneID:4620835"
     CDS             240008..242971
                     /locus_tag="AGOS_AEL208W"
                     /old_locus_tag="AEL208W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR240C (PFK1)"
                     /codon_start=1
                     /product="AEL208Wp"
                     /protein_id="NP_984653.1"
                     /db_xref="GeneID:4620835"
                     /translation="MSVETAYGVAFRSLATTDERLYKATVQFYKRLSFATVKLYDKFK
                     NHGDEMLLSGTSQSSRHETWLMSFKLSEVDSSGCRVPQQEAERKLQSDGAMIKVRLVN
                     EVAAADCGALRVSYYSGSFAEAAAAFPDREEVSEHEFRIRDPLGNEIALTDTPHLHDA
                     VLGEQAVGADFFLSGSGETHRLAQGRETAAALMRSLRETPGAPDSKPKKKLAVMTSGG
                     DSPGMNAAVRAVVRAGIYYGCDVFAVYEGYEGLLKGGEYLKHMQWSDVRGWLSEGGTL
                     IGTARCMEFRERKGRKQAAANLIEQGIDALVVCGGDGSLTGADLFRSEWPSLVEELVS
                     DGRFTAQQVHPYRNLTIVGLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDATAKSH
                     SRAFVVEVMGRHCGWLALMAGIATAADYIFIPERAAPQNKWQDEMKEVCRRHKAKGRR
                     NITVIVAEGALDTELNPITAEQVKTALVELGLDTRITTLGHVQRGGTAVAHDRWLATM
                     QGVDAVKAVLEMTPDTPSPLIGILEEKIIRIPLMESVKLTKQVAAAIQEKDFDKAISL
                     RDTEFIELYESFISTTIKDSTAVPESGPLRVAIVHVGAPSAALNAATRAASLYCLANG
                     HKPFAIINGFSGLIQTGEVRELSWIDVEDWHNLGGSEIGTNRCAAADDMGAVAYHFQK
                     NEFDGLIIIGGFEGFKSLQQLYSARSQYPVFNIPMVMIPSTVSNNVPGTEYSLGTDTC
                     LNALVNYTDAIKQSASATRRRVFVVEVQGGHSGYVASFTGLVTGAVSVYTPEKKIDLH
                     SIQEDLALLKENFRHDQGENRNGKLLIRNEQASSIYTTELIADIIAEQSNGRFGVRTA
                     VPGHVQQGGVPSSKDRVAACRFAVKSVKFLESWNEKAKQAASHDDRQLGFRYVKGVKT
                     PMLPNNDASAAVICVNGSTVSFKPVNDLWQNETDVELRKGHDIHWSEFTKVGDILSGR
                     CNLRKEVDAMRAASA"
     gene            <243295..>245175
                     /locus_tag="AGOS_AEL207W"
                     /old_locus_tag="AEL207W"
                     /db_xref="GeneID:4620836"
     mRNA            <243295..>245175
                     /locus_tag="AGOS_AEL207W"
                     /old_locus_tag="AEL207W"
                     /product="AEL207Wp"
                     /transcript_id="NM_210007.1"
                     /db_xref="GeneID:4620836"
     CDS             243295..245175
                     /locus_tag="AGOS_AEL207W"
                     /old_locus_tag="AEL207W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL299W (TRF5) and YOL115W (PAP2)"
                     /codon_start=1
                     /product="AEL207Wp"
                     /protein_id="NP_984654.1"
                     /db_xref="GeneID:4620836"
                     /translation="MMTASVAGNRSGRSGNIARERSNRSRGAQKSDKERNLSKGSSRP
                     KSNSSRVKKMRKSSLSKVQKNFAVFNDSAEHENKYETLAVAEADEKEVILLDEEEDTA
                     MTTETKGVHAEETANVTGAEGVNAAANALDDNQDFIGFSDSEEEVASGEENGDADYAV
                     EDAEDESSEPLPTNADYPWIQNHDHSRQREIADWLTLEIKDFVSYISPNKTEIQLRND
                     ALKRIRDAVQDFWPDANLHCFGSYATDLYLPGSDIDCVVNSKSGDKDNKNALYSLASY
                     LKRNGLATQVSVIAKARVPIIKFVEPASQIHIDLSFERTNGVEAAKIIRGWLHDTPGL
                     RELVLIVKQFLHARRLNDVHIGGLGGFSIICLAYSFLKLHPRIICRDIEPLQNLGVLL
                     IDFFELYGKNFGYDDVGIAVSEGDASYINKKEYPELTRNLRGTFNLVIQDPGDPANNI
                     SRGSFNIRDIKKAFAGAFELLTNRCFELDAATFKHRVGKSILGNVIKYRGAKRDFKDE
                     RALIVNKAIQENEEFHQRRGRIVHRDTAEFINISDDDDYELQPPPKRARVPAPAPAPA
                     DNVVVLDDPADDYVPAQPVDKLMGLDDTDDYLPAPASPTDTPKLDKAAKRNYWLSKGQ
                     TM"
     gene            complement(<245238..>245780)
                     /locus_tag="AGOS_AEL206C"
                     /old_locus_tag="AEL206C"
                     /db_xref="GeneID:4620837"
     mRNA            complement(<245238..>245780)
                     /locus_tag="AGOS_AEL206C"
                     /old_locus_tag="AEL206C"
                     /product="AEL206Cp"
                     /transcript_id="NM_210008.1"
                     /db_xref="GeneID:4620837"
     CDS             complement(245238..245780)
                     /locus_tag="AGOS_AEL206C"
                     /old_locus_tag="AEL206C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL114C"
                     /codon_start=1
                     /product="AEL206Cp"
                     /protein_id="NP_984655.1"
                     /db_xref="GeneID:4620837"
                     /translation="MIIWRAAHSCFRTSTMPWAMRATRRYSDGAAEMRGWLEQLHWSQ
                     IPKQLYRAQYARSSGPGGQNVNKVSTKCTLTVEGFSKCAWFPALVREQAVRRLRYYAR
                     AQDAVVVQCDQWRSRERNREECLRRLVRELKAVVHVAAAPDPVAEARHARLHAAADRH
                     RLHGKRRQGERKRLRGRVEY"
     gene            <246099..>248480
                     /locus_tag="AGOS_AEL205W"
                     /old_locus_tag="AEL205W"
                     /db_xref="GeneID:4620838"
     mRNA            <246099..>248480
                     /locus_tag="AGOS_AEL205W"
                     /old_locus_tag="AEL205W"
                     /product="AEL205Wp"
                     /transcript_id="NM_210009.1"
                     /db_xref="GeneID:4620838"
     CDS             246099..248480
                     /locus_tag="AGOS_AEL205W"
                     /old_locus_tag="AEL205W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL298W (CLA4) and YOL113W (SKM1)"
                     /codon_start=1
                     /product="AEL205Wp"
                     /protein_id="NP_984656.1"
                     /db_xref="GeneID:4620838"
                     /translation="MSLSAAARELSESDFQDIGPAPKPPPVAYNQTKPLVNYMSQMDL
                     GAKSGGKMRAVQRKKSGWVSYKDDGLLSFLWQKRYMVLNDNYLSLYKGDSGREDAVVQ
                     IPLTSIVSVSRNQLKQNCFEVVRSSDRSGAPAAGAGGDSSKKSVFIATKTELDLHTWL
                     DSIFSKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPFNWEKLLKHSRITGEDWNNN
                     SAAVIQVLQFYQEYNNGTATPTAQAAAQAAGAPGRPPMLTLSSNSSQASMQQIASTPP
                     YSGGEMIPQRKAPTPPKPVVTSGSAIPSAKGGPNVGVTTSPSVHHQNTQHGKQQSPTQ
                     SGPPKSLPPLHRDEEGPTAPLGNSVSSVATKESPTERLLNNLSETSLMQKQLPAKPVA
                     PPSSVGPVAPPLRLQPQRVAPGRPAQPGPHAPDTRPGGPNAMKQQHGPPAAASGQLGP
                     DSKKPEGAPGHPTAVAKKKKAGRPTMSNAEIMTRLAAVTFNTDPSPFFQMIEKAGQGA
                     SGSVYLAQRLKIPPYDENSGVSQHELNDNIGDKVAIKQMILSKQPRKELIVNEILVMK
                     DSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYI
                     VRETCQGLKFLHDKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRATMVGT
                     PYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPYLNEEPLKALYLIATNGTPKLK
                     HPELLSLEIKRFLSVCLCVDVRYRASTEELLHHSFFETSCEPEELANLLKWKK"
     gene            complement(<248759..>253534)
                     /locus_tag="AGOS_AEL204C"
                     /old_locus_tag="AEL204C"
                     /db_xref="GeneID:4620839"
     mRNA            complement(<248759..>253534)
                     /locus_tag="AGOS_AEL204C"
                     /old_locus_tag="AEL204C"
                     /product="AEL204Cp"
                     /transcript_id="NM_210010.1"
                     /db_xref="GeneID:4620839"
     CDS             complement(248759..253534)
                     /locus_tag="AGOS_AEL204C"
                     /old_locus_tag="AEL204C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL297C (MON2)"
                     /codon_start=1
                     /product="AEL204Cp"
                     /protein_id="NP_984657.1"
                     /db_xref="GeneID:4620839"
                     /translation="MASSDIFTSTVRQLTQDLHALASESKRRNSEVKHASDRSLQILR
                     IVHSFEELERHPDFILPFVLSCKSGNAKFTSLSMQSLQRLAIHQSIPREQIEHVLEAL
                     IDSTQLAVEIQLKVLQIIPIFFKTYGKHIIGPLCAKMLRCCTTLLLTPSKAQVVVGTA
                     SATLKQLINDVFGRLKYPDADAELYDVLISNNETIKVNSYRYDANLLFTDLCSIYGSR
                     SQQNTLLDSNCINEEYGLELLELVLLNYELLFLTHRDLLFLLRTKAVPLLLRYISSSK
                     NFAIVVRSARCITLLIKVQYLTLLELELEVILSLLIHTLSPKSDTLLWRKALILEVFL
                     NVIQDNTILLEVFKAYDVHESRKDVVFVLLETMTENFESNSLSELLNVSEFLPSGEQA
                     LLLNETAVSKNKLMDLLDKASAPSTDGTYIVFLLIAISNGISNSIGSKAVAASHDGDE
                     KILEELCDMYTKIFDSIFKIQKKILYAGALDNQLFHSVLRAFQKLAHAAGILSLSSEL
                     SQCLRVFCLATIETTAEEEVPLESVQSPNATGMLNAISDTLRGVPTTPPSPKEEAKSS
                     YRSLHQRNLSVFRALLSLSISLGPTLTGEHWEYILEAWQWTVYSISGPSHDLHNTPHS
                     TSSPAIPKLIKNDTLAVEASINKLFESTRTYSYESFERFLLCLVEGAARLPQDPECNK
                     ATGARRVDVQGNVMDFHHHKVFYIDRISDLVKFNISRFTDPEGKNIWNKLSDFLISQA
                     TVHSSTDEDLRLYVTQVFMEIITKVATDAENLQQQYDSKFDIIGDRLLEALMKLNNAV
                     LGFVNSSVHMSVSINVDFDILFHILRTLKDLVDNFGESLQDSWTTVLKILMPQFGIIK
                     RSYENDSERGMDGGNLTEAIQQKHRDLVHISFKVFKLISDNFLETLPYPVIKDVIDTL
                     FEFVQQDTDLNISFSSISQFWILGDYMRTMVTLPRDTGVTTDGIIQVPTPGKLPSNNT
                     EGRDISDALWIYLLKTLVKCTNDSRLEIKKGAIQTFFRIVDSYSSSFPSWELVSEEVV
                     EPLLSSAPNPREYIEYADFFSITLQGLVHLYPIYFADFRNKPWDKEWSWLFSFIQRLQ
                     SSQSFEARFIASHNLGELMSLIKDINDVPKGIVTSCYEIWSSYNVLYTELLPSSDKKN
                     NISCLEEVIRSFIPLYRLLDKFELLTLRTVEDCLAIFNTAFRYPLLPEHVSDKKKLSI
                     LQSETLKALKQFPMNQDHAIELVIWYQLSSVMVLPFDTRKRIEQKLAGKLDGVSRNRI
                     PTFEAVSYHASMMLLERINACNSFDDQFMNQKYLTKTLKNFYEPIKYKSMIELASEDS
                     LPLWVVSSRCFNHIFASLFCHLKKYEDNKQNDWCGDLLEIYVKVLVAPLQRMDQVADI
                     ATEAHDISEYKKHRDLLLKYINLMAIDVNHIQPYVSSLWNNSFYYDFDAIEDHIINGS
                     TNLQEITDKLVAFDFSNVIGSTEEPALLSKCNLTTICLEDLIQFCNNMEPGSKKLRSI
                     AVPFLISRVAFVLRRYITDESLLNRAPLSKVKRLELVKVLNGLHDILDLRIGHVDEEV
                     ENLRVLYPLLLNTIPLSHKVGGLQDLLQKLSLRFNVLYT"
     gene            <253865..>255121
                     /locus_tag="AGOS_AEL203W"
                     /old_locus_tag="AEL203W"
                     /db_xref="GeneID:4620840"
     mRNA            <253865..>255121
                     /locus_tag="AGOS_AEL203W"
                     /old_locus_tag="AEL203W"
                     /product="AEL203Wp"
                     /transcript_id="NM_210011.1"
                     /db_xref="GeneID:4620840"
     CDS             253865..255121
                     /locus_tag="AGOS_AEL203W"
                     /old_locus_tag="AEL203W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL295W"
                     /codon_start=1
                     /product="AEL203Wp"
                     /protein_id="NP_984658.1"
                     /db_xref="GeneID:4620840"
                     /translation="MLKALIPVRTIPYAWATSSPSRVASRSKSFKAGGCGIVRGGRRS
                     KQKDKGKKGKGMQAELDKLQSSGQFMWTLSHGVVRNFVRRRPAANSIIYMVDKPRSPV
                     TTQLINIPAHPHMSTQLDMKGPLPEACDDIPSFWGAAMFPIRGEPTDGREASCEKSGS
                     RKVRNSEPSRAIKSPICGGNELASALLEIGGSLEGGYGCHDHGGWTSAQERVTGTATR
                     SAAAHEGSRDHLLQLIPTLQVDQNMFEIEMDNLTISLCKKVYDATGIPWKHHLCSERL
                     PLFIYSTQSPRTRLDFQRFLRRSIKAHVQPLLNVLSEKRSLSAIQLDAAAAQEIDILV
                     DYLSWQIPSIRPIRCKAACLVHEGPVAGFSRVFWLQPGLRDWISRKRRRTGWHIAYSR
                     RTKSNDSRQLSLATFESAFYASTPLV"
     gene            complement(<255180..>256688)
                     /locus_tag="AGOS_AEL202C"
                     /old_locus_tag="AEL202C"
                     /db_xref="GeneID:4620841"
     mRNA            complement(<255180..>256688)
                     /locus_tag="AGOS_AEL202C"
                     /old_locus_tag="AEL202C"
                     /product="AEL202Cp"
                     /transcript_id="NM_210012.1"
                     /db_xref="GeneID:4620841"
     CDS             complement(255180..256688)
                     /locus_tag="AGOS_AEL202C"
                     /old_locus_tag="AEL202C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL294C (RIM21)"
                     /codon_start=1
                     /product="AEL202Cp"
                     /protein_id="NP_984659.1"
                     /db_xref="GeneID:4620841"
                     /translation="MVQRTRWRYSAIAHNYNSCRPMELGAGIAVGAWDGVWARARSAE
                     FVAATDMGDPVYSAFMRYDDSAPLHAAVAADWATYVAADFNGGPFKYSIFPILYSFTA
                     SLVVTMGLTVIVFFNVRTKPHRGVPKLLRVAAVLACGNLLTFVVRAMMQLGRDHAEGV
                     VPMNHILDMLWTDTAFNTVDILAVLILQLCQVQTVMRFFTRFQEKRLISLCGILLAVL
                     SQVLWAIPPYSEAVSNHFMPLDDDKDMDVLPPFVYLVRIAQAGSYASFVLMHVFAKKK
                     LCVQSVQMFLLTVLTVVVVVLQPAFFITDVTNVWIDNLSEIFSTTCYMGSTVIVWEWS
                     NRLSILEARRQAQSILGRPVYEDEEQGYNFARYALKIQTALTSKSDEGDTTSATTFAA
                     PRSARFEGKGGPQSPVYVQEGEQQAVMAFNKRMGTRALAHHVLDSIIYYTDKVVVKGL
                     GNLSASLPSKTSSATSVRGRVRKRIGLEGANDVFVYRTKDLVFDSDEDIPRT"
     gene            <257168..>258892
                     /locus_tag="AGOS_AEL201W"
                     /old_locus_tag="AEL201W"
                     /db_xref="GeneID:4620842"
     mRNA            <257168..>258892
                     /locus_tag="AGOS_AEL201W"
                     /old_locus_tag="AEL201W"
                     /product="AEL201Wp"
                     /transcript_id="NM_210013.1"
                     /db_xref="GeneID:4620842"
     CDS             257168..258892
                     /locus_tag="AGOS_AEL201W"
                     /old_locus_tag="AEL201W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL293W (MSB3) and YOL112W (MSB4)"
                     /codon_start=1
                     /product="AEL201Wp"
                     /protein_id="NP_984660.1"
                     /db_xref="GeneID:4620842"
                     /translation="MAEVYQSALKSPSVPNLAKTAGGEATNRRRNTRSLHREDNLSLL
                     DLYEGVDDTEEEREEEVVRPRAASAASAGRVPQRAVPRGRQAAGPGRGGDGLRGDGRP
                     LFMHSATTVTSLHTEATSVVSMTTGGTITPTGTRRLTRSGSHCDRYGFKKQTQYVSEE
                     AYDAWWEGYSKYCIRRKHKWRALLAKAGLGLDGDNPDRFPSKSEKLKRYVRKGIPAEW
                     RGNAWWYFARGQEKLNKNRGVYDRLLAKINDPSERATLKDLDVIERDLNRTFPDNVHF
                     QKSANSEQEPPMIRSLRRVLVAFSIYNPKIGYCQSMNFLSGLLLLFMDEEKAFWMLVI
                     ITSRYLPGVHNVNLEGVNIDQGVLMLCIKEYLPEFWSRIWPESDGKKASNRNEFLYKL
                     PPMTLCTASWFMSCFIGIVPIETTLRIWDCLFYEESHILFKISLAIIRLSEPEFPQRQ
                     RRLKNRDDEDMEVFQVIQTFPKSLLDPNDIFDKVIFRKRIRFNSLNQEEIDRCRKYVM
                     GQRQKLKNYTEIMGDRISDKGRDPRIHLDIINEALSSEEYGFRRNLTGVHWNNSIKER
                     VRQLSKRK"
     gene            complement(<258942..>259553)
                     /locus_tag="AGOS_AEL200C"
                     /old_locus_tag="AEL200C"
                     /db_xref="GeneID:4620843"
     mRNA            complement(<258942..>259553)
                     /locus_tag="AGOS_AEL200C"
                     /old_locus_tag="AEL200C"
                     /product="AEL200Cp"
                     /transcript_id="NM_210014.1"
                     /db_xref="GeneID:4620843"
     CDS             complement(258942..259553)
                     /locus_tag="AGOS_AEL200C"
                     /old_locus_tag="AEL200C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL111C (MDY2)"
                     /codon_start=1
                     /product="AEL200Cp"
                     /protein_id="NP_984661.1"
                     /db_xref="GeneID:4620843"
                     /translation="MTNTEREFVNKFLTLAALEEPTRTRDYFKPLEQVKSIAVTLQPL
                     KYKYNKQSRPRAGQGLEGNEVKLFLKSVRPPRFAHTALFAANDNVSQVKERLREIEPA
                     VSTADLRLLLKGKVLNDGMILSDLKAPEAALMVLVQPHRENAPAAAAAPPRPESDGLD
                     VAAVPTLDVPWDRISSTLEDALGDRGVAAATLTRLQRGWDLAG"
     gene            <259707..>260472
                     /locus_tag="AGOS_AEL199W"
                     /old_locus_tag="AEL199W"
                     /db_xref="GeneID:4620844"
     mRNA            join(<259707..260372,260425..>260472)
                     /locus_tag="AGOS_AEL199W"
                     /old_locus_tag="AEL199W"
                     /product="AEL199Wp"
                     /transcript_id="NM_210015.2"
                     /db_xref="GeneID:4620844"
     CDS             join(259707..260372,260425..260472)
                     /locus_tag="AGOS_AEL199W"
                     /old_locus_tag="AEL199W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL110W (SHR5); 1-intron"
                     /codon_start=1
                     /product="AEL199Wp"
                     /protein_id="NP_984662.2"
                     /db_xref="GeneID:4620844"
                     /translation="MPKSEATEATGSKSGPDLLEGGNNPLFFNCHEFLVTKYRELGEE
                     VVREHTEDEALCITHFPNIYCPQGSVEFDRTRIVRLPRRFEESMHYPSFSTELPGHEP
                     AALQREDEARFTPAGFHDGHVFGRSSLSPLSNYVSPEECRDVVRAINGYLKEAYRVQG
                     TQNILFNALDVLTFYTVSLLLSYFRRRTQLEQLEDYVEEVNERFFEKRGIRIISPRRS
                     AYLSLDIQIPRPVPPAARS"
     gene            <260693..>261910
                     /locus_tag="AGOS_AEL198W"
                     /old_locus_tag="AEL198W"
                     /db_xref="GeneID:4620845"
     mRNA            <260693..>261910
                     /locus_tag="AGOS_AEL198W"
                     /old_locus_tag="AEL198W"
                     /product="AEL198Wp"
                     /transcript_id="NM_210016.1"
                     /db_xref="GeneID:4620845"
     CDS             260693..261910
                     /locus_tag="AGOS_AEL198W"
                     /old_locus_tag="AEL198W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL292W (PUS4)"
                     /codon_start=1
                     /product="AEL198Wp"
                     /protein_id="NP_984663.1"
                     /db_xref="GeneID:4620845"
                     /translation="MNGIFAIEKPSGISSNQFLQKLKHALTKSQVFSKDLQKAIAERA
                     MQYQKETGRKPSKHKLRKVSQIKMGHGGTLDPLASGVMIVGIGTGTKKLSEYLSGTVK
                     MYESEALFGLSTTSGDMEGDILNETSTAHLDIESLKTVEKKFVGALKQTPPIYAALKM
                     NGKPLHEYAREGIPLPKSIEPRKVTVYELEVFDDSLSTNHSYRLLKPPSDSVKAAIEK
                     MNANIDNDTLYYSEEYCASQGLDSQEAKIEPPIKLTEEERAAINEQGDNYRAPLLHFK
                     AKVSSGTYIRSLVSDIGKAMRSSAYMVKLIRTEQQNWSLTKNNVFKLEDFTDRDEALW
                     VPVLEKVLETGHEVKLDEEFKSAEQKLADSKMLLEKSAEQFSEAPVDEPSQQSDVPEE
                     CANPKKRDIDSIV"
     gene            complement(<261981..>263585)
                     /locus_tag="AGOS_AEL197C"
                     /old_locus_tag="AEL197C"
                     /db_xref="GeneID:4620846"
     mRNA            complement(<261981..>263585)
                     /locus_tag="AGOS_AEL197C"
                     /old_locus_tag="AEL197C"
                     /product="AEL197Cp"
                     /transcript_id="NM_210017.2"
                     /db_xref="GeneID:4620846"
     CDS             complement(261981..263585)
                     /locus_tag="AGOS_AEL197C"
                     /old_locus_tag="AEL197C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL291C (MID1)"
                     /codon_start=1
                     /product="AEL197Cp"
                     /protein_id="NP_984664.2"
                     /db_xref="GeneID:4620846"
                     /translation="MMSREYLGVLLWLLTNIITGARSQGLPQALSMPSVYGSRAFMSE
                     NLELKDTVGGLFNNQTMHELAPINCSIVPGARNKLEFNVSTLSSGISTAYEVLTLLSG
                     NICWRPLNTTGQVLRVYYSFNKTTLDDLSGAEAADFAEGYMEALAVRPYQVDDNQTDP
                     YSTLYLVSLLVDSETGKPLPAAAANPEPWHYRLSISQNDLGFQWDSRPWIEVIDTDYN
                     SALLSTGNLGPASDDKGKRKYDPDLYDLYLYSVEHIDTFNGLSRSYCAVSGGPRLIRS
                     SSSDYTERPNSTLSNPSLKITKSLVEQVGQVREQFHITGLNSSTTYVAYLTMRVSSAT
                     TGIAGTIFQKTVFSTMENDACSLIFGLDFCKGVAYSVPTSSLQNKDKTLMAGAYDAIA
                     SSLYANFSLALQLIPCDESTESRYSPLRHCEDCEQSYKSWLCAVTIPRCTSRPKENYV
                     ARDSDDNRNALINDKIKPVSNYYEILPCIDMCHQMVRDCPSSFGFSCPSRSKFPQLAH
                     RSYQSYSNVSEALNCNYIGNAEIIST"
     gene            <263972..>264973
                     /locus_tag="AGOS_AEL196W"
                     /old_locus_tag="AEL196W"
                     /db_xref="GeneID:4620847"
     mRNA            <263972..>264973
                     /locus_tag="AGOS_AEL196W"
                     /old_locus_tag="AEL196W"
                     /product="AEL196Wp"
                     /transcript_id="NM_210018.1"
                     /db_xref="GeneID:4620847"
     CDS             263972..264973
                     /locus_tag="AGOS_AEL196W"
                     /old_locus_tag="AEL196W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL290W (RFC3)"
                     /codon_start=1
                     /product="AEL196Wp"
                     /protein_id="NP_984665.1"
                     /db_xref="GeneID:4620847"
                     /translation="MSGVARNANNLPWIEKYRPDSLDDVYGQRDVVETVRKFVQEGRL
                     PHLLFYGPPGTGKTSTICALAKEIYGKNYRNMVLELNASDDRGIDVVRNQIKEFASTR
                     QIFSKGFKLIILDEADAMTSAAQNALRRIIEKYTKNTRFCILANYAHKLTPALLSRCT
                     RFRFQPLAEAAIERRVLSIMAHEHLQLTEDARAALLRLAAGDMRRALNVLQAAKATLD
                     DPAQPVTEDVVYDCVGAPHPRDIETVVDSILRDDWATALDTVRRVRVARGLALVDMIH
                     GAVELLTSYDLKQPTRIALLTHLADIEYAVSKGGSDKIQTSAAIAAIKSSMELQLQT"
     gene            <265575..>266288
                     /locus_tag="AGOS_AEL195W"
                     /old_locus_tag="AEL195W"
                     /db_xref="GeneID:4620848"
     mRNA            <265575..>266288
                     /locus_tag="AGOS_AEL195W"
                     /old_locus_tag="AEL195W"
                     /product="AEL195Wp"
                     /transcript_id="NM_210019.1"
                     /db_xref="GeneID:4620848"
     CDS             265575..266288
                     /locus_tag="AGOS_AEL195W"
                     /old_locus_tag="AEL195W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL289W (PCL1)"
                     /codon_start=1
                     /product="AEL195Wp"
                     /protein_id="NP_984666.1"
                     /db_xref="GeneID:4620848"
                     /translation="MDAKALALLFRSPVTDEMLQFLTRATLRVAPCGRDAQCASPPMS
                     GGARRTLPSIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFL
                     ACLILSAKFHNDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRD
                     LAPLLAPIKLDLTRCARMHARSPLPRRALCSPAHSLSASSSTSTLVSTGRSSALHKPR
                     PAAALQAPAPLYSIPGHIL"
     gene            266474..266565
                     /locus_tag="AGOS_AgSNR40"
                     /old_locus_tag="AgSNR40"
                     /db_xref="GeneID:4620849"
     ncRNA           266474..266565
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR40"
                     /old_locus_tag="AgSNR40"
                     /product="AgSNR40"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR40; start and end coordinates are
                     approximate; in synteny"
                     /transcript_id="NR_149385.1"
                     /db_xref="GeneID:4620849"
     gene            <266969..>267253
                     /locus_tag="AGOS_AEL194WA"
                     /db_xref="GeneID:9487584"
     mRNA            <266969..>267253
                     /locus_tag="AGOS_AEL194WA"
                     /product="AEL194W-Ap"
                     /transcript_id="NM_001355324.1"
                     /db_xref="GeneID:9487584"
     CDS             266969..267253
                     /locus_tag="AGOS_AEL194WA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL109W (ZEO1)"
                     /codon_start=1
                     /product="AEL194W-Ap"
                     /protein_id="NP_001342262.1"
                     /db_xref="GeneID:9487584"
                     /translation="MSETNTAAAATTEPVVAKPAEATEAVATPVEKKVEEPAKKTEQA
                     AEAAAEPAAAAETDAAAPAAETEAPVEAKAEAKKLPFWKKLSAKLKKILN"
     gene            <267514..>268635
                     /locus_tag="AGOS_AEL194W"
                     /old_locus_tag="AEL194W"
                     /db_xref="GeneID:4620850"
     mRNA            <267514..>268635
                     /locus_tag="AGOS_AEL194W"
                     /old_locus_tag="AEL194W"
                     /product="AEL194Wp"
                     /transcript_id="NM_210020.1"
                     /db_xref="GeneID:4620850"
     CDS             267514..268635
                     /locus_tag="AGOS_AEL194W"
                     /old_locus_tag="AEL194W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL288W (CAF40)"
                     /codon_start=1
                     /product="AEL194Wp"
                     /protein_id="NP_984667.1"
                     /db_xref="GeneID:4620850"
                     /translation="MYSTAAAGAGPIHSVPPNQMNFPPLVSTMATQGAQQQQGVQQAQ
                     VGAGGSSLPKNMGQGQQGMGPPHMGMVSGGMPLVGQPVMPNMPPATAGISGQQASSRA
                     LDDPNVYHWICQLTYGPNKEQALLELGRKREQYDDLALVLWSSFGVMTALLQEIISIY
                     PLLSPPMLNNQLSNRVCNALVLLQCVASHPDTKTAFFQAHIPLFLFPFLNTTSRQRTF
                     EYLRLTSLGVIGALVKNDSVEVINFLLRTDIIPLCLRIMESSSELSTTVAIFILQKIL
                     LDDNGLQYICATQERFYAVSQVLTNMVDQLTVQQTPGRLLKHVVRCYLRLSDNLEARR
                     LLKQVLPRQLKDNTFTDVLQDDLGTKRCLAQLLLTLNEE"
     gene            <268941..>271739
                     /locus_tag="AGOS_AEL193W"
                     /old_locus_tag="AEL193W"
                     /db_xref="GeneID:4620851"
     mRNA            <268941..>271739
                     /locus_tag="AGOS_AEL193W"
                     /old_locus_tag="AEL193W"
                     /product="AEL193Wp"
                     /transcript_id="NM_210021.1"
                     /db_xref="GeneID:4620851"
     CDS             268941..271739
                     /locus_tag="AGOS_AEL193W"
                     /old_locus_tag="AEL193W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL287W (SEC21)"
                     /codon_start=1
                     /product="AEL193Wp"
                     /protein_id="NP_984668.1"
                     /db_xref="GeneID:4620851"
                     /translation="MSTHTYKSGFRVTVSNKAPEEAQAGHLPDKMTVYQDCLNEFNES
                     PVKPARCRMLIGKLLKLLSHGETFPANESTALFFSISKLFQHPNNSLRQAVYLALKEL
                     CRNSEDVLMATSSVMKDVQNGTDLVKPNAIRALTRVLDASTAFSAERLYKSAVVSKDP
                     SISSAALVSSYHMLPIAESTVKRYANETQEAVSDLKTYPHSAGPTDFYRVSSYISQYH
                     ALGLLYKLKSHDKIAMMKLIQQFSANNVLRNQLAQVQMVRLVHELLRMDNQLVPQFVP
                     QLQSWLTSRYDAVKLEACKLISSLNSYMPSDIHTAMIHTLQGMLSVPQVCSRFAAVRL
                     LNSISMTAPEKVIICNPELESLINDSNRNISTYAITTLLKTGTSKNISSLIKTITKFI
                     HEVSDDFKVIIIDAIRTLSLKFPDEWKNILSFLIDTLKSAEGGYTFKNNIVDALFDLI
                     QHVPQSREQALEHLCDFIEDCEFNEISVRIIYLLGKEGPSTEKPSLYVRHHYNRVVLE
                     NSIIRSAAVSALSKFSSPKKDPSLAYSIEKLLKGIQTDEDDEVRDRATILVKLLEENK
                     EKPGVADEFIQPKHSYDLHALESKLTNYLHHNEDGFATPFDASSIPKYTEEELKAINL
                     KQKQQQFFANAEPSNSGKKTSGSDPKLSASATDIAAEAVQPSSIDYAEQLSSIEEFAS
                     YGAIIHSSKPIPLTEPEAEFTVAGVKHLFQDHLVLQFNITNTLTDVALDKVTVICTPE
                     EDAEMTELCAIPLDRLLPGDTGSCFISYEKPTATTVGFFNNLNFTTLELDPATNAPFE
                     GDEGFQDEYEIDALYLQPGDYIKSVFVGDFAATFEELPHEEVAVYNLSQSGASLQDIV
                     NKLVLSTNCLPLENSQFVSTESNSAVVKLFGKHITSEDRVALLVRLIKSTKGIALKVQ
                     CKSDSAELCGDLANGLVL"
     gene            complement(271895..271966)
                     /locus_tag="AGOS_t0101"
                     /db_xref="GeneID:4620852"
     tRNA            complement(271895..271966)
                     /locus_tag="AGOS_t0101"
                     /product="tRNA-Gly"
                     /codon_recognized="GGA"
                     /db_xref="GeneID:4620852"
     gene            <272327..>273508
                     /locus_tag="AGOS_AEL192W"
                     /old_locus_tag="AEL192W"
                     /db_xref="GeneID:4620853"
     mRNA            <272327..>273508
                     /locus_tag="AGOS_AEL192W"
                     /old_locus_tag="AEL192W"
                     /product="AEL192Wp"
                     /transcript_id="NM_210022.1"
                     /db_xref="GeneID:4620853"
     CDS             272327..273508
                     /locus_tag="AGOS_AEL192W"
                     /old_locus_tag="AEL192W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR025C (OLA1)"
                     /codon_start=1
                     /product="AEL192Wp"
                     /protein_id="NP_984669.1"
                     /db_xref="GeneID:4620853"
                     /translation="MPPKKQVEEKKVLLGRPGNNLKAGIVGLANVGKSTFFQAITRCP
                     LGNPANYPFATIDPEEARVIVPSPRFDSLCDVYKPASKVPAHLTVYDIAGLTKGASKG
                     EGLGNAFLSHIRSVDSIYQVVRCFDDAEIIHIEGDVDPVRDLDIINTELRLKDIEFAE
                     KHLEAVEKITKRGGQSLEVKQKKEEAELVKRIIELLKSGQRVANQSWSTKEVEVINSM
                     FLLTAKPSIYLINLSERDYIRKKNKHLLKIKEWIDKYSPGDLIIPFSVCLEERLSHMS
                     AEEAVEECEKIGVQSAFPKIITTMRQKLDLISFFTCGPDEVREWTIRNGTKAPQAAGV
                     IHNDLMNTFILAQIMKYEDVMEYKDDNAIKAAGKLLQKGKDYVVEDGDIIYFRAGAGK
                     N"
     gene            complement(<273618..>274502)
                     /locus_tag="AGOS_AEL191C"
                     /old_locus_tag="AEL191C"
                     /db_xref="GeneID:4620854"
     mRNA            complement(<273618..>274502)
                     /locus_tag="AGOS_AEL191C"
                     /old_locus_tag="AEL191C"
                     /product="AEL191Cp"
                     /transcript_id="NM_210023.2"
                     /db_xref="GeneID:4620854"
     CDS             complement(273618..274502)
                     /locus_tag="AGOS_AEL191C"
                     /old_locus_tag="AEL191C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR037C (SCO1) and YBR024W (SCO2)"
                     /codon_start=1
                     /product="AEL191Cp"
                     /protein_id="NP_984670.2"
                     /db_xref="GeneID:4620854"
                     /translation="MISRTRCLQAAAGIARQRAAFGGVREFSRTRLATQEAPAGPEAP
                     GKRRPLSRIPLGAQETHSQRVEGGAIEFTTWKAAAVLLVLGGGLFYVFSREKRRLEVQ
                     REAEANRGYGRPAVGGPFQLVDFNGNEFTEKNLLGRFSLVYFGFTHCPDICPAELDKL
                     AAWLRGLKQRGIDVQPIFVTCDPARDPPAVLKEYLAEFHPDIVGLTGSYEEVKKACKQ
                     YRVYFSTPPNVKPGQDYLVDHSIFFYLMDPEGAFVDVLGRQYDEQTGQAKIEEHVKAY
                     VPAAEREKRKEKWYSFLF"
     gene            <275085..>277739
                     /locus_tag="AGOS_AEL190W"
                     /old_locus_tag="AEL190W"
                     /db_xref="GeneID:4620855"
     mRNA            <275085..>277739
                     /locus_tag="AGOS_AEL190W"
                     /old_locus_tag="AEL190W"
                     /product="AEL190Wp"
                     /transcript_id="NM_210024.1"
                     /db_xref="GeneID:4620855"
     CDS             275085..277739
                     /locus_tag="AGOS_AEL190W"
                     /old_locus_tag="AEL190W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR038W (CHS2)"
                     /codon_start=1
                     /product="AEL190Wp"
                     /protein_id="NP_984671.1"
                     /db_xref="GeneID:4620855"
                     /translation="MVANPFLSEESDRAGGPMHGERAIPPLPRSPGRLAPSRAATRYS
                     PQRPERGGLAERAHLAPNRYEANLSLSPSRNMHTVLDMGFEASDSDSDSERSPVAPSS
                     HGGRTHGGRPSMGSAYSPRKADDDGSSSVLSGATIGQTNFQLNHPQKRYIRRGKSEVR
                     RTPPLAKQKNILKLDNPIPRGLLDILPRRDSPEFTEMRYIACTVEPDMYVEQGYSLRM
                     AEMDRECQVVVCVTMYNEDKYALARTLHSIQRNISHLCRRKKSQVWGKNGWKKVQVII
                     VSDGRNKINSGSLDYLSALGVYQEDMAKSTVNGEPVRAHIFELTTQVSINDQLNYKSE
                     NIVPCQMVFCLKEENQKKINSHRWLFNAFCRVLDPTVVMLVDVGTRLNDTAVYHLWKA
                     FDMDSNVAGAAGQVKTMKGKYGCKLLNPLVASQNFEYKMSNILDKPLESMFGYISVLP
                     GALSAYRYRALQNNEDGTGPLYSYFLGESIEGRNCNVFTANMYLAEDRILCWELVAKR
                     DAKWVLKYVKEAQGETDVPEEPPEFISQRRRWLNGAMFAALYAQLHFFQIWGTKHSLR
                     RKIFFHIEFLYQFFQMFFSWFSISNFFLTFYYLAGSMIGVLKNGKAVFTFFKYLIICD
                     LAAIFIISMGNSPQGANHLFIISMFLLSVCSTYALVCGITFAAKTLTAISTPSAAFSN
                     IMVSLLSTYGLYILSSFLYLDPWHIFTSSIQYFLMLPSFVCTLQIFAFCNTHDVSWGT
                     KGASQGSKPKSEAMVTQGPDGKQIVEGTEWPQDIDNKYQEIKSRLKSDEVVEIKVDPI
                     QKQADHYRDVRTRIVMLWMLSNLILIMMITQIYSPEETSNNKYLVFVLGSVAGLAAFR
                     FLGSFSFLVIKYTRMIVKWKRKSAQIAK"
     gene            <278326..>281757
                     /locus_tag="AGOS_AEL189W"
                     /old_locus_tag="AEL189W"
                     /db_xref="GeneID:4620856"
     mRNA            <278326..>281757
                     /locus_tag="AGOS_AEL189W"
                     /old_locus_tag="AEL189W"
                     /product="AEL189Wp"
                     /transcript_id="NM_210025.2"
                     /db_xref="GeneID:4620856"
     CDS             278326..281757
                     /locus_tag="AGOS_AEL189W"
                     /old_locus_tag="AEL189W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR023C (CHS3)"
                     /codon_start=1
                     /product="AEL189Wp"
                     /protein_id="NP_984672.2"
                     /db_xref="GeneID:4620856"
                     /translation="MSDDYYMFDNESLLKSSPQDNLVQRTGSLVRPERNHMNDPSHPH
                     HYYARKAKETRVSVNPSSTGIMPSTDPLPSKTLNKPRPPVKPKIAKRREDDPLSLWQF
                     YCYAITFWAPSPLLELFGMPKKERQFAWREKVGLISVIIYCGIFVAYLTFGFTNTVCN
                     VDRQRLRNNEVAHQYLIIHGKAYNLDFSAHPAAAGIDAGSNVLYNPIAAGGKVASFLF
                     QNVNGNCKGLIIPKENCSIPHEGLDLAWYFPCKLYSQDGSTSPEFSLSEYYDGWACHT
                     SENARGAYYNLQPTADVYFTWEDIKNSTRNLVVYNDDVLDLDLLNWLQTEDLEIPGAF
                     DDLKSANLKGFDISVVLSNSHDKQVARCLSEIVKVGVIDSDTVGCIASEVVLYISLVF
                     ILSIVTIKFLVSCYFHWCIARKQGASPVDNKTLAKMANDIEDWSENINSQGPIKPVQH
                     PTGFGQSKDFNLNMFQRNRNFRLDLSQGNLDVTADLALLEKLKGFGITTMTIQSLLKE
                     LSPESTPYNIASPRSPSILPLNPLTDDFFSHNQNEHLDPSIIHPNVIPQPPPDYTPFG
                     YPLIHGICFVTCYSENEEGLRTTLDSLSTTTYPNSHKLLMVLCDGLIKGSGNSKSTPE
                     IALDMMEDFVVPPERVQAYSYVAVAYGTKRHNMAKVYSGFYKYDNSTVPPEKQQKVPM
                     ICIVKCGTEDEQASSKPGNRGKRDSQVILMSFLQKVTFDERMTRLEFELLKNIWQITG
                     LMSDFYEFVLMVDADTKVYPDSLSHMVAEIVKDPKIMGLCGETKIANKRQSWVTAIQV
                     FEYYISHHQAKAFESIFGSVTCLPGCFSIYRIKCPKGEDGYWVPILCNPDIVERYSDN
                     VTNTLHKKNLLLLGEDRFLSSLMLKTFPKRKQIFVPKAACKTIVPDKFRVLLSQRRRW
                     INSTVHNLIELVLINDLCGTFCFSMQFVIAIELIGTVVLPLAICLTIYVVIFAIVSKP
                     TPVITLILLAIILGLPGILIVVTATRWSYLVWMGIYLLALPIWNFVLPTYAFWKFDDF
                     SWGDTRQVAGGDKGNHCDGEGDFDGSLIQMKTWREYERIERLERTNKLGTTPGVGEPT
                     SRRAFSSMDNFPAILSEQLNGSYAQQAGPLLPPLPPLPPLPALSSQSPRPRPRAP"
     gene            complement(281872..281944)
                     /locus_tag="AGOS_t0102"
                     /db_xref="GeneID:4620857"
     tRNA            complement(281872..281944)
                     /locus_tag="AGOS_t0102"
                     /product="tRNA-Thr"
                     /codon_recognized="ACU"
                     /db_xref="GeneID:4620857"
     gene            <282642..>284135
                     /locus_tag="AGOS_AEL188W"
                     /old_locus_tag="AEL188W"
                     /db_xref="GeneID:4620858"
     mRNA            <282642..>284135
                     /locus_tag="AGOS_AEL188W"
                     /old_locus_tag="AEL188W"
                     /product="AEL188Wp"
                     /transcript_id="NM_210026.1"
                     /db_xref="GeneID:4620858"
     CDS             282642..284135
                     /locus_tag="AGOS_AEL188W"
                     /old_locus_tag="AEL188W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR263W (SHM1)"
                     /codon_start=1
                     /product="AEL188Wp"
                     /protein_id="NP_984673.1"
                     /db_xref="GeneID:4620858"
                     /translation="MFIRRLHTSSRRLTCGEALRACQQTGARSANGQLMLSQHVQEFD
                     PEMYDILTKERSRQKRSITLIPSENFTSVAVMNLLGSEMQNKYSEGYPGQRYYGGNQY
                     IDMAESLCQKRALELYGLDPAKWGVNVQSLSGAPANLYAYSAIMEVGDRMMGLDLPHG
                     GHLSHGYQLQNGNKISYISKYFQTMAYRVDPATGLVDYDTLSETSKLFRPKVIVAGTS
                     AYARVLDYKRFREIADACGAYLLSDMAHVSGLVAAGVHPSPFEYSDIVTTTTHKSLRG
                     PRGAMIFYRKGIRKVTKKGTEIMYDLDKRINFSVFPAHQGGPHNHTISALAVALKQAA
                     TPEFKNYQTAVVENAKVFGEELSKRGFSLVSGGTDTHLLLIDLSPMGIDGSRLETILE
                     RLNIAANKNTIPGDKSALYPSGLRVGTPAMTTRGFGPAEFGRVAAYINEAVKLAIGLK
                     SQEPVDAKDAKTRLAHFKSFCAESEQVTKLANEVADWVAQYPVPGEL"
     gene            complement(<284212..>284838)
                     /locus_tag="AGOS_AEL187C"
                     /old_locus_tag="AEL187C"
                     /db_xref="GeneID:4620859"
     mRNA            complement(<284212..>284838)
                     /locus_tag="AGOS_AEL187C"
                     /old_locus_tag="AEL187C"
                     /product="AEL187Cp"
                     /transcript_id="NM_210027.1"
                     /db_xref="GeneID:4620859"
     CDS             complement(284212..284838)
                     /locus_tag="AGOS_AEL187C"
                     /old_locus_tag="AEL187C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR264C (YPT10)"
                     /codon_start=1
                     /product="AEL187Cp"
                     /protein_id="NP_984674.1"
                     /db_xref="GeneID:4620859"
                     /translation="MARHYCCQVKLVLLGESSVGKSSIVTRFTTGEFRKNQATIGAAF
                     TTRSVQWEEDAGDGSDAKEVRSVTFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTE
                     QQSFQNARSWIDELNTYIGEAQRNDVVVRIVGNKIDLHAGGQLEQPLPSATFVSAKTG
                     EGIEELFMDIAKHVKPERFVLQAEPQESPQRSILNVLGASSADHGCRC"
     gene            <285036..>290222
                     /locus_tag="AGOS_AEL186W"
                     /old_locus_tag="AEL186W"
                     /db_xref="GeneID:4620860"
     mRNA            <285036..>290222
                     /locus_tag="AGOS_AEL186W"
                     /old_locus_tag="AEL186W"
                     /product="AEL186Wp"
                     /transcript_id="NM_210028.1"
                     /db_xref="GeneID:4620860"
     CDS             285036..290222
                     /locus_tag="AGOS_AEL186W"
                     /old_locus_tag="AEL186W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR275C (RIF1)"
                     /codon_start=1
                     /product="AEL186Wp"
                     /protein_id="NP_984675.1"
                     /db_xref="GeneID:4620860"
                     /translation="MSRDPLGLVDLLRVWLSDRCLQAHRSHHVPSRSLFPNSPQLWDQ
                     NSPEAVERSVKTMQLENKPSQQTNKRIKALDVLDKHISQRSTQKKLQQVPQLLPGDSH
                     TSSGEDEGLPGKIWRGDGRAAGRPRTSPEIRVERQNADEERPTLSASSPLKKSVVFSE
                     EVTSSPIRATVSSSPVRSAHNRPPSKSILKSSPSKLLAGVQGQERALHQFLNPNMASI
                     VAVDPFSLDYWTVGEVHTLSDQNSLAEYKRVLEGAVHLLKQPAGSSRQFEIYATLNGI
                     LPSPNATSVSDVDARKLSLTIENIDVLMQISYVKLKQTQENLLLSSKKDPFLSRLYVQ
                     IVRFFSNLLATVRIVKSFERKPHVRSICQSVMDLALESLNHENTNKVMITAQLTLLRE
                     ERYGEFFLSDIQIKTFIEAVANIKGIASTNLLYEKHLLLKQYLVKYPDCMLDSVRLWF
                     STEVLARILIVHEHYNGKLLSSSISVMLELLKVSLVNRRRLEISALLNTTAVECIPQL
                     DNKEFARSRVQRSKTTKQLLQERIKELILENKDYRSAMDIWLCVMGLVYGDPSSLESI
                     LDEEGDSWIKLNLLCHNSSDPAASKLAFKAWRILIYLTFVNFQLNFSQANELMKLLLR
                     PLRLFAECDLNNKSIIEGINYTISDILYMSFSDPSSSIRFQYLQRHIISPLFMDILPK
                     YKCSAVIQHTEGIFVKLLGKNDDGRQAKKLFNPMRVLSPVGITESDFSAIPFNILNCS
                     WGDIMNLVSIMLTFEHIDLGAIFEMFLALLLRVPDSLRTPDNCTTCVAFAKRLLLELS
                     KEDSAVAFDAILEKCVSFFFQAFEAILFEGLSGVTPFYDLINIEKQSPEEQLRWLKLT
                     LDLTKHMIPDVFIVEKFLELSNPAINSYAGNFVGSKLLSATIQPSILDSFLTIVNKVP
                     TPEAIENVLEFCTNVLPESIDILSKLNFLDWDDNALVYFVKKYSKRVSNGRLDPNLLE
                     RLRPHLFVNTNLFVELSTLLVKSGERELMKELVSHHPYSISLSMLDKVDLTEALAKES
                     VAQLLSRISELSLDEQYKLLIHAIKTREASALVASFEHIKLLLENKPQNISVDLDIIS
                     KDIFALCCDVKEWKLMANISGVLIERNLVTHLLMNLEDKADIVLQYFDPVTIIAILAR
                     YSDNSTTCDAIFRKCLEDHDPFVCFQLLRELVGTNNFKVFSANYVYLFKFIFDPKDRF
                     CEKNREEALELFPVLTNHLMLLSQNIVSEAMEAIKSMVTLQGREYQFQLLARMVHHPQ
                     FSVKGDERLVNLIRTWKESTSTPKKRPRMFRFISPRKGDVTAIQEEITVPVSGGHAIC
                     ENDIDEPRTGATLNDPQDDASSSADMADYPVLNNLSNPASGRDEDETEQESSDECIAS
                     QSHLNREARKLAQNNGVFPIEGVATDILDQTPSSPPSGLPAPNSAVENDIDNDAVKGD
                     NSTSNEHHASINSSPDAEPAEVDSHPMGNRGSRQNADPELAEDCPTRGNCQTDRQNIC
                     DKDAQADFEDLPDSPVPTSFDKREGGNDIASFADKQGLASMATEKAGERVFDFVEDTH
                     STPVKIVHMPNQPIEPEHKGNSANKDPGDSPLIVGATTVGQTAASEESLEEEQDPDVS
                     VVAPLRIPIFKSNHAFYPHLGTHSDEDRIAVKEENNTVSFESPVLHQPQPPNTGNDTS
                     RETTPYYGKPLKAKFPSKKVRRVVSRINALEQDDITHMGPDEKDSLRRELLTFIMKLE
                     GL"
     gene            complement(<290357..>291904)
                     /locus_tag="AGOS_AEL185C"
                     /old_locus_tag="AEL185C"
                     /db_xref="GeneID:4620861"
     mRNA            complement(<290357..>291904)
                     /locus_tag="AGOS_AEL185C"
                     /old_locus_tag="AEL185C"
                     /product="AEL185Cp"
                     /transcript_id="NM_210029.1"
                     /db_xref="GeneID:4620861"
     CDS             complement(290357..291904)
                     /locus_tag="AGOS_AEL185C"
                     /old_locus_tag="AEL185C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR274W (CHK1)"
                     /codon_start=1
                     /product="AEL185Cp"
                     /protein_id="NP_984676.1"
                     /db_xref="GeneID:4620861"
                     /translation="MESSQAECLPEIKELELGETIGQGTFAFVKTASLRADPQTIVAV
                     KFVHVERCKARGMTDEDLTREVVLQTRCAGHRHVVRVLDCNVSREYLWIAMELADGGD
                     LFDKIEPDVGVDSEVARFYYQQLVRALTHLHEACGVAHRDIKPENMLLDRAGNLKVAD
                     FGLATRFRRRDGTRRLARDRRGTLPYLAPEVVGERAYHADTADIWSAGVLVFVLLTGE
                     TPWSEPSVDDGMFRAFVADGGNLSDGPWGKIGLVELNLLRKMLQQRPAARATLAQLRQ
                     HPWFKAPVVFADPDGMCADPAQLARRLLFKLRVPLSDAAYVQFTQDAPCSGPALTATQ
                     PVENELAHLEHDSYNSKTPIFSQCNLDRATADELQKRPATQSVRFDREVAVMQFRDEV
                     DPTLSFDFNPAKFTKFFTADDMASVLPQLEFALRESSIPVRAGMYDSFCELERIMGAD
                     KVFPVSIDIKARDRKGWLLSGIVCIREVADGLKVVCFERKAGDPLEWRRLFKRIALFC
                     RHLIYIA"
     gene            <292107..>292991
                     /locus_tag="AGOS_AEL184W"
                     /old_locus_tag="AEL184W"
                     /db_xref="GeneID:4620862"
     mRNA            <292107..>292991
                     /locus_tag="AGOS_AEL184W"
                     /old_locus_tag="AEL184W"
                     /product="AEL184Wp"
                     /transcript_id="NM_210030.1"
                     /db_xref="GeneID:4620862"
     CDS             292107..292991
                     /locus_tag="AGOS_AEL184W"
                     /old_locus_tag="AEL184W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR273C (UBX7) and YJL048C (UBX6)"
                     /codon_start=1
                     /product="AEL184Wp"
                     /protein_id="NP_984677.1"
                     /db_xref="GeneID:4620862"
                     /translation="MSVEQVSGAHACEEQVARFERNVEAAERRSASEDKALVIYSGGN
                     DDEWLLRWFRPVLVESVGDKCVWLRVTAGSAGAAQVRTRYGVGGSPGVWCVRGGQVVL
                     GLQGQRGGAGFARRLLRSLDAQTTCELAFKLTDGGLLRHKFSAGATLALVRAWVDAHR
                     NDGTLPYQFYSSAQRATLTEAQERLTLTELDLVPRSALILKPVQTAAAEAVGDAHGGG
                     LLSSLQRAVAWLVTRSAPAAAAPTAGTASPSPASSCYASPMQSPLLKHFDCGESELSI
                     PPTCIAPSARKFQSPDRR"
     gene            complement(<293068..>294321)
                     /locus_tag="AGOS_AEL183C"
                     /old_locus_tag="AEL183C"
                     /db_xref="GeneID:4620863"
     mRNA            complement(<293068..>294321)
                     /locus_tag="AGOS_AEL183C"
                     /old_locus_tag="AEL183C"
                     /product="AEL183Cp"
                     /transcript_id="NM_210031.2"
                     /db_xref="GeneID:4620863"
     CDS             complement(293068..294321)
                     /locus_tag="AGOS_AEL183C"
                     /old_locus_tag="AEL183C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL049W"
                     /codon_start=1
                     /product="AEL183Cp"
                     /protein_id="NP_984678.2"
                     /db_xref="GeneID:4620863"
                     /translation="MLPESRLASLYSDFRKLQELNPDGFQANVLTWKDHLMNTVWRDE
                     LLIEGGDELLERLSTKETGFPKSIDVAIDQLVMDRRLVPLGRFVRGPDFGLLSWVRWT
                     LHKVVDLSWRSRVRENGRYLRNCAYVNMDVLAARHGAVEGALEERVVARATRYTDLVF
                     SREEFYGVVRESLRGRGEYDVVLADLDKHRKAILVDGDVVKVVMPAVRALVQPFGPDR
                     VTANDRHIAEFKGSLRLVERQVQAIHGHVEETARALRGAVAAGAARDVQRRYLRMNKL
                     AQASLSRALNQFTNLMEIKDHIDKSVDNLHLVEVLSGASRALADINRQIGSLDDVERL
                     LDDVHEHMEDSERISGALTASVAEDDGELDSELAAMEQELQQELQQEETLLGVLERLQ
                     VSDREPQALARSASPAKLAEPPQTL"
     gene            <294427..>295854
                     /locus_tag="AGOS_AEL182W"
                     /old_locus_tag="AEL182W"
                     /db_xref="GeneID:4620864"
     mRNA            <294427..>295854
                     /locus_tag="AGOS_AEL182W"
                     /old_locus_tag="AEL182W"
                     /product="AEL182Wp"
                     /transcript_id="NM_210032.1"
                     /db_xref="GeneID:4620864"
     CDS             294427..295854
                     /locus_tag="AGOS_AEL182W"
                     /old_locus_tag="AEL182W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR272C (HSM3)"
                     /codon_start=1
                     /product="AEL182Wp"
                     /protein_id="NP_984679.1"
                     /db_xref="GeneID:4620864"
                     /translation="MEEWRIQDRMSQLADVLEAPEEHGVGSVNGLVDMLQLDLGVMVR
                     LDADARPLLSAMKKVLTAGEMSGLDYSGLLSLLDTVVKLAPFETVLEVFSVEDIITAL
                     ESDDQLVRTSCKVLAVSHPKDLFSTTRIMDVLLQLYFSQRTVPVNAVEDVFQSLCTDG
                     LIRRRILENNYPLLREMRSTHDAILFSRYLVLMTILFRHIDRSEFQKELFVPTTEEVL
                     DSLKKDIFLFINVAKYYRALLEYATDPGAAGGPRDWALSYILPVLHAFGHIYENKEKY
                     IEVHSYARAYLFQLLRTVSYLEDMEVFRELDVKYLHISGDNPDVMHFMAIFNPMYLYR
                     HHFDLLTSQVTVKPSFLPVLKNIVSCQETFEILKPALTASAILIMPYSEQMVLLGQLS
                     SYPHSTEYLVQELPKVMSNLICNENGPISEPETIELRKKVFENLLLYSATVLNVWYEP
                     LLDEYTNICSGKTSFVRTEVVDMYL"
     gene            complement(<296010..>299225)
                     /locus_tag="AGOS_AEL181C"
                     /old_locus_tag="AEL181C"
                     /db_xref="GeneID:4620865"
     mRNA            complement(<296010..>299225)
                     /locus_tag="AGOS_AEL181C"
                     /old_locus_tag="AEL181C"
                     /product="AEL181Cp"
                     /transcript_id="NM_210033.2"
                     /db_xref="GeneID:4620865"
     CDS             complement(296010..299225)
                     /locus_tag="AGOS_AEL181C"
                     /old_locus_tag="AEL181C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL050W (MTR4)"
                     /codon_start=1
                     /product="AEL181Cp"
                     /protein_id="NP_984680.2"
                     /db_xref="GeneID:4620865"
                     /translation="MDGDLFSVFGEEPKELPELPAEDIEQVPDEHQVETKKRGLSPSS
                     NTKEESQQAESTAKKVKKDKKLVDEKKKSEVVPVLADSFEKEASREVEASSGLATADA
                     AQVEENGKMKLRHQVRHQVALPPNYDYKPIGQHIRTNEARTYPFTLDPFQDTAVSCID
                     RGESVLVSAHTSAGKTVVAEYAIAQSLREKQRVIYTSPIKALSNQKYRELLAEFGDVG
                     LMTGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEE
                     TIILLPDKVRYVFLSATIPNAMEFAEWICRIHSQPCHIVYTDFRPTPLQHYLFPAHGD
                     GIHLVVDEKGTFREENFQKAMASISNQLGDDSNSATSKGKRGQTYKGGAAKGDAKGDI
                     YKIVKMIWKKKYNPVIVFSFSKRDCEELALKMSKLDFNSDEEKDALTKIFNNAISLLP
                     EADRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLN
                     MPAKTVVFTSVRKWDGKQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQVA
                     KGMVKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLEHSFYQFQNITSMPVMEKKMN
                     ELSKKLEDIHVDDESNVKDYYDIRQTLDAYNEDVRKVMTHPANVLSFLQPGRLIKINV
                     GGKQDYGWGAVVDFAKRINKRDPTAVYADHDSYIVNVVVNTMYKDSPLNLLKPFNPVL
                     PEGIRPAADGEKTTCALISITLDSIQGLGNLRIFMPSDIKADSQKEVVGKTLKEVQRR
                     FPKGIPLLDPIKNMKLEDEEFLKLLKKIEILESKMNSNPIANSVKLQELYEKYSEKVA
                     MQNDIKHLKSKMNEAQAVIQLDDLRRRKRVLRRLGFCSASDIIELKGRVACDISSGDE
                     LLLTELILNGNFNELKPEQAAALLSCFAFQERCKEAPRLKPELAEPLKAMREVAAKIA
                     KVIKDSKLEIVEKDYVESFRHELMEVVYEWCRGASFTQICKMTDVYEGSLIRMFKRLE
                     ELIKELIDVSNTIGNVTLKEKMEAALHMIHRDIVSAGSLYL"
     gene            complement(<299576..>301528)
                     /locus_tag="AGOS_AEL180C"
                     /old_locus_tag="AEL180C"
                     /db_xref="GeneID:4620866"
     mRNA            complement(<299576..>301528)
                     /locus_tag="AGOS_AEL180C"
                     /old_locus_tag="AEL180C"
                     /product="AEL180Cp"
                     /transcript_id="NM_210034.1"
                     /db_xref="GeneID:4620866"
     CDS             complement(299576..301528)
                     /locus_tag="AGOS_AEL180C"
                     /old_locus_tag="AEL180C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL051W (IRC8)"
                     /codon_start=1
                     /product="AEL180Cp"
                     /protein_id="NP_984681.1"
                     /db_xref="GeneID:4620866"
                     /translation="MSANGGAAKKMRGAVLCSSFGLLVATTGTSVAVAFTTKQCPETL
                     YRASLIVVTATTAVCAASHATARVKAQPKMLVPLATIPCVGMVGAAMWYVMQLAWHRT
                     AVLDSTAMGVGGLIVTHLALLIASVFCSGFAAGIVMLAGAPTEETPECEGHALGKRNA
                     APYGNNRQPLDSTAAEVSQRSMSTLIPEVDDIWEYSSKNWMNDYDTNYPICEKGATPD
                     IPRPVFRPACATRRYRSISGSSIVQKSSAGPHGTACSKKGIFDLLQNKILKKVSPAHM
                     DDLPRHEEQYLEARYVTRLSNGCDVSSSALKAPDYLVSPTFPTASAGRLILMNTHDDD
                     NQDISDNSIMANSLRKDHRRANYSASILIPPQTLSESSLQVTVGPKERPHSALTQGID
                     VTHTDRSEDAKTLIASNTNGSGSADGDRDRDFSGNSGCQQHSPTNLLPPFGSPGAASN
                     SVLDPVGPKLASRGCAHGNLVINHMRTLNMENTSTLDIAEEAIRHQGSDDSLLQGLTR
                     GNTPREVAAISAQHKSAAASSTSSAGRAFARSGHADLPLHMWSPSQRSAPLISHGSRT
                     QSVSSSPIRAHALTQKLGHSLSKSLLNIRWDQRESIERLAPPRGQLADLRYVHHLQGK
                     YSPSRSTNTCSSAERKHFLTVKSAFN"
     gene            <302174..>303043
                     /locus_tag="AGOS_AEL179W"
                     /old_locus_tag="AEL179W"
                     /db_xref="GeneID:4620867"
     mRNA            <302174..>303043
                     /locus_tag="AGOS_AEL179W"
                     /old_locus_tag="AEL179W"
                     /product="AEL179Wp"
                     /transcript_id="NM_210035.1"
                     /db_xref="GeneID:4620867"
     CDS             302174..303043
                     /locus_tag="AGOS_AEL179W"
                     /old_locus_tag="AEL179W"
                     /note="NOHBY510; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F01408g"
                     /codon_start=1
                     /product="AEL179Wp"
                     /protein_id="NP_984682.1"
                     /db_xref="GeneID:4620867"
                     /translation="MELRVWKLWRRWERRQEVGRGTTCYVEVWQRKGVTCAVKRVRGD
                     DPSEHHNREVRAMLTKEYNILRSLHSVHVVAVVEQRLSKGWILLEYVPFCVQKVMRMD
                     LAPGAEERRCLLGQLVEGVAYLHSSGVVHRDLKLDNMMLAPDCHTLKLIDFGHAVKLQ
                     AGKTKCYGIGGTEPLIAPEALNQLSYEGYPVDMWSIGIIMYMLFNDIADLRYPWRIAR
                     SSDEAFLAYEEEGLLHISTEEHLCRRFLTPDPALRITAAEAVEIPFLQYNCDGHVHER
                     TRRLCQKFWGTYM"
     gene            complement(<303110..>304033)
                     /locus_tag="AGOS_AEL178C"
                     /old_locus_tag="AEL178C"
                     /db_xref="GeneID:4620868"
     mRNA            complement(<303110..>304033)
                     /locus_tag="AGOS_AEL178C"
                     /old_locus_tag="AEL178C"
                     /product="AEL178Cp"
                     /transcript_id="NM_210036.1"
                     /db_xref="GeneID:4620868"
     CDS             complement(303110..304033)
                     /locus_tag="AGOS_AEL178C"
                     /old_locus_tag="AEL178C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL053W (PEP8)"
                     /codon_start=1
                     /product="AEL178Cp"
                     /protein_id="NP_984683.1"
                     /db_xref="GeneID:4620868"
                     /translation="MFFKSPIDIEILFDGQESRKQVEIPSVSSTSKTLKDRYPLYEDG
                     ESVSGLVTLRVREGRKVEHLGIRVSLVGSVDTTKSSSEAKKRAIDTFLSLSADICPPG
                     ELVHSQSFPFNFKDVEKRYESYRGKNIDVMFYVKVVVLRKSTDIVKLKKFWCYLYNTI
                     PPVLAAGAADENKPVKLDIGIENCLHIEFEYSKSQYALKDVIVGRIYFLLTRLKVKHM
                     EISLIKRETCGHEPNQLSDTTSIRYEIMDGSPVKGETIPIRLFLGGYDLTPNITSNYF
                     SVKNYLSLVIIDEDGRRYFKQTEIILYRTLS"
     gene            complement(<304264..>305682)
                     /locus_tag="AGOS_AEL177C"
                     /old_locus_tag="AEL177C"
                     /db_xref="GeneID:4620869"
     mRNA            complement(<304264..>305682)
                     /locus_tag="AGOS_AEL177C"
                     /old_locus_tag="AEL177C"
                     /product="AEL177Cp"
                     /transcript_id="NM_210037.2"
                     /db_xref="GeneID:4620869"
     CDS             complement(304264..305682)
                     /locus_tag="AGOS_AEL177C"
                     /old_locus_tag="AEL177C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL054W (TIM54)"
                     /codon_start=1
                     /product="AEL177Cp"
                     /protein_id="NP_984684.2"
                     /db_xref="GeneID:4620869"
                     /translation="MMGEFKHPPQEKQKMSSTKKAGYSNPAFAAMGIPALRLPGPKWC
                     AFWLVVGAGIAGVVYDKREQRRICKHYSSLVKDQGAAHMDTWLKPRRLTVFVAPPPGD
                     YLETSMKVWRRYVKQVLFEAGLDYEVFTEERQGVIRHEVAERVRQLRRDIAAAEAAEQ
                     RALDEKRWLNRMRSWWRREKLSEEELERIRAQKFRDEFTYKQLLGVFYKNAPLREQKV
                     WDADALVEDPVLAGGVICIGRGAYKEYIAGIHEGTLGPLDPPTLTPEAPTELSAAAED
                     LTQAPEQPEPSAAAEALKQAPEQAEHSPAEPDSAATDAPDEKSNNAPAPPPAPYVSPD
                     EYSSLSLSQELVGDVRHPSSHIPALFHQPLLVIPVPNLSGFLQTPRKIYRFYTRRYYA
                     EECCKAAAAMVLQTIRPFQPDDLNLGISEEEDWPRRWVEQGRERKSEWVQDLKADPRV
                     IAELHVVDPALMADLAATMNLN"
     gene            complement(<306792..>307727)
                     /locus_tag="AGOS_AEL176C"
                     /old_locus_tag="AEL176C"
                     /db_xref="GeneID:4620870"
     mRNA            complement(<306792..>307727)
                     /locus_tag="AGOS_AEL176C"
                     /old_locus_tag="AEL176C"
                     /product="AEL176Cp"
                     /transcript_id="NM_210038.1"
                     /db_xref="GeneID:4620870"
     CDS             complement(306792..307727)
                     /locus_tag="AGOS_AEL176C"
                     /old_locus_tag="AEL176C"
                     /note="NOHBY509; No homolog in Saccharomyces cerevisiae;
                     Non-syntenic homolog of Kluyveromyces lactis KLLA0D04158g"
                     /codon_start=1
                     /product="AEL176Cp"
                     /protein_id="NP_984685.1"
                     /db_xref="GeneID:4620870"
                     /translation="MPNQKRGPWTCEEDKLLLKLIDQHGAFNWVKISALLKSRSPKQC
                     RERYHQNLKPSLNKTPISEQEGELIQELVAKIGKKWAEISRVLNNGRSDNAIKNWWNG
                     GTNKRKRARKSIAARQIIQNYHMHSLQSYVQTREQAVYVPAAATPPQQQGKFAEQQAL
                     PPLTALTPNMSRRNSLEVVPQNVGFKDAKRQFMLYSPEDSSQASRCAISEGPAASFVP
                     RLPALAHRAVPLSVAVTPASPQGCHNAMPGTGPGLAEHQLAIHSPPGSRETLYDTHDR
                     SALCKLDFLLNKDEANKAAQVEFTAAPAASGADHK"
     gene            complement(<308933..>309640)
                     /locus_tag="AGOS_AEL175C"
                     /old_locus_tag="AEL175C"
                     /db_xref="GeneID:4620871"
     mRNA            complement(<308933..>309640)
                     /locus_tag="AGOS_AEL175C"
                     /old_locus_tag="AEL175C"
                     /product="AEL175Cp"
                     /transcript_id="NM_210039.2"
                     /db_xref="GeneID:4620871"
     CDS             complement(308933..309640)
                     /locus_tag="AGOS_AEL175C"
                     /old_locus_tag="AEL175C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL055W"
                     /codon_start=1
                     /product="AEL175Cp"
                     /protein_id="NP_984686.1"
                     /db_xref="GeneID:4620871"
                     /translation="MSSELEGTTPKDARADGFKLAVCVYCGSSFGNSAKYADAARSLG
                     ELFHQLQWKLVYGGGTTGLMGTVARATMGPDCDGYVHGIIPNALVAKERDDKADHNAL
                     LHASVDNHTGVTPISEEYGATTIVPDMHTRKAMMARESDAFVALPGGYGTLEEVMECI
                     TWSQLGIHQKPIILFNIDGFYDSLLAFVDRAIADGFISRKNGDILEVATSPEEVVRKI
                     ENYHVPDGRFNLRWADM"
     gene            <310175..>312160
                     /locus_tag="AGOS_AEL174W"
                     /old_locus_tag="AEL174W"
                     /db_xref="GeneID:4620872"
     mRNA            <310175..>312160
                     /locus_tag="AGOS_AEL174W"
                     /old_locus_tag="AEL174W"
                     /product="AEL174Wp"
                     /transcript_id="NM_210040.2"
                     /db_xref="GeneID:4620872"
     CDS             310175..312160
                     /locus_tag="AGOS_AEL174W"
                     /old_locus_tag="AEL174W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL056C (ZAP1)"
                     /codon_start=1
                     /product="AEL174Wp"
                     /protein_id="NP_984687.2"
                     /db_xref="GeneID:4620872"
                     /translation="MVGDIQLQETQQGVVHGHIHNYNNLTYIHGHVHNSSRGGDGEER
                     PQAEPEGGVMTAVQATRREIDCSKYQDCQHFEFVNYHNLNLFQELQGEAAGVPAPGSR
                     GWQDDLLLPQQGAKRSKGTCTQCSPKIMEICCEQQHVAGGEGPSEIAVFHGCPTGERG
                     GEDRSGAVVNLPKFINCDFTCPSGTAMSHIDSSSSTLTVETSAADSPTLEDGSFDWLC
                     QQCVNYDSCEDTAGHEQQHCHDHVVNSETDIKILNDLVSISSMYEAPLCKNADQSINL
                     LHSSISGIADTGAAVGSNSPTPTAQVIPQGRAHHHHHHHHHHHHRIELHPHKSLEDAI
                     TKGQERFTSNERDPVPEQLPAEQRRCLSINGTNTINFNWNFKSNDRALRCLWDDCSAI
                     HPNLLDLQSHMLKDHISGSAADADFPCRWKDCDFLSADTDSLINHVNGTHGIGFDIQF
                     LDDKALQLQNCNHCETHCSSNAIEPSADGTFRCLWGSCTDCFSSRQALNDHIVSSHVP
                     SGRSAYQCNWAGCTKHFTQRQKLLRHIKVHTGHKPCSCPHCPKTFSTDDILAQHIRTH
                     SGERPFHCHYCRKQFSTSSSLRVHIRTHTGEKPLSCTVCGKRFNESSNLSKHMKIHER
                     KYMCKLCKRSFDRLPQYNSHVAKCARLRLAKPSIERL"
     gene            <312486..>314081
                     /locus_tag="AGOS_AEL173W"
                     /old_locus_tag="AEL173W"
                     /db_xref="GeneID:4620873"
     mRNA            <312486..>314081
                     /locus_tag="AGOS_AEL173W"
                     /old_locus_tag="AEL173W"
                     /product="AEL173Wp"
                     /transcript_id="NM_210041.1"
                     /db_xref="GeneID:4620873"
     CDS             312486..314081
                     /locus_tag="AGOS_AEL173W"
                     /old_locus_tag="AEL173W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL057C (IKS1)"
                     /codon_start=1
                     /product="AEL173Wp"
                     /protein_id="NP_984688.1"
                     /db_xref="GeneID:4620873"
                     /translation="MVSRNREMSLVLYNRNNQNDTSIVVHDARTRSLVLFHEAAGRLS
                     LAASDSASYEGGRCPHCGHLLGLQSYFIHDQYFQLLEDLPRPGTVEAPDTFIPQNLFT
                     QGYYQNFFQELEVLGNGARGAVYKVEHTFLEHSLGVYALKKIAIGDDMAWLNKCIQEV
                     KFMNSITQDCLHLVKYNHVWLERTSSVGHVTAQAGANKTTTATDDVPYMFILQQFCPG
                     GNLEGVINTKVFQRLTGSESTEERKRLFRMRRRGLTGTRKGLSTRQVLSVASDLAHGL
                     RELHSLDIIHRDLKPSNCLLLGEYDPSSTENFPKILIGDFGESQLRGQLRTATGATGT
                     LEFTAPELVLFEDDVRVKAMTSSAPQFTFESDMYSLGMILYFVVFGELPFGPGGDMRL
                     LKTQIKKYSCSASALQQRHSGYFLKPIDPRIFELISSLLSPSAADRPDADEAIAIIND
                     ILASCNSADAHVPAKGLVMHREAAMNLAVRSAQLAVSLAYMRWHYASPWNNLNLFLLG
                     FSFNCSSSTRPYLLAITLALFLM"
     gene            <314143..>315762
                     /locus_tag="AGOS_AEL172W"
                     /old_locus_tag="AEL172W"
                     /db_xref="GeneID:4620874"
     mRNA            <314143..>315762
                     /locus_tag="AGOS_AEL172W"
                     /old_locus_tag="AEL172W"
                     /product="AEL172Wp"
                     /transcript_id="NM_210042.1"
                     /db_xref="GeneID:4620874"
     CDS             314143..315762
                     /locus_tag="AGOS_AEL172W"
                     /old_locus_tag="AEL172W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR270C (BIT2) and YJL058C (BIT61)"
                     /codon_start=1
                     /product="AEL172Wp"
                     /protein_id="NP_984689.1"
                     /db_xref="GeneID:4620874"
                     /translation="MLPPSLFPVPEQAQCDQRACVSFYQRITRCLSIQGLMGKSEQKL
                     EVHSRMDYRRKVSAPEAVTYGASTESIREFSTSSDLLPQNGPVTQGLSTSAEKAKPER
                     TPSSNYSSVLPSLSRVGFQSIFQNNETRRSRQSVLSESFNGAQISQNDDRLAGSYNYN
                     QLLEQSERGTGSYGKCSSSLSLELHVPKTRMPHGSNSSQQNGLSRGKNSLKQAAIKLF
                     RVRSTSSKYQDVDVQPTPWMKFLHSQHGKHQKAAYVTSNVVESNKSVYSQGQSQPSNL
                     SDKSVRLFHEVNFDNNDVQLLHDLIKNMPSFESNFHQFTIHEQDALLSNIWGVYCNLI
                     LSVFKNHRLWQLPAKIEDINRVLKFYIKLKQDGKTACTGSKFLNEIEQCLRASFYVLE
                     TQVLYDHAEGIEMQSALKRLCAVWELFYQHAYGDSMAVLAPLDSNFQRYPQYWCATQD
                     SGHLTLAQLLFQMFRDAIVVPYYQTFMNDGDNIAASFQKHFTDEDEKNCVTQTEKLLL
                     LQCFGLLSSLNSRDVNQQIVQGLLAGVRMSI"
     gene            complement(<315831..>317069)
                     /locus_tag="AGOS_AEL171C"
                     /old_locus_tag="AEL171C"
                     /db_xref="GeneID:4620875"
     mRNA            complement(<315831..>317069)
                     /locus_tag="AGOS_AEL171C"
                     /old_locus_tag="AEL171C"
                     /product="AEL171Cp"
                     /transcript_id="NM_210043.1"
                     /db_xref="GeneID:4620875"
     CDS             complement(315831..317069)
                     /locus_tag="AGOS_AEL171C"
                     /old_locus_tag="AEL171C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL059W (YHC3)"
                     /codon_start=1
                     /product="AEL171Cp"
                     /protein_id="NP_984690.1"
                     /db_xref="GeneID:4620875"
                     /translation="MDRRKLIFGKFWLFGLLNNVLYVVILAAAVDIVGPTLPKSLILL
                     ADILPSFLVKLVAPFFIDRVEYHYRIWSLIALSGFGMLLVASGRLGVCIVGIVLASIS
                     SGVGEITFLQLTHYFSHVALNGWSSGTGGAGLAGSFLYMLLTSILKIPVSRSLLLFSI
                     LPIGFLLYFTLQVERTAYEPLASGHFMEAEDNSGSVISLEAPRTTVDNARDCASRPRL
                     AALRERIEVTMRRLKVLVVPYMIPLSTVYLFEYLINQGVSPTLMFPIHEGYGTSQLFH
                     KYRDIYVAYGTLYQLGVFISRSSGSWVRIRGLYLLSVLQFLNLVILLIQSWYYVIHSV
                     WVIMAIVLYEGLLGGASYVNSFLNISEDVPLAEREFSLGAVSISDSSGTLVAAFIGIL
                     LEPVLCSHQVKTGRPWCQLE"
     gene            complement(<317257..>318633)
                     /locus_tag="AGOS_AEL170C"
                     /old_locus_tag="AEL170C"
                     /db_xref="GeneID:4620876"
     mRNA            complement(<317257..>318633)
                     /locus_tag="AGOS_AEL170C"
                     /old_locus_tag="AEL170C"
                     /product="AEL170Cp"
                     /transcript_id="NM_210044.1"
                     /db_xref="GeneID:4620876"
     CDS             complement(317257..318633)
                     /locus_tag="AGOS_AEL170C"
                     /old_locus_tag="AEL170C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL060W (BNA3)"
                     /codon_start=1
                     /product="AEL170Cp"
                     /protein_id="NP_984691.1"
                     /db_xref="GeneID:4620876"
                     /translation="MNISEAGRLLGHSRLRHIPGRRYNSMGKIRGNNYFAETTRDVWT
                     IINEAAAKAAAESVANGGSGAGKGMKVLNLGQGFFSYSPPDFAIAGAQRALENAMNNQ
                     YAPTRGRPALVEALLKLYRPMYGDLAAENVQVTTGANEGIFACLAGLVNPGDEVIVFE
                     PFFDQYIPNIELLGGVVRYVPIRPPAELSKRVTEGTEWVIDYDMLRQTINEKTKAVII
                     NSPHNPIGKVFTREELLKLGNICVEKGIYIISDEVYEHLYFTDEFTRIATLSEEISQH
                     TLTVGSAGKSFAATGWRIGWVISRNKELLALASKAHVRICFSSPAPLQEACAVAIEHA
                     LKTTYYADTRAAYQKKYERFQKPFDDLGLPYTRAEGSYFLLVDFSRLPLPADYHFPEE
                     LADKGRDFRVAYWLINELGLVAIPCSSFFIPDHREASENMLRFAICKDDTYLDEAIER
                     LMVLKNYL"
     gene            <318805..>319312
                     /locus_tag="AGOS_AEL169W"
                     /old_locus_tag="AEL169W"
                     /db_xref="GeneID:4620877"
     mRNA            join(<318805..318814,318911..>319312)
                     /locus_tag="AGOS_AEL169W"
                     /old_locus_tag="AEL169W"
                     /product="AEL169Wp"
                     /note="5'UTR intron"
                     /transcript_id="NM_210045.2"
                     /db_xref="GeneID:4620877"
     CDS             318914..319312
                     /locus_tag="AGOS_AEL169W"
                     /old_locus_tag="AEL169W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR269C (FMP21); 1-intron"
                     /codon_start=1
                     /product="AEL169Wp"
                     /protein_id="NP_984692.1"
                     /db_xref="GeneID:4620877"
                     /translation="MFRSVLRHSYAVPTVNYTWSSRSLIRFFTSDEKAAPPSLPREEQ
                     KEFERLQKIAQSQAAIDEYNRQFENDHTKESANSPILKTEIGSFSPEFSKTLPEFEGD
                     KNPETGEIGGPRQDPLRYGDYSYNGRVTDF"
     gene            complement(<319346..>321367)
                     /locus_tag="AGOS_AEL168C"
                     /old_locus_tag="AEL168C"
                     /db_xref="GeneID:4620878"
     mRNA            complement(<319346..>321367)
                     /locus_tag="AGOS_AEL168C"
                     /old_locus_tag="AEL168C"
                     /product="AEL168Cp"
                     /transcript_id="NM_210046.2"
                     /db_xref="GeneID:4620878"
     CDS             complement(319346..321367)
                     /locus_tag="AGOS_AEL168C"
                     /old_locus_tag="AEL168C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL061W (NUP82)"
                     /codon_start=1
                     /product="AEL168Cp"
                     /protein_id="NP_984693.2"
                     /db_xref="GeneID:4620878"
                     /translation="MTGELHPIFNADALGASHRLHAHTHGDGTKIVAYYNKHLRLGRF
                     TEQTYKSWHAEVDAKASSILNGSGSLLAFYGDHIIEVVDREGKKITLTVNGGIKQVLW
                     HPLAYLDSCLVVLTGQETIEIYELNEPRYEKPTLVLNEPTSQLGISSRVIDITNIAFA
                     PDGLSLYLFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDTPDDAK
                     VATIEYLEFVTQLLQAIEKNGSDGELVIPEHRRRTISQGPYNIHGFPEKLYSAVGTKL
                     TVVPLGESEAHLLLLSFDDSTNILLFPSTEVLMSWTKDLKNAYTLMLVEEFTATGTAF
                     ATCDGVAVLGIDSAQRVEIPYLQALEDCIRDCNLAALQDINFTSSICKIPGKFHSVAR
                     FNAPGNKGIILVGDHHAKIVPSTEAAKSDTETELDSQPGKEPTYTVCFPNSLEEILNT
                     NKELQRRKHQPLPLVPPALKNIPLNSDLNEQHLATLTNISKEVMDRIILSQSAGLLMH
                     NRLSLQQYELHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRLKQRLCMLQST
                     LNRINSSHKFSDLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELAFLKNELESLP
                     EHRQHDRQEEEPFDFRRLQELLKLDSKIITECTDNLSAAARELERKLCI"
     gene            complement(<321588..>321893)
                     /locus_tag="AGOS_AEL167C"
                     /old_locus_tag="AEL167C"
                     /db_xref="GeneID:4620879"
     mRNA            complement(<321588..>321893)
                     /locus_tag="AGOS_AEL167C"
                     /old_locus_tag="AEL167C"
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /transcript_id="NM_210047.1"
                     /db_xref="GeneID:4620879"
     CDS             complement(321588..321893)
                     /locus_tag="AGOS_AEL167C"
                     /old_locus_tag="AEL167C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR268W (MRPL37)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /protein_id="NP_984694.1"
                     /db_xref="GeneID:4620879"
                     /translation="MLSLRSSFRRLFSVSCRVYDQQAQKAVSSCPAGTPLNLLIKKGG
                     KEPLALEDSDYPEWLWKVLDPEAQAAKLAEDPIKARKKALRRMNREHIKQQNFLAKM"
     gene            complement(<322078..>324498)
                     /locus_tag="AGOS_AEL166C"
                     /old_locus_tag="AEL166C"
                     /db_xref="GeneID:4620880"
     mRNA            complement(<322078..>324498)
                     /locus_tag="AGOS_AEL166C"
                     /old_locus_tag="AEL166C"
                     /product="AEL166Cp"
                     /transcript_id="NM_210048.2"
                     /db_xref="GeneID:4620880"
     CDS             complement(322078..324498)
                     /locus_tag="AGOS_AEL166C"
                     /old_locus_tag="AEL166C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL062W (LAS21)"
                     /codon_start=1
                     /product="AEL166Cp"
                     /protein_id="NP_984695.2"
                     /db_xref="GeneID:4620880"
                     /translation="MRFKEVGLLFCQLLAVLIFAAGFFPQKKVLKGDAQFQYMAETQR
                     ALEPAFDKLVLVVIDALRADFLFQQNVSHFDFVHELLNRGEAWGFTAYSNPPTVTLPR
                     LKGITTGSAPNFLDAILNVAEDDSSSNLKDQDSWISQFAKHGKKIHFFGDDTWLKLFP
                     EEFFQKHDGTNSFFVSDFEEVDTNVTRHLPHELQHKDWDVLILHYLGLDHIGHKGGAA
                     SQFMPPKHREMDAVIRQIYDQVDNRTLLCVMGDHGMNDLGNHGGSSAGETSAGMVFIS
                     KMLSSYPRPAAQDGVSSPVTAAEDYQFFTRIQQVDFVPTIASLFNIPIPKNSLGVFVR
                     EFSSLLGQHATTKIIENYHQLMQLAAKKTAARGNDDIDSMLAEMKDVQATLARTATNY
                     NYAMLFLGVGMLSIVTAATAYCYISSARLNEASVLMIAVTALLGSSVFGSSFVEEEHQ
                     IWWWIIIAVVGYSWATRPSCTPSHLVFLVCARLLRGWNNSGQKFMYDFTVAELLKSHP
                     SIKWLLVCATLAVVALDGFTERPLLSIFNLLAGLLCFVYKTCWANVNGEVSPTYAQTL
                     VTKACSLLFAGGTPWDDKQLLVPLARLFFKVTAAIVCMRIAYNVVFAKRKFLSELFPL
                     FTIVLIMQTASQNIPLFLVFTIMRSSLRNILRVGYPQQRCEMFFVLSLILQNLSFFQF
                     GGTNSIATIDLTNSYNGISENYNIYVVGLLMCIGNMAPAIYWSLAAVVDHQLYSKKSY
                     AQQKLSSMFFYSVNSLLLLVACICMRYHLFIWSVFSPKLCYLLGWNILIHFLTETVLE
                     PFLLMVAG"
     gene            complement(<324648..>325796)
                     /locus_tag="AGOS_AEL165C"
                     /old_locus_tag="AEL165C"
                     /db_xref="GeneID:4620881"
     mRNA            complement(<324648..>325796)
                     /locus_tag="AGOS_AEL165C"
                     /old_locus_tag="AEL165C"
                     /product="AEL165Cp"
                     /transcript_id="NM_210049.1"
                     /db_xref="GeneID:4620881"
     CDS             complement(324648..325796)
                     /locus_tag="AGOS_AEL165C"
                     /old_locus_tag="AEL165C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR267W (REI1)"
                     /codon_start=1
                     /product="AEL165Cp"
                     /protein_id="NP_984696.1"
                     /db_xref="GeneID:4620881"
                     /translation="MSSYTCNSCALAFQSSEDQRMHMKSDWHRYNLKRRVAQLTPIDE
                     NTFKEKVAALATEEQQPPSSKELRRRQREALLEKKKKLLEMARQSMLQNMGDELKVNI
                     ESLVADKLGVAAAPADQEAAPAEVPALSAEEQHEQLMAEKIKNKVEIPPEACLFCPKR
                     THASFEENLEHMQKKHGFYIPEQKYLVDKPGLVKYLSEKIGLGNLCLCCSFQGRSLEA
                     VRAHMLAKSHCRIPYESEDEKLEISEFYDFSSTYAELDAAANADEGEWEDVESDADSE
                     SGDEELPQELIYHDGVELHLPTGVKVGHRTLQRYYRQNLKPERELTEGQGTVIAAETR
                     HFATILDAKQVATQKKVWQTEVKDKKRDSKRAAKFINNQPYYRDQLLQ"
     gene            complement(<326059..>326982)
                     /locus_tag="AGOS_AEL164C"
                     /old_locus_tag="AEL164C"
                     /db_xref="GeneID:4620882"
     mRNA            complement(<326059..>326982)
                     /locus_tag="AGOS_AEL164C"
                     /old_locus_tag="AEL164C"
                     /product="AEL164Cp"
                     /transcript_id="NM_210050.1"
                     /db_xref="GeneID:4620882"
     CDS             complement(326059..326982)
                     /locus_tag="AGOS_AEL164C"
                     /old_locus_tag="AEL164C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR265W (TSC10)"
                     /codon_start=1
                     /product="AEL164Cp"
                     /protein_id="NP_984697.1"
                     /db_xref="GeneID:4620882"
                     /translation="MKYELNGQVVLISGGSQGLGRAFAQKYIEESDSTVVIVSRSEEK
                     LTRAGEAICGGARRLGAGGAGRLLYYACNLGDAAAVGGLFATLADAGLQVTQVLFCAG
                     GAVPGLFAELSSAQLAAGVEMNYGTALHLAHGAVRHGARHLVFFSSAAAVYPFIGYSQ
                     YAPLKAALRALVAVLRQECDGVRVSCVYPGNFASEGYAEENRTKPAITAAIEGSSEAI
                     SCAACCDKIVRGLRSGYDDVTTDFVGWLLLACNMGFNYHSTTYFLWPLGWLLGALVNL
                     LVVPIYMLLCRWDIHKWRTQREETHLAAKTD"
     gene            complement(<327149..>327418)
                     /locus_tag="AGOS_AEL163C"
                     /old_locus_tag="AEL163C"
                     /db_xref="GeneID:4620883"
     mRNA            complement(<327149..>327418)
                     /locus_tag="AGOS_AEL163C"
                     /old_locus_tag="AEL163C"
                     /product="AEL163Cp"
                     /transcript_id="NM_210051.1"
                     /db_xref="GeneID:4620883"
     CDS             complement(327149..327418)
                     /locus_tag="AGOS_AEL163C"
                     /old_locus_tag="AEL163C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL062W-A (COA3)"
                     /codon_start=1
                     /product="AEL163Cp"
                     /protein_id="NP_984698.1"
                     /db_xref="GeneID:4620883"
                     /translation="MLEPSRYQDPRTWKMTPAMIRARRPYIRGNLFGLVTLLGVAGGI
                     YVYTYRALHKDDDFADVPIPPVSEEELRQLRQEYELHKKQRAAER"
     gene            <327583..>328293
                     /locus_tag="AGOS_AEL162W"
                     /old_locus_tag="AEL162W"
                     /db_xref="GeneID:4620884"
     mRNA            <327583..>328293
                     /locus_tag="AGOS_AEL162W"
                     /old_locus_tag="AEL162W"
                     /product="AEL162Wp"
                     /transcript_id="NM_210052.1"
                     /db_xref="GeneID:4620884"
     CDS             327583..328293
                     /locus_tag="AGOS_AEL162W"
                     /old_locus_tag="AEL162W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL063C (MRPL8)"
                     /codon_start=1
                     /product="AEL162Wp"
                     /protein_id="NP_984699.1"
                     /db_xref="GeneID:4620884"
                     /translation="MTAGLVRRLSRSKPHRDSLLRNLASQLFLHGSITSTKPKLKEAQ
                     RYAERIITIAKHAAKKPAIFTPELQSRLHLSGDTAGLVRKLVEEVGPRYAGRAGGCTR
                     LLQLEPRLGDRAPAAVLELVDQPLRGPDGELQRGNLKLWLTVKAAMYAAEQGAAPSPL
                     TVRNLVKLAHGKELEQFLADVADVRRLLLEHQGAADSPEEAERFVGGLRSALEAPAAA
                     PAPPARKRYEFAPRPARN"
     gene            <328508..>329578
                     /locus_tag="AGOS_AEL161W"
                     /old_locus_tag="AEL161W"
                     /db_xref="GeneID:4620885"
     mRNA            <328508..>329578
                     /locus_tag="AGOS_AEL161W"
                     /old_locus_tag="AEL161W"
                     /product="AEL161Wp"
                     /transcript_id="NM_210053.1"
                     /db_xref="GeneID:4620885"
     CDS             328508..329578
                     /locus_tag="AGOS_AEL161W"
                     /old_locus_tag="AEL161W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YGR012W"
                     /codon_start=1
                     /product="AEL161Wp"
                     /protein_id="NP_984700.1"
                     /db_xref="GeneID:4620885"
                     /translation="MHAQLIRKMSAPTLAAGGFPDAIGKTPLIKLQKLSQELGRNIYG
                     KAEFMNPGGSVKDRAALYLVEEAERAGLIDPSRPGTIVEGSAGNTAIGLAHIARSRGY
                     NAVFYMPDTQSREKVNLLRYLGTEVHPVPVCPSTDPLNFNNRARDHAAALDNAVWTNQ
                     FDNEANWKAHYATTGPEILQQMRNAGLEVDAFTCSTGTGGTFSGIARYLAEATERKCK
                     LVVTDPPGSVVYSFVKTGNLEREGSSFTEGVGQGRITKNLEASVDIIDDAVFVPDPES
                     LNMTYRLLDEEGLFLGGTSGLNVAGAVRVARELPPGSNVVTILCDTGHKYADRVFSKK
                     WLQEKKLYDEIPDSLKKYVTLE"
     gene            complement(<329648..>332029)
                     /locus_tag="AGOS_AEL160C"
                     /old_locus_tag="AEL160C"
                     /db_xref="GeneID:4620886"
     mRNA            complement(<329648..>332029)
                     /locus_tag="AGOS_AEL160C"
                     /old_locus_tag="AEL160C"
                     /product="AEL160Cp"
                     /transcript_id="NM_210054.2"
                     /db_xref="GeneID:4620886"
     CDS             complement(329648..332029)
                     /locus_tag="AGOS_AEL160C"
                     /old_locus_tag="AEL160C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR276C (PPS1)"
                     /codon_start=1
                     /product="AEL160Cp"
                     /protein_id="NP_984701.1"
                     /db_xref="GeneID:4620886"
                     /translation="MITSVRKQQKRQKSREQLGELESKKMEGEGVWGSGTIRAGRLAE
                     LAERQAQAALPASERMFPWLHGYVQDSAPRADKFALSVVRSQPLDAATIENSGILRAS
                     MDLHEVLLTVDNTEAERAVDAALEEYGAGVCTARRAELLAACQRYQLLPFLQTDALKQ
                     CRYGSRRLRLGDKGSWRQPGMFRRFDLQPARHVELSSVVVVYCLANMHPDRCCCHDAA
                     TILQWACRFVALNYPERAHLAPEVLILEDPGHVPASLVGTAPMALSSLQKPFPAQLVS
                     RFDVASFNNWERDLLYKERLEISKMSSMSMIEDCVMCGNATDFEVLRLFRSNGAACPS
                     TAAPRKYYSPDNTIVLLKALEYQEKDGVPVLDSVLFNLPPSELHDVQLFVSCTEHTPF
                     PHHDDIRHHLTQMEAPIHIAFPSSGSIGLGTLTLDSITSCVNICHLIYRFSAVHKKLS
                     LLYCSDGYTETSFLLVAYLIFAWDQPLDEVLLRLHTEVERPYFLFPIDIQVLGHLQLL
                     LRDMSPLRHPNRGPELLAVDPDLFSRMFFTKPSQDSLFLKSKGPLPSRILPHLYLGSL
                     EHAHDPNLLRRLGIRNIVSVGETLSWLQSPHSREAAKTEESKQETITDAYVTAPAETA
                     AATSTTASTGSLNLLKRNRSPSAPEIKPLKSSSCKTTVFSKDGFEICHTSNLGDNGAD
                     PMLTQLDQMLSFINRCYEAGEKVLVHCMVGVSRSATVCIAECMRRLNCAVIQAYLFVR
                     VRRLNIIIQPNLMFIYELLKWQELKHPDVLKIDWHIMCRAINELNSNYIKDMI"
     gene            <332422..>332973
                     /locus_tag="AGOS_AEL159W"
                     /old_locus_tag="AEL159W"
                     /db_xref="GeneID:4620887"
     mRNA            <332422..>332973
                     /locus_tag="AGOS_AEL159W"
                     /old_locus_tag="AEL159W"
                     /product="AEL159Wp"
                     /transcript_id="NM_210055.1"
                     /db_xref="GeneID:4620887"
     CDS             332422..332973
                     /locus_tag="AGOS_AEL159W"
                     /old_locus_tag="AEL159W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL065C (DLS1) and YBR278W (DPB3)"
                     /codon_start=1
                     /product="AEL159Wp"
                     /protein_id="NP_984702.1"
                     /db_xref="GeneID:4620887"
                     /translation="MMEDKGKAAMPRLPISKCKRIAKTDPDYIMTTQAAYIATAFATE
                     LFVQAISEDAMAQAQLDGRRAGGRAARLTYNDLARSVAREERYAFLADVIPETKTLAH
                     LVRQNKVRYSAPLAQGQATLPFARRAVEGGESDAASEDEDVEEGELQKDLAEVAKMNQ
                     IVDLDAESSAGEADGDENEPEDD"
     gene            <333130..>334077
                     /locus_tag="AGOS_AEL158W"
                     /old_locus_tag="AEL158W"
                     /db_xref="GeneID:4620888"
     mRNA            <333130..>334077
                     /locus_tag="AGOS_AEL158W"
                     /old_locus_tag="AEL158W"
                     /product="AEL158Wp"
                     /transcript_id="NM_210056.2"
                     /db_xref="GeneID:4620888"
     CDS             333130..334077
                     /locus_tag="AGOS_AEL158W"
                     /old_locus_tag="AEL158W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL066C (MPM1)"
                     /codon_start=1
                     /product="AEL158Wp"
                     /protein_id="NP_984703.2"
                     /db_xref="GeneID:4620888"
                     /translation="MGLFNGDNNDDEVKKFNADALDSRLSRQLSQLDGVVSELWRDAV
                     LEPSSFVDNVVSHAMGKLPSDRLVDDLWLNATDALGGLLTGVGLPGGLGHPFKVREML
                     DERHGEKGLYSYKMPTDSQFMKCQEVRGLSVWDTRGWWRCLFPKAVVEKSLPAGQEAG
                     VLTREQVEQDREHRHGLFFPEYTGYLSWRSHMLSLARQRREQEEKNRAARERKALPAV
                     GTNAPEDVMSWTQQVAERTPASAANVVGTSKYTTYSYTDRGHEHITESKTYYDDGTVA
                     INSEKKITPVDGTEPVYETINQVVNRDDESSKDGWFWRK"
     gene            <334437..>335672
                     /locus_tag="AGOS_AEL157W"
                     /old_locus_tag="AEL157W"
                     /db_xref="GeneID:4620889"
     mRNA            <334437..>335672
                     /locus_tag="AGOS_AEL157W"
                     /old_locus_tag="AEL157W"
                     /product="AEL157Wp"
                     /transcript_id="NM_210057.2"
                     /db_xref="GeneID:4620889"
     CDS             334437..335672
                     /locus_tag="AGOS_AEL157W"
                     /old_locus_tag="AEL157W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR279W (PAF1)"
                     /codon_start=1
                     /product="AEL157Wp"
                     /protein_id="NP_984704.2"
                     /db_xref="GeneID:4620889"
                     /translation="MSSKKQDYIAKVSYRNSLPPPPLPPKLLKYRYPDNEAVESPQLI
                     TSLYTKTNVTPLIQLDKELGMPVDLLRIPGVLNQQDTKNLYGYDSVKLVPEDRILLRD
                     PRVDRLTKTDLSKVTFLRRTEYVSAATTAKSERKRPLDATAEANEILTPSRIVQKVES
                     TFDNVVTDLSKIKHPIKKNVHAVKTWSLLPDTASMDQAFFAVKMVGSAALDNKEKSNL
                     DMSTALFRPVELEEDEWVSLYTTEPSSSKLLNDELEQQLDELSESANVYKFRRFKDYD
                     MKQISSPTNSKFLSELALRFNNEKGVVYYKPLRSRLELRRRRINDVIKPLVRENNWDQ
                     INLTLRKPTTQETKFRDKVRMRFDPIDFPNVDDDEDEEMEDVSPEHMVAEADASAEEQ
                     RPDASDDSLKATEEQDAPM"
     gene            <336243..>337148
                     /locus_tag="AGOS_AEL156W"
                     /old_locus_tag="AEL156W"
                     /db_xref="GeneID:4620890"
     mRNA            <336243..>337148
                     /locus_tag="AGOS_AEL156W"
                     /old_locus_tag="AEL156W"
                     /product="AEL156Wp"
                     /transcript_id="NM_210058.1"
                     /db_xref="GeneID:4620890"
     CDS             336243..337148
                     /locus_tag="AGOS_AEL156W"
                     /old_locus_tag="AEL156W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL068C"
                     /codon_start=1
                     /product="AEL156Wp"
                     /protein_id="NP_984705.1"
                     /db_xref="GeneID:4620890"
                     /translation="MGFKVNAELRSCGGRLLKLSHVSDACKSTMDVNVYLPVQYYKKT
                     ERAIPTIYYLSGLTCTPQNASEKAFWQAQADKYGFAVVFPDTSPRGVEIPKDPEDSWD
                     FGEGAGFYVNATMEPFARYYNMYDYIHNELPGLLAKHFSAGPQNAKVDFLENIGITGH
                     SMGGFGALSGYLKNYRNAKWRFKSCSAFAPIVNPSVVPWGQKAFRGYLGEDKALWEQY
                     DPCCLVKKVENAGHDTILIHVGTSDPFLEKHLKPELLAEAIKGTSWEGKVSINLVDGF
                     DHSYYFVSTFVPEHAKYHAEKLGLV"
     gene            complement(<337207..>339003)
                     /locus_tag="AGOS_AEL155C"
                     /old_locus_tag="AEL155C"
                     /db_xref="GeneID:4620891"
     mRNA            complement(<337207..>339003)
                     /locus_tag="AGOS_AEL155C"
                     /old_locus_tag="AEL155C"
                     /product="AEL155Cp"
                     /transcript_id="NM_210059.1"
                     /db_xref="GeneID:4620891"
     CDS             complement(337207..339003)
                     /locus_tag="AGOS_AEL155C"
                     /old_locus_tag="AEL155C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR280C (SAF1)"
                     /codon_start=1
                     /product="AEL155Cp"
                     /protein_id="NP_984706.1"
                     /db_xref="GeneID:4620891"
                     /translation="MENKSNQDDPRSIDYGLPPDIVLATLPYLEPRDIKNLSLTNKYF
                     YKLLDYGGSNTLWHELYRKAFGYTQTNEEPFSSNGAEGLSTCSETVLVTAFPDMSWME
                     RYKARERCTRLYTWGSQQHGRLGYTLGCNPMVSDDVFDGRWGHQRVGISKPTLVPWFT
                     EACRTDNGEPVPGLPDVAEIDQDDRTIVQMSAGGFSFQLLTKSGKLYFTGITYTGGHP
                     GPGPKNERDYNYFRNIVLEIDQNRIPDLFARNGMYRHRVHNAWSEPVPHDDLYRALNK
                     MKKRCLQHIPGNRHVQRLLARDSLSFYHEESAFAMKVDPSLFDKVKFVSVTSGRSHIL
                     ALDDNNNLYSWDGPDIDYGVRIVFEGLPVRKTNPLLKIGSGWDFNCVYIYAVGLVVWS
                     SRSAVKKGDTFAKANYNVIPDTADISGTNRISDYACCANNVVFYITNNGRKLWIYSHG
                     VSKTVDLPFDGRLTKIEASCMTLVLCTENSTYTLKVNNGDIVEDSFMKMNLEQGQKFI
                     AVSAGDYHNLALTDKGELYSWGLESDICGCLGQGDPDEAVDTRQIATFESARSIRVLQ
                     PAKVELPANSVCVAITAGGWHSAALIMQNQST"
     gene            complement(<339187..>341853)
                     /locus_tag="AGOS_AEL154C"
                     /old_locus_tag="AEL154C"
                     /db_xref="GeneID:4620892"
     mRNA            complement(<339187..>341853)
                     /locus_tag="AGOS_AEL154C"
                     /old_locus_tag="AEL154C"
                     /product="AEL154Cp"
                     /transcript_id="NM_210060.1"
                     /db_xref="GeneID:4620892"
     CDS             complement(339187..341853)
                     /locus_tag="AGOS_AEL154C"
                     /old_locus_tag="AEL154C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR281C (DUG2)"
                     /codon_start=1
                     /product="AEL154Cp"
                     /protein_id="NP_984707.1"
                     /db_xref="GeneID:4620892"
                     /translation="MANEPPLIHLWNHPHSIISTIAFPHRKLLFAGTQDSKILCFDLC
                     TYNLVKTIHLGEDTDNFTKTSVLGLSKSQDEKLLFSAGTDSLVRVWSIGTVPQDDSIE
                     AKELVTIYSLMDIGDIFSLAYLDAEQTLVFGCQNASMLYVDNFMARKIPTRSAIDFDK
                     LPHRRYNKFFDSTGPGGGGGGGGGGGGGTGGAGGGVSNLPSVRSASFISPEGNNLILQ
                     VPSENIITYAHNGFIYSICRINGRGTWLSTHFEQYATDPNVSFFVSSAGDGISKIWAL
                     LPLNSQERRVGHKVQLLTEFDNEESVFCQFVEYPFLYCGLSGGIIKIWDLNINQLVTS
                     LKTPYAEDIMSITVYKDNVFATHKQGITRFHQGNVNFWNAHQGLVLSSEILRKSCTSN
                     RIDRMVTGGNDGSLALWNINEWLNGTASPGGSAPTEEHSLPSGERRNSWTEYQQIQLD
                     NDHMIATLREFISYQTVSQLPEPQNIIDSRRCANFLQNLFTKLGANHCGLIPVSTGSN
                     PVVLAQFKGNAAAPKRILWYGHYDVISADHPSQWDNDPFTLTCENGYLKGRGVSDNKG
                     PLLAAIFSVAELFQKGYLNNDIIFLVEGEEENGSRGFREILLASEGLLNQRWDWILFS
                     NSYWLDQKVPCLNYGLRGVINAEITISSDEPDRHSGVDGGVYREPSADLICITSKLQA
                     DDGTIRIPHFHDAVQPVTEQERQDFRDIISRAEIDNRTTVEHLVAKWTQPSISFTKFN
                     TSGPGNATVISQRASLVVSIRLVPPQDVRTIKQLLIDYITQSFAALRSRNHLHISILN
                     EAEPWLGDPHNTCYEILREELHDTWGIDPLFIREGGSIPCIRFLERQLNAPAVQIPCG
                     QSTDNAHLDNENLRIKNWYNMRAILTKVFNRL"
     gene            <342472..>344175
                     /locus_tag="AGOS_AEL153W"
                     /old_locus_tag="AEL153W"
                     /db_xref="GeneID:4620893"
     mRNA            <342472..>344175
                     /locus_tag="AGOS_AEL153W"
                     /old_locus_tag="AEL153W"
                     /product="AEL153Wp"
                     /transcript_id="NM_210061.1"
                     /db_xref="GeneID:4620893"
     CDS             342472..344175
                     /locus_tag="AGOS_AEL153W"
                     /old_locus_tag="AEL153W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL069C (UTP18)"
                     /codon_start=1
                     /product="AEL153Wp"
                     /protein_id="NP_984708.1"
                     /db_xref="GeneID:4620893"
                     /translation="MVAAEAVQELPPDEEELALAKLVFGDTADFHEALRNADLNYVSS
                     DEDVYGQESSSDDEEGTEIGHLNDDQLFFVDEGADTEGGADGEPEAMEVDQVSEESDS
                     GEESGSSAAWSDSDDEHLNVTIGQTNMSKKLRTTYAEKELSSRQYVQRLRQQFEKIYP
                     RPLWVDEHESESGYESSANEDSEQLVDGDVSALAKILHNTYSYKAQSSSLLSPKTLDI
                     VRLKDANVSHPSRSAIQSLSFHPLKPLLLTGGYDRTLRIYHIDGKHNHMVSSVYLKGT
                     PVQTCKFYVSPSHSEQMVLTGGRRRYMHTWDLMNTTAHVANISKISRMYGHEETQRSF
                     EKFKLAHLHTQQGVHGIILLQGNNGWVNILHAVSGIWLMGCKIEGVLVDFCVDYQAQS
                     QGKFRTILIATNTYGQVWEFDLTDGGSVMKKWNDDGGVAITTIQVGGGTSTSHILSSD
                     KVRQNRWLALGSESGFVNVYDRQSSSAKPVATLSQLTTTISSLEFSPDGQVLCIASRA
                     AKDALRLVHLPTCSVFSNWPTSGTPLGKVTSVAFSTHGEMLAVGNEQGKVRLWRLNHY
                     Q"
     gene            344513..344570
                     /locus_tag="AGOS_AgSNR189"
                     /old_locus_tag="AgSNR189"
                     /db_xref="GeneID:4620894"
     ncRNA           344513..344570
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR189"
                     /old_locus_tag="AgSNR189"
                     /product="AgSNR189"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR189; start and end coordinates are
                     approximate; similarity is partial. In synteny."
                     /transcript_id="NR_149366.1"
                     /db_xref="GeneID:4620894"
     gene            <344968..>345759
                     /locus_tag="AGOS_AEL152W"
                     /old_locus_tag="AEL152W"
                     /db_xref="GeneID:4620895"
     mRNA            join(<344968..344977,345353..>345759)
                     /locus_tag="AGOS_AEL152W"
                     /old_locus_tag="AEL152W"
                     /product="40S ribosomal protein S14"
                     /transcript_id="NM_210062.1"
                     /db_xref="GeneID:4620895"
     CDS             join(344968..344977,345353..345759)
                     /locus_tag="AGOS_AEL152W"
                     /old_locus_tag="AEL152W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL191W (RPS14B) and YCR031C (RPS14A); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S14"
                     /protein_id="NP_984709.1"
                     /db_xref="GeneID:4620895"
                     /translation="MAKELAQTRDASQVFGVARIYASFNDTFVHVTDLSGRETIARVT
                     GGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHVKIRATGGTKTKTPGPGGQAA
                     LRALARSGLRIGRIEDVTPIPSDSTRKKGGRRGRRL"
     gene            complement(<345944..>346336)
                     /locus_tag="AGOS_AEL151C"
                     /old_locus_tag="AEL151C"
                     /db_xref="GeneID:4620896"
     mRNA            complement(<345944..>346336)
                     /locus_tag="AGOS_AEL151C"
                     /old_locus_tag="AEL151C"
                     /product="40S ribosomal protein S22"
                     /transcript_id="NM_210063.1"
                     /db_xref="GeneID:4620896"
     CDS             complement(345944..346336)
                     /locus_tag="AGOS_AEL151C"
                     /old_locus_tag="AEL151C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL190C (RPS22A)"
                     /codon_start=1
                     /product="40S ribosomal protein S22"
                     /protein_id="NP_984710.1"
                     /db_xref="GeneID:4620896"
                     /translation="MTRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKH
                     GYIGEFEYIDDHRSGKIVVQLTGRLNKCGVISPRFNVKINDVEKWTANLLPARQFGYV
                     ILTTSAGIMDHEEAHRKHVAGKILGFVY"
     gene            <346738..>347042
                     /locus_tag="AGOS_AEL150W"
                     /old_locus_tag="AEL150W"
                     /db_xref="GeneID:4620897"
     mRNA            join(<346738..346743,346893..>347042)
                     /locus_tag="AGOS_AEL150W"
                     /old_locus_tag="AEL150W"
                     /product="60S ribosomal protein L39"
                     /transcript_id="NM_210064.1"
                     /db_xref="GeneID:4620897"
     CDS             join(346738..346743,346893..347042)
                     /locus_tag="AGOS_AEL150W"
                     /old_locus_tag="AEL150W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL189W (RPL39); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L39"
                     /protein_id="NP_984711.1"
                     /db_xref="GeneID:4620897"
                     /translation="MAAKKSFKIKQKLAKAKNQNRPLPQWFRLKTNNTIRYNAKRRHW
                     RRTKMGI"
     gene            complement(347175..347264)
                     /locus_tag="AGOS_AgSNR65"
                     /old_locus_tag="AgSNR65"
                     /db_xref="GeneID:4620898"
     ncRNA           complement(347175..347264)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR65"
                     /old_locus_tag="AgSNR65"
                     /product="AgSNR65"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR65; start and end coordinates are
                     approximate; similarity is partial. In synteny."
                     /transcript_id="NR_149410.1"
                     /db_xref="GeneID:4620898"
     gene            complement(<347575..>349758)
                     /locus_tag="AGOS_AEL149C"
                     /old_locus_tag="AEL149C"
                     /db_xref="GeneID:4620899"
     mRNA            complement(<347575..>349758)
                     /locus_tag="AGOS_AEL149C"
                     /old_locus_tag="AEL149C"
                     /product="AEL149Cp"
                     /transcript_id="NM_210065.1"
                     /db_xref="GeneID:4620899"
     CDS             complement(347575..349758)
                     /locus_tag="AGOS_AEL149C"
                     /old_locus_tag="AEL149C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL187C (SWE1)"
                     /codon_start=1
                     /product="AEL149Cp"
                     /protein_id="NP_984712.1"
                     /db_xref="GeneID:4620899"
                     /translation="MTLRHDSMAALRESPFLNRKHTLSPALRFNCMVHEEEELSEADL
                     ESEGDSDRTQPATPSNNLRFYSSRQAAGLCRSVGTLNLSLENASRKLAPLTTSRDLPV
                     RVREEDNGGLEFLSGTAMCQGDGDKEFHRGDNLWRPFPPRHDKNLKRSASKCEMKPPL
                     ISDRSQSRDNDSVEDENARNMAYSPLGNKKKMRKFPECQLFKDVKPDQSAFQQKGLMS
                     KMRSNLLPQKLIIPDTPVKKSPHSSIMESPMDCSVYGSSSVPHDTQPFKNFPLFKPGT
                     PPIESSPTYQHRAQRLDSKNDMPAQRMKRRSKVIKNTDLSNMLQQFTDDLFGSGDEEP
                     VFNSSPLRTPRKRSPQPDRLRPPVTTTRQQGKRRLVGTSHASQSARARNPDEHLGANF
                     SNVTLLGRGQFSTVYQVTFPETSAKYAVKSMAPKKHYSRSRIIQEIQLLSEISQETSD
                     AEGREYVVQFISSWEYQGTYYAMTELCENGNLDQFLQEQLVARSKRLEDWRIWKIIVE
                     VCLGLRFLHETCSIVHLDLKPANIMITFEGNLKLGDFGMATKLPLTDKAFENEGDREY
                     IAPEIISDGIYDFRADIFSLGLMIVEIAANVVLPDNGNAWHKLRSGDLSDAGRLSSTE
                     IYTTSIFSSTDINSTNITEVSRPCSYNAGSGRIKHIPAWVPRFLIDNDSLEKLVIWMI
                     EPDYRKRPTASNLLQAEECQYVELTRKAGAIIQEDDFGPKPEFFS"
     gene            <350314..>352035
                     /locus_tag="AGOS_AEL148W"
                     /old_locus_tag="AEL148W"
                     /db_xref="GeneID:4620900"
     mRNA            <350314..>352035
                     /locus_tag="AGOS_AEL148W"
                     /old_locus_tag="AEL148W"
                     /product="AEL148Wp"
                     /transcript_id="NM_210066.2"
                     /db_xref="GeneID:4620900"
     CDS             350314..352035
                     /locus_tag="AGOS_AEL148W"
                     /old_locus_tag="AEL148W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL186W (MNN5)"
                     /codon_start=1
                     /product="AEL148Wp"
                     /protein_id="NP_984713.2"
                     /db_xref="GeneID:4620900"
                     /translation="MIKLRRKLIALLVGGFMLALLSSLPRQKSPIASAAHSPAQEWFT
                     RGSQDINDPLEFYKMLFERLRKDAAQIKTAGSYVTQDADCQIRDLEDKLPESSHLGSY
                     DGLAKCFRLERDHLEGLRQGHSEFLRTIHGELAISAKSALFKTLYPLPAGIVTVGGGR
                     YSILAMVMIRALRKRGTTLPVEVFLTDDDADDEAFCSYIEHFNAKCVLFSDRLPKSVL
                     ASQKLSGFELKAVALLLSSYQQVIFIDADNVPLKPLDDVFKSKPLAEYGLVLWPDIWK
                     RVTAPAFYDIAGIPVDFKRRVRFSADDVSPPSRYTKPGEVDESFNRAHVPLHDFAGTM
                     PELSSESGQLLIDKARHMDTLLLILYYNVHGKHLFYRLSTQGTSGEGDKETFAMAAQA
                     LGKPYYQVKTKLRFQGYHTPSQYVGAALLQHDFVQDHEQWLRAREEVARRPSELAAYN
                     PAYNVDEHFYNTLMRPEKPLDVMFVHASYHKLVPIDLFREKVYIGEDGKQFRSFPDLA
                     AMDNFDIELFAIQILNEAICSATTKIEFKYNRDKIKSPEEFEDMCTYVRDRMRMLLDT
                     RDTRTHS"
     gene            <352298..>354760
                     /locus_tag="AGOS_AEL147W"
                     /old_locus_tag="AEL147W"
                     /db_xref="GeneID:4620901"
     mRNA            <352298..>354760
                     /locus_tag="AGOS_AEL147W"
                     /old_locus_tag="AEL147W"
                     /product="AEL147Wp"
                     /transcript_id="NM_210067.1"
                     /db_xref="GeneID:4620901"
     CDS             352298..354760
                     /locus_tag="AGOS_AEL147W"
                     /old_locus_tag="AEL147W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR030C (SYP1)"
                     /codon_start=1
                     /product="AEL147Wp"
                     /protein_id="NP_984714.1"
                     /db_xref="GeneID:4620901"
                     /translation="MQEERVKYANSVLTSRTPFEVAEIVRIRLSQAKIINGEFYTLFK
                     ELSELKKSYVQQLRKIIIVNEDLDKLVYNGMVQRQVLTAPEMAGMDFDWLGELRGVWQ
                     QVIRGLKADMHAQVEEYKGLDRDVVGVLRSHVETDEHWREVRKLHPKLSRMAAEMEVS
                     RSTPEKVAAAERQWVEQAPRLLEVMEATDEKRLLVLKNCLLQYQNLLDDSLHANLDES
                     EKVMERLLEFTPDREIDRFASAVVNYDFRFEPMQAAEADGEGAAAATPVEHRLRHVSG
                     SSMLRNLLSNDTFSDASNNVSLVPSRKSKLKSKVGSIFGRRRHRRAPQLQSESIPESD
                     TSSLHSHGTSSYHDSELYSKSHAVSSEAAAPRPAANSNNAPPAEKKPELEATRSSFSI
                     NQAPLVPQPRSKKTPEIIGASNVQAITEKSGPADTAAPAQNFIRQRSTWDGVQQDPTA
                     LHDETNIVSSLAPARRSSAAGQLGAHFWSPVPASQEGQNVPSLEGGRRDIHSMLFTNL
                     SKADIDNSVTRHESTNSQTSEMRQLEPQQTGSSLLLMNITGQSLFQHTELTSLGLNAS
                     IGEVINAKFKDGILSSSQLIGEIALNYISSDSTGNSLPLDIILKIESAEQFDKIIVNH
                     TILERTADENNIIYKLAPQFIFGKTLGALKYSLKSPLVPIAIHPVWRFEQTQASVMLT
                     LKIFSGLPPAVQELVLEDLIVSVAIDNTVAKSALSKPQGSFSKEKRRITWRFKEPLVL
                     RRDNEERLVARFLTEGVAQESQKGVQAKFTIRGLQLGGGLVLRSQEVTLEDPFGSETA
                     DIWNDVTTSRTLVAGAYYGLST"
     gene            complement(<354986..>355915)
                     /locus_tag="AGOS_AEL146C"
                     /old_locus_tag="AEL146C"
                     /db_xref="GeneID:4620902"
     mRNA            complement(<354986..>355915)
                     /locus_tag="AGOS_AEL146C"
                     /old_locus_tag="AEL146C"
                     /product="AEL146Cp"
                     /transcript_id="NM_210068.1"
                     /db_xref="GeneID:4620902"
     CDS             complement(354986..355915)
                     /locus_tag="AGOS_AEL146C"
                     /old_locus_tag="AEL146C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL185C"
                     /codon_start=1
                     /product="AEL146Cp"
                     /protein_id="NP_984715.1"
                     /db_xref="GeneID:4620902"
                     /translation="MSFNSFRRRGHTASKSVIKASLSQISEAQRTLEDTCCLVEYHGI
                     DEEDVQVLNNPASESKDDPSAISEDEVAKQPSYGGETNQQCTEVRSEEYAVLSDSTEE
                     MEELERCYRGGSEVVLEPQSTSERIDDWCLTHVSCGTSTVLEAASSRVRDIARSWGVE
                     GDERATLSAGTTRPPAVRPLPRVSSYESRKLAQLTPAELAQLTKFVKELLPYLIQGRA
                     SVRTPRCEAKYGNVPTLFPDRGNLLRCSLDANNVSKMANLYEQMRQLLLDAPSNGNYE
                     ALDDISLSSMHSSLPVQSWYGWHMVPRVRDTEF"
     gene            <356465..>356944
                     /locus_tag="AGOS_AEL145W"
                     /old_locus_tag="AEL145W"
                     /db_xref="GeneID:4620903"
     mRNA            join(<356465..356700,356748..356836,356886..>356944)
                     /locus_tag="AGOS_AEL145W"
                     /old_locus_tag="AEL145W"
                     /product="AEL145Wp"
                     /transcript_id="NM_210069.2"
                     /db_xref="GeneID:4620903"
     CDS             join(356465..356700,356748..356836,356886..356944)
                     /locus_tag="AGOS_AEL145W"
                     /old_locus_tag="AEL145W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR028C-A (RIM1); 2-intron"
                     /codon_start=1
                     /product="AEL145Wp"
                     /protein_id="NP_984716.2"
                     /db_xref="GeneID:4620903"
                     /translation="MLRQVRQFHASSRALDFSKMMIVGRIGSDISQFVSQNDKKYAKY
                     SIASQPRRDGPTNWYTITVFNEPQMNFLTQYVRKGALVYVEADAANNVFEREDGSKSY
                     SLSLIQREINLIRNGKPAEQAEQEE"
     gene            <357311..>357652
                     /locus_tag="AGOS_AEL144W"
                     /old_locus_tag="AEL144W"
                     /db_xref="GeneID:4620904"
     mRNA            <357311..>357652
                     /locus_tag="AGOS_AEL144W"
                     /old_locus_tag="AEL144W"
                     /product="AEL144Wp"
                     /transcript_id="NM_210070.1"
                     /db_xref="GeneID:4620904"
     CDS             357311..357652
                     /locus_tag="AGOS_AEL144W"
                     /old_locus_tag="AEL144W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL184W (GON7)"
                     /codon_start=1
                     /product="AEL144Wp"
                     /protein_id="NP_984717.1"
                     /db_xref="GeneID:4620904"
                     /translation="MQPPTATYCTPEGDSHAFTVVPDAPRYRTTDGTTSGPSAYVLQA
                     GQIDRDRPSPPKLDAQGEPTALSRLRMHLTGLQDDINSFLTAEMQRAKNKKQKIDDTQ
                     EQRATGGSTAA"
     gene            <357761..>359320
                     /locus_tag="AGOS_AEL143W"
                     /old_locus_tag="AEL143W"
                     /db_xref="GeneID:4620905"
     mRNA            <357761..>359320
                     /locus_tag="AGOS_AEL143W"
                     /old_locus_tag="AEL143W"
                     /product="AEL143Wp"
                     /transcript_id="NM_210072.2"
                     /db_xref="GeneID:4620905"
     CDS             357761..359320
                     /locus_tag="AGOS_AEL143W"
                     /old_locus_tag="AEL143W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR028C (FEN2)"
                     /codon_start=1
                     /product="AEL143Wp"
                     /protein_id="NP_984718.2"
                     /db_xref="GeneID:4620905"
                     /translation="MPLRHEGVATKMAGRRESAPSSHEDRRVTKRMSDALSLAERDTP
                     PKDHQKGEPAVNERILLYKIDLFVLSFVCLQYWINYVDRVSFGNAYVSGMDKELGLHG
                     NQFNVINTCFTVGYILGMLPNNLLLLVLPPRIWLSVCTLGWGLLTLAMYRATSFEYCC
                     AVRFFQAVFESCTFSGTHLILGSWYKENELALRSAVFTASGLIGSMCSGMMQVAIFDA
                     MDGRRGISGWRWLFIIDFLVTVPIAIYGFIFFPGTPDHNRADTSALVFSKAELRYARA
                     RLPARDERARLDLSVFHRVLGRWHWWLFSLLWVAGGENISFASNSTFSLWLANRGYSL
                     AQRNRYPMGIFAVGIAATFASAFYMDRCRCSQHWHVALAITAVMCIVAVLIRSNPLSP
                     AIMFAAQYLGGVAYAGQAIFFSWANIVCQSDLQERAIVLASMNMFSGAVNAWWSLLFY
                     SATTVPHFRNGCYALLGTSIVSALISVIVRLLQLREQRRKLADLPANLNYVGADTSLE
                     DPLATDSHRSP"
     gene            <359614..>360852
                     /locus_tag="AGOS_AEL142W"
                     /old_locus_tag="AEL142W"
                     /db_xref="GeneID:4620906"
     mRNA            <359614..>360852
                     /locus_tag="AGOS_AEL142W"
                     /old_locus_tag="AEL142W"
                     /product="AEL142Wp"
                     /transcript_id="NM_210073.1"
                     /db_xref="GeneID:4620906"
     CDS             359614..360852
                     /locus_tag="AGOS_AEL142W"
                     /old_locus_tag="AEL142W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL183W (MNN11)"
                     /codon_start=1
                     /product="AEL142Wp"
                     /protein_id="NP_984719.1"
                     /db_xref="GeneID:4620906"
                     /translation="MLFRPKSSRLSKDGSKFRSGIELFRESMHSTRAGLVHATMCSLL
                     AAGVLVLYFAGSLIYGSKDAAVVLPARHGHYVHSIQSPTPLIFPRVEDTHVLRDMGLR
                     TLYILRIDEHRRSRISMEVGDRPTPEKNLPKDDKRALAKRSFLDHGKRVYHRTSNHPE
                     VVLVTLIDFENYDKNTITRIVQNRVDYAAKRGYGIYVRWAQEFIPLVDKQTLEDSYEF
                     MKPMAMRAAMHAFPHAKYFWFLDHTGLIMNMDFSLQDNLLASRSLNNVLLRDVPVVAG
                     TTIKTYSNFAPANAKILVPQSPLGELDTNSFIVSSTLYGKAFLDYLSDPLIRNYNWDS
                     LAASIGHMLQWHPKFLSKTGLVKSKVIAARYIPNRSPDSPNAAEVAYEDGDAVVLFTG
                     CDERQSCPADIEKFSTKKSS"
     gene            <361378..>363000
                     /locus_tag="AGOS_AEL141W"
                     /old_locus_tag="AEL141W"
                     /db_xref="GeneID:4620907"
     mRNA            <361378..>363000
                     /locus_tag="AGOS_AEL141W"
                     /old_locus_tag="AEL141W"
                     /product="AEL141Wp"
                     /transcript_id="NM_210074.2"
                     /db_xref="GeneID:4620907"
     CDS             361378..363000
                     /locus_tag="AGOS_AEL141W"
                     /old_locus_tag="AEL141W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YJR030C and Syntenic homolog of Saccharomyces cerevisiae
                     YJL181W"
                     /codon_start=1
                     /product="AEL141Wp"
                     /protein_id="NP_984720.2"
                     /db_xref="GeneID:4620907"
                     /translation="MAPEKLMHVEQDHQIVLARLEKYLRLGQQCALAVQDPCVLHAFK
                     VEKLGWLARGLAEEHRLMLSRLARAGEAGGCAELVCAWLDGEGGVVGRYGALLVGCAD
                     LLFESGMVRYQMRPRSEFLICVLQLYTKLEVLCGALAHDGLAQQLQNFEEAFVARWNR
                     KNMSLLLFDEVVDVLAVDAPFVSPPLFSLDNVVKRDFFELTLPKFGYTQLLVEVFQLD
                     TGEIAIFRVNSERLPYRADQGKRLLRQITSCGEPLTCIGRSLLFSTFRKSDLTVLEEM
                     PSAMHLTTRIDSDVHMVLRAVYQFEWDTFWRCTLHTMFSASPPSLGGIAAIASARRIS
                     HPPQNFKIKHQKLAETLCCGTQGLGLQLQPSRPTTHERQLQDAGSDCSMQTSLLPPAP
                     KLLSHAWTAVPEESGEDSQSSSGYDNTPQQLQLFELEDSTSTRGSQNDSSLRLLELAD
                     SKRTDSGSLVLQYPSFRSSIASSLHLRSPSPHSEDTASEGSARKRPQPDNGTRNAEHD
                     DFEESFASHKPENMKRRNAYLLQFLNHMRPAS"
     gene            complement(<363224..>364192)
                     /locus_tag="AGOS_AEL140C"
                     /old_locus_tag="AEL140C"
                     /db_xref="GeneID:4620908"
     mRNA            complement(<363224..>364192)
                     /locus_tag="AGOS_AEL140C"
                     /old_locus_tag="AEL140C"
                     /product="AEL140Cp"
                     /transcript_id="NM_210075.1"
                     /db_xref="GeneID:4620908"
     CDS             complement(363224..364192)
                     /locus_tag="AGOS_AEL140C"
                     /old_locus_tag="AEL140C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL180C (ATP12)"
                     /codon_start=1
                     /product="AEL140Cp"
                     /protein_id="NP_984721.1"
                     /db_xref="GeneID:4620908"
                     /translation="MRSLRFVQLHRHLAVLGRARCRVYSSATAAPLGVDKTSENNLQT
                     ETNRLAKTFTKFWDKVDLAREGGHVTVHIDGKPVRTPLGSPLRVDERRGILAHMLREE
                     WAGLTSLAVKPYSLPLTSLVSRCIDLETVSAPGCHPDTVAKVGGDRSAISQGLLRYLD
                     TDTLLCFSPRSEFEGALRKAQDEMYKPIIAGVETLLAEVSGKPVSLRCLDADVHGLRG
                     NVQSEDTRAAAGKYMDNLSVWDFAVFEKVVLTTKSFICGILLLQNKIGKAAPALKLST
                     EEIARAATLETIYQVERWGEVEDTHDVNHRDIRRNINAAAVVAYRE"
     gene            <364312..>364650
                     /locus_tag="AGOS_AEL139W"
                     /old_locus_tag="AEL139W"
                     /db_xref="GeneID:4620909"
     mRNA            <364312..>364650
                     /locus_tag="AGOS_AEL139W"
                     /old_locus_tag="AEL139W"
                     /product="AEL139Wp"
                     /transcript_id="NM_210076.1"
                     /db_xref="GeneID:4620909"
     CDS             364312..364650
                     /locus_tag="AGOS_AEL139W"
                     /old_locus_tag="AEL139W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL179W (PFD1)"
                     /codon_start=1
                     /product="AEL139Wp"
                     /protein_id="NP_984722.1"
                     /db_xref="GeneID:4620909"
                     /translation="MAGNESLIQEIAAGLRNSKGQLELVTAQLAQLQRQKKLAHVTAK
                     ELGSYPVDQVWRSCGKMFLLDSKTDYTQQLDADAKTIEEQIKALEVKRHYLETTVENS
                     IEALKKAVQR"
     gene            complement(<364717..>365472)
                     /locus_tag="AGOS_AEL138C"
                     /old_locus_tag="AEL138C"
                     /db_xref="GeneID:4620910"
     mRNA            complement(<364717..>365472)
                     /locus_tag="AGOS_AEL138C"
                     /old_locus_tag="AEL138C"
                     /product="AEL138Cp"
                     /transcript_id="NM_210077.2"
                     /db_xref="GeneID:4620910"
     CDS             complement(364717..365472)
                     /locus_tag="AGOS_AEL138C"
                     /old_locus_tag="AEL138C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL178C (ATG27)"
                     /codon_start=1
                     /product="AEL138Cp"
                     /protein_id="NP_984723.2"
                     /db_xref="GeneID:4620910"
                     /translation="MKYVRCVLLTGALFNIAAGLKCADSKVLSRYKVSQHAAKGKFTE
                     STPPSETTDFWWINLCEEHSEPVPDKCKDDAMFCHRQQVKLDDGKEYVTQVFDVPRNQ
                     EVDVEELRDGFQVSFTGKWGERERKVKVRYTCADDKAEDEVSAEGAFGAHTTPVEVAL
                     RGPSGCIQATEKSSGIGGWITWLVIYAVLLTLIYLLAKSYMSVGHGSMQDFREEFVER
                     STNLVSSLPEFAKEVMGKVVGGGPSSRGGYSAV"
     gene            <365895..>366449
                     /locus_tag="AGOS_AEL137W"
                     /old_locus_tag="AEL137W"
                     /db_xref="GeneID:4620911"
     mRNA            <365895..>366449
                     /locus_tag="AGOS_AEL137W"
                     /old_locus_tag="AEL137W"
                     /product="60S ribosomal protein L17"
                     /transcript_id="NM_210078.2"
                     /db_xref="GeneID:4620911"
     CDS             365895..366449
                     /locus_tag="AGOS_AEL137W"
                     /old_locus_tag="AEL137W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL180W (RPL17A) and YJL177W (RPL17B)"
                     /codon_start=1
                     /product="60S ribosomal protein L17"
                     /protein_id="NP_984724.2"
                     /db_xref="GeneID:4620911"
                     /translation="MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAISGWDLTKA
                     QTYLEQVLDHKRAIPFRRYNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANA
                     EAKGLDSTKLFVSHIQVNHAPKQRRRTYRAHGRINKYESSPSHIELVLTEKEEAVEKA
                     TEKKVVRLSSRQRGRLAAQKRITA"
     gene            complement(<366664..>368592)
                     /locus_tag="AGOS_AEL136C"
                     /old_locus_tag="AEL136C"
                     /db_xref="GeneID:4620912"
     mRNA            complement(<366664..>368592)
                     /locus_tag="AGOS_AEL136C"
                     /old_locus_tag="AEL136C"
                     /product="AEL136Cp"
                     /transcript_id="NM_210079.1"
                     /db_xref="GeneID:4620912"
     CDS             complement(366664..368592)
                     /locus_tag="AGOS_AEL136C"
                     /old_locus_tag="AEL136C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL179C (COY1)"
                     /codon_start=1
                     /product="AEL136Cp"
                     /protein_id="NP_984725.1"
                     /db_xref="GeneID:4620912"
                     /translation="MAANGSSVFQHALQLWKQADLPNLQEGLDQAILEVKHHEEEALE
                     SRKTLATETKAFKKLDTDARLLQINKLIKMYQAEVDSLTSRFKFTEQKLFEVYGRLTE
                     APDPQPLLQSSLDALQGSDNMRQLQKENAALKDKLTKYADYENLKARLREVEQNSAKT
                     FARRLVAKEQEVNSTWEEKERNWEKKEDELNKQVKTLKETNKVLNDKLSKKNGLDSED
                     QADGDAESKSSNSHVGAAEFRLLADELESSQVRILDLEKRNEELSGALAKASSAAERD
                     SELHNKDLQINHLESENALLTASLERERSSLAETRKSLGQQIQTISQELTSYKGELTT
                     VRRKLVTYSDYEQIKQELTALRKIEFGVDDDKPDEDGDLGSALTAANKKLQSSLAGLR
                     SRNQDLEQNNNLLVAQVKNLKEQLQELEALNAKLENDLGKVEDVARFNDNMSMISGAT
                     RHITNRQGYGGKLSPTSSIIGIPEEAETVGLTSNTSILPIVTQQRDRIRNKNMELERQ
                     LKQSSLDRGKLLAEVASLRKDNQKLYERIKYISSCNSGLGESTREVSTGVDIESQYQT
                     GYEESLHPLVQFKKSEQERYTKGRMSQPEKLFFTFANVILANKTSRLVFLAYCIALHV
                     LVVITAAYSVSATRAVGM"
     gene            complement(<368960..>371023)
                     /locus_tag="AGOS_AEL135C"
                     /old_locus_tag="AEL135C"
                     /db_xref="GeneID:4620913"
     mRNA            complement(<368960..>371023)
                     /locus_tag="AGOS_AEL135C"
                     /old_locus_tag="AEL135C"
                     /product="AEL135Cp"
                     /transcript_id="NM_210080.2"
                     /db_xref="GeneID:4620913"
     CDS             complement(368960..371023)
                     /locus_tag="AGOS_AEL135C"
                     /old_locus_tag="AEL135C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL176C (SWI3)"
                     /codon_start=1
                     /product="AEL135Cp"
                     /protein_id="NP_984726.2"
                     /db_xref="GeneID:4620913"
                     /translation="MGSSRSVGSYSGEGGQGSGGVSRAEAWSDKEEAKQWSQESAEGV
                     DIAFDEAIDGEVLSADRNSAVEEGAEADAPETKENTETLSGSGEVMEQDGGDGEEEED
                     DDGVESSYPVAADTIEVDAETENATNSPGTVNAGDADTGPVEARELSELPAEVKQEHN
                     GYGSSMQVDDSGRAVAVEGGLQSSTEKEVDLVVPQTHEIVIPSYAKWFHLNKIHEIEK
                     KSLPEFFTNRIPSKTPQVYVKYRNFMVNSYRLNPNEYFTVTSARRNLCGDAGSIFRVY
                     KFLSKWGLINYQVNSKVKPTAVEPPYTGEYSTRHDAPRGLFPFQSYKPAVQIPDMSRL
                     KKMMTQLRDPITGGNRQESSPSLKTEAGEEQAVDGKRMANGISTGHLRAPKKPRLQDM
                     IDKDWEKGEVIKLLKSLQQHGTDWMQVAKDVGNKTPEQCILRFLQLPIEDNFLDSEEN
                     LGPLKYGAHLPFSKADNPVMSTIAFLVGLVDAETVRAMTQRAIKSIDGEEVPSANGTS
                     DETPARVVKDASEIAVASLGARAHVFANNEERALNAVTNELVHTQLRKVDLKLKLLDT
                     MEKSLEVERKALQKQQEEVFLQRFSFSKYAINVLEKFEQALKDTQDPAVMKDNINAIR
                     KMILNPPEFAMGSSSAAPTDMSSGGAHETPGAAAPEGSVAALDITSVKPVSMDAPQLY
                     RYWSG"
     gene            <371713..>372555
                     /locus_tag="AGOS_AEL134W"
                     /old_locus_tag="AEL134W"
                     /db_xref="GeneID:4620914"
     mRNA            <371713..>372555
                     /locus_tag="AGOS_AEL134W"
                     /old_locus_tag="AEL134W"
                     /product="AEL134Wp"
                     /transcript_id="NM_210081.2"
                     /db_xref="GeneID:4620914"
     CDS             371713..372555
                     /locus_tag="AGOS_AEL134W"
                     /old_locus_tag="AEL134W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL174W (KRE9)"
                     /codon_start=1
                     /product="AEL134Wp"
                     /protein_id="NP_984727.2"
                     /db_xref="GeneID:4620914"
                     /translation="MRAASGFGVVLWLLMQAVQLVWADVSVLKPEKGARFSAKSGKAS
                     LELRWRIDETTYPKKDEIEIYNVTLCGGPLNQLTCMMNLANDVLPADVKEDNGELSLD
                     LTVDANIVADGMYMVQLTANAGIMGYTINYSKRFYLEDMTGPKKITVSAPLDHPLWGE
                     VHITARKDGVKFDPTAEYASVPYLSQTAKTRYAPMQTQPATKISATTWVNKHEVTSVS
                     YFSVIRNDLLFQETTITRSIDYTLSLFHNYATPQPHPSEWYDPKQRQTLSTRKINLSH
                     LSKR"
     gene            complement(<372632..>372982)
                     /locus_tag="AGOS_AEL133C"
                     /old_locus_tag="AEL133C"
                     /db_xref="GeneID:4620915"
     mRNA            complement(<372632..>372982)
                     /locus_tag="AGOS_AEL133C"
                     /old_locus_tag="AEL133C"
                     /product="AEL133Cp"
                     /transcript_id="NM_210082.1"
                     /db_xref="GeneID:4620915"
     CDS             complement(372632..372982)
                     /locus_tag="AGOS_AEL133C"
                     /old_locus_tag="AEL133C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL173C (RFA3)"
                     /codon_start=1
                     /product="AEL133Cp"
                     /protein_id="NP_984728.1"
                     /db_xref="GeneID:4620915"
                     /translation="MSHQTPRLDPAQIASTNHSVFRLIAKVVAQPKQEEITIQSPTTN
                     REMVTLGSVRVSQLTKFKVEQWYEFVCRASDSGDAGVFVLDSVELPLPSGEELSVDGV
                     VALQQLCSKFPEMY"
     gene            complement(<373295..>373948)
                     /locus_tag="AGOS_AEL133CA"
                     /db_xref="GeneID:9487585"
     mRNA            complement(<373295..>373948)
                     /locus_tag="AGOS_AEL133CA"
                     /product="AEL133C-Ap"
                     /transcript_id="NM_001355323.1"
                     /db_xref="GeneID:9487585"
     CDS             complement(373295..373948)
                     /locus_tag="AGOS_AEL133CA"
                     /note="NOHBY537; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AEL133C-Ap"
                     /protein_id="NP_001342263.1"
                     /db_xref="GeneID:9487585"
                     /translation="MVAILGQARRQVVRKMVSVQSNERYDEASHCSGDLDIVADYVTS
                     LLYKFVQFERSFNIMLVLGHSYDVQPFHDKFLREFGATVLTSQDDRDAWQDYRNRHSN
                     VLVTYTKAMLAPCAYTDMIIFIDYLPSLDDYTHAITNLRDGCGFCYLVFDPETVELDD
                     MSSRTLDLQECLECYRADDTGPVDPLSLDPNMQLLLSMLEMEENTIQACNYYDTVIY"
     gene            <374828..>376546
                     /locus_tag="AGOS_AEL132W"
                     /old_locus_tag="AEL132W"
                     /db_xref="GeneID:4620916"
     mRNA            <374828..>376546
                     /locus_tag="AGOS_AEL132W"
                     /old_locus_tag="AEL132W"
                     /product="AEL132Wp"
                     /transcript_id="NM_210083.2"
                     /db_xref="GeneID:4620916"
     CDS             374828..376546
                     /locus_tag="AGOS_AEL132W"
                     /old_locus_tag="AEL132W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL172W (CPS1)"
                     /codon_start=1
                     /product="AEL132Wp"
                     /protein_id="NP_984729.1"
                     /db_xref="GeneID:4620916"
                     /translation="MAIILGKEGLRSEGGGRRRLARRDFLQVACGLAILLLGGWHWFA
                     QDTKVASVSTAPLCGRINPIAPAFNKSLDRIFHDPVFKRDSIKRLSGAIQIRTEIGDV
                     HPAPADDPEYYAEFYKFHAYLETTFPLVYEHLQVEVVNKVGLVYTWGGSDAALKPLLL
                     AAHQDVVPVNRDTWEQWNHPPFDGFYDEDTDTLWGRGTIDCKNLLIGTLEAVDLLLRD
                     GFKPTRTVLLAFGFDEESTGKYGAGEIAQHLEERYGKNGIYAIVDEGNGILPASDSLY
                     FAAPVTGEKGYADFVITVHGRGGHSSVPPEHTNIGIAAKLISLLEDNPSELTFSASNP
                     VYGVLTCYAEHDNSLPEIVRRAILNAPHDSGAAAKLLEFLATQHLYRDLMRTSQAVDI
                     IRGGVKANALPEEVSFLINHRIDVTSNVETVLARNVRQIQAVAEKYGYGVVIGDEELA
                     PKTELGYIALEVSNAFPPAPVSPTHGSEVWDLFAGTIQDVYENRVFADRDVEFYVGQS
                     LFSGNTDTRHYWNLTENIYRFMAIQLTGEVLSVIHSVNEHLNFTDHLSTVGFLYEYIV
                     NTNEHT"
     gene            complement(<376667..>378034)
                     /locus_tag="AGOS_AEL131C"
                     /old_locus_tag="AEL131C"
                     /db_xref="GeneID:4620917"
     mRNA            complement(<376667..>378034)
                     /locus_tag="AGOS_AEL131C"
                     /old_locus_tag="AEL131C"
                     /product="AEL131Cp"
                     /transcript_id="NM_210084.1"
                     /db_xref="GeneID:4620917"
     CDS             complement(376667..378034)
                     /locus_tag="AGOS_AEL131C"
                     /old_locus_tag="AEL131C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL178C (STE3)"
                     /codon_start=1
                     /product="AEL131Cp"
                     /protein_id="NP_984730.1"
                     /db_xref="GeneID:4620917"
                     /translation="MSTDHAWTIIALASLAVLLLLPPLVWHSGTRNTPGIILIVWLLI
                     MDIKCIVDAAIWGGTDFASRWAGYGWCDLMIRLQAGANVGISCAVSNIAFNLRRILKA
                     DAALPNAGSYKKVVVDLSFCIVSPLVVMGLTFLAQAFRFAIFRYSGCQVALSPTWVTA
                     VCYTLWILIWSMVGFVYAILLLLVFYRRRKDVRDILHCTNSGLNLARFARLLIFCLVI
                     ILVMFPFSVFSFVEDLRNVEGGYIFIFKANREMWNQIPHLDPGSPLYSIWLYILMSYL
                     VFLIFGLGSDALSMYAGIARAIGFGAVMDRWNSHVNRNSDKHTDRITRQFLHRHGYDE
                     FHSKPCADSAAARTDKSMPSTPTNFVVDYALPQDLKREERRRRQAYNNGNIYFDDSAL
                     GMGRYGDCQLDLESGIDLSPMTAISFSRELNGSMKDTAASVSICSDDTKAEVFPPQHS
                     HRGRN"
     gene            complement(<378403..>379623)
                     /locus_tag="AGOS_AEL130C"
                     /old_locus_tag="AEL130C"
                     /db_xref="GeneID:4620918"
     mRNA            complement(<378403..>379623)
                     /locus_tag="AGOS_AEL130C"
                     /old_locus_tag="AEL130C"
                     /product="AEL130Cp"
                     /transcript_id="NM_210085.2"
                     /db_xref="GeneID:4620918"
     CDS             complement(378403..379623)
                     /locus_tag="AGOS_AEL130C"
                     /old_locus_tag="AEL130C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL171C"
                     /codon_start=1
                     /product="AEL130Cp"
                     /protein_id="NP_984731.2"
                     /db_xref="GeneID:4620918"
                     /translation="MVYVQIAIAWHFISSSIALAHEAAHLSAPQIIPQLSREYHSIDF
                     LNVGFTGSYSPVSTLKAVESKQCRCETGPRVWFSGATAPIDEPLSVHFRGPLKLHRFA
                     YYTSEHFVLDQQASGSWQRGAYFDAASRTRQNAVFLTRAGAHSECLGKALTYAAEDGV
                     SRSDRPATLSKHASLSSDQEFAIFADDPCPESGIGNACGVYRKGIPAYHGFAGATKMF
                     LFEFEMPAETLAPHPKFEFYDLPAIWLLNARIPRTAQYPNNADCSCWASGCGEFDVFE
                     AMNATESYHLYSAFHTFQGIDDVGSGIQPPAFFERRPRGVMRGGVIFDSVGHVRVFMS
                     DAVSFERNISSAKLASMMYRLQLSTPYKLVLPNVTAVRPILEMTSNAIHLLHKAGMTG
                     YVVLTLASLVYLII"
     gene            complement(<380043..>380618)
                     /locus_tag="AGOS_AEL129C"
                     /old_locus_tag="AEL129C"
                     /db_xref="GeneID:4620919"
     mRNA            complement(<380043..>380618)
                     /locus_tag="AGOS_AEL129C"
                     /old_locus_tag="AEL129C"
                     /product="AEL129Cp"
                     /transcript_id="NM_210086.1"
                     /db_xref="GeneID:4620919"
     CDS             complement(380043..380618)
                     /locus_tag="AGOS_AEL129C"
                     /old_locus_tag="AEL129C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL170C (ASG7)"
                     /codon_start=1
                     /product="AEL129Cp"
                     /protein_id="NP_984732.1"
                     /db_xref="GeneID:4620919"
                     /translation="MNQDKFPGDPCGDEAQPCLCYCAGCCNIQAYRVYFVRLFITGFV
                     LPVCWLLNILLYLYVCWWIPHDIIFPGVKADSSLQDPEKSADFTGAAKAALDRPSSEE
                     PWDTSTVRDTLPADDTSRISPENAGQAHLKAIAASTIECHYRCRRIYLKWLARSLICI
                     VGYAAAAIALVAVLSSQKAAAAAGNTLLTSP"
     gene            complement(<380885..>382939)
                     /locus_tag="AGOS_AEL128C"
                     /old_locus_tag="AEL128C"
                     /db_xref="GeneID:4620920"
     mRNA            complement(<380885..>382939)
                     /locus_tag="AGOS_AEL128C"
                     /old_locus_tag="AEL128C"
                     /product="AEL128Cp"
                     /transcript_id="NM_210087.2"
                     /db_xref="GeneID:4620920"
     CDS             complement(380885..382939)
                     /locus_tag="AGOS_AEL128C"
                     /old_locus_tag="AEL128C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL168C (SET2)"
                     /codon_start=1
                     /product="AEL128Cp"
                     /protein_id="NP_984733.2"
                     /db_xref="GeneID:4620920"
                     /translation="MSRSSSPSVSLPLPSSATLFLDREDKTEEALGTFIELEQCTYTH
                     KRLGDSRSNEFMECDCFEDYKDEQNHACDENSDCINRLTLIECVNDLCTSCGDDCQNQ
                     RFQKKEYADIAVFQTEKKGYGVRAERDIEANEFIYEYIGEVISEADFRDRMVDYDMRG
                     FKHFYFMMLQAGEFIDATERGCLARFCNHSCNPNAYVSKWDVAGKLKMGIFAHRKILK
                     GEEITFDYNVDRYGATAQPCYCDEPNCIGFLGGKTQTDAASLLPQNYADALGVRPSVE
                     KKWVKMRKALGEEIDKSGSSNINIEFVESLELEPCVQYSDVNKVMSVLLQIDDKFICS
                     KLLERILLTSDETMRYQIIKLHGYKCFSKLLGLFETDENTQHRILQYLSDLPKTTKNG
                     IVSSQIDKKVESLLQKEALKEDASALLERWNTYETYQRIAKKDFTKTSNGLNKVTDFR
                     RVRLPLGWEIIHENGRPMYYNAQRQIKRVDPPSDTHLQRPARTTPPQRYNGGFYDRTT
                     KRPLDPESFEKRKRQRLEWEQQELAKKKQEEVRHLKEKLEVEKQKKSELEQIIEDANK
                     QQEQQRLERLQKEKETAERRERRRQTHSASRIEHKWNKFFAQIVPNLIKSYATSMDRA
                     RIKECARDIVKILSSKELKKDATKVPPAEVTKEKRKKVNEFCKSYMDKLLAKMHEKAV
                     SK"
     gene            complement(<383265..>385340)
                     /locus_tag="AGOS_AEL127C"
                     /old_locus_tag="AEL127C"
                     /db_xref="GeneID:4620921"
     mRNA            complement(<383265..>385340)
                     /locus_tag="AGOS_AEL127C"
                     /old_locus_tag="AEL127C"
                     /product="AEL127Cp"
                     /transcript_id="NM_210088.2"
                     /db_xref="GeneID:4620921"
     CDS             complement(383265..385340)
                     /locus_tag="AGOS_AEL127C"
                     /old_locus_tag="AEL127C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL176C (LST4)"
                     /codon_start=1
                     /product="AEL127Cp"
                     /protein_id="NP_984734.2"
                     /db_xref="GeneID:4620921"
                     /translation="MLGRLLRTNSFIDLLGSFPNGKDDGKGPQPHHEATPPPSSMHMP
                     DELRTLLYGCRKVEGEGRGGEGRGSGTFRLVVAQELGQMMSRDNYQVVLDCGGTRAAV
                     GSGGAEMPLSELKEYIFGSPVRLSDRCRSDKLKLSRGARVIVVTRIFYTGYAGNARRL
                     AVCCCIPEQFLTVVTECWSQVSAWFDEVQDVLMPLLEAEPLLPKDLRVSAPAQVDVLL
                     HKFYRHLILPLHGLLETHRLFLYPADSLDFVTAWFREVFNWLEVKDGHRLKFLPALLG
                     KLRHDAAAELLHNRSSRIVVMSGNVTVANKLIFILSAFLRPRYSGQVHYVDDGLAARN
                     VELKEAPADPKYSSTITSKGWEIPRKRSRSSVLSKSSDETSFAHVFLPSSLRSTNSLQ
                     YISSSLNSQYGSYGSWFKKTIPLGHSPRINESPDNTFMHHHTNSTSSLQQQQAGTCAS
                     GNNASSVTTSTTPNTNRWSQGSPSISEYEEYPWLGYGTAPSGAPSKSRIQKVNMPRNS
                     NRVHDKKLLHERFVSICGDVQEVDFHTSPATESYGAILEVPILEELSFPSQELLPRYS
                     SYLPTLDPAFQVQACPITSNTERRLVDCMKQDLHNAEYSRTLLISLRSREIKEITITK
                     DPSTKTIVQRTKKIFLNGKPGHVSQKLHEEIHFVDNHLTATWKKWEDPVESEDKTKLF
                     ITSFHELMK"
     gene            <385617..>386819
                     /locus_tag="AGOS_AEL126W"
                     /old_locus_tag="AEL126W"
                     /db_xref="GeneID:4620922"
     mRNA            <385617..>386819
                     /locus_tag="AGOS_AEL126W"
                     /old_locus_tag="AEL126W"
                     /product="AEL126Wp"
                     /transcript_id="NM_210089.2"
                     /db_xref="GeneID:4620922"
     CDS             385617..386819
                     /locus_tag="AGOS_AEL126W"
                     /old_locus_tag="AEL126W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL175W (ZRT3)"
                     /codon_start=1
                     /product="AEL126Wp"
                     /protein_id="NP_984735.2"
                     /db_xref="GeneID:4620922"
                     /translation="MYNVGGFEVARWAVFTTLSAALCVIGGIMVPVVARLCSSQRDVN
                     SRVLNYGLSLSAGAMMCSSMYTMLPRAKGRAVTEFLGFLGGVGASFVVNELVHRYTSQ
                     SLLHCAHEGGEAGPSTGQGEGLGPSEERALAVRQSLRQYGSTTCIPLARTATVNSLAP
                     TCGSEHKQTVVCLESNIGYDLENLATYREQYRAGLPSNAGETACAGEDEEHAAAERHL
                     HVLATPFSKLLSIGIQTCVAITLHKFPEGFIIFFTNGEDMEDSRLGLSVFLGLAVHNF
                     IEGFTMTLPLYTALDTKWLAVLLTAALSVGTQPVGALFGYFVFKHTDKHDVQLDMTLL
                     LSITAGFLFVLALQMFQTAVAFSDTHHHHEDDDGKLIKSEHSSGTSCLKWCCLGVLLV
                     LGSNTFAS"
     gene            complement(<386970..>388697)
                     /locus_tag="AGOS_AEL125C"
                     /old_locus_tag="AEL125C"
                     /db_xref="GeneID:4620923"
     mRNA            complement(<386970..>388697)
                     /locus_tag="AGOS_AEL125C"
                     /old_locus_tag="AEL125C"
                     /product="AEL125Cp"
                     /transcript_id="NM_210090.1"
                     /db_xref="GeneID:4620923"
     CDS             complement(386970..388697)
                     /locus_tag="AGOS_AEL125C"
                     /old_locus_tag="AEL125C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL174C (TPO5)"
                     /codon_start=1
                     /product="AEL125Cp"
                     /protein_id="NP_984736.1"
                     /db_xref="GeneID:4620923"
                     /translation="MVAAGYSALPQAIKERMHTLPSRLSTNFGGILGRDDEPVEVEHF
                     QYEQKLDRTLLSRRSVIGLGFGLMSPVLGMSTTLGIGLVHGGPPTILGAFALCGLMSW
                     LTALAIGEVVSKYPIELHGSVALLAPERYRLVAAYYTGCLILLGNWVMNASIQYAGAQ
                     LIISLIAISGDLVSEENLAIWTVAVYFLSITVTGVINAKFASFLEPINTVCIYWILYA
                     VVFIDVLLILFHKGSFRPFLSAFSNFDNRLSGYESMLLSFLVGGLQQSNFTLQGFSML
                     PALSDETQEPEKDIPKGMSQAVLVSTVCGVIYLVPLLLVMPSPEEVMSDSRVMEIVLL
                     FTKSTRSNIVSYLQVMLILGNLLFSGIGSITTSSRAVYSISRDHAIPYYELWSYVSPG
                     SQSQVPKYAVYLSMGASYLFGILPLISGTAYNSFIGASVMCLCSASGLAVICVMLNGR
                     RGVKGAAVKIRCRLGWPVSIVVLLWLLLVMFCMCMPVTLPVTFSSMNYTSCIFAVFLV
                     GIGALYNLWGRYHFKIPQIYENIPLTSRGTTVSPLMLDSPSKAEDTFLTQNSLTTVVG
                     EGSAGPSHC"
     gene            <389294..>392116
                     /locus_tag="AGOS_AEL124W"
                     /old_locus_tag="AEL124W"
                     /db_xref="GeneID:4620924"
     mRNA            <389294..>392116
                     /locus_tag="AGOS_AEL124W"
                     /old_locus_tag="AEL124W"
                     /product="AEL124Wp"
                     /transcript_id="NM_210091.1"
                     /db_xref="GeneID:4620924"
     CDS             389294..392116
                     /locus_tag="AGOS_AEL124W"
                     /old_locus_tag="AEL124W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL173W (SNU114)"
                     /codon_start=1
                     /product="AEL124Wp"
                     /protein_id="NP_984737.1"
                     /db_xref="GeneID:4620924"
                     /translation="MDDDQYDEFGNPLHGDAYESSGDETGETGAQLVRRESADEHGEA
                     ARDLVLQRAEESVYGPDVELLVELEDREGLGVPLVKAESERRRVETAVFTQRDRNVPR
                     ARYDREYMMQLACAPERCRAACVVGALHSGKTSLLDLLAVQAHERLPYMSKAMRQGWK
                     PLKYTDSLKIEIERGVSMKLNGFTFLGADGRGQSHVLTLIDTPGHVNFMDETAVAMRA
                     CDVCIVVVDVVEGLSSVVESLIKRAERLGLPLIFVLNKIDRLLLELKLPVKDCSLKLH
                     ALVDKINAYTQGRYSPERGNVLFASSKLGFTFTLEEFVKYYYAPKLQAGSSELVERLW
                     GRVYFHKGQFSLHPNPENEVTFVQFVLKPLYKIITHTLSKDPSDIERLLHQELGISLG
                     DIPPDVDQVPLLKMVMGRVFGDETGLIDAIVKHGQPSTYKSQKELPVNADGTVAHVLK
                     LMEYGGELWSLVRIYSGELRAKDFVSVINESQDVSAIEEDEITKVQVGQVALLGGRYI
                     LPVTHASAGQLVLVKGLDEYYTKSATIFTGPAVCFPLIDYYNEPVFKVVVQPQVPSEL
                     PKLLDGLNLVHKLYPGAVIKVEETGEQVIFGSGELYLDTLLYDLRQNCAKIEIKVSMP
                     LVKFSEGCSDTSFAAIPVSSPDGKIKLVISAEPLQQELIRDLTRGKLVSSELQDMKTL
                     ARKLRNDYGWDSLAARSVRSFHNCNVFLDDTLPDEVDKGLVNAVMRHILQGFKWALRE
                     GPLAEEPIYGVQFKLLDLQIEGDHSSSSIQLVALVRRACYIALLTAVPVILEPIYEVD
                     IVVHEVLASIVKNLFAKRRSARIYKIEAIVGTPLIEVKGQMPVIESVGFETDLRLATS
                     GGAMCQMHFWNKIWHKVPGDVMDEEAVIPKLKPAPMDSLSRDFVMKTRRRKGLSSEGY
                     QSNNGPTLEKYIEPELYAKLRERGLV"
     gene            <392304..>393491
                     /locus_tag="AGOS_AEL123W"
                     /old_locus_tag="AEL123W"
                     /db_xref="GeneID:4620925"
     mRNA            <392304..>393491
                     /locus_tag="AGOS_AEL123W"
                     /old_locus_tag="AEL123W"
                     /product="AEL123Wp"
                     /transcript_id="NM_210092.2"
                     /db_xref="GeneID:4620925"
     CDS             392304..393491
                     /locus_tag="AGOS_AEL123W"
                     /old_locus_tag="AEL123W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL172W (EBP2)"
                     /codon_start=1
                     /product="AEL123Wp"
                     /protein_id="NP_984738.2"
                     /db_xref="GeneID:4620925"
                     /translation="MAKGFKLKELLSRYKETVKGERPKKKNNVKKADTQQSNESAGQA
                     NESLEESGSAKQQDVAPVDASTTPLSRKERRKQKKQQKQQQKQQEEQQEEASGDESAE
                     AAPASLDLDKLARSDSESESEDEFAEARSVEEHEAEDGSEEDVPLSDVEFDSDADVVP
                     HQKVTINNTKAISDSLARIQLPWQKHSFQEHQTVTAAANADAGITDIYDDTERELAFY
                     KQSLDAVVQARDALTALRVPFKRPLDYFAEMVKTDEHMDKLKSKLVKEASDKKAREEA
                     RKQRQLKKFGKQVQVATLQQRQKEKRETLDKIKSLRTKRKHNDIDDDAFAVGVEDAAA
                     EKPHKAGAKRQAKNAKYGQGGLKRFKRKNDAQSSAEMTDFSTRKMKGKAPRPGKSKRS
                     RRH"
     gene            <393863..>394918
                     /locus_tag="AGOS_AEL122W"
                     /old_locus_tag="AEL122W"
                     /db_xref="GeneID:4620926"
     mRNA            <393863..>394918
                     /locus_tag="AGOS_AEL122W"
                     /old_locus_tag="AEL122W"
                     /product="AEL122Wp"
                     /transcript_id="NM_210093.1"
                     /db_xref="GeneID:4620926"
     CDS             393863..394918
                     /locus_tag="AGOS_AEL122W"
                     /old_locus_tag="AEL122W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL167W (ERG20)"
                     /codon_start=1
                     /product="AEL122Wp"
                     /protein_id="NP_984739.1"
                     /db_xref="GeneID:4620926"
                     /translation="MTKEDNRKKFVDEFPSLVSQLTQSLREYGIPQDAIDWYEKSLNY
                     NTPGGKLNRGLSVVDTYVILKNCKSPLDLPVDEYRRVALLGWCVELLQAYFLVADDMM
                     DKSITRRGQPCWYRVEEVGDMAINDAFMLEAAIYCLLKRNFRDQPYYVDLLELLHDVT
                     FQTEVGQLLDLMTAPEFIVDLNKFSLQRHSYIVIFKTAYYSFYLPVALAMYAAGVNDE
                     RDFAQAREVLLPLGEYFQIQDDYLDCFGRPEDIGKIGTDIQDNKCSWVINAALKLCSP
                     EQRKILDENYGRKDPECEQRCKQIFYDLKLQEVYERYEEQVAARLRERIGEIDESRGF
                     RREVLYSFLDKVYRRKK"
     gene            <395120..>395404
                     /locus_tag="AGOS_AEL121W"
                     /old_locus_tag="AEL121W"
                     /db_xref="GeneID:4620927"
     mRNA            <395120..>395404
                     /locus_tag="AGOS_AEL121W"
                     /old_locus_tag="AEL121W"
                     /product="AEL121Wp"
                     /transcript_id="NM_210094.1"
                     /db_xref="GeneID:4620927"
     CDS             395120..395404
                     /locus_tag="AGOS_AEL121W"
                     /old_locus_tag="AEL121W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL166W (QCR8)"
                     /codon_start=1
                     /product="AEL121Wp"
                     /protein_id="NP_984740.1"
                     /db_xref="GeneID:4620927"
                     /translation="MGGPHGKAYMGWWGSMGSPKQKYITSYAVSPYAQKPLAGIFHNA
                     VFNTFRRVRAQALYVIIPFGLYYAWWANCRDYNEFLYTKAGREELERVNN"
     gene            <395600..>397921
                     /locus_tag="AGOS_AEL120W"
                     /old_locus_tag="AEL120W"
                     /db_xref="GeneID:4620928"
     mRNA            <395600..>397921
                     /locus_tag="AGOS_AEL120W"
                     /old_locus_tag="AEL120W"
                     /product="AEL120Wp"
                     /transcript_id="NM_210095.2"
                     /db_xref="GeneID:4620928"
     CDS             395600..397921
                     /locus_tag="AGOS_AEL120W"
                     /old_locus_tag="AEL120W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL171W (NNK1)"
                     /codon_start=1
                     /product="AEL120Wp"
                     /protein_id="NP_984741.1"
                     /db_xref="GeneID:4620928"
                     /translation="MSNTYNVNPGLKRRDAPTLLQRNFAERVSVDTLISGEAGPPDEG
                     GSDGGEHNDEDEDTIYFKPKKIYRMEQESGSRQTLVRVYSETERSNFNEVTGKRMFDD
                     WKYRPLYYHEEETRPRCEGVGSVSAGSVRWGDMQDEYVPDLDFAAAVKAWQAEELKEE
                     MPMTRYQLWSEDESDFNLDSASSSMIIESSHAQVSPIPFPSSTGKSPVSAAHSLLTLN
                     KALGNRVGSRVFSPSNLESKAKHRSMYEWGSLLSISSATSIGDKFTQDDIRAITRKIP
                     DDFLSLPYTQRKKILMDIAPDKDYKAIMSVFKKYSLVSSSSFTHLSNHGSRRSRHGSM
                     ASQYLSSFTPSSASFKPDERGSIVLGHRLGKIIGFGAWGMIRDCYDVKQSFVISPSES
                     QPPASHAMKIVRFKNNQKVKEHALREIAIWKKLHHPNILELINWKQEEDYAAYYLTEK
                     IQDGTLYDLVSTWGESDGSTIPLDQRCKLTIALALQLISALKYMHSKYIVHADVKLEN
                     CLLEKTGSQSWKLYLCDFGMSCQYGKPRNDNEELYSPDEGMDFSPAERKGLKNKRRPS
                     LSKSSSQGVLKPLTKLQKIIRSKQQTHDDTPLGITSFPKQYGPSLTSTTMSSSSVWKQ
                     ASPAGSSSKLDKTGRSGTSEEHDAATKAVEPHSHIGSLPYAAPELIDPCPPPLGPSAD
                     IWASGVTMYTMLTGKLPFKHDYEPRLRAMISSGKYDTELLRSVCNISENGLAPQGPGP
                     AFGGLYAAVCGCLTKSMVHRWELSEVDNTLRNE"
     gene            <398358..>398774
                     /locus_tag="AGOS_AEL119W"
                     /old_locus_tag="AEL119W"
                     /db_xref="GeneID:4620929"
     mRNA            <398358..>398774
                     /locus_tag="AGOS_AEL119W"
                     /old_locus_tag="AEL119W"
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /transcript_id="NM_210096.1"
                     /db_xref="GeneID:4620929"
     CDS             398358..398774
                     /locus_tag="AGOS_AEL119W"
                     /old_locus_tag="AEL119W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL170W (MRPL38)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /protein_id="NP_984742.1"
                     /db_xref="GeneID:4620929"
                     /translation="MIYLKTILKVIDNSGAQLAECIKVLGKGSPKSAGKVGDKIVCVV
                     QKAKPMNQSITGQSNNNRVKKGDIVRAVIVRTKQKNMMRPDGSTVSFGDNACVLLHKT
                     TGEPLGTRIQLNDGVVSRELEAKGYNKICSLASKVA"
     gene            complement(<398944..>400995)
                     /locus_tag="AGOS_AEL118C"
                     /old_locus_tag="AEL118C"
                     /db_xref="GeneID:4620930"
     mRNA            complement(<398944..>400995)
                     /locus_tag="AGOS_AEL118C"
                     /old_locus_tag="AEL118C"
                     /product="AEL118Cp"
                     /transcript_id="NM_210097.1"
                     /db_xref="GeneID:4620930"
     CDS             complement(398944..400995)
                     /locus_tag="AGOS_AEL118C"
                     /old_locus_tag="AEL118C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL168C (KKQ8) and YJL165C (HAL5)"
                     /codon_start=1
                     /product="AEL118Cp"
                     /protein_id="NP_984743.1"
                     /db_xref="GeneID:4620930"
                     /translation="MPQQVRLSRENSVKRSRSLTKSFRGLFKFNSPGSPPSSAATSDS
                     SEMSGAQGGRGNGLLGGRTKKASISPKSEAQFTQRNKSAESVVSDEGVAMVASAGAQF
                     YGRGKHESSPNVLMTGGEEAARAAGRASAESIALSEGGPPSIDTKLERVTPSLIYPQN
                     GRAKHSSQRSRSASVGRNKERGGPTPAPIGSIREEESKKAHKCIIQQEHFTVDENGNH
                     QHSLKVLPLIVQDPESHKPKLFSFSAVFKSHKNGEDEELSDAFSILPDYSTVLEKTLV
                     EPLSEVKIFSEAAQPDENGGRTEANQPKDMPKIVNKHAAIGNEELKLINNLSETIHVG
                     MQGPDKHSSPPQPFTCKATKSKQVLAEKYGKCIGMIGQGAYGTVWVTCRSLPQDNQTE
                     THYPTETYERNGKLFYAIKEIKPRADEPNEKFSTRLTSEFVIGHSLSGGAGGTKRLTS
                     HPNILKVLDLMQAHDVFIEVFEFCPSGDLFSLLTRSSKTGSGLHPLEADCFMKQLLNG
                     VRYMHDHGVAHCDLKPENILFTPNGTLKLCDFGSSSVFQTAWEKRVHFQTGAVGSEPY
                     VAPEEFIPKREYDTRLVDCWSCGIIYCTMVLGHYLWKIAIKEKDQIYSAFLDDMTTRG
                     EYYVFENMRHVNQEVNRCRKMCLYNIFQWDPKKRITIPKLLDTPWMRRTKCCVNYRAA
                     I"
     gene            complement(<401437..>403272)
                     /locus_tag="AGOS_AEL117C"
                     /old_locus_tag="AEL117C"
                     /db_xref="GeneID:4620931"
     mRNA            complement(<401437..>403272)
                     /locus_tag="AGOS_AEL117C"
                     /old_locus_tag="AEL117C"
                     /product="AEL117Cp"
                     /transcript_id="NM_210098.2"
                     /db_xref="GeneID:4620931"
     CDS             complement(401437..403272)
                     /locus_tag="AGOS_AEL117C"
                     /old_locus_tag="AEL117C"
                     /note="NOHBY508; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0A06842g"
                     /codon_start=1
                     /product="AEL117Cp"
                     /protein_id="NP_984744.2"
                     /db_xref="GeneID:4620931"
                     /translation="MLKQRQRQVVGHFLRRHRRALLHEYVLVPIGVICFMALLYGVDR
                     LIRNVIKVKFPASVAVMIVNLGVMCTFSAISQPLAERYVAVVDVPLSWSLRWMNLFFT
                     PAFVTLPLSEWISAREAMLIMATFVVGYLVGVAVLAYVTVGCQRLFGKSRKSLFTRQH
                     ELDTGEAEGSRFARPSATGVLDSPARSEDTASVTEYRPAELQDVPLMNLASHSGMLLS
                     RSATQEHTGSSPGMSEGLFTRSSSDTGPAKSQEKQQEQDSSEFTSEPSSMNPATLHEP
                     APSQKAYRDSSALETEDKPAFCERAVTRQVSHQLDRLISVQLLRAHLHHILYGLGFVA
                     SMFSYYFSWYLMPYHLFTAVCAFMFIADAPLVQNPKYKRFLHPVLCSVALTWLVMLIS
                     VLIKHRRVSFFISELHDYKTGRTYLHLFDTAAFGARVWPGAGDIFGSCMDVSIVGLSM
                     PMFTYRADLRRHFASMIPAILILSAGTLILYPLIAHLIGIRSDRSLGFVGRSITLALA
                     TPVVDNLHGSMTLMAVCTVVSGVVGALTGGPHLDLLRIRSDDYVTRGVTLGCNCGAIA
                     TAYLLGVDRRAAAISSLSFVIFGTFMVILSSIGPVQAWVNHLATL"
     gene            complement(<403531..>403920)
                     /locus_tag="AGOS_AEL116C"
                     /old_locus_tag="AEL116C"
                     /db_xref="GeneID:4620932"
     mRNA            complement(<403531..>403920)
                     /locus_tag="AGOS_AEL116C"
                     /old_locus_tag="AEL116C"
                     /product="mitochondrial 54S ribosomal protein MRP49"
                     /transcript_id="NM_210099.1"
                     /db_xref="GeneID:4620932"
     CDS             complement(403531..403920)
                     /locus_tag="AGOS_AEL116C"
                     /old_locus_tag="AEL116C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL167C (MRP49)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein MRP49"
                     /protein_id="NP_984745.1"
                     /db_xref="GeneID:4620932"
                     /translation="MSNVKKQLAFLNRICGTAKPQVLVDTTKVSGLKLTFQAQSHNGH
                     MGARKLWREHLPTLQFYNPGLDIQVHRVANSDKKQPVPCVLEVLGHDGNVLHRLDMAH
                     KHSDTIIDELLSTVEHTPVPAEQQVRV"
     gene            complement(<404268..>405428)
                     /locus_tag="AGOS_AEL115C"
                     /old_locus_tag="AEL115C"
                     /db_xref="GeneID:4620933"
     mRNA            complement(<404268..>405428)
                     /locus_tag="AGOS_AEL115C"
                     /old_locus_tag="AEL115C"
                     /product="AEL115Cp"
                     /transcript_id="NM_210100.2"
                     /db_xref="GeneID:4620933"
     CDS             complement(404268..405428)
                     /locus_tag="AGOS_AEL115C"
                     /old_locus_tag="AEL115C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL166C (TPK3) and YJL164C (TPK1)"
                     /codon_start=1
                     /product="AEL115Cp"
                     /protein_id="NP_984746.2"
                     /db_xref="GeneID:4620933"
                     /translation="MVETADVTHFVQPRVATEEIVPQQDASSTMPGLSMESRSLCKNI
                     MRAEWAQESGRQLRGRKLEGRTTKGKYTLYDFQILRTLGTGSFGRVHLVRSNHNGRFY
                     AMKVLKKHVVVKLKQVEHTNDERKMLSVVSHPFIIRMWGTFQDAHQVFMIMDYIEGGE
                     LFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKLTDF
                     GFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDQNT
                     MGTYENILNAEVKFPPFFNAEVRDLLSQLITRDLSKRLGNLQNGSQDVKAHPWFSEVI
                     WDKLLCRNIETPYEPPIHAGQGDTSQYDRYPEEDANYGALGEDQYQALFSDF"
     gene            complement(<406336..>408108)
                     /locus_tag="AGOS_AEL114C"
                     /old_locus_tag="AEL114C"
                     /db_xref="GeneID:4620934"
     mRNA            complement(<406336..>408108)
                     /locus_tag="AGOS_AEL114C"
                     /old_locus_tag="AEL114C"
                     /product="AEL114Cp"
                     /transcript_id="NM_210101.1"
                     /db_xref="GeneID:4620934"
     CDS             complement(406336..408108)
                     /locus_tag="AGOS_AEL114C"
                     /old_locus_tag="AEL114C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL163C"
                     /codon_start=1
                     /product="AEL114Cp"
                     /protein_id="NP_984747.1"
                     /db_xref="GeneID:4620934"
                     /translation="MKSYIIKPRNCFLHLLSPSVYWRPVLETFTQKKSMTQVSRGGDE
                     TATIASDEYMEAEPLLPLSEPRWPTADDSYCETTLGTLYEEEHIKSNASAGVTGQGTV
                     RQAHVQRAEAIEGPTRFPLTQNIYFICFLICVGCGSGGVLLTPTVTLSLDKVCEYLAP
                     DGSTIGCDRTQVQEVLSNIDKKVSPIRGILCMLMSAWLGRLSDRIGRKPIFLYMGVIQ
                     LMYLFLWYIFFFQKAIPFSKSVMIFVRSFDALGGGVMTLLATGNSYVSDFATAETRTV
                     YMTAITSVIYAVAGAGPLFSALFTRITQKYQSISFCVALACCGLFIAASLVIKEPRRS
                     KRWQESGSDFAQQGLPLDRQYASFRGFLKHHAMAIVNHVKGLFAPFSSLCAQEGNGSS
                     LLSPWAVILLVLISLVFGPISQSLTSVLVLYAIFEYHWADERLGYFVSLLGICHAVFL
                     WFSPGILRAMRRRHSTDPRHLDRIDILCIRGSLWAGLAAAALLAASRHESTLYVYGVV
                     HAFSGLLYPTINSALLKFAPPEATGALLGAMSMLISMASMVLAPLFFSLYEHTVAYRP
                     EIFIYLGLIMMTLCTASGHFLKES"
     gene            complement(<408301..>411078)
                     /locus_tag="AGOS_AEL113C"
                     /old_locus_tag="AEL113C"
                     /db_xref="GeneID:4620935"
     mRNA            complement(<408301..>411078)
                     /locus_tag="AGOS_AEL113C"
                     /old_locus_tag="AEL113C"
                     /product="AEL113Cp"
                     /transcript_id="NM_210102.2"
                     /db_xref="GeneID:4620935"
     CDS             complement(408301..411078)
                     /locus_tag="AGOS_AEL113C"
                     /old_locus_tag="AEL113C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL165C (MCD4)"
                     /codon_start=1
                     /product="AEL113Cp"
                     /protein_id="NP_984748.2"
                     /db_xref="GeneID:4620935"
                     /translation="MWNKHRLAFILVGLLFHLFYLRSIFDIYFVSPLVHGMRQFKSNE
                     EPPAKRLFLIVGDGLRADTSFDKVKHPVTGKTEFLAPYLRSLVEHNATYGISHTRMPT
                     ESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSVFNQSTHTYSFGSPDILPMFKSGAS
                     DPTKVDAWMYGHEFEDFTQSSIELDAYVFRHMDALFRNATVDSKLRHEMMQDGNVFFL
                     HLLGCDTAGHSYRPYSAEYYDNVKYIDSQLERLVPKVREFFGDDDTAFVFTADHGMSA
                     FGSHGDGHPNNTRTPLVAWGAGLNRPVLNDVPVYDNYTENWDLAHVRRNDVNQADIAS
                     LMSYLIGLNYPTNSVGELPLAYVNGTERTKLNALYKNALSILEQYLVKETEMIQSQLV
                     YKEYPKFAQKSHSSYIQEIEHLIDRIANGEEDLEPEAIALSEELMKTALEGLQYLTTY
                     NWRFIRSIVTLGFIGWITYSFTIFLRLFILEKQYAMKTSPQNLASFGALTAALNYVLY
                     YQRSPFNYYMYLLFPLFFWSQILTNSTILHDGIREMFKGVSMLQRIGICALIVSIYEG
                     IVYGYFDRWIFTIIFNLLALYPFFCGIKDAKTNMFWGANSMALSIFTLFDAVKIESLT
                     QINVSGLLLVASGLYALWRVSKKINSHTKIVILLQILLLAMMLAVTNKSVTSLQQRAG
                     LPTDAKIAGWVILTLSLSLMPLLHYLKPSNDYQVRVLVIYLTFAPTFLILTISFESFF
                     YLLFTNYLMLWIEIESKIKAQNIAKNSQNWLQLLRISIIGFFLLQFAFFGTGNVASIS
                     SFSLDSVYRLMPVFDPFPMGALLILKIMIPYILLSTALGIMNLKLNIKDYTVSSLILS
                     TSDVLSLNFFYLLRTEGSWLDIGVTISNYCLAILSSLFMIVLELFSHFLLKNVRDNGM
                     DIAASKQQKRH"
     gene            complement(<411321..>412928)
                     /locus_tag="AGOS_AEL112C"
                     /old_locus_tag="AEL112C"
                     /db_xref="GeneID:4620936"
     mRNA            complement(<411321..>412928)
                     /locus_tag="AGOS_AEL112C"
                     /old_locus_tag="AEL112C"
                     /product="AEL112Cp"
                     /transcript_id="NM_210103.1"
                     /db_xref="GeneID:4620936"
     CDS             complement(411321..412928)
                     /locus_tag="AGOS_AEL112C"
                     /old_locus_tag="AEL112C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL162C (JJJ2)"
                     /codon_start=1
                     /product="AEL112Cp"
                     /protein_id="NP_984749.1"
                     /db_xref="GeneID:4620936"
                     /translation="METARIRLDETTYYSLLGLPFGASELHIRKAYMRLARELHPDKS
                     KSKEAAELFKVVAHAHSVLTDKEKRLKYDRQLIAKGLHTYVSNSSSSLNYKPPGSRPV
                     TRAQQAAVAADKERAAKKAKPYEEQPYGFGTEAESSPQAGDGTPQRSTTATKPFKAKS
                     YQHQRNPGTPPETGNKKSSTFSARFISNSVPAAPESKPSDEYPAKKMPRKQATPEPSS
                     SPFLSPDHRHYARTKFESRRRGTRSASPLKTMPTSQTDTLDGLKSIINKFSDRVKVNI
                     FGSPSTVETEHVTDLSEDQSSVEQDGGDEARLRADMLAGDKATARCAPIPQDGTKEIN
                     LEELNTSLPPQRETFNMRNVSDTLDRMNVKRQKLNTEATHVPGNIPLPAQRHLSPALD
                     ESGSLAEPVNKSIPRVYKIDRIPPTEFAMDLSVSDIELPTMPSFHCNILDKSDIKLCR
                     EKILEFNTKANRLKKQLIQALSLRSSADEALENRVVRVENMAAYVEAKNYDLDVVMKL
                     HEIQNRQRIVAESFTNLMRSAYASGTF"
     gene            complement(413047..413120)
                     /locus_tag="AGOS_t0103"
                     /db_xref="GeneID:4620937"
     tRNA            complement(413047..413120)
                     /locus_tag="AGOS_t0103"
                     /product="tRNA-Asn"
                     /codon_recognized="AAC"
                     /db_xref="GeneID:4620937"
     gene            <413543..>414073
                     /locus_tag="AGOS_AEL111WA"
                     /db_xref="GeneID:9487586"
     mRNA            <413543..>414073
                     /locus_tag="AGOS_AEL111WA"
                     /product="AEL111W-Ap"
                     /transcript_id="NM_001355322.1"
                     /db_xref="GeneID:9487586"
     CDS             413543..414073
                     /locus_tag="AGOS_AEL111WA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL161W (FMP33)"
                     /codon_start=1
                     /product="AEL111W-Ap"
                     /protein_id="NP_001342264.1"
                     /db_xref="GeneID:9487586"
                     /translation="MLIETQVATRRRVPRRRAIGLPHLVKIIRPDTMSDAGEFTVSID
                     IPNRMRQVHESFLCQRAMPSLTSMNSNISDEDYEHDLVLALRESCVCHNPIETIAVEQ
                     DFTIPTSYFTDEDVFAFGDGFDFPPLFLHNELHSVLVAPADLALGSAGAGFRPYADCP
                     IAMLQGAAVSFAAEFY"
     gene            complement(<414629..>415675)
                     /locus_tag="AGOS_AEL111C"
                     /old_locus_tag="AEL111C"
                     /db_xref="GeneID:4620938"
     mRNA            complement(<414629..>415675)
                     /locus_tag="AGOS_AEL111C"
                     /old_locus_tag="AEL111C"
                     /product="AEL111Cp"
                     /transcript_id="NM_210104.1"
                     /db_xref="GeneID:4620938"
     CDS             complement(414629..415675)
                     /locus_tag="AGOS_AEL111C"
                     /old_locus_tag="AEL111C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL163W (PIR3) and YJL160C; Inverted gene duplication in
                     this genome; Inverted gene duplication in Saccharomyces
                     cerevisiae"
                     /codon_start=1
                     /product="AEL111Cp"
                     /protein_id="NP_984750.1"
                     /db_xref="GeneID:4620938"
                     /translation="MQIKKSALAATALFASSALSSYVAGDPWDTLTPTGTYSGAITSY
                     ASTFGIAVVPLATEKASKAKRAVPVSQIGDGQIQATTKTTVPAVSQIGDGQIQATKTT
                     VPAVSQIGDGQIQATKSTVPAVSQIGDGQIQATTKTTVPAVSQIGDGQIQATKSTVPA
                     VSQIGDGQIQATTKTTVPAVSQIGDGQIQATTKTSVPAISQIGDGQIQATRSTTTLSN
                     PASQIGDGQVQATTAPAHDDKHDSKDPVTAVSCRSEGTLELTLKDGVLYDGAGRIGAI
                     VANRQFQFDGPPPQAGAIYAKGWSITQEGNLALGDNDVFYQCLSGSFYNLYDENIAPQ
                     CSPIKLQAIDLVTC"
     gene            <416817..>417563
                     /locus_tag="AGOS_AEL110W"
                     /old_locus_tag="AEL110W"
                     /db_xref="GeneID:4620939"
     mRNA            <416817..>417563
                     /locus_tag="AGOS_AEL110W"
                     /old_locus_tag="AEL110W"
                     /product="AEL110Wp"
                     /transcript_id="NM_210105.1"
                     /db_xref="GeneID:4620939"
     CDS             416817..417563
                     /locus_tag="AGOS_AEL110W"
                     /old_locus_tag="AEL110W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL164C (PIR1) and YJL159W (HSP150); Inverted gene
                     duplication in this genome; Inverted gene duplication in
                     Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AEL110Wp"
                     /protein_id="NP_984751.1"
                     /db_xref="GeneID:4620939"
                     /translation="MQVRNTIAASTLLASTAMSAYIAGESWDGLMPENVYEGGITDYP
                     STFGIAVVPLTPRVFDGSKKRDLSAVEQIIDGQVQSKSDSVPASGAVAQIGDGQVQAI
                     TLKQPQNGPESQPDESSDKRCPTPAELENILASASAERDPSDPVNAYSYRYEGTLEMS
                     LNDSVLRDGHGRIGSIVSSRQFQFDGPPPQSGAIYAKGWSLTPEGNLALGDTDIFYRC
                     LSGNFYNLYDQSIGGQCSPVHLQAINLISC"
     gene            complement(417636..417707)
                     /locus_tag="AGOS_t0104"
                     /db_xref="GeneID:4620940"
     tRNA            complement(417636..417707)
                     /locus_tag="AGOS_t0104"
                     /product="tRNA-Cys"
                     /codon_recognized="UGC"
                     /db_xref="GeneID:4620940"
     gene            <419410..>420699
                     /locus_tag="AGOS_AEL109W"
                     /old_locus_tag="AEL109W"
                     /db_xref="GeneID:4620941"
     mRNA            <419410..>420699
                     /locus_tag="AGOS_AEL109W"
                     /old_locus_tag="AEL109W"
                     /product="AEL109Wp"
                     /transcript_id="NM_210106.2"
                     /db_xref="GeneID:4620941"
     CDS             419410..420699
                     /locus_tag="AGOS_AEL109W"
                     /old_locus_tag="AEL109W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR048C (NAP1)"
                     /codon_start=1
                     /product="AEL109Wp"
                     /protein_id="NP_984752.2"
                     /db_xref="GeneID:4620941"
                     /translation="MASPIKTKNQIDGAPTPQNTPASVLKESYLKNGNPLQTQQATTS
                     VPQTINEEEINAALAKNPQLLATIQGKLGSLLGQDSGYIASLPRKVKDRLYALKKLQQ
                     DIFQLEKEFQLEMFQLEHKYLLKYAPLHARRAAIVKGADEPTPAEVEAGRLIEKENET
                     PAIIDDDADEGDESDDAEDETGTPGVPGFWLTALENLPMISQTITDRDAEVLHYLANV
                     SMEYLTEGKPGFKLLFDFAPNPFFADPVLVKTYYYQPELGYSGDFIYDHAEGTPIQWA
                     SHEANVTVVVEKRKQRNKTTKQVRTIEKLTPVESFFNFFDPPAVPPADESLDADDDDE
                     EVVGLESRLALDYAIGEEIKDKLIPRAIDWFTGVAREFDYDDDEDSDAEGHFDDEDSD
                     VDDDDDHPAEAADESEDDDFAASETRPGDNPPECKQQ"
     gene            <420989..>421975
                     /locus_tag="AGOS_AEL108W"
                     /old_locus_tag="AEL108W"
                     /db_xref="GeneID:4620942"
     mRNA            <420989..>421975
                     /locus_tag="AGOS_AEL108W"
                     /old_locus_tag="AEL108W"
                     /product="AEL108Wp"
                     /transcript_id="NM_210107.1"
                     /db_xref="GeneID:4620942"
     CDS             420989..421975
                     /locus_tag="AGOS_AEL108W"
                     /old_locus_tag="AEL108W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR046C (PET10)"
                     /codon_start=1
                     /product="AEL108Wp"
                     /protein_id="NP_984753.1"
                     /db_xref="GeneID:4620942"
                     /translation="MAKTQTLNVAKNSQTASVAKLVADSPTLSHLQRYGAADALGRWL
                     PWTLVSTVATLVVAVLATAKQYLVDAPGTPAAVKGAWVRLLAGAQALDAAVSTLVLRD
                     GVDAFREQYVQHGTVGLWAAYFALDFTANVSNYVLRGLVRPLRVAYEPRREEATTPAS
                     SAGSDMPHLRELTNTTNALRRDISSKYIEPTRSMIESYLEPTRTKIEAEYIHPINERV
                     ESTKTLLNSTYDAAYETVSRTYEGNLSSHESVSRALVSTGVDLGSKTLEKIRAVTRSA
                     DGQPTETVNGAGTNGTHKTNGVAHGANGIHRAGIKAHANGNGKAAAGDENAA"
     gene            <423112..>425781
                     /locus_tag="AGOS_AEL107W"
                     /old_locus_tag="AEL107W"
                     /db_xref="GeneID:4620943"
     mRNA            <423112..>425781
                     /locus_tag="AGOS_AEL107W"
                     /old_locus_tag="AEL107W"
                     /product="AEL107Wp"
                     /transcript_id="NM_210108.1"
                     /db_xref="GeneID:4620943"
     CDS             423112..425781
                     /locus_tag="AGOS_AEL107W"
                     /old_locus_tag="AEL107W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL154C (VPS35)"
                     /codon_start=1
                     /product="AEL107Wp"
                     /protein_id="NP_984754.1"
                     /db_xref="GeneID:4620943"
                     /translation="MSYAESVEQATGVIKQQTVLIQRHLAQRKLLDALKHISIMLTEL
                     RNPSLTPKQYYELYILVYDALSVLSQYLVENHPKRHHLADLYELVQYAGNILPRLYLM
                     ITVGTAFLQIKDSPREEILKDMIEMCKGVQNPVRGLFLRYYLSQRTKEWLLPQNGPAG
                     NASEGRSQENVENNVKKFNVEFIINNFIEMNKLWVRLQHYGPLRERELRTKERRELQI
                     LIGSNLVRLSQIVEDDSKLYAEVILPQLLDQIVQCRDVVSQEYLLDVICQVFPDEFHL
                     ATLPTLLETTLKFNPDVSINKVVSNLVERFNGYVERQSGDIDSVQNTFRKLCIQGQPT
                     SASGDTISSSGGLFFVFWRYLEKLSEQRPDLPLNDLFPLVQGILKLSLTWYPDVLSNV
                     DCLFKFTVRKCQENGGPDANPDYEYLFQDLLLSMTSSSMFYRVLTECESYQKLLSMQP
                     VGLQKLVVNCILDTIFKAGITITNRIHLEKILLLCESLIKVNNPKIHNSGEDAEQHSA
                     QDDDPTSCLLNIEQEKLAQVVHICRSQSIEKQVELLLTCKSWFYKGGIQMRYTYPAVV
                     TAFWKLIRKTDIKKSKYPSREKKYRQLIKQLFKYVSRCLSELGNTVGAPCADLVFKMN
                     LQSAAIADHLGLSEISYDFFTQVFTIFEESLSDSRSQFQAIITMAQTLQKTRSLYVEN
                     YYDSLITRCTLYGSRLLKKQDQCRAVYLCSHLWWATEIPLIGEEEGITDTFYREGKRV
                     LECLQRSLRVADSIMDNVQSCQLMVEILNRCCYYFVHGDESATHVGPKYINGLIELIE
                     TNLKSLKIEESVEFAESKLPKPSYANFVVGVDGSYIQVPTSPTATVAAVMSKPPNITI
                     SSLVPIVTGYLQRTLNYIEDQKVVDDRFRAIIV"
     gene            <426105..>427472
                     /locus_tag="AGOS_AEL106W"
                     /old_locus_tag="AEL106W"
                     /db_xref="GeneID:4620944"
     mRNA            join(<426105..426128,426177..>427472)
                     /locus_tag="AGOS_AEL106W"
                     /old_locus_tag="AEL106W"
                     /product="AEL106Wp"
                     /transcript_id="NM_210109.2"
                     /db_xref="GeneID:4620944"
     CDS             join(426105..426128,426177..427472)
                     /locus_tag="AGOS_AEL106W"
                     /old_locus_tag="AEL106W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL155C (FBP26); 1-intron"
                     /codon_start=1
                     /product="AEL106Wp"
                     /protein_id="NP_984755.2"
                     /db_xref="GeneID:4620944"
                     /translation="MPVYTVSNVQNLKICVVMVGLPARGKSFISQKIVRYLSWLSIKA
                     RCFNVGNYRRQAGAAKPSAEFFASDNAMGMKVRRQAVEQAVADMNRWFFEEDGIVGIL
                     DATNTTHERRDWILKMCRENGIEPMFLESWCNDQDIILRNILEMKATSPDYEGCDPED
                     ARRDFLERIAKYEDVYEPLDETRDQDLTFVRLINVAQQVIINRIETYLESRIVFYVMN
                     LHIKPRVIWLSRHGESVYNLEKKIGGDSHLSPRGLEYARKLPELVRESAGNVDLTVWT
                     STLVRTGETAQFLPYKQLQWKALDELDAGVCDGMTYEEIEEKYPEDFKARDEDKYEYR
                     YRGGESYRDVVIRLEPIIMELERQENILIITHQAVLRCIYAYFMNVPQEESPWVSIPL
                     HTLIKLEPRAYSTKVTRVKANIEAVSTYKEKGTSRVGEPSQDRRPLQ"
     gene            <427951..>429960
                     /locus_tag="AGOS_AEL105W"
                     /old_locus_tag="AEL105W"
                     /db_xref="GeneID:4620945"
     mRNA            <427951..>429960
                     /locus_tag="AGOS_AEL105W"
                     /old_locus_tag="AEL105W"
                     /product="AEL105Wp"
                     /transcript_id="NM_210110.1"
                     /db_xref="GeneID:4620945"
     CDS             427951..429960
                     /locus_tag="AGOS_AEL105W"
                     /old_locus_tag="AEL105W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL156C (SSY5)"
                     /codon_start=1
                     /product="AEL105Wp"
                     /protein_id="NP_984756.1"
                     /db_xref="GeneID:4620945"
                     /translation="MVRGLFGFGKRSGQDRNREPERRKCDEEDMLGEDPKQPILLSGK
                     TCESVQSSSIFSRGLRTCGTDISTSGAFSESGARVDKDIGKPLRVTGVGTALGTVAEH
                     EEGSQTLGLVPSGTDSTGDAYEETHPDRRGAGQLETELQELGDKLDSVMDEIVQNVTN
                     VSKAVIQAIEHFKNFLEQAEGCHYGVSTEHSAAFRRITKIVLHFQDNLLQSDVFSNSR
                     AILLRWYIKFLTSLNLEVHDLPPADVKRMPLPSLKIYAIGQDCNLPNRDKISTIIEEI
                     AGANDSSISDQEGAFIAPVLRGLDKNSAILTILFGFPRPQQAHYEMVKVLYSLFRDVH
                     FYCVKDYITPCAANVAPNVVPSSIPMQAFSPQRTQFIPPYTLPSDVMAPPMSMSLSSE
                     DSVSMTGTLGGYLFPQIPESEEHLSGFAGAAFGITCAHVVLTESQDHPYVSVPSRVLQ
                     NIYKKTLKEELTRYPEGSIERLSFEDEISRIEQNLEWQQENKFGQVVWGERSIVKQKL
                     SDFAIIKLNPKIRCRNYLGDDLSGIPDPVLRFKNLYVRKKLMTLRPGLEVFKVGASSK
                     YTRGTVNGSKIVYWADGKIQSTEFVISSPQPFFATGGDSGAWLLTKLDDELGLGVVGM
                     LHSYDGEQKQFGLYTPIADILERLHDVTGVIWDIDQPPELSKYID"
     gene            <430441..>433698
                     /locus_tag="AGOS_AEL104W"
                     /old_locus_tag="AEL104W"
                     /db_xref="GeneID:4620946"
     mRNA            <430441..>433698
                     /locus_tag="AGOS_AEL104W"
                     /old_locus_tag="AEL104W"
                     /product="AEL104Wp"
                     /transcript_id="NM_210111.2"
                     /db_xref="GeneID:4620946"
     CDS             430441..433698
                     /locus_tag="AGOS_AEL104W"
                     /old_locus_tag="AEL104W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL157C (FAR1)"
                     /codon_start=1
                     /product="AEL104Wp"
                     /protein_id="NP_984757.2"
                     /db_xref="GeneID:4620946"
                     /translation="MSSLNVDGTANFTTPVIEYYAKFMHSPPSRDSVSGTSPTTKFLK
                     TLSGGSIRRLSSKFRPHSRNSGLQQQQISYPQPVNRTLPVIHGPSGAAPVSLQKLGST
                     TMQGKKRPTPLNLKMVSQPLAVQKTSSDASKPKLGSPMKLRPPSKMQTNDLRSSGKTL
                     VDDQGLRLSIQQSALSNSNRSPDTYAGRISTNYASIHRRHTITSAINGGKRYNSNACS
                     ICGENLNALLAGERIVELTCDHQSHYHCYFTLLEVSVQNDKYPRCQLCGQERKPKSDE
                     ILTDMKSSILLTKPLRSTQGSSISAQVLGPTSATGEKPLVDIYTPCEQLLKSADVGSN
                     GFCSSYNDSMYCANTSDEVTLEYPLSATDSNPDSRSPTPSEGDCLKVNVIPQMNKLMV
                     DDTLDEVIVPFVLNCFVPGVKKEDIDAECLADQSLRADVNEYISNKFSLHLNGSSPLR
                     LFDRLNYSLDGNQWTHVVVYCFEKCLLLVEQEHTDVEPVIIGKIPMEHLSRLYKYNSN
                     TIILDLKSISLPEVYLQDLKGSAALINKWHFYLSNAQSRVPVALQTTNCWQLLPQHIL
                     DKVPKELISYNQLTGDALGLTASLHNSTISGNRGINSCGKSSKLQIVVAVSLFNCQPE
                     LHSNEELLKIIQQQLRSLKYSLHEDDLLGIVVAAKEGFNNGRFYGMVSKNWELWDEII
                     DDMRVTESDNGHVSDIIDLHYIMEASSRLLSMVEGSSDYIRQLVILSNDYQAHSPAEP
                     SDIPPGIYQRLEQFTSRAIEEYKFSITQLVTKNSHAILRNYVNGAHYNITTEPVEHLT
                     DINCQELIHELHQKSVPQVQIELQSFDQNIATFKSVENKGKLVPCLEASLLLQVGCLK
                     PGESRSLIFEMRIDKHGLRRFLADKHGLLTSSPDCAESPSLSLVHCHYAPAFSRERRR
                     AACSGVAFSFNFCRRGCSPIVSLVASPVSPDPAAAGALEAPEDDLYVDIPLVAPLSPA
                     RDAVFVGRQIQLLVVDALGRLGVETPRSMPCVSPARLRELVSVLFGMSRDCACTVPAY
                     VREAHPTLAIHQQTEALCKKLEQIVDAYEHGGRDTDAAGIPHWAQLARALYLSLM"
     gene            <434357..>434932
                     /locus_tag="AGOS_AEL103W"
                     /old_locus_tag="AEL103W"
                     /db_xref="GeneID:4620947"
     mRNA            <434357..>434932
                     /locus_tag="AGOS_AEL103W"
                     /old_locus_tag="AEL103W"
                     /product="AEL103Wp"
                     /transcript_id="NM_210112.1"
                     /db_xref="GeneID:4620947"
     CDS             434357..434932
                     /locus_tag="AGOS_AEL103W"
                     /old_locus_tag="AEL103W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL158C (CIS3), YKL164C (PIR1) and YKL163W (PIR3);
                     Inverted gene duplication in Saccharomyces cerevisiae'"
                     /codon_start=1
                     /product="AEL103Wp"
                     /protein_id="NP_984758.1"
                     /db_xref="GeneID:4620947"
                     /translation="MQFKTTALSTLLYAAAYVAAQEENSSSWTTLSHTATYTGVAVTD
                     YATTFGIAVQPITTSVSEAPKEHKEKPTSTCDGPVATAKPEIDVKVSACANEGTLRMT
                     LTDGILYDGRGRIGAIVSNRQFQFDGPPPQAGSIYAKGWALTEEGNLALGDSDVFYQC
                     LSGNFYNLYDQNIAPQCSPIKLQAIKLVDNC"
     gene            435565..435664
                     /locus_tag="AGOS_t0105"
                     /db_xref="GeneID:4620948"
     tRNA            join(435565..435601,435620..435664)
                     /locus_tag="AGOS_t0105"
                     /product="tRNA-Ser"
                     /codon_recognized="AGC"
                     /db_xref="GeneID:4620948"
     gene            <435787..>436356
                     /locus_tag="AGOS_AEL102W"
                     /old_locus_tag="AEL102W"
                     /db_xref="GeneID:4620949"
     mRNA            <435787..>436356
                     /locus_tag="AGOS_AEL102W"
                     /old_locus_tag="AEL102W"
                     /product="AEL102Wp"
                     /transcript_id="NM_210113.1"
                     /db_xref="GeneID:4620949"
     CDS             435787..436356
                     /locus_tag="AGOS_AEL102W"
                     /old_locus_tag="AEL102W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR339C (FCF1)"
                     /codon_start=1
                     /product="AEL102Wp"
                     /protein_id="NP_984759.1"
                     /db_xref="GeneID:4620949"
                     /translation="MGRAKKTRKFALVKRTLNAKKDTRIKANAEKEAKKDDPELTKHI
                     PQVSSALFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCV
                     MAELEKLGPKYRIALKLARDPRIKRLNCSHKGTYADDCLVNRVLQHKCYIVATNDAGL
                     KQRIRKVPGIPLMSVGGHSYVIEKLPDVF"
     gene            complement(<436424..>436963)
                     /locus_tag="AGOS_AEL101C"
                     /old_locus_tag="AEL101C"
                     /db_xref="GeneID:4620950"
     mRNA            complement(<436424..>436963)
                     /locus_tag="AGOS_AEL101C"
                     /old_locus_tag="AEL101C"
                     /product="AEL101Cp"
                     /transcript_id="NM_210114.1"
                     /db_xref="GeneID:4620950"
     CDS             complement(436424..436963)
                     /locus_tag="AGOS_AEL101C"
                     /old_locus_tag="AEL101C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YLR326W"
                     /codon_start=1
                     /product="AEL101Cp"
                     /protein_id="NP_984760.1"
                     /db_xref="GeneID:4620950"
                     /translation="MMLLASVPLSYLYRRFVGKYKLEMEDPYFEEVEFEKRPFWGGST
                     KVVKRRREKVIPDHIPKRDKNVLQRLKKRAYGMDMAFSLCGLRFGWLGILGMLPVVGD
                     IAGVVMSLLTLREANGVQGGLPMGVVLAFLLNIVVDFVVGLIPLVGDMISIAYKANSR
                     NVLVLERYLSQKYAKQHAD"
     gene            <437279..>438136
                     /locus_tag="AGOS_AEL100W"
                     /old_locus_tag="AEL100W"
                     /db_xref="GeneID:4620951"
     mRNA            <437279..>438136
                     /locus_tag="AGOS_AEL100W"
                     /old_locus_tag="AEL100W"
                     /product="AEL100Wp"
                     /transcript_id="NM_210115.1"
                     /db_xref="GeneID:4620951"
     CDS             437279..438136
                     /locus_tag="AGOS_AEL100W"
                     /old_locus_tag="AEL100W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR090C (YNG2)"
                     /codon_start=1
                     /product="AEL100Wp"
                     /protein_id="NP_984761.1"
                     /db_xref="GeneID:4620951"
                     /translation="MSFERPQDPSSALEQATQDVSNLKSESRFLLEEIRASDLEFYES
                     KKRFLNKDTQIHKFIKQHGSLVDNPKEAEFQERIKEDLERCHQLQVDKCTVANSLLYM
                     VTKHLKKVQANIEALEEDGLLAPLEDDAVELANELSRESSVLSSGTSLERRKRTVAAG
                     TLSAGSSLRKRVKKERGRSTQRDGMLSEPPSDEASSHGANFADDLQDFNDELFSLNQQ
                     EEDDKQLYCFCQSVSYGEMVACDGPNCKYEWFHYGCVNLDEPPKGQWYCPECRQEMAN
                     LKLKKKKRV"
     gene            <438419..>440422
                     /locus_tag="AGOS_AEL099W"
                     /old_locus_tag="AEL099W"
                     /db_xref="GeneID:4620952"
     mRNA            <438419..>440422
                     /locus_tag="AGOS_AEL099W"
                     /old_locus_tag="AEL099W"
                     /product="AEL099Wp"
                     /transcript_id="NM_210116.2"
                     /db_xref="GeneID:4620952"
     CDS             438419..440422
                     /locus_tag="AGOS_AEL099W"
                     /old_locus_tag="AEL099W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR338C"
                     /codon_start=1
                     /product="AEL099Wp"
                     /protein_id="NP_984762.2"
                     /db_xref="GeneID:4620952"
                     /translation="MVGLTETISKAFNDVRPTLRSVGVANNHRHISLGLLPPNRKNPL
                     VRKYRKKARLHETDRGSFYSLDEDFGSVMGADPSMLDVTAEEEGVLDGGELSRTVSLP
                     STLASEAGPSSALNVDWILEEHERRYSTVNGSAEDIVAVDVEGAAPDMVHYTHFMHRV
                     KQQLPSDKAEVRVLRPRKLSYYSIGSKGGPSSAFRGSEDLDDEPATVKSESLVLLCYS
                     VPLIFTFLLEQMFPVVCALVVGHLGKNELAAVSLASMTTNITFAIFEGISTSLDTLCP
                     QAYGARNYYGVGLHMQRCVLFSLAFFVPFAALFWFSEGILPYLIKEKSLVPLTSQFLR
                     VMIVGGPGFILFENLKRYLQAQGIFDAGIYVLLICCPLNIVMSYLLVWNPVIGLGFIG
                     APIAVALNFWCMFLLLLLYCIYFNGSKCWGGLSRKAFDHWKDLSKLAVPGIIMLEAED
                     MSYEILTLFSSYLGTEYLAAQSAVSTTVAMLYMIPFAVGISVSTRIAQYIGARNPDNA
                     RLASRVGIASSAVVGIVNCTMLILGRDLIPRIYSSDAEVIRLMREILPLLGLVEIFDA
                     LNAIAGSCLRGQGMQYVGSVVNLVVYYLFAIPLGMLLSWTFDMKLSGLWVGIGSGMLV
                     IGLIEGYYVLFADWDMLIDRAEMLKETEDDSDEEVDEFSALLP"
     gene            <440701..>442164
                     /locus_tag="AGOS_AEL098W"
                     /old_locus_tag="AEL098W"
                     /db_xref="GeneID:4620953"
     mRNA            <440701..>442164
                     /locus_tag="AGOS_AEL098W"
                     /old_locus_tag="AEL098W"
                     /product="AEL098Wp"
                     /transcript_id="NM_210117.2"
                     /db_xref="GeneID:4620953"
     CDS             440701..442164
                     /locus_tag="AGOS_AEL098W"
                     /old_locus_tag="AEL098W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YNL277W (MET2)"
                     /codon_start=1
                     /product="AEL098Wp"
                     /protein_id="NP_984763.2"
                     /db_xref="GeneID:4620953"
                     /translation="MTSFLYSGKRFIAKAAGRSTNPQMSFPCLDKLDALTAKLKENRI
                     GSINGGSTVGDFYGTLADNEPVYGNVKSGYQLYSCEEPLLLDYGGVLLGFRIAYETWG
                     TLNAERSNAVLLHTGLSASSHARSSELNGIPGWWEKFIGPGSKILDTNRFFVVCTNVL
                     GGCYGSTGPSSADPADGEPYATRFPILSIQDIVRAQHKLVRECFGIEKLYASVGSSMG
                     GMQSLAYGQLFPSDVEKIVSISACAQSDPSSIALRHAQRQVLMADVNWNRGLYYPSEK
                     YPDRIPPHVGMKLAREIATVTYRSGPEWESRFGTERLDPDGTPTLCPDFLVESYLNHQ
                     GEKFSLEYDANSFLYLSKTMDLFDLSASHLRRSQQKRMEAAVRLKRGTLSNTSSVYAE
                     PPTKKKSRTISIEENHRDLVEGMAPLRDKDILIIGVQSDALFPAAQQRKIVELLGNSR
                     GVHYIELTQEQSIFGHDTFLLDTEHIGLPIGKFLSGT"
     gene            complement(<442327..>443172)
                     /locus_tag="AGOS_AEL097C"
                     /old_locus_tag="AEL097C"
                     /db_xref="GeneID:4620954"
     mRNA            complement(<442327..>443172)
                     /locus_tag="AGOS_AEL097C"
                     /old_locus_tag="AEL097C"
                     /product="mitochondrial 37S ribosomal protein MRPS28"
                     /transcript_id="NM_210118.1"
                     /db_xref="GeneID:4620954"
     CDS             complement(442327..443172)
                     /locus_tag="AGOS_AEL097C"
                     /old_locus_tag="AEL097C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR337W (MRPS28)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS28"
                     /protein_id="NP_984764.1"
                     /db_xref="GeneID:4620954"
                     /translation="MLSRDLVRMSLSSVRAFSSTSVACSTKAVRALRAQKIRQANQAK
                     QNKLKSSLGAVDPVLGRKDTPFVVRMLAELREPHVLVNDYKTEEVDKMMASIEAARRE
                     RMQLSGMETFAGSNFDAASIAARREAVMRILNMRNADQATAVKRATRLAMEEFQRFPG
                     DTGSSEVQAAVLTINIQKIAAHVKDNKKDNLNTRRLRMLVQQRQGILRYLKRDNPQRY
                     YWTIEKLGLDDNAVEMEFNMDRRYMQDYKFFGDRILIKDSKKVASAKRRASRKERKLA
                     AAAMQ"
     gene            <443823..>444461
                     /locus_tag="AGOS_AEL096W"
                     /old_locus_tag="AEL096W"
                     /db_xref="GeneID:4620955"
     mRNA            <443823..>444461
                     /locus_tag="AGOS_AEL096W"
                     /old_locus_tag="AEL096W"
                     /product="AEL096Wp"
                     /transcript_id="NM_210119.1"
                     /db_xref="GeneID:4620955"
     CDS             443823..444461
                     /locus_tag="AGOS_AEL096W"
                     /old_locus_tag="AEL096W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR089C (GAR1)"
                     /codon_start=1
                     /product="AEL096Wp"
                     /protein_id="NP_984765.1"
                     /db_xref="GeneID:4620955"
                     /translation="MSFRGNSRGGRGGARGGSRGGRGGFGGRQFQQGPPDSVVEMGAF
                     MHDCEGDIVCRSINTKIPYFNAMIYLENKTEVGKVDEILGPLNEVFFTIKCAEGVKAS
                     SFKDGDKFYISPEKLLPIERFIPKPKVAGPPKPKRKRAAGGAPGRGGFGGRGGSRGGF
                     GGRGGARGGFGGRGGARGGFGGFGGRGGSRGGFGGRGGARGGSRGGRGGKRF"
     gene            complement(<444634..>445710)
                     /locus_tag="AGOS_AEL095C"
                     /old_locus_tag="AEL095C"
                     /db_xref="GeneID:4620956"
     mRNA            complement(<444634..>445710)
                     /locus_tag="AGOS_AEL095C"
                     /old_locus_tag="AEL095C"
                     /product="AEL095Cp"
                     /transcript_id="NM_210120.1"
                     /db_xref="GeneID:4620956"
     CDS             complement(444634..445710)
                     /locus_tag="AGOS_AEL095C"
                     /old_locus_tag="AEL095C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR336W"
                     /codon_start=1
                     /product="AEL095Cp"
                     /protein_id="NP_984766.1"
                     /db_xref="GeneID:4620956"
                     /translation="MAATRRSANCLQQLRSYGIDVKQLVLNTKVNVPSKEATVKPSKV
                     PVTLSKPIPKATTSISMQLFEEYNPGIVLPKAADMSLISRFFNSSKVKFEWCAREYLE
                     IPGERYKIEQAQLQQQELLDEKSFNESLDIREPTEAYRVSADIKNRPIPNTEQLTRGS
                     FLLHDELPEIIFLGRSNAGKSTLLNNLTTNFKQVQLNRHATTSKKAGHTRALYCYNVG
                     NRLRLVDSPGYGVMSTQQQGECTMQYIRERKQLRRCFMLISAKDGFTKTDYGMLEFLM
                     NYGIAFEVIFTKMDKVRDVKTLRDSISTSGILDAPIRPRLMFLNSVVNKAYPKRLGIA
                     HLRQTIFEACNIKPNTLPSKAYKQ"
     gene            complement(<445920..>449585)
                     /locus_tag="AGOS_AEL094C"
                     /old_locus_tag="AEL094C"
                     /db_xref="GeneID:4620957"
     mRNA            complement(<445920..>449585)
                     /locus_tag="AGOS_AEL094C"
                     /old_locus_tag="AEL094C"
                     /product="AEL094Cp"
                     /transcript_id="NM_210121.1"
                     /db_xref="GeneID:4620957"
     CDS             complement(445920..449585)
                     /locus_tag="AGOS_AEL094C"
                     /old_locus_tag="AEL094C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR335W (MSN5)"
                     /codon_start=1
                     /product="AEL094Cp"
                     /protein_id="NP_984767.1"
                     /db_xref="GeneID:4620957"
                     /translation="MDTNGAGHIVSALEIIYSPKSSNQQRLEAQKFLDQVKEHGESPF
                     WGYEIALNNGQNSILKHFGLGLLVHALQRHWKDYDPEKRVALRKWVQELNYHVTPEDP
                     RYIKEKLAYLWVEVAKRVWGEALKGDEVSEHALMESWVDMDRNLAELWHMSEASRELT
                     LIIFRTLFEDTFLLEDLTVLKRISVVQPLCIMILCPLDLFSEHYKHTDKWQLFKSHPE
                     GWFGIWVSDLLRSLETSNTQYTLRLLETLKTCLNWPISDVVVRYDILGALLKCLLSDI
                     PRAQAISLDSIHILLTRPYNSHTHFDHIISKVFNSMSLLDKVYENLQFNPQHGVDESK
                     YPIVKKFADMITCLHKSILRFSADDKNVELYLRLVLKTTYNPSLIVSGISLDLWCTCI
                     RNDEFLPILEKYVLSDLLEFSANALVHYEQIDGHISKHYADVDFQSISDYNAFCSTYR
                     KRIRDVIRLISCIQVDYVYDWLCARLNNYFGSAYGQEILSSTFLNHKAEPYWSSLSQL
                     MIVECFINGCIRWKIWYTNEEDYNKKLEMILVKVETLSNQLISLNIRDPLLLKKQIQN
                     FALFLTILKDNVLFTLLEKIITSATMDYPDINIEDKTEKSDAVRELRYACGIELNRMA
                     LLMPDSLKDIYSDLENVVAGIMPKLTSHETISFKSFLLSIALTSSMDDKDSRFSAIVD
                     PELAAWSDKSTVVGLTDLPWFLERLGIVKITEYFQKRGIDENSNLLAVQIDEEGKQLK
                     VDLAKHWQTLFPVRATRMFIHYSMQTVKANEDFLKLQELWKPRIVPIMPYILRLLYQL
                     QSYHDPENWKELPIVVQSFINCSTIERFWEAGATNKSKDEFIDEHMKALQTVRDFADS
                     VGHIVRYTREYVLLILSGISSLGSIFYEIEDIPNLLMDSIAIYKPNSDDISPGVSTHG
                     WKHIINVAIRPILKGCPEQCAPAFMSRFLPKLFDTMAVILCKKWSAYMNNTNMSPSPV
                     DDDEMTEEILEENLLRQLTTVVVRLLIDCVGQVGTSSQVTKLKLSPHQIKMRRVIFGD
                     INVMASYLKLLNCLISFRDSKCSFNAILIMKGSLTETLIKHEDVDNFYITEILPNFLM
                     NVLTQNAFKDSFHEAMYVFTVAFLTLCKERESCRTYFYDLSRGYDINSLYENLRRVDN
                     YKDQKVLMVDFIEWIKAVKGDPEDVNEDDNKKRERREAVLARANERLIKKNKDQGDML
                     DDPNTEDGAFGRLFDDH"
     gene            complement(<449952..>450830)
                     /locus_tag="AGOS_AEL093C"
                     /old_locus_tag="AEL093C"
                     /db_xref="GeneID:4620958"
     mRNA            complement(<449952..>450830)
                     /locus_tag="AGOS_AEL093C"
                     /old_locus_tag="AEL093C"
                     /product="AEL093Cp"
                     /transcript_id="NM_210122.1"
                     /db_xref="GeneID:4620958"
     CDS             complement(449952..450830)
                     /locus_tag="AGOS_AEL093C"
                     /old_locus_tag="AEL093C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR088W (RPF1)"
                     /codon_start=1
                     /product="AEL093Cp"
                     /protein_id="NP_984768.1"
                     /db_xref="GeneID:4620958"
                     /translation="MAAEDIRIKNKMKRKQLFAELKDKQNKERHKMRRLRAKEERENP
                     ALKEERLEKNVPKTIDSMRVFDESIGQDVEGEQDELQAFFNSGEPPKILLTTNVNARK
                     KAYEFANVLIEVLPNVTFVKRKFGYKLKEIAEFCNNRNYTDLVVINEDKKEVTGLTFI
                     HLPAGPSFYFKLSSYVEVEKIHGHGRPTSHIPELILNNFSTRLGKTVGRLFQSIFPQS
                     PDIEGRQVITLHNQRDYIFFRRHRYIFRNEEKVGLQELGPQFTLKLRRLQRGIKEETE
                     WEYKPEMDKDKKRFHL"
     gene            <451943..>453808
                     /locus_tag="AGOS_AEL092W"
                     /old_locus_tag="AEL092W"
                     /db_xref="GeneID:4620959"
     mRNA            <451943..>453808
                     /locus_tag="AGOS_AEL092W"
                     /old_locus_tag="AEL092W"
                     /product="AEL092Wp"
                     /transcript_id="NM_210123.1"
                     /db_xref="GeneID:4620959"
     CDS             451943..453808
                     /locus_tag="AGOS_AEL092W"
                     /old_locus_tag="AEL092W"
                     /note="NOHBY507; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F21714g"
                     /codon_start=1
                     /product="AEL092Wp"
                     /protein_id="NP_984769.1"
                     /db_xref="GeneID:4620959"
                     /translation="MMDHNSDIDRTRREVLQELIHTEGDYVSMFGLFRESYLKVLARE
                     EEHVVFRSMEGVVKELVRWHRRMEFDLQRIMREHDPNSVETALRVSKLVVAYMARLEA
                     LYRSYIYHFRASTRLFAEEAYYGKVMSELMGRLDHGVRTYQRTQFSGLEKRHLWQKDT
                     SYDCLSHLPISRLTNYKLFLEVIGKNVTSPVDKRRIAGYTRKASEIIHQINSDNSTMD
                     PVNAVIQRRLRFPTVEYAPVSAFGQCLLAGCLNAMWVRRRSSYGFAVTAEPLGAFLFK
                     SYLILADICHDWWTVKHCVPMVRCNIHDLTDVISVSDRDSPKLREAISEATSGSNTAP
                     VEGTIIDTGNNPPMALKLEFYFYGQCFELTFAFRHAQEYQVWKQYLETVKELNGPSVS
                     DFEQLTDIGESTMVPRDMVPRTTVASRCPKVNELHNLTNAQRDMLKHSPSDYYGENSI
                     QINVSFSGSQRTQQKYQTLSRNKSDSNSYSAKFDSGRRLHIEALMFDVWSDALVRTPS
                     LEYIMTSYSDTITSVATTRPPSSTRSSWGMFSIRSDNTRATSILEPTNNQDLSSQQNN
                     HNHTQTCNNCSNTTNTTNGNNNKSGTIGRLGTINKLRNYLTVKTYNKQFSENQVA"
     gene            complement(<454022..>455851)
                     /locus_tag="AGOS_AEL091C"
                     /old_locus_tag="AEL091C"
                     /db_xref="GeneID:4620960"
     mRNA            complement(<454022..>455851)
                     /locus_tag="AGOS_AEL091C"
                     /old_locus_tag="AEL091C"
                     /product="AEL091Cp"
                     /transcript_id="NM_210124.2"
                     /db_xref="GeneID:4620960"
     CDS             complement(454022..455851)
                     /locus_tag="AGOS_AEL091C"
                     /old_locus_tag="AEL091C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL066C (RIB2) and YDL036C (PUS9)"
                     /codon_start=1
                     /product="AEL091Cp"
                     /protein_id="NP_984770.2"
                     /db_xref="GeneID:4620960"
                     /translation="MLKGVPGLLFKETQRHLKPRLVRIMENTSQDESRKRQVASNLSS
                     DADEGSPAVTRPVKITKRLRKKNLGTGELRDKAGFKLKVQDVSKNRHRQVDPEYEVVV
                     DGPMRKIKPYFFTYKTFCKERWRDRKLLDVFVDEFRDRDRPYYEKVIGSGGVLLNGKS
                     STLDSVLRNGDLISHELHRHEPPVSSRPIRTVYEDDDILVIDKPSGIPAHPTGRYRFN
                     SITKILEKQLGYTVHPCNRLDRLTSGLMFLAKTPKGADEMGDQMKAREVKKEYVARVV
                     GEFPIGEIVVDMPLKTIEPKLALNMVCDPEDEAGKGAKTQFKRISYDGQTSIVKCQPY
                     TGRTHQIRVHLQYLGFPIANDPIYSNPHIWGPSLGKECKADYKEVIQKLNEIGKTKSA
                     ESWYHSDSQGEVLKGEQCDECGTELYTDPGPNDLDLWLHAYRYESTELDENGAKKWSY
                     STAFPEWALEQHGDFMRLAIEQAKKCPPAKTSFSVGAVLVNGTEILATGYSRELEGNT
                     HAEQCALQKYFEQHKTDKVPIGTVIYTTMEPCSLRLSGNKPCVERIICQQGNITAVFV
                     GVLEPDNFVKNNTSRALLEQHGIDYILVPGFQEECTEAALKGH"
     gene            complement(<455933..>457219)
                     /locus_tag="AGOS_AEL090C"
                     /old_locus_tag="AEL090C"
                     /db_xref="GeneID:4620961"
     mRNA            complement(<455933..>457219)
                     /locus_tag="AGOS_AEL090C"
                     /old_locus_tag="AEL090C"
                     /product="AEL090Cp"
                     /transcript_id="NM_210125.2"
                     /db_xref="GeneID:4620961"
     CDS             complement(455933..457219)
                     /locus_tag="AGOS_AEL090C"
                     /old_locus_tag="AEL090C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL065C (INP54)"
                     /codon_start=1
                     /product="AEL090Cp"
                     /protein_id="NP_984771.2"
                     /db_xref="GeneID:4620961"
                     /translation="MKRLECHSSEADCFRISLTTSNCAKQIPLGSNDYLLQRAIFERL
                     LSAGVDYDLYAIGFQELLPIWDASCPLQTKSCLRRLVPVILQRLNSGVEDTPEVPVDR
                     NVQHSEADSLLGSLERQAIGDTEQSTQNAWPSRQVPVSYRFVACNAIGAVGLMLFAKE
                     DLKVEVLRTCNVRTGALGSSLKGSTAIQVQLSNSRCSQKFTFITSHFAAKEGPDKLAQ
                     RIKDYHTTMRTFDKHLDSFQDGHVFFFGDLNFRISPRQPTDLQYSDQPVIDHLLATYD
                     ELNRERTAGTVFEGFEEAKINFPPSYKYIFLQDNLNYDYTRQPSWCDRILYKNDPKRV
                     RVHRYASIDRRSILNYTDHEPVTLDVSVSCHTQFVPMAMQNISPQSTMEMYVGDVTDI
                     LLMLFSRVYYAPTIFDLVVLTIFLCLVLLALFRLTV"
     gene            complement(<457490..>460237)
                     /locus_tag="AGOS_AEL089C"
                     /old_locus_tag="AEL089C"
                     /db_xref="GeneID:4620962"
     mRNA            complement(<457490..>460237)
                     /locus_tag="AGOS_AEL089C"
                     /old_locus_tag="AEL089C"
                     /product="AEL089Cp"
                     /transcript_id="NM_210126.2"
                     /db_xref="GeneID:4620962"
     CDS             complement(457490..460237)
                     /locus_tag="AGOS_AEL089C"
                     /old_locus_tag="AEL089C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL035C (GPR1)"
                     /codon_start=1
                     /product="AEL089Cp"
                     /protein_id="NP_984772.2"
                     /db_xref="GeneID:4620962"
                     /translation="MEGASQIQCMDSNYTCVFGSYNTTTVNLVLGLPGMFSTFTSSQL
                     LKLRILAITASAVSIIAGIIGLEMVACIDRRRKVFRHHMVMFLIVFDLLKAIVLLVYP
                     VTILINNGVYATPAFFNVVGWLTAYAIEGADIAIVIFAIHFGLLIFRPNWKWPNPTTG
                     NMEGGFYKCRRFMYPIAGLLPMLLASLAFIGYDKKHDPSVSGVVILDNNTYHFPSDPR
                     VGGYKPMSAWCYLPPYPYWYKLVLSWGPRYVIFVSICGIYVSIYVYVSSKSQRIKSEL
                     GDFHQRTSSRRRVTLSSQETRDPPKTLQQRVVRSATYFADSLGLVWLFRTVKNFFLLT
                     AEDEQFESDPEDSCGDEEVEDFYHGVKSLNYDEEHLAPTTASDGASLGDGILPGPLGS
                     STGRHFLLPPTIANAYGSNTEGASRVSSAYAGDNAALLGVARDQQSLNSENDVKHKPS
                     LGRRESFFSNRSSCSRKFPKTAIQPLSPILSPSAMHVSRPLPVEMFEHNMDMKSAMAS
                     LHEPLHQYDYYYPGALTDLKKDIHSDTYKEFKRRRYQIRKQLKSLFIYPFAYLVVWLF
                     PFIVDCTHYRYELRNGPIIWLAYIATFMQPLNCLVDVFVASYRERPWRYTWSSIEKKE
                     ILNKYLLKGELGEQTIMELVNSDLGRRGWYYRGRWMKRECWRHKPSRWKRACWYVYRT
                     VKGFIKNDYDFTDNCNDHEYWEKYYTLGLSSESSYDTRKNTDNDTNPIGMSGTCPREA
                     NTAPVSKQENEIIRIPIYWRIIHCHPMMRGIDLDELDRKIRLKSKEYNFVTPGLHAAL
                     TGSARHCFDPTGDSYHQISDPSFPPNYSIGDGNKGTPASFAAPSDSGDLPVSLRVTAQ
                     DRAGDNVAFSDETNDVHFAQGTKGIDGQSVADSGSQMIDLLSFLKGHEDRPSRDTITH
                     Q"
     gene            complement(<460837..>461904)
                     /locus_tag="AGOS_AEL088C"
                     /old_locus_tag="AEL088C"
                     /db_xref="GeneID:4620963"
     mRNA            complement(<460837..>461904)
                     /locus_tag="AGOS_AEL088C"
                     /old_locus_tag="AEL088C"
                     /product="AEL088Cp"
                     /transcript_id="NM_210127.1"
                     /db_xref="GeneID:4620963"
     CDS             complement(460837..461904)
                     /locus_tag="AGOS_AEL088C"
                     /old_locus_tag="AEL088C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL064C (MET22)"
                     /codon_start=1
                     /product="AEL088Cp"
                     /protein_id="NP_984773.1"
                     /db_xref="GeneID:4620963"
                     /translation="MSYEKELRVAVQAVRKASLLTKRIQSQITSNKGLSSFTKDDNSP
                     VTIGDFGAQAVIINAIKVHFPDDKVVAEETSEGYSDELMEQVLSEIRGADSEFGAVLG
                     DVATEVPLTNSRFPLTSGVQVRAAIDAGNHTGGREGRFWCLDPIDGTKGFLRGAQYAV
                     CLALVVEGVVRLGVIGCPNLQLAPFGLQDPAPAPLGYLFKAVDGSGSFYGSTTSDVWS
                     PAAVRRLAHSSEMVALEGYEKTHSAHDAQAVIKESLGMTRSHQLDSQAKYCLLAAGLG
                     DLYLRLPLSLAYQEKIWDHAAGNVIVREAGGVHTDAVLGQPLDFGAGRTLLTKGVIAS
                     CGPASVHEHVVSISSDVIKNR"
     gene            complement(<462124..>463356)
                     /locus_tag="AGOS_AEL087C"
                     /old_locus_tag="AEL087C"
                     /db_xref="GeneID:4620964"
     mRNA            complement(<462124..>463356)
                     /locus_tag="AGOS_AEL087C"
                     /old_locus_tag="AEL087C"
                     /product="AEL087Cp"
                     /transcript_id="NM_210128.2"
                     /db_xref="GeneID:4620964"
     CDS             complement(462124..463356)
                     /locus_tag="AGOS_AEL087C"
                     /old_locus_tag="AEL087C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL033C (SLM3)"
                     /codon_start=1
                     /product="AEL087Cp"
                     /protein_id="NP_984774.2"
                     /db_xref="GeneID:4620964"
                     /translation="MYKSFIDICARRQTAGYRLPRVPSTHDNIIVAMSGGVDSSVCAA
                     LYAHFPKVRGLYMQNWSQTSGSGPVEGKAEPCYEQDWKDIEKVGAYLNIPVERVNFER
                     DYWLDVFEPMLQRYQQGYTPNPDIGCNRFVKFGALREHLDKEYGRGNYWLVTGHYARI
                     LSPQTRRETHLLRSHYAPKDQSYYLSQVGREALADLLMPMGFLTKPEVRQWAAELHLP
                     NATKPDSQGICFVNNSQHGRFQNFLQEYLPSSVGHIVTVEEESGTRRIWGQHRGIWSY
                     TIGQRVGISLPQGDPKYQGAWYVSHKDPKTNTIEIVKGRDNRALYKDTLSVSDFESLV
                     PPEDLASTLEAAMTNGELYMQFRSLQQAVKVTRLQLQDSGFELQLATAQRAMAPGQYC
                     CLYHNDRVLGSGTVRATF"
     gene            <463726..>466608
                     /locus_tag="AGOS_AEL086W"
                     /old_locus_tag="AEL086W"
                     /db_xref="GeneID:4620965"
     mRNA            <463726..>466608
                     /locus_tag="AGOS_AEL086W"
                     /old_locus_tag="AEL086W"
                     /product="AEL086Wp"
                     /transcript_id="NM_210129.1"
                     /db_xref="GeneID:4620965"
     CDS             463726..466608
                     /locus_tag="AGOS_AEL086W"
                     /old_locus_tag="AEL086W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL031W (DBP10)"
                     /codon_start=1
                     /product="AEL086Wp"
                     /protein_id="NP_984775.1"
                     /db_xref="GeneID:4620965"
                     /translation="MGLASKRKRDTEEHSDEGEDFDIAGNIALDSEDSDDSVSDSDNE
                     VQDIIEFSDDEKQNAPQVSKTAKGAKGAKVAAPRSDAAFPSLELSDGEDADNGDKDDV
                     DSYFNTTSQLAASKAKKGSFASFGLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDI
                     VGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSN
                     LRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRL
                     FEMGFQEQLNELLGSLPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSEN
                     LEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRKQSNDDADDSDDETDKKKK
                     HSKKSKQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARR
                     QQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKG
                     WAYTILSESELPYLLDLELFLGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKIS
                     YVNRLILGSAPRLDLEAMGDLFKNLVESNFELQNLKAVSIKAEKLYLRTRQPASAESI
                     KRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQNRHNKETVFEFARNHDDEMAILMK
                     RRRRQIAPIQQRAKERQQLLEKERQAGLRHTLEDEILKGEENEVGYSVPQELLRDFED
                     ADELAAKRNTKKGFRDENFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDKV
                     QVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAP
                     LKVGARESSIPANLLADPTGSRLANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAME
                     SGLHVKGYNAPGMKQELRTTEQIRKQRSMAEKRKAKNARPAKKRKF"
     gene            <466788..>468374
                     /locus_tag="AGOS_AEL085W"
                     /old_locus_tag="AEL085W"
                     /db_xref="GeneID:4620966"
     mRNA            <466788..>468374
                     /locus_tag="AGOS_AEL085W"
                     /old_locus_tag="AEL085W"
                     /product="AEL085Wp"
                     /transcript_id="NM_210130.2"
                     /db_xref="GeneID:4620966"
     CDS             466788..468374
                     /locus_tag="AGOS_AEL085W"
                     /old_locus_tag="AEL085W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL030W (PRP9)"
                     /codon_start=1
                     /product="AEL085Wp"
                     /protein_id="NP_984776.2"
                     /db_xref="GeneID:4620966"
                     /translation="MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNP
                     DEKVLDNISKDDINSNRIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSD
                     DIESLRDPNMNFETFEADIKELQERQAEGADSESAISSLERKRREYSMFSASSGADQT
                     ILSNVGQFIDVNKLFMWEEHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGT
                     GYLTAPPVDRNSKRYQVFIQKLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPV
                     EDPPRGLLCIACGKHFKVGTVFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATS
                     IENTRALVERKYAFTSGERNREMATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDV
                     NPLNLPLGPDGYPIPYWLYKLQGLDIEYACEICGNHVYKGRRIFERHFQEQRHAYGLR
                     CLGIEPSPAFKDIYNIAEAQQLFQSLQSSTGPAGLATRRAGAISSSANTRKLEVEVED
                     EDGNVMTHQVYEDLKKQGLL"
     gene            <468542..>469843
                     /locus_tag="AGOS_AEL084W"
                     /old_locus_tag="AEL084W"
                     /db_xref="GeneID:4620967"
     mRNA            <468542..>469843
                     /locus_tag="AGOS_AEL084W"
                     /old_locus_tag="AEL084W"
                     /product="AEL084Wp"
                     /transcript_id="NM_210131.1"
                     /db_xref="GeneID:4620967"
     CDS             468542..469843
                     /locus_tag="AGOS_AEL084W"
                     /old_locus_tag="AEL084W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR029C (CDS1)"
                     /codon_start=1
                     /product="AEL084Wp"
                     /protein_id="NP_984777.1"
                     /db_xref="GeneID:4620967"
                     /translation="MTDKDSRKEDMGENLTSDGEVASVKDKVATNPNGDPRLLEDSKV
                     YNFVVRTIWTLIMIAGFFITLAMGHFWCVILILGCQIATFQECIAVTAESGREKNLPL
                     TRTLNWYFLFTTIYYLDGKSLYKLFRHYTINYRVLGFIAANHKFISYCMLVFGFVVFV
                     CSLRKGFLKFQFASLCVTHMVLLLVVFQAHLIINNVLNGLIWFLLPCGLVIVNDIFAY
                     LCGITFGRTKLIAISPKKTLEGFLGAWFFTGLAALVLTRLLTPYTYMTCPVQNIHTNV
                     FSPLNCETNPVFIPQTYRLPPIIFDRFNVSTITFKPIYMHAFNLATFASLFAPFGGFF
                     ASGLKRTFKVKDFGHSIPGHGGITDRVDCQFMMGSFMNLYYETFISEKRITVETVLST
                     ILMNFDERQILQLIAALNRVLWENGKMAGDNYERISELYNI"
     gene            <470172..>471782
                     /locus_tag="AGOS_AEL083W"
                     /old_locus_tag="AEL083W"
                     /db_xref="GeneID:4620968"
     mRNA            <470172..>471782
                     /locus_tag="AGOS_AEL083W"
                     /old_locus_tag="AEL083W"
                     /product="AEL083Wp"
                     /transcript_id="NM_210132.1"
                     /db_xref="GeneID:4620968"
     CDS             470172..471782
                     /locus_tag="AGOS_AEL083W"
                     /old_locus_tag="AEL083W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR028C (YPK3)"
                     /codon_start=1
                     /product="AEL083Wp"
                     /protein_id="NP_984778.1"
                     /db_xref="GeneID:4620968"
                     /translation="MALFKFDEEISRRTSNCSGAILLDEFEDSHSEPSHDVDSDDFGQ
                     HHEQDLPWYKNLMSLNPTATAPKDFVSSPLVHSSISAREPAYTPARSRRRSSLYNKFA
                     VSTPPNTTRFPVSVDAEAFLDPTLPEGMSPSFQKRQTPRKLEDFKPVRVLGRGAYGKV
                     LLVKDQLTSKLFAMKQLKKAEIVVTAPEEESTDGEDAVLLPAVVEKRVERTFAERTIL
                     SQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLKEQGTLDEVTVSFYAAEISCA
                     LKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVNQADSPLGGEQVEELYSII
                     GTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTGANHKVILSKIKQDKGIK
                     IPHYLSDGMKDYLNALLKKDIGKRWDVDRFWDKEGTKTKKKKAGQAKTSCYQSHFIFR
                     KINWKLMENGDLQRTTYGPIIPVITDWELAENFDSEFTGMRLESEDIQENGIRIQNNR
                     DGSSGGMRNDVFKGFSFVASTSYLDRYF"
     gene            complement(<471962..>472540)
                     /locus_tag="AGOS_AEL083CA"
                     /db_xref="GeneID:9487587"
     mRNA            complement(<471962..>472540)
                     /locus_tag="AGOS_AEL083CA"
                     /product="AEL083C-Ap"
                     /transcript_id="NM_001355321.1"
                     /db_xref="GeneID:9487587"
     CDS             complement(471962..472540)
                     /locus_tag="AGOS_AEL083CA"
                     /note="NOHBY534; No homolog in Saccharomyces cerevisiae,
                     syntenic homolog of Kluyveromyces lactis KLLA0F24596g"
                     /codon_start=1
                     /product="AEL083C-Ap"
                     /protein_id="NP_001342265.1"
                     /db_xref="GeneID:9487587"
                     /translation="MEKGDKIYSSVTQRISGELNINIDINIERGQELGVRLNKGKVMK
                     YWSTVKRYLIDTGDIYEDEHLVHSECGLLLRDHAQAGSVYEPNSSDEFINKKLFQKSL
                     TAAQWQRRKQEALESQVRNEIISETSEQRLKRFTRGYRRSQNMEIAPVSRGPIAERSR
                     SSESTGSDRETRRGRSHKWGSLQLKTVIVPID"
     gene            <473280..>475325
                     /locus_tag="AGOS_AEL082W"
                     /old_locus_tag="AEL082W"
                     /db_xref="GeneID:4620969"
     mRNA            <473280..>475325
                     /locus_tag="AGOS_AEL082W"
                     /old_locus_tag="AEL082W"
                     /product="AEL082Wp"
                     /transcript_id="NM_210133.1"
                     /db_xref="GeneID:4620969"
     CDS             473280..475325
                     /locus_tag="AGOS_AEL082W"
                     /old_locus_tag="AEL082W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YBR015C (MNN2)"
                     /codon_start=1
                     /product="AEL082Wp"
                     /protein_id="NP_984779.1"
                     /db_xref="GeneID:4620969"
                     /translation="MASEQSTKPAHGSLRLATYARQLCHVWRRKFGMHTLVLAGLSML
                     ASTAFLLVYNRVYEGAQHGLFRSRVDVEVPTNIWQYADEALPDRRTFVEEILRTVQAY
                     PPGAALQVQADCLLERVRATDERKFGSLTASKLQGCVDLSGDAFAHAKEQHALMMKVI
                     QKSLPEHLSDLDHYPYISDGIVILGGGHKTIAAIPAIRSIRENSGITVRNSMPIEVVI
                     PGPADEEKVFCSKILPVLDPSGLTRCVHLGDTISSSLLSKVKPSDHRTLALLASSFSR
                     VLYLDSSVQVINAIDGYFHHELFNERGLVLWPDYWRRLHHPKLYELAGSKVDTGRRER
                     YSIDKGSPIELYGGKDGEWPMHDCKDSIPDASSSSGVLLIDKKKHFKTLALALYYNVH
                     GEPFFYPLLDPKAPREAEKDTIVFAAHVLSRGGGPLYHQVTTPKRSEGHRKDKASSKP
                     ILEDTVDTSTIITSTYRHGAASYHDFFADHNFELLAGEIINSNFDSRRLAYVKWWRQN
                     HSDDTTYKDKSDEDLSNDASVKADFYTSFHGNYTLAEYLNFFEFTPVSFVETDVLTCN
                     PWIVAQSRDLTFDGASAVGAQPANQQTQYKAGPPTHHRLFSDHFQKLTTYDLELATWS
                     AYAEFLCSKFSYKDYPYLKEHLGLTDSPTTAYKMMCKYISARVSHLQSTSWHTMGNK"
     gene            <475573..>476703
                     /locus_tag="AGOS_AEL081W"
                     /old_locus_tag="AEL081W"
                     /db_xref="GeneID:4620970"
     mRNA            <475573..>476703
                     /locus_tag="AGOS_AEL081W"
                     /old_locus_tag="AEL081W"
                     /product="AEL081Wp"
                     /transcript_id="NM_210134.2"
                     /db_xref="GeneID:4620970"
     CDS             475573..476703
                     /locus_tag="AGOS_AEL081W"
                     /old_locus_tag="AEL081W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR026C (ETR1)"
                     /codon_start=1
                     /product="AEL081Wp"
                     /protein_id="NP_984780.2"
                     /db_xref="GeneID:4620970"
                     /translation="MQALNTTKRLMSTKQFPLFKSLLYSSHDPADCTQVLKVHSYTPK
                     VGADESILLRTLAFPINPSDINQLQGVYPSVPEKTLDYSTEKPAAIAGNEGVFEVMSV
                     PQGERRLAVGDWVIPLYSNTGTWTNYQTCRDAGTLVKVNGLDLYTAATIAVNGCTAYQ
                     LVNDYVQWDPSGNEWIVQNAGTSAVSKIVTQVAQARGVKTLSVIRDRENFAEVAKELE
                     ERYGATKVISETQNNDKDFSKDELPVILGPNARVRLALNSVGGKSSGAIARKLERDGT
                     MLTYGGMSRQPVTVPTTLLIFNGLKSLGYWITENTKRNPQSKIDTISALMRMYGDGQL
                     QPPEADIKKIEWDVQKMNDEQLLEAVKNGIQSNGKSVVVLKW"
     gene            476920..476993
                     /locus_tag="AGOS_t0106"
                     /db_xref="GeneID:4620971"
     tRNA            476920..476993
                     /locus_tag="AGOS_t0106"
                     /product="tRNA-Asn"
                     /codon_recognized="AAC"
                     /db_xref="GeneID:4620971"
     gene            complement(<477075..>477511)
                     /locus_tag="AGOS_AEL080C"
                     /old_locus_tag="AEL080C"
                     /db_xref="GeneID:4620972"
     mRNA            complement(join(<477075..477202,477253..>477511))
                     /locus_tag="AGOS_AEL080C"
                     /old_locus_tag="AEL080C"
                     /product="AEL080Cp"
                     /transcript_id="NM_210135.1"
                     /db_xref="GeneID:4620972"
     CDS             complement(join(477075..477202,477253..477511))
                     /locus_tag="AGOS_AEL080C"
                     /old_locus_tag="AEL080C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL108C (INO4); 1-intron"
                     /codon_start=1
                     /product="AEL080Cp"
                     /protein_id="NP_984781.1"
                     /db_xref="GeneID:4620972"
                     /translation="MATGKVTKKRVAPAILDNGIAAPSLVFQARPNVSREKLTGTQKR
                     ENHVTSEQRRREILREYYDELVRLVPDLQESENRSEWQIYMKTRNYLCWLYKRNAQLR
                     RQLKLTNVKYPEYLVWKCPNALNGPG"
     gene            <478162..>479163
                     /locus_tag="AGOS_AEL079W"
                     /old_locus_tag="AEL079W"
                     /db_xref="GeneID:4620973"
     mRNA            <478162..>479163
                     /locus_tag="AGOS_AEL079W"
                     /old_locus_tag="AEL079W"
                     /product="AEL079Wp"
                     /transcript_id="NM_210136.1"
                     /db_xref="GeneID:4620973"
     CDS             478162..479163
                     /locus_tag="AGOS_AEL079W"
                     /old_locus_tag="AEL079W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL107W"
                     /codon_start=1
                     /product="AEL079Wp"
                     /protein_id="NP_984782.1"
                     /db_xref="GeneID:4620973"
                     /translation="MTLSNKYIEIPGPPPLSWQTIPTATRYLSFAYVLFTVALWSTRR
                     TASSTVEDPQLVICPIVQLVPSQILKFPYSLLLSNLVDVELWKFVVDLLNLIIGGTYI
                     ESYWNSPQEMLKYTLMIGTATNLVMCLVTFVLSFFITSIRLEYPLDGNYTMLIGFAIV
                     YKQLLPETTIIEIRNVPFISKNFRFKLYPIFLLCTLTLSQVFWYHNISELISIWTTFF
                     TCWLYLRFYQVLPSAVTGNVTADQVVGDASDTFQLLYFFPDIIKPVLRPIFDKSYNLA
                     IEKYRWRTPFMPNDIELGNSLTESRVKSDITVTEERRKQLALQVLEQRINSDKEQPQ"
     gene            complement(<479288..>480163)
                     /locus_tag="AGOS_AEL078C"
                     /old_locus_tag="AEL078C"
                     /db_xref="GeneID:4620974"
     mRNA            complement(<479288..>480163)
                     /locus_tag="AGOS_AEL078C"
                     /old_locus_tag="AEL078C"
                     /product="mitochondrial 54S ribosomal protein YmL10/YmL18"
                     /transcript_id="NM_210137.1"
                     /db_xref="GeneID:4620974"
     CDS             complement(479288..480163)
                     /locus_tag="AGOS_AEL078C"
                     /old_locus_tag="AEL078C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL284C (MRPL10)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL10/YmL18"
                     /protein_id="NP_984783.1"
                     /db_xref="GeneID:4620974"
                     /translation="MFSLLTVRLGSLRGLSSPVQQPARFMSLLGSLRPSEGSTKTYKR
                     VGRGPSSGKGKTAGRGQKGQKARGHVKSWFEGGQTPIYKLFPKLGFTNVHSLQLRTLN
                     LERIMWFHRKGRLPLEEGEVLDMKKMKDFGLVTGTFKDGVKILANGKENFNIPIQIEA
                     TRASSEAIKAIEAAGGGFTARYFNRLSLRAHLSPHWFLEKRGRIPLPARPTKKKDINY
                     YSDMNKRGYLVKEQHPLYLEIQRLRALGTVSGGSKRAKKTALEIQLEAMEESAAVAPS
                     APSKSAIISLQELQQ"
     gene            <482236..>483246
                     /locus_tag="AGOS_AEL077W"
                     /old_locus_tag="AEL077W"
                     /db_xref="GeneID:4620975"
     mRNA            <482236..>483246
                     /locus_tag="AGOS_AEL077W"
                     /old_locus_tag="AEL077W"
                     /product="AEL077Wp"
                     /transcript_id="NM_210138.1"
                     /db_xref="GeneID:4620975"
     CDS             482236..483246
                     /locus_tag="AGOS_AEL077W"
                     /old_locus_tag="AEL077W"
                     /note="NOHBY506; Weak homolog in Saccharomyces cerevisiae
                     YPR013C; Similar to Ashbya gossypii ADR308C"
                     /codon_start=1
                     /product="AEL077Wp"
                     /protein_id="NP_984784.1"
                     /db_xref="GeneID:4620975"
                     /translation="MIFPIRYLYVSLAQFSAHENRALVALGYLQEEHTLGVEPQIVMF
                     HEPVSHPRSDYAFSDSVKLLPCMSSHTQGRHCQWYHQQQGPHMQGVYHGRSIRRLLDH
                     ITDLKYMLLDSMQNGMDVEEHCFVREQLMHLIQIVPHVHLSPTPNRMQLQVVEEHKGL
                     ERLAPAVQVQLPSIRSLIPGNEGTESVPQAPVTPEDISPSTSVTHAQHAHGDNVPRGE
                     GFQFRAHVPPPPFSAAMSASSAKADTASTAIATSAAVYADIEQLSSADKRQKGVRNQC
                     PVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQLQRGKEG
                     QV"
     gene            complement(<484363..>485310)
                     /locus_tag="AGOS_AEL076C"
                     /old_locus_tag="AEL076C"
                     /db_xref="GeneID:4620976"
     mRNA            complement(<484363..>485310)
                     /locus_tag="AGOS_AEL076C"
                     /old_locus_tag="AEL076C"
                     /product="AEL076Cp"
                     /transcript_id="NM_210139.1"
                     /db_xref="GeneID:4620976"
     CDS             complement(484363..485310)
                     /locus_tag="AGOS_AEL076C"
                     /old_locus_tag="AEL076C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL029C (BUD16)"
                     /codon_start=1
                     /product="AEL076Cp"
                     /protein_id="NP_984785.1"
                     /db_xref="GeneID:4620976"
                     /translation="MPRVLATQSHVVHGYVGNKAATFPLQYLGWDVDCVNSVQFSNHT
                     GYGIDKVFGSVTSSSELECLFNGVLSLASTGSQYDGILSGYLPNSHSVRTMGYYYQQL
                     KRQNSRLLWLMDPVMGDEDQLYVDKDVVPAYRELVESGSVDILTPNQFEMELLHGRKI
                     ASLQELEGAIKSIHRHVPIIVVTSLSPSVFADPDHVYCVASVRGSACNFYRVPLIDSY
                     FTGVGDLFSALLLHSAYGSLLQKQRNFAEDINWALNIVQQVLENTRQMSAVKSRAVIG
                     HAPSMLKMELRIVESRNFFRWRDSWSAEERDFKWFPCTS"
     gene            485973..486044
                     /locus_tag="AGOS_t0107"
                     /db_xref="GeneID:4620977"
     tRNA            485973..486044
                     /locus_tag="AGOS_t0107"
                     /product="tRNA-Met"
                     /note="Initiator tRNA"
                     /codon_recognized="AUG"
                     /db_xref="GeneID:4620977"
     gene            <486221..>487324
                     /locus_tag="AGOS_AEL075W"
                     /old_locus_tag="AEL075W"
                     /db_xref="GeneID:4620978"
     mRNA            <486221..>487324
                     /locus_tag="AGOS_AEL075W"
                     /old_locus_tag="AEL075W"
                     /product="AEL075Wp"
                     /transcript_id="NM_210140.1"
                     /db_xref="GeneID:4620978"
     CDS             486221..487324
                     /locus_tag="AGOS_AEL075W"
                     /old_locus_tag="AEL075W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR043C (POL32)"
                     /codon_start=1
                     /product="AEL075Wp"
                     /protein_id="NP_984786.1"
                     /db_xref="GeneID:4620978"
                     /translation="MSDSIQEFLNVQLIQNCQLATVTDLADKFGLDAGAAKSALLAYH
                     SATKNKEVHRLIVCVYSTGTIRVVCDDDDVPREDLADVFLYGLSPSSSLAISANVRSN
                     PTLRNPYTLVAVPDDEAAAEPPQRSRTQAADAGPRPNLRGNQTYPAAAKPSPSKAGTA
                     QAKAGKFDSGLRSTAIIARMREDREKKERERQEELKKRRQKSTIVTEEKKLQIAKLAQ
                     LFDGDSDSGDEEMDGRDEETVLAPLPPVSAPDVAAPAAAPDQTLDLEALLDTTADESL
                     LSIHPDQNSPTRGSQDHASTLTSLDAQPQSTTDEDGYLVTTKILPSAPPAALPSGAKR
                     PAQRAGGPPSKSAKTAPASKKVQSSLMNFFKKK"
     gene            <487577..>488059
                     /locus_tag="AGOS_AEL074W"
                     /old_locus_tag="AEL074W"
                     /db_xref="GeneID:4620979"
     mRNA            <487577..>488059
                     /locus_tag="AGOS_AEL074W"
                     /old_locus_tag="AEL074W"
                     /product="AEL074Wp"
                     /transcript_id="NM_210141.1"
                     /db_xref="GeneID:4620979"
     CDS             487577..488059
                     /locus_tag="AGOS_AEL074W"
                     /old_locus_tag="AEL074W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL027W (VMA3)"
                     /codon_start=1
                     /product="AEL074Wp"
                     /protein_id="NP_984787.1"
                     /db_xref="GeneID:4620979"
                     /translation="MSELCPVYAPFFGAIGCAAAIVFTSFGAAYGTAKSGVSICATCV
                     LRPDLLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGL
                     AAGFAIGIVGDAGVRGNAQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVTC
                     "
     gene            complement(<488315..>490471)
                     /locus_tag="AGOS_AEL073C"
                     /old_locus_tag="AEL073C"
                     /db_xref="GeneID:4620980"
     mRNA            complement(<488315..>490471)
                     /locus_tag="AGOS_AEL073C"
                     /old_locus_tag="AEL073C"
                     /product="AEL073Cp"
                     /transcript_id="NM_210142.2"
                     /db_xref="GeneID:4620980"
     CDS             complement(488315..490471)
                     /locus_tag="AGOS_AEL073C"
                     /old_locus_tag="AEL073C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR042W (NUP85)"
                     /codon_start=1
                     /product="AEL073Cp"
                     /protein_id="NP_984788.2"
                     /db_xref="GeneID:4620980"
                     /translation="MSKMANEMLLDIDGMDFVEDEDMGAEGELQFSFDPVSNAPMVSF
                     PSTQQPDLEKLRFKFAPVLSRSFAFNGGSRTGTLYGVQVPYVDNSKEFSQYAAKLFEV
                     YKSLGADKQFAVPTIGLINHTSTLEHNQTVNLALEAIVSELELFIESLKYSGRQQRLV
                     DLEECLSILNCLKTVQFTLDSEEENSRAKFIDSLISWVNRTDGEPSEAVIAKVLGDGK
                     QTPILENPYFWRLLCQLIIRGLFDQAVAAIEKSELLSYLADKCSATHTMVQDMVNLLQ
                     GYPRELEPVYREWKDLVLQLHLNWSQSEHKISIELASSLEDCLLIMCGNKSKIIYYSK
                     TWYECYCGLMLYYIPSLQLSEEYLQLVLKEHPLDVTSPWEQACVSIITGKIYSILPVL
                     DSLDSCTAAFTAAICEAKGLLENDLLDDGGLEVSNTGDEMFGLGNTMASYLLNQFALS
                     IVTYEDKNLWAVAIGIIYLTPNYSDAAKRMMIAELLPHYPFQTNDDIEWMLTICAKWK
                     LPQIARTIYRVLGQEALYLNNIIEAISNFSKAGEFEWVKHYSWMIFEASILQGAPLED
                     EVVNSIVTGEYESAIPKELVEVMVTPAMKQSLSPYAVLFNFFRATEDGRWAEALELLL
                     SLIEFTYLPPQYLILLIGRFLYPLFLQDESKMFKEQDVLRVIKALEQFHDRPDEITTA
                     MYKELLVKVDTLPKDPLNLINAIRTKLSLKLCHQFM"
     gene            <490812..>494228
                     /locus_tag="AGOS_AEL072W"
                     /old_locus_tag="AEL072W"
                     /db_xref="GeneID:4620981"
     mRNA            <490812..>494228
                     /locus_tag="AGOS_AEL072W"
                     /old_locus_tag="AEL072W"
                     /product="AEL072Wp"
                     /transcript_id="NM_210143.2"
                     /db_xref="GeneID:4620981"
     CDS             490812..494228
                     /locus_tag="AGOS_AEL072W"
                     /old_locus_tag="AEL072W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR041C (URB2)"
                     /codon_start=1
                     /product="AEL072Wp"
                     /protein_id="NP_984789.1"
                     /db_xref="GeneID:4620981"
                     /translation="MALDSAEAISKYLRSKSITTDELCDVCQDLEAGRYSVFFPSAHI
                     FVLELIIDRWNDPKHESYRTNWRVWDLFNRMWQRVEQEDHKKRLSKRLRFSVVLLQGI
                     ESVKQDYDSFSKAVLETMQLINSTSAIHCSVETAMKLLGETVNLLNRCDGTDASGRRA
                     MLNELLTLSNIESVADVGSKIATLYSGHLLSPTLTYMQLYGGPDSNDAGSNILRKLMS
                     KFLYGPSVIPLRHIEKFLSDYELPKEQVQVFFRTTIQFLSSSDFATLESIFKILLKIA
                     PEMSAAMLHDLSLEKKTMSQEFLENMFNEAFSQENWALVANVLILDVDVGIKNAQKIL
                     NVLSQGKINGHLINMWKALIDCHVIAREFPQFLEKWKSHCSQSSCKVLLENEQYYAVV
                     AGNIPLLSVSQIRDLLEELLDQVSKDSSEEAINVATIIVLGLRKLPYNLLQEFKLSLL
                     KFFELHHIRTTAFWDLKHHILELYDDVASAELLSGKDIPAMLVELETAPMNLYFTIFK
                     IRELIEFEMDSVIENFIRRLEILSNQRYILLQLFSRWSTIVDLTFNQSQMEHLLEISL
                     KPDNIEIYNEILKYDDFFEETNIIHTLVRLLGAKIEHATCRSLLCQFPVQCIGKNVRV
                     DVINRILAQEQLHSDEPHLVEHLLKNPTFKSAIETDCKALAKVISQESDYYALDNPLF
                     TTVWGNHLNNMKSEQCQTFISELIESISNGLTEQFEFATYKLAFYIVTSTPHKFDKVK
                     EVAQTYVRNVMDILKQQQNILDNVKLSSWLMGSLYRVFCQFELSQPIDFLRSFLLSVS
                     QQMKACNDHQLLETRFQLHCLCYEDNLEGLLACYVLLREIGVQKNRLLPAVSSAVKLK
                     SVSDHTSFNRAFFSIISSFSELSVVQAEGVLELYGVFVPLLSKENTIGTRLFVRSVLE
                     FHTYSERILAQKKALLKVLVLYKDTLVSKPWLFTQYAVESLFPLCTKLNISICHSDYP
                     GQDEVFVSSTQLLSSVLLFHRYKLSNRHHLVTSTLCCYMGLLAESERYRLSVLSAKSF
                     SRLVINFCEPSHSPNNSNKDSLNSRVTVAKRSLRKYLPIILLNYVNKVISHNFKETIR
                     KEITPCIFSVFDVLSRSELAVITSSLDNPGRVYFKNLYAEYQKLGRWHEE"
     gene            complement(<494324..>496582)
                     /locus_tag="AGOS_AEL071C"
                     /old_locus_tag="AEL071C"
                     /db_xref="GeneID:4620982"
     mRNA            complement(<494324..>496582)
                     /locus_tag="AGOS_AEL071C"
                     /old_locus_tag="AEL071C"
                     /product="AEL071Cp"
                     /transcript_id="NM_210144.2"
                     /db_xref="GeneID:4620982"
     CDS             complement(494324..496582)
                     /locus_tag="AGOS_AEL071C"
                     /old_locus_tag="AEL071C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR040W (GEF1)"
                     /codon_start=1
                     /product="AEL071Cp"
                     /protein_id="NP_984790.2"
                     /db_xref="GeneID:4620982"
                     /translation="MSYQPVGPRQEAEHQAEVRNFDQFTTIDWILEEKSQRNSGARDV
                     GYSGRWRRYLEEVWHRGQAFFTLTAIGVTVGCIAGFIQVLTETLVNWKTGYCARNWLL
                     NKSFCCQRIAEDTRKFLVIEGAQCVEERLWVPWSNSVLAYFTFITLSVAFAMLSALMV
                     KCLAPMATGSGISEIKVHVSGFQYKKEFFSLTTLAVKSVALPLAISSGLSVGKEGPSV
                     HYATCCGFLIVQFLLRNTLKYAEQAEYLVASSAAGVAVAFGAPIGGVLFGLEEMSSSP
                     HFNLSTLWKSFYVALSAVSTLQYLDPFRNGKIVLFEVKYDRDWHVEEIPIFILLGIFG
                     GLYGHYIGNLNIWFVTFRRNYLSKWPLREVFVLALATTCLSYFNEFLKLDMTESMSLL
                     FHECVEEKSGMNFEHRLCQLDGKFSFLSFLTLYCSLMFATVVRALGVVVSYGARVPAG
                     IFVPSMAVGATFGRSISVLVENFITGPHVITPGTYAFLGAAAALSGITNMTLTVVVIM
                     FELTGAFIYIIPTMIVVAITRIVYSSFSKEGGIAEKMIMVNGFPFMECPQEHRDFLDE
                     YCAADISTTDVVTIKESMHLSDLESLLEEVGNSYKGFPIIRNDDENEQEKRCIGYVTL
                     QHIRSQLGMYTNDNTARNTVVDFTKKFLPDDENLIQFSDLVNYTPFTVDKSLSLSLLY
                     QMFHKLGCKVVIVEDAGFLVGIITKKDFLRFQRTKRTELYGSINTFDEQSAERLWNLI
                     MRVIRKLRSKQL"
     gene            <497043..>497426
                     /locus_tag="AGOS_AEL070W"
                     /old_locus_tag="AEL070W"
                     /db_xref="GeneID:4620983"
     mRNA            <497043..>497426
                     /locus_tag="AGOS_AEL070W"
                     /old_locus_tag="AEL070W"
                     /product="small nucleolar ribonucleoprotein SNU13"
                     /transcript_id="NM_210145.1"
                     /db_xref="GeneID:4620983"
     CDS             497043..497426
                     /locus_tag="AGOS_AEL070W"
                     /old_locus_tag="AEL070W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL026W (SNU13)"
                     /codon_start=1
                     /product="small nucleolar ribonucleoprotein SNU13"
                     /protein_id="NP_984791.1"
                     /db_xref="GeneID:4620983"
                     /translation="MSSTPNPKAFPLADAALTQQILDVVQQASNMRQLKKGANEATKT
                     LNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAAS
                     ITTNDASAIKSQIYAVKDKIETLLI"
     gene            complement(<497453..>500689)
                     /locus_tag="AGOS_AEL069CA"
                     /db_xref="GeneID:9487588"
     mRNA            complement(<497453..>500689)
                     /locus_tag="AGOS_AEL069CA"
                     /product="AEL069C-Ap"
                     /transcript_id="NM_001355320.1"
                     /db_xref="GeneID:9487588"
     CDS             complement(497453..500689)
                     /locus_tag="AGOS_AEL069CA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL025C"
                     /codon_start=1
                     /product="AEL069C-Ap"
                     /protein_id="NP_001342266.1"
                     /db_xref="GeneID:9487588"
                     /translation="MLVQLASPDVLDYSVCQGLLSGREERVLDVYNNGSSASNTFIVV
                     CERSLWVLQATGKGLRRRRIASCETPVQKSCVSEGAVLVVRDNWVYQYGDEGPAGDVA
                     MPVHAYSRGIRIAGDAERYYVDSRHSRYLWGPYRASALPLAVFALADPILDFQFEGSR
                     VFSVKRLSHGRGYYVERVDSVSCGAGARRDVLHISDDIKHAPIFSAGGGSSATYVFVA
                     YHYTWVVAKDTLGVRKFPNPPFIKRSVVRGAALYVEPWPRGPAPRGNAETLVLRVCTG
                     YGAAYKATVDANADKTLRWNKLHYGTRSDTFNGCWYLGSERYLYSTGRKLVSKDFSSG
                     TELSIRHVSASDIVHDLCILQLLPMLDDGIFSIETLTCGSYTQYDNKGFIGTAYDELS
                     VDGLRSLTLPVAVAPDTWRSMEDFWLSSTTSASVSASDIAYPREGESLKPRLDLFQDI
                     LFCTLVQNPSGVPTKYLILRADGKLVCHHLGESIEPAFEFPTSCGLNERTLLSSFEDG
                     NQMHIVAATDGIITVFELQDALIENVCTVSKVYLLATIPEVICSIHSSKDGVFVLTKT
                     QLYNFTLAEMQCRPCNRTSITIASPPKFCVNSYGRAVLYHDKDYLYQYRDGQILRTKL
                     PHRCDTVLQKDENTVYMLATDSKLWEMKVMRKSKMHTHIEDGTVFTKVTTCIGSTKAI
                     ICAETGEANIQEKLVLYDFGSRRKLAECELDPKECVINLYSFFAPMSDSDLNNSKQLC
                     IATTYTATNQYVRLFAVDGSSLFAEDRKEVKWIVTDIKVYGNMIVASGERLAVYFLQE
                     ENGELTLCECGNRCVQLSGSLTMGTVIHEDNIFLFDAHKGITVFRLHKDGLNGANIMR
                     STDAAGYPSIEHNTITHVASTSVPWSRLFNLNAAAYNAQGDVCFEDRKELWHSTVTFA
                     AVCDASGCVTLFQFSPASIERGTDICRFEIKQTILKLVSIPTSLSEHITELPPACTPL
                     FALYLEDGSVRIISNGKVTPNAQPIESSHNLRACRYSVPNPAATQSLSGVSGDVFSFR
                     RQRVVPEPSKSVPQPLAGPPCIRIFVSGPPSPPPLQRTFSPPELDLTL"
     gene            complement(<501030..>504221)
                     /locus_tag="AGOS_AEL069C"
                     /old_locus_tag="AEL069C"
                     /db_xref="GeneID:4620984"
     mRNA            complement(<501030..>504221)
                     /locus_tag="AGOS_AEL069C"
                     /old_locus_tag="AEL069C"
                     /product="AEL069Cp"
                     /transcript_id="NM_210146.2"
                     /db_xref="GeneID:4620984"
     CDS             complement(501030..504221)
                     /locus_tag="AGOS_AEL069C"
                     /old_locus_tag="AEL069C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR039W"
                     /codon_start=1
                     /product="AEL069Cp"
                     /protein_id="NP_984792.2"
                     /db_xref="GeneID:4620984"
                     /translation="MPATLALTDVRKPKQFVGGYHWRNDEEILIVEWDGLSIRNMSSP
                     HDIISASSFPLDILSASSYVQPLTKRNYLAVFERDGACRIINEKLEIVDTYTVENPVR
                     SPCCCFDERLSRMFLVWDGYSIYQCELDGEKELFFRNMRAIYASAEEILQIALRWDIT
                     DVDGSQLSIGILSKGQYAGPYYYEEIQEPLDQSHATPWAVSTDMLEVGVFSRPPFLLA
                     LSSVGSFVLTPSETHYYAAPYLAARTVAKQAKSSATEAGPFPTILDPKLQITNAYVLY
                     GEDSPKICAVTNTGMYFELLSKLAFDSSGAMLSRSPLVLGKNRLEFGPELDYFSPIGK
                     DLILVHSRLNGLVLRRRRDNFRLFSESTRTDSILFAGVAGPEMTSYMFFCGGTSLNNG
                     LLELYRMGFPNEFIRHDPIDFGSSVEKMWPTTEGIYWLDPAGDLHQNSRKVLSKADVQ
                     DILPNGQMILRELDTIAVCTLDENIYVRLDSKYELHWSDHSASIKLSVETQPPTRTFM
                     SADSGYLGLSLDNNVYLIDKDKHVQMLRVDAKDPIFSFKVKMTERGVRIMYCDIMGSL
                     VIYKGQKLLAKLKVHSKGLHICPIASSDKVLLYHETSVYLFSLNDLSIGHLPFPCHPR
                     EIKLASDDSFLVTDANGHMLVVHCKEMRKWKPQLVRTSDTTPGLISKCVVPTHNPSFI
                     VATLVADHFDRELSKTEYSSQLAVFSCLDGKFTSFYDLYERYPNAIITDIISMNAQRQ
                     NDADDLFEQMSYAKKLALSRCVFVSVSYETSEEDGDNIFLYSVDDFTGNLELQMKYNT
                     HFHVSLLETYRDNTILAIGECLQAFVLDYSVKDNRFMLQPLSDAVDVGGVPKDCSVLC
                     IPDARDCKRKRRAESHQAKLVIHNTMKGFQQFEILDRKSKRHSQAHSDRTAVQIFFRP
                     VPIGELDAILKPAAELSAISASAISFEGAGYIPVSAIADVDNTVILIRQDAADVKICQ
                     LEIPHRVTSITAARRSPSSGRQPHQPPLFNELDPLFIISTVAGGCYLVSGLSARSPVA
                     VNTRIPGVSIDSDSELQMYPCRPSIFSDPKFIK"
     gene            <504513..>507032
                     /locus_tag="AGOS_AEL068W"
                     /old_locus_tag="AEL068W"
                     /db_xref="GeneID:4620985"
     mRNA            <504513..>507032
                     /locus_tag="AGOS_AEL068W"
                     /old_locus_tag="AEL068W"
                     /product="AEL068Wp"
                     /transcript_id="NM_210147.1"
                     /db_xref="GeneID:4620985"
     CDS             504513..507032
                     /locus_tag="AGOS_AEL068W"
                     /old_locus_tag="AEL068W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR036C (HUL4)"
                     /codon_start=1
                     /product="AEL068Wp"
                     /protein_id="NP_984793.1"
                     /db_xref="GeneID:4620985"
                     /translation="MSFFSRNINSKDRHKIQIISNSTAPSFEPNNEFVTSSCCCCGTI
                     LQHPKNISKFRCSVCYVTVVLQGTAFTQDKTELFDLDDMRELLSSCNNTYRELDKDEK
                     RLRKHEVFHLLEDYIATRMVTIFPLNASFESSNPREMLDYDQVKEFYRILMELPTKKP
                     FYSFLVACNELLKRPHVALNTPTPTNPKYKRIGLFRWILIILEVPIFKQTLANAEARC
                     NTPHFRAISYEVLKKAVGYMSCLDEASAKELVHFLKYMQKDIFASKVELVNMYITFHF
                     ARILHTIGKETNNGKYSPQLEDFEHSEKLNPSLNQGSAKKLVHTNMNIFFGGIVRPMT
                     SSANSKDILALNYRFSPEDYGNEWHIKTGARLLLCLYVANQSAYKCPVSNFYNTMIDF
                     VDYKRDFELWQDLSKLSASHEKENSGSSGPRYSPVQFTICQCPFLFSLGMKISILEYE
                     TRRLMEYSAEQAFLKALDRKQVVDVYLKIRVRREFVTTDSLRSIQNQQKDLKKSLRIE
                     FVNEPGIDAGGLRKEWFLLLTRDLFNPNNGLFVYVPESRLCWFSIMESIEHELLQGEG
                     SSSELYYLFGVVLGLAIYNSTILDLKFPRAFYKKICGEVLSVNDFLELYPETGTNMLK
                     MLEYDGEDFEDIFALTFETCFPDRFDESKIHYRQLCPDGSTQAVTRENKHEYFRLWMD
                     FYLNRSIAPGFESFRNGFFHVIEGNSFRLFGSEELEQLVCGSNEQSLDVSMLRSVTRY
                     QGGFDDNSPVVQWFWEILSEMEYPQQRKLLHFVTGSDRVPATGVTTIPFRISRIRSGA
                     DRLPLSHTCFNEICLHEYKDKETLRNKLIIALEESQGYGFR"
     gene            <507373..>508011
                     /locus_tag="AGOS_AEL067W"
                     /old_locus_tag="AEL067W"
                     /db_xref="GeneID:4620986"
     mRNA            <507373..>508011
                     /locus_tag="AGOS_AEL067W"
                     /old_locus_tag="AEL067W"
                     /product="AEL067Wp"
                     /transcript_id="NM_210148.1"
                     /db_xref="GeneID:4620986"
     CDS             507373..508011
                     /locus_tag="AGOS_AEL067W"
                     /old_locus_tag="AEL067W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL024W (RIP1)"
                     /codon_start=1
                     /product="AEL067Wp"
                     /protein_id="NP_984794.1"
                     /db_xref="GeneID:4620986"
                     /translation="MLGLRNSVTALRAASQARLLSCSSVAAKSTYRTPDFSDYLKEKN
                     DSNKGRSYAYFMVGSLGLLSSAGAKSTVDTFISSMSASADVLAMAKVEVNLASIPEGK
                     NVVVKWQGKPVFIRHRTASEIDEANGVQMSSLKDPQTDADRVKKPEWLVMLGICTHLG
                     CVPIGEAGDFGGWFCPCHGSHYDISGRIRRGPAPLNLEIPAYDFDGEKLIIG"
     gene            complement(<508432..>510504)
                     /locus_tag="AGOS_AEL066C"
                     /old_locus_tag="AEL066C"
                     /db_xref="GeneID:4620987"
     mRNA            complement(<508432..>510504)
                     /locus_tag="AGOS_AEL066C"
                     /old_locus_tag="AEL066C"
                     /product="AEL066Cp"
                     /transcript_id="NM_210149.2"
                     /db_xref="GeneID:4620987"
     CDS             complement(508432..510504)
                     /locus_tag="AGOS_AEL066C"
                     /old_locus_tag="AEL066C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL023C"
                     /codon_start=1
                     /product="AEL066Cp"
                     /protein_id="NP_984795.2"
                     /db_xref="GeneID:4620987"
                     /translation="MTDRSGISDSAKTPLRKPKNLVLCFDGTDQNFGPDPFTNVLKIF
                     RMLESNDDSIQMCYYQPGIGTSMSVRGGDKSSTRCALENTFDSMFAFSLDHHIISAYL
                     FLVQYYELDDKIIMFGFSRGAFIARVLTGMLERVGILKRGLENIVPMAWKIYAAWEYA
                     CQPSQPDYTTTLIDEFRNTFARNIPIRVHFEGLFDSVNSCGIIRDRLFPYTSRSGIVD
                     HVRHACSVDERRGKFKQQSFSPNPYTQKLFSFVYRNYMIEPQHYSPLQYGYTDSERFS
                     NPFINSTLVRTSSIPQLTDRSPDAGLFADGMKPDSDSAAVLLRNVADYLEGVGQETQG
                     SWFRRRLSSLSKQRVEGVFQHYSPGNESSDRSTFVSSDLVEKWFPGDHSDVGGGWAPD
                     IETEQFLSNLSLRWMLSEAIKHGVHFKKGIIHQFANTYDSSSSVLSASHDMLSLKKGQ
                     FTMQSPFTNSSNPSKVDLDKFHGLLKVPRKVSSMLRVFKKKSGSTLQSASSLGHSPRA
                     FPPRCIIRPAKNDGHGTKSIFQVIAWWIVEMMFIGIRIEDKNCQWKNVYVPNLGRHRN
                     IPAYGELHWSVYWRCKYVGDYRPKNLPPYAEKLIEHYIGVSLNNGKEHRRKKMASSIP
                     SKQVSYPTQESSPLLSPAGNFTCARSSLEVDILAQADEDRIRKWIAEDWRNVPDELHE
                     LLQRNPDL"
     gene            complement(<510722..>513799)
                     /locus_tag="AGOS_AEL065C"
                     /old_locus_tag="AEL065C"
                     /db_xref="GeneID:4620988"
     mRNA            complement(<510722..>513799)
                     /locus_tag="AGOS_AEL065C"
                     /old_locus_tag="AEL065C"
                     /product="AEL065Cp"
                     /transcript_id="NM_210150.2"
                     /db_xref="GeneID:4620988"
     CDS             complement(510722..513799)
                     /locus_tag="AGOS_AEL065C"
                     /old_locus_tag="AEL065C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR035W (RAD26)"
                     /codon_start=1
                     /product="AEL065Cp"
                     /protein_id="NP_984796.2"
                     /db_xref="GeneID:4620988"
                     /translation="MSADDELGELGLEVVPHSELEQQIESNAQTLLDQKQYKLEQDRL
                     ERYEEKLKVLRQQQSSLGRKLRAATRISVRKKLQEQLDRLEAEDLPPVLQDIRDIKRR
                     LREIGQDQKTDEPRSGGVRQAGESEKDYLVRTGRLTAFGNRTEFTLADDSTRADNRQA
                     SHGEEDGADATPESVPFPYTDEEDNSDSDSSGASAEGTADAAEDDGNELHYQRRLSGW
                     LEQRKRSRGHDPHPGIPEWEKPHPTLPDAKLYDDFKIPADIFDKLFSYQKTCVQWLYE
                     LHQQNCGGIVGDEMGLGKTIQIVSFLASLHHSGKLKGPVLVVCPATVMKQWCSEFQTW
                     WPPFRAVILHSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYANLGRTKKQLEARR
                     GIESLVQKVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKIRNPDAGISLTCK
                     RLRTPHRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFANPINAGGYANATN
                     IQVQTGYKCAVALRDLISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQFQKEKYLQFLN
                     SEDMIKIKNGRRQVLYGIDILRKICNHPDLLERDFRKHEPSFGDPRRSGKMTVIKQLL
                     LTWKKQGHKALLFTQSRQMLDILEAYISHKDPELAGLQYLRMDGTTNIAHRQALVDRF
                     NNGPYHLFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRIGQKRDVTIY
                     LLMVAGSIEEKIYHRQIFKQFLTNKVLSDPKQKRFFKMNELHDLFSFGPGAASDSFAS
                     EIEQQTASLRRQPAAHGTDDYDSVQRFEGVSKLEGFFNAKDRADREKDEDARLMDGLL
                     GGGSLATAVHHDSVVQAHATPSDDIIAREAALVARNALAALRKSRALTKNYDVSTPTW
                     TGKFGQAGRVKKKRRQPATSSAAIITALGNPPPATTPASTMSEEHARSLAQMRDFLQA
                     QPGYFSTSVALIEHTGLKILTKQDLTQTRALLRTIATFDKTRSGWILKEEFRD"
     gene            complement(<514092..>514418)
                     /locus_tag="AGOS_AEL064C"
                     /old_locus_tag="AEL064C"
                     /db_xref="GeneID:4620989"
     mRNA            complement(<514092..>514418)
                     /locus_tag="AGOS_AEL064C"
                     /old_locus_tag="AEL064C"
                     /product="AEL064Cp"
                     /transcript_id="NM_210151.1"
                     /db_xref="GeneID:4620989"
     CDS             complement(514092..514418)
                     /locus_tag="AGOS_AEL064C"
                     /old_locus_tag="AEL064C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR034W (PET191)"
                     /codon_start=1
                     /product="AEL064Cp"
                     /protein_id="NP_984797.1"
                     /db_xref="GeneID:4620989"
                     /translation="MGASCKDQRKAVAICLQRSPCVMIERNTPKKCLEDPELRKQMPD
                     LCIAQMRSFLECKRGMVDMTKRFRGNGAMSTGRYDQQYENLSTGNFNARAEMQKLEEL
                     DESNKT"
     gene            <514598..>518539
                     /locus_tag="AGOS_AEL063W"
                     /old_locus_tag="AEL063W"
                     /db_xref="GeneID:4620990"
     mRNA            <514598..>518539
                     /locus_tag="AGOS_AEL063W"
                     /old_locus_tag="AEL063W"
                     /product="AEL063Wp"
                     /transcript_id="NM_210152.2"
                     /db_xref="GeneID:4620990"
     CDS             514598..518539
                     /locus_tag="AGOS_AEL063W"
                     /old_locus_tag="AEL063W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR033C (RAV1)"
                     /codon_start=1
                     /product="AEL063Wp"
                     /protein_id="NP_984798.2"
                     /db_xref="GeneID:4620990"
                     /translation="MLNFLPGQPNSSLHTVCQKCWNNRTIIAYCSGNNLIIMSNRFSR
                     LQTIYFEKDATAVDICEQTGNLAVAVGNTVYVYGPEYELREHRWAEHGQFYHDDSQVN
                     CVRWVGKTELVVASSYMSLWRIRAGLGTFNKHLLWSQRQPAPVYNCAVTEDAEYIATV
                     GKHDARVKVWRRLSNAAEQAEFDLTVIPHGGSVTMLRWRRSEEPSHCKILYVLGTDSK
                     LRIWSNYEMENKNNAQDWGTVELDRKAQERFVVILDSRLLAAALPTKRRSELLQYLAS
                     QQPELVGLVSRSGRLRMLALEHLSQDPPRMASTKPLLTIDLLSEWFESPPQVLYFCEP
                     QIYEASGGQLSLVIHDLRGSIKHVLLPLDKLARPTSLGDILEHRFTGHSKSIQRLWRS
                     SDGEAILTISRFHENAIWIPQNLHAGVSLQMQNIIETDSPIHLALVHEKGALVITFLK
                     SFKLQAWGCSANSSQRAHLLAEVTISKSRGYPILMSNTPEKKHHHERHFITLLYDSGH
                     VDAFLATPNEIKPVESGSIDLEGEDMIYRASTIDPVQPSSGGDRDLITLITRTGTIRT
                     YKAVVASDLSRVQWMLTHILDTNIEDCSLIAGSSINKTCVIDSTKKEITIWDLKRGVL
                     EYTHLFQDTVRDIDWTSTNSGQSIISIGFNSHVLLLTQQRYDYTNKLPTFLPIKRLDI
                     TKHTTHEIGDSTWMKDGTIVVASGNQLFVEDKQLDLTDSFTLQSIGSRCITSNDLLHL
                     TSVLNGPLPVYHPQFLIQALYFGKLNLVKEIILNLFLQIREREYNPDVTEPLPSSLCI
                     PYHKFLLPDDENYIFDHHPEPYSSYNIALSALLREKLTKFPLPYLTRHQQITLITVLE
                     AIESVEKNNSIVDSSGLKFILGMKLFLSHKMTQSSVTMRDVMWAVHSENKHLLQSLVF
                     ADITSTARLREYKVCYWVKQDGLVRIFESLARYEFTKNDRRDPSACAIFYLALKKKKI
                     LLSLWRVAARHPEQAKMLNFLEHDFTQARWRTAALKNAFVLASKHRYLDSACFFLLAD
                     SLKDAVNVLVRKLEDLDLAIGVCRVYSGDSSPELHHLLTNHVLPGAVVDNDIWTMSYV
                     YWRLKNENLAIKALLGRYVHEQSEHAFHDKSPINKSFLMEDPALLHLYSWIRLKSTCK
                     NSTRWDSNEQEEYLLMNKVADIYRRMGCDYLSLSLLRNWKFTANAKGNADDRSNAPSW
                     SSSQLHFSERAPGSFGNRTFDSPSSLFDKSENRSGYTDTATPRNMLDDFMNVDSYRAR
                     SSVPEAQELWEETPDALSSGYSTHTQNKMKGTSGHPPVKVPKVRNLLDDFM"
     gene            complement(<518615..>519766)
                     /locus_tag="AGOS_AEL062C"
                     /old_locus_tag="AEL062C"
                     /db_xref="GeneID:4620991"
     mRNA            complement(<518615..>519766)
                     /locus_tag="AGOS_AEL062C"
                     /old_locus_tag="AEL062C"
                     /product="AEL062Cp"
                     /transcript_id="NM_210153.1"
                     /db_xref="GeneID:4620991"
     CDS             complement(518615..519766)
                     /locus_tag="AGOS_AEL062C"
                     /old_locus_tag="AEL062C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR032W (CPR7)"
                     /codon_start=1
                     /product="AEL062Cp"
                     /protein_id="NP_984799.1"
                     /db_xref="GeneID:4620991"
                     /translation="MSGVTRVYIDIEIGGCKSGRIVFELFQDKAPLSAQNFKQLCCGG
                     IELDGKHVSFRGNRFHRVIKNFMVQAGDIMYGMEGADEENLGKGGCSIYSQQDEEGPC
                     RGAFADENTGEFSEPFLLAMANMGAPDSNSSQFFITTTAAPHLNGKHSIFGQVIHGKA
                     VVREIEKEAVDSDGVPEKAVRIAGCGEWTQDMPVPLYNACNDPIGGDIYEEYPTDNTL
                     FGGEEFGKAYAAAVLIKESGTQLLKRKDFQNAFFKYRKSLNYVNEYIPDVDIDAEQFE
                     KFNVLKQKLYLNMTLALFNMGSYDSAISYTNYVLEMDRVPSMDLAKAYYRRGNCYLAK
                     NLLEEALSNYKRCKEHNSDEAVDMKIASVESKLAARLEKTKKSISKFFQ"
     gene            <520000..>524181
                     /locus_tag="AGOS_AEL061W"
                     /old_locus_tag="AEL061W"
                     /db_xref="GeneID:4620992"
     mRNA            <520000..>524181
                     /locus_tag="AGOS_AEL061W"
                     /old_locus_tag="AEL061W"
                     /product="AEL061Wp"
                     /transcript_id="NM_210154.2"
                     /db_xref="GeneID:4620992"
     CDS             520000..524181
                     /locus_tag="AGOS_AEL061W"
                     /old_locus_tag="AEL061W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL022W (GEA2) and YJR031C (GEA1)"
                     /codon_start=1
                     /product="AEL061Wp"
                     /protein_id="NP_984800.2"
                     /db_xref="GeneID:4620992"
                     /translation="MARQDVAVNPVTIVIKECITLSTAMRKYTRYTSQLGVAALLGGG
                     SDIFSNQDDSLADAFSNLASKTNDPLLSGFIQLRLMLNNLKTLDEVDALTVLQPFLLV
                     ISTASTSGYITSLALDSIHKIFRYNILNEHSKNYVAAFRQTVHSLTHCRFEGSEQTSD
                     DSVLLKVLSLIETIVVSSCGDVLSDSLMSDVIQTVMSLACNKRRTEVLRKAAEMSMMS
                     ITVKLLAKLRAIEPTNTEKYINDESFATALLKEDIIGTMPRATTDVSVENGTLVATEA
                     KKHEDAPVDDTTLEENYGLPVVKDYLGILISLIVIENSHKQNNSTKVFGLHLLNMTVE
                     LAGDLFPKHPRLFSLVSDPIFKNILYLIQNTDKLSLLQAALQLFTTLTIILGDCLQSQ
                     IELTLKTIFSILLDEKKGNDNKIRPSAVKELLVEQISILWTRSPSFFTSIFINYDCDL
                     ERSDLAINFLKKLTKLALPESALITADSVPPICLEGFISLIDDMHANVQRSGEKFDSD
                     LQVDILVQRERKNEFIRCVEEFNKKPKVGIPLLIEKNFIKSEDESDIASFLFENNTRL
                     NKKTVGEYLASPDKVSLLRKFIDLFDFENLRVDEALRILLTKFRLPGESQQIERIVEA
                     FSAKYVSSQHYDESKAGKDIEDDYSTVQPDSDSVFILSYSIILLNTDLHNPQVKKHMT
                     LDDYTYNLKGCNNQKDFPMWYMERTYYSIRDKEIVMPEEHHGSDGWFDDVWNNLISSN
                     TVLTELNTPRHNSIEDMDPAYTLHFDRAIFQNVGSQIVSTLFKIFAVASDDNISTRML
                     STIDKCSQLASFFGFTKLYNGILTETIKFTTLTGETKNARKLYDFNDVPVVLIHLEDT
                     MEVITVSSQSVRLGQDFKGQLATVVLSRILGNTGKNTISKEIWVQLLNILLVLYEGLV
                     IPPDLCPQVQRELALGPLPKPSAEYNINKTKFTKGLLSTFASYLKGDEEPTEEEIAWS
                     VKGMETIENSQLISSILGASQETEAELISHILGAVKLEKNGDNSRFFEQEILFLCELA
                     ISMLVRCQNKSTGRQILTQLKIFAEINGISKAFRQRLLSYNIFVIKQLETPEAIISLI
                     DKEMLFNNEIYDSEFFESDPGMSVLNSLLSLSQQDAFTSELLANEGFWKLLRRYAPLK
                     KCTLAVYNFLDNFIITNQGLITDENFMWMLGLLDEISSTGAVGGRWEEEFDRLVKSGR
                     AVEKENPYQEIVDLSLKSINLTSQLIKVRTNLTKTEIVALIQALAHQCLNPSYQLRLY
                     ALSSLEDAMTKGILVSNDTITVSELFEHGLFPLIDNSKNINALPLLDIMSTLSRIYLY
                     YLECGKTTNDTYMKVQNMFNKYVENPTMEQKLQELITAKKEIEKNINGPSRPHTVADN
                     KETSMEEAPGPVEEK"
     gene            complement(<524268..>525557)
                     /locus_tag="AGOS_AEL060C"
                     /old_locus_tag="AEL060C"
                     /db_xref="GeneID:4620993"
     mRNA            complement(<524268..>525557)
                     /locus_tag="AGOS_AEL060C"
                     /old_locus_tag="AEL060C"
                     /product="AEL060Cp"
                     /transcript_id="NM_210155.1"
                     /db_xref="GeneID:4620993"
     CDS             complement(524268..525557)
                     /locus_tag="AGOS_AEL060C"
                     /old_locus_tag="AEL060C"
                     /note="NOHBY505; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E22880g"
                     /codon_start=1
                     /product="AEL060Cp"
                     /protein_id="NP_984801.1"
                     /db_xref="GeneID:4620993"
                     /translation="MDKEHVIDADKAGYSPSSSLIGMVTAGGRSMVYQFTSFYLRAPM
                     KLFRPARYDYTHYLRILLTGEDKVSQPQRPKPSGQWFRNPAYTYYLENSSVGVLTRAL
                     NKYGWKVLPDRVLPPLVLNSAAGVVLYTTYLSSLSFLRGPLGAGGEHGQSPPRISDVV
                     CAGFMAGVAQAVASAPIDAIYTRSTANDLLSSAKKYNSLWLYGIDKLKEIGLVGCFGG
                     FGLSLVKESVGFAVYFTTFELLKGQVCNKTIEYLEAHKKLKATGAQSANEGSEQYLPA
                     KTTSEGYMSQREKQWLQRSFVFGAGVTAAFALQLVQYPMLKLQKTHLSRLEAFDIYQK
                     AIANLKDQSTIEPKISKIRLRGGNTRLLHLYFNSYIDTLEHVASISKSTGTARWLYKG
                     FLRNTLAIIPGTATGLLLLEYMRTSLDGSAQYSSPLE"
     gene            <525979..>526782
                     /locus_tag="AGOS_AEL059W"
                     /old_locus_tag="AEL059W"
                     /db_xref="GeneID:4620994"
     mRNA            <525979..>526782
                     /locus_tag="AGOS_AEL059W"
                     /old_locus_tag="AEL059W"
                     /product="AEL059Wp"
                     /transcript_id="NM_210156.1"
                     /db_xref="GeneID:4620994"
     CDS             525979..526782
                     /locus_tag="AGOS_AEL059W"
                     /old_locus_tag="AEL059W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL021W (URA3)"
                     /codon_start=1
                     /product="AEL059Wp"
                     /protein_id="NP_984802.1"
                     /db_xref="GeneID:4620994"
                     /translation="MSTKSYAERAKAHNSPVARKLLALMHEKKTNLCASLDVRTSRKL
                     LELADTLGPHICLLKTHVDILTDFDIETTVKPLQQLAAKHNFMIFEDRKFADIGNTVK
                     LQYSSGVYRIAEWADITNAHGVTGPGVIAGLKEAAKLASQEPRGLLMLAELSSQGSLA
                     RGDYTAGVVEMAKLDKDFVIGFIAQRDMGGRADGFDWLIMTPGVGLDDKGDGLGQQYR
                     TVDEVVSDGTDVIIVGRGLFDKGRDPNVEGARYRKAGWEAYLRRIGETS"
     gene            <527133..>527396
                     /locus_tag="AGOS_AEL058W"
                     /old_locus_tag="AEL058W"
                     /db_xref="GeneID:4620995"
     mRNA            <527133..>527396
                     /locus_tag="AGOS_AEL058W"
                     /old_locus_tag="AEL058W"
                     /product="AEL058Wp"
                     /transcript_id="NM_210157.1"
                     /db_xref="GeneID:4620995"
     CDS             527133..527396
                     /locus_tag="AGOS_AEL058W"
                     /old_locus_tag="AEL058W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL020W-A (TIM9)"
                     /codon_start=1
                     /product="AEL058Wp"
                     /protein_id="NP_984803.1"
                     /db_xref="GeneID:4620995"
                     /translation="MDALNSREQQEFQRVVEQKQMKDFMRLYSNLVERCFSDCVNDFT
                     SSKLTSKEQTCIMRCSEKFLKHSERVGQRFQEQNAALNQSMGR"
     gene            complement(<527582..>529255)
                     /locus_tag="AGOS_AEL057C"
                     /old_locus_tag="AEL057C"
                     /db_xref="GeneID:4620996"
     mRNA            complement(<527582..>529255)
                     /locus_tag="AGOS_AEL057C"
                     /old_locus_tag="AEL057C"
                     /product="AEL057Cp"
                     /transcript_id="NM_210158.1"
                     /db_xref="GeneID:4620996"
     CDS             complement(527582..529255)
                     /locus_tag="AGOS_AEL057C"
                     /old_locus_tag="AEL057C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR023C"
                     /codon_start=1
                     /product="AEL057Cp"
                     /protein_id="NP_984804.1"
                     /db_xref="GeneID:4620996"
                     /translation="MMGGTKQPLVSEQLRGFPWAQISLVMFVRLSEPVAFMSLFPYMY
                     FMVRDFDVSSNESQIAAYSGWLGSVFALCQVVSAMNWGHFAERYGRKWALILGQLGTC
                     CSLLLLGFAGNYYQALLARSLMGLLNGNAGVVRTVVGELASQERHQALAFSTMQLLWQ
                     FGAVLGPMIGGYLSFPKGQNKIPEWYPPWLSKMVSLFPYSLPNLVISVLLLGSVLTTA
                     LFLEETHPHLKHSRDRGLEVGSWLLRHFWPWYTARSSSTERALVTDEEVQSDTEERTH
                     LLSDGRRTSGEDYAYSRVTGKDAAPGETQNKAVATGTQLGTEFVEEGIPPPLEQTAMR
                     HMIYADVFYPIISHLCLELHLTPTVEFLPVFLSTALATEERPDGTVGLASRFPWKIVG
                     GIGMSSERAGDLLSTTGIVGCLVMFFLFPLITQRYDPISIYRSGLSLFPIVYVLVPYI
                     VFLQKDSIPKWCTYVYLYSLTSAKTTICCLTMPQMLLIIHRTCHPRYRGVVNSAVISL
                     GAGARFIGPLLGGYILAWSQAHEVAWLLWWLLAALAVYAGYQAYKIRAV"
     gene            complement(529328..529816)
                     /locus_tag="AGOS_AgSNRRPR1"
                     /old_locus_tag="AgSNRRPR1"
                     /db_xref="GeneID:4620997"
     ncRNA           complement(529328..529816)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNRRPR1"
                     /old_locus_tag="AgSNRRPR1"
                     /product="AgSNRRPR1"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNRRPR1; start and end coordinates are
                     approximates. Not in synteny."
                     /transcript_id="NR_149437.1"
                     /db_xref="GeneID:4620997"
     gene            <530788..>532752
                     /locus_tag="AGOS_AEL056W"
                     /old_locus_tag="AEL056W"
                     /db_xref="GeneID:4620998"
     mRNA            <530788..>532752
                     /locus_tag="AGOS_AEL056W"
                     /old_locus_tag="AEL056W"
                     /product="AEL056Wp"
                     /transcript_id="NM_210159.1"
                     /db_xref="GeneID:4620998"
     CDS             530788..532752
                     /locus_tag="AGOS_AEL056W"
                     /old_locus_tag="AEL056W"
                     /note="NOHBY504; No homolog in Saccharomyces cerevisiae;
                     Weak similarity to Ashbya gossypii ABL053W"
                     /codon_start=1
                     /product="AEL056Wp"
                     /protein_id="NP_984805.1"
                     /db_xref="GeneID:4620998"
                     /translation="MTQYKVEDYLNLDEGQFSDSAEETGIYLTQAAYDEGFSTTAASV
                     PVILAEVPKLARLSELSLLPQYNSSTGNRVEKKSVQRNRRDRVIRSFVKAFDKTLETS
                     DSSLLSATPSPKSIFSYGFSSSQDEERAFSVVEGHLQIPQDDAYINDGGTMFKLALEN
                     SPSVSPEELELLETAPFANNNSDDILSFSQVIEQHANMEQDMVQLEPDASRQVFDYLA
                     NLERSVELTSLTFEDQFDVPISVFSQMPQQMHVHMQAQLPGEDEDNEEEEEEAYEEEE
                     EDEEEEETYTEEPSSNFTMPIPLQLTPQPVFHRLQEVRPETLGSSPRMNNFVPEKKRR
                     KLSIQPLTFDQIRLTHGLLRKTMIRHYDTEDLKLQIKKEIAKEQKAVKDALKRPDKAQ
                     CPKKRTISKTRLQDVSINFHQALTGLRDLEVVFAQNHILSSGYWSAKANALGVTEMRS
                     IVSVIRQQYENHITFEFVDDDVNPNTIPDGMKLLKFSVISRYCEHLENDRYVNDWVHL
                     ITYNDLSELLGFALDISDEMIVVNDDSLIFETQNEPWKRLLMRWRSIYDKKLFIISES
                     KEMMQLKIEKAKSRGKPFNLDEREKKLKEDLFNQLMSYKGLLGAPSKTAKDQALIKTN
                     KLQALIKIVLEKYCWVDPSKVPEGGYRRLF"
     gene            complement(<533101..>534738)
                     /locus_tag="AGOS_AEL055C"
                     /old_locus_tag="AEL055C"
                     /db_xref="GeneID:4620999"
     mRNA            complement(<533101..>534738)
                     /locus_tag="AGOS_AEL055C"
                     /old_locus_tag="AEL055C"
                     /product="AEL055Cp"
                     /transcript_id="NM_210160.1"
                     /db_xref="GeneID:4620999"
     CDS             complement(533101..534738)
                     /locus_tag="AGOS_AEL055C"
                     /old_locus_tag="AEL055C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL020C"
                     /codon_start=1
                     /product="AEL055Cp"
                     /protein_id="NP_984806.1"
                     /db_xref="GeneID:4620999"
                     /translation="MGIQVSDQIAIALKQHGIEVVFGIVGIPIVELAEKLAEHGVRFI
                     ACRNEQSCSYAASVYGYLTNKPGALLVVGGSGVVHALAGIHNAWVNKWPLLVIAGSTE
                     DEYKGGFQELDQLRIVAPWTSFKGRLSLDNVNYMVYTAVKTAVLQHGVSYLDVPGRLI
                     NMDAVGPLASKPVDIQHVRSGPDSSRVQGAAKLLQDGRNILVVVGRGCAEYPGVVRSF
                     LERYRLPFLPVPMAKGIVPDSHELNVNGCRSLALKRAEIVLVLGARLNWILHYGSAPK
                     WNADATFIQVDRDPATLGHNNSSGVNYSVLSDVELFINAITAVLPQSWQYRGVDNEVL
                     DKIRENGVKLQRKAQLTPGSPLNYHAVYSLLRKLIDDKNTILSAEGANTMDNSRLWFG
                     TDYPKRRLDAGTGATMGLGVGYALSAKLANPDKFVVALEGDSAFGFSCMELETAVRNK
                     VGLVVVVMNNGGIYHGNPGSGPVRTTDLSPECAYHLVGQGLGCNGVLIRTLDELKKEF
                     PRALQNSMKSITTVLNVILEPGTQTNVSFGWQAKSNM"
     gene            complement(<534932..>536365)
                     /locus_tag="AGOS_AEL054C"
                     /old_locus_tag="AEL054C"
                     /db_xref="GeneID:4621000"
     mRNA            complement(<534932..>536365)
                     /locus_tag="AGOS_AEL054C"
                     /old_locus_tag="AEL054C"
                     /product="AEL054Cp"
                     /transcript_id="NM_210161.1"
                     /db_xref="GeneID:4621000"
     CDS             complement(534932..536365)
                     /locus_tag="AGOS_AEL054C"
                     /old_locus_tag="AEL054C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR024C (SLM5)"
                     /codon_start=1
                     /product="AEL054Cp"
                     /protein_id="NP_984807.1"
                     /db_xref="GeneID:4621000"
                     /translation="MLAPFRPRRYSAITSPLRTITVRDLLQLQDAPKQPLDVQGRVRS
                     FRAMKNASFLDLEDGSSKNALKVVISHHGRPNPVTLKTGQSVAVRDAMWKWTPDRQQA
                     FELACQPTDVQVIGDVTDEYPLQKKYVSLKHLRQWPLWKHRTQYLGGLLRFRSHIEAT
                     LTQILTQEGIYKVPPPVVTSGDCEGAGELFHVEANSLRASQRKYFGTNAYLTVSAQMH
                     LEVIALALGRVWALTPCFRAEESDTSRHLSEFWMLEAELCFVQDVTQLTGFVQKLIQE
                     LARTLLQRQDELLPGMVPQEGAESRETVLARWQSLIEHPWHTVTYTEAIQVLQRQHDL
                     SPFVHAPQWGAALQSEHEKWLAGAHFGGPVFVTDYPRECKAFYMRLNDDKKTFACFDL
                     LFPEMGEVMGGSIREERYDALLREMTSRNMNIAELDWYLQLRRQGSAPHGGFGLGMER
                     LISWLYGNHNVRDAIGFYRSATSTIEL"
     gene            complement(<536582..>537217)
                     /locus_tag="AGOS_AEL053C"
                     /old_locus_tag="AEL053C"
                     /db_xref="GeneID:4621001"
     mRNA            complement(<536582..>537217)
                     /locus_tag="AGOS_AEL053C"
                     /old_locus_tag="AEL053C"
                     /product="AEL053Cp"
                     /transcript_id="NM_210162.1"
                     /db_xref="GeneID:4621001"
     CDS             complement(536582..537217)
                     /locus_tag="AGOS_AEL053C"
                     /old_locus_tag="AEL053C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL019C (MMS21)"
                     /codon_start=1
                     /product="AEL053Cp"
                     /protein_id="NP_984808.1"
                     /db_xref="GeneID:4621001"
                     /translation="MPRELIDSISAQYRELLAIARQMASRDAHLERSKADYKAQSDQC
                     EPIKLQTWDGYQQGELTAPSLAEIYAQEDAGEEARAPAEHEDQLQRLFTALPYIWNDP
                     TAMVPDQAASRQEDEELKISGGTIELTCPITCQPFVRPMISRKCGHVFDEVGLRRFLE
                     RQTKPCPQGACGHNLSMKDFVPDLVMQFRCLLHEARGPLTRNASEDPADIV"
     gene            <537446..>538213
                     /locus_tag="AGOS_AEL052W"
                     /old_locus_tag="AEL052W"
                     /db_xref="GeneID:4621002"
     mRNA            <537446..>538213
                     /locus_tag="AGOS_AEL052W"
                     /old_locus_tag="AEL052W"
                     /product="AEL052Wp"
                     /transcript_id="NM_210163.1"
                     /db_xref="GeneID:4621002"
     CDS             537446..538213
                     /locus_tag="AGOS_AEL052W"
                     /old_locus_tag="AEL052W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL018W (EAF5)"
                     /codon_start=1
                     /product="AEL052Wp"
                     /protein_id="NP_984809.1"
                     /db_xref="GeneID:4621002"
                     /translation="MPMHAQRLIIEQAFMTKTGASHPPSSPQRTANSLMNISKVLILE
                     TLYELLLNGQTNRVSLVRLQADVNDHPMTKQLAHQWQTLKINDILDVIKLLFPKQTSL
                     SDGQIIFYNLQIVEIRDTLLDVVRECQDTLVKDVKQLEQQYQAIKSHDDMKIRRERIM
                     GMYRDTILAKLQSFQHFHRLYSKLDPSPVVRDMMDLERIKATSIENLSHLQHILQKCV
                     TDSVMTTKAGSDRYREIILSQGELDDTVKFVRYAMDN"
     gene            complement(<538296..>538409)
                     /locus_tag="AGOS_AEL051CA"
                     /old_locus_tag="AEL051C-A"
                     /db_xref="GeneID:9487589"
     mRNA            complement(<538296..>538409)
                     /locus_tag="AGOS_AEL051CA"
                     /old_locus_tag="AEL051C-A"
                     /product="AEL051C-Ap"
                     /transcript_id="NM_001355319.1"
                     /db_xref="GeneID:9487589"
     CDS             complement(538296..538409)
                     /locus_tag="AGOS_AEL051CA"
                     /old_locus_tag="AEL051C-A"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR024C-A (PMP1)"
                     /codon_start=1
                     /product="AEL051C-Ap"
                     /protein_id="NP_001342267.1"
                     /db_xref="GeneID:9487589"
                     /translation="MLPRGVILVLVIVGLVGIGLAVIFAVRRGWFNTLRQK"
     gene            <539150..>540052
                     /locus_tag="AGOS_AEL051W"
                     /old_locus_tag="AEL051W"
                     /db_xref="GeneID:4621003"
     mRNA            <539150..>540052
                     /locus_tag="AGOS_AEL051W"
                     /old_locus_tag="AEL051W"
                     /product="AEL051Wp"
                     /transcript_id="NM_210164.1"
                     /db_xref="GeneID:4621003"
     CDS             539150..540052
                     /locus_tag="AGOS_AEL051W"
                     /old_locus_tag="AEL051W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL017W (GTT3)"
                     /codon_start=1
                     /product="AEL051Wp"
                     /protein_id="NP_984810.1"
                     /db_xref="GeneID:4621003"
                     /translation="MTATLQHLKKFELALLAEKLKIKHPAKLNKPALVALIQEHLRAL
                     KEPLDVLEYPELSEYYDSAGESEGETDAEISGEEDGDESGEDADSAGEQEGESGLQWF
                     SKLRFDKMRPASSQFSFQFHELLTDVQSNIADVNESIQDTLSTIPAISAIFYALEAYM
                     YIIQPFFSFDWSRRPYFVHCTLSHTQLISLLAFWGTFSFCVPAVAAYYINFIRYDLPQ
                     VEIDPLVFHVTKSLLALFVGHYWRPGLVSEATYVVKDSFGRAKFSELIRHGLAFAQLQ
                     WALNLQQWPLIFGITGVILCLYVL"
     gene            complement(<540314..>542467)
                     /locus_tag="AGOS_AEL050C"
                     /old_locus_tag="AEL050C"
                     /db_xref="GeneID:4621004"
     mRNA            complement(<540314..>542467)
                     /locus_tag="AGOS_AEL050C"
                     /old_locus_tag="AEL050C"
                     /product="AEL050Cp"
                     /transcript_id="NM_210165.1"
                     /db_xref="GeneID:4621004"
     CDS             complement(540314..542467)
                     /locus_tag="AGOS_AEL050C"
                     /old_locus_tag="AEL050C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR026C (NPP1) and YEL016C (NPP2)"
                     /codon_start=1
                     /product="AEL050Cp"
                     /protein_id="NP_984811.1"
                     /db_xref="GeneID:4621004"
                     /translation="MQSADHKAHCGGMNDQELEEAYDYNSVLDELDYMTAPGARTAWH
                     KRWMQQARGTWYKWRTPRRLAGSQRGVELYRLDRAGEGTMLLEDEARELEGKRWGSWA
                     RTLVPLVMLAALLPVYLTILAPWIRFAKLAPTEPAASPRWNNGTHDFVGLTLLVSIDG
                     FHPSYINNESTPFINELYSGTYAKSGVLTTPYMRPSFPSETFPNHWTLVTGRRPGHHG
                     IVSNVFYDDTLKKEFVFVDSPQDPAFWKGGDPIWFTAQKAFGISEFSAAAHFWPGSET
                     VYEEDDPERETRTPRYVDKYDGLESMDHKLDRIFEFIDMPLGERPGLILSYIPEVDSV
                     GHRYGNAWTNPVLQKALRDTDDFMRRLFQGLEQRNLTSFANTVIVSDHGMAKLNWTKD
                     VLFLEDIFSSDDVSRLERISGHVNCGVYPKDSHDVHYFHQTLKEHLKGLPYDVYLREQ
                     LPAEYELQGRYDHRLAPIWILSHPGKYIMDNRKTAPPNEIFGMHGFNNSHVDMRATFI
                     GVGPFFGRSGVTSYLAPFDNIEVCQLLSDVIGLAEPAETDATWPWPFSHMTLKEWTNI
                     ALPYGWHEDSEYLAYRYPGSTFNKLWNHFKRPAAQEQVTTTLSSPSDHPPSSAAAPTT
                     TLSSPSDHPPSSAAAPTTTLSSSSDHPTSSSAAPTTETTEWYSGIMDGAAHIIDDTEQ
                     LINSIMPQEVGDFVGGLVHDVLGGVEHFLDGLSSE"
     gene            <542959..>544566
                     /locus_tag="AGOS_AEL049W"
                     /old_locus_tag="AEL049W"
                     /db_xref="GeneID:4621005"
     mRNA            <542959..>544566
                     /locus_tag="AGOS_AEL049W"
                     /old_locus_tag="AEL049W"
                     /product="AEL049Wp"
                     /transcript_id="NM_210166.2"
                     /db_xref="GeneID:4621005"
     CDS             542959..544566
                     /locus_tag="AGOS_AEL049W"
                     /old_locus_tag="AEL049W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL015W (EDC3)"
                     /codon_start=1
                     /product="AEL049Wp"
                     /protein_id="NP_984812.2"
                     /db_xref="GeneID:4621005"
                     /translation="MSQFQGFKVQVELKDGKVITGTISKCNSKSLTLQDVAFSDGGIS
                     QLFKVKASRLRDLKVTGAPKGGKKWLANNAANGSPSNGAQSGGNGGTQSPGSGEEAAA
                     DGRSSSSSHGQHSGKDATWEHDDDLERLKNEDFDFQSNLRMFNKQDVFAKLKQQDTVN
                     PSERLVSHNKLRKEKIHFENDEMVIPNAKDDDWDEPGSGSAGSEKQKAAAAPAEYLPI
                     TKSINITHLLQQSSKDAPSEDEVLVKLQNVLSPPSRSQSLSKMPGFRTLKTDIAVPLA
                     TPVQLLEMERLAEDAFLFPPALALEHSAVHLARFMRQKLGGAARLHTANNNAQPLVVL
                     LASENRCGARALATGRCLAQNSHVRVLAVLAADPHAPGADASFRTQLDMFSRCGGRVV
                     DSVVALSAALEGLNSPPELIVDALQGFDCSLADLVDDAPGAGAARLRTLIAWANAQNC
                     PVWSLDIPSGIDAGSGAHTFEPCVRPDAVVCSSWPLVSLALLDCPELYLCDSAIPHQC
                     YAMRSSLRKFAAVRDVFVTEGVVQLTR"
     gene            <544884..>546590
                     /locus_tag="AGOS_AEL048W"
                     /old_locus_tag="AEL048W"
                     /db_xref="GeneID:4621006"
     mRNA            <544884..>546590
                     /locus_tag="AGOS_AEL048W"
                     /old_locus_tag="AEL048W"
                     /product="AEL048Wp"
                     /transcript_id="NM_210167.1"
                     /db_xref="GeneID:4621006"
     CDS             544884..546590
                     /locus_tag="AGOS_AEL048W"
                     /old_locus_tag="AEL048W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL013W (VAC8)"
                     /codon_start=1
                     /product="AEL048Wp"
                     /protein_id="NP_984813.1"
                     /db_xref="GeneID:4621006"
                     /translation="MGGCCSCLKESQDDATVLPIAENEREAVTSLLGYLEDKDNYDFY
                     SGGPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRPVDREVLEPILILLQSHDPQIQ
                     IAACAALGNLAVNNENKILIVEMGGLEPLIEQMKSNNVEVQCNAVGCITNLATQDDNK
                     AKIAHSGALVPLTKLAKSKNIRVQRNATGALLNMTHSGENRKELVDAGAVPVLVSLLS
                     SSDADVQYYCTTALSNIAVDESNRRKLSQTEPRLVSKLVVLTDSPSARVKCQATLALR
                     NLASDTGYQLEIVRAGGLSHLVKLIQCNSMPLVLASVACIRNISIHPLNEGLIVDAGF
                     LKPLVKLLDYNDNEEIQCHAVSTLRNLAASSEKNRQEFFESGAVEKCKQLALVSPISV
                     QSEISACFAILALADNSKLELLDANILEALIPMTFSTNQEVAGNAAAALANLCSRINN
                     YEKIIESWTEPSKGVCGFLIRFLQSEYPTFEHIALWTILQLLESHNETMLGLIKSNKE
                     IVKSIKRLSDINYENAQKASSLHSRLQQVNGGSVASGSEQYEHASLELYNITQQIMQF
                     LN"
     gene            547545..547616
                     /locus_tag="AGOS_t0108"
                     /db_xref="GeneID:4621007"
     tRNA            547545..547616
                     /locus_tag="AGOS_t0108"
                     /product="tRNA-Met"
                     /note="Initiator tRNA"
                     /codon_recognized="AUG"
                     /db_xref="GeneID:4621007"
     gene            complement(<547669..>548007)
                     /locus_tag="AGOS_AEL047C"
                     /old_locus_tag="AEL047C"
                     /db_xref="GeneID:4621008"
     mRNA            complement(<547669..>548007)
                     /locus_tag="AGOS_AEL047C"
                     /old_locus_tag="AEL047C"
                     /product="AEL047Cp"
                     /transcript_id="NM_210168.1"
                     /db_xref="GeneID:4621008"
     CDS             complement(547669..548007)
                     /locus_tag="AGOS_AEL047C"
                     /old_locus_tag="AEL047C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR020C-A (MAK31)"
                     /codon_start=1
                     /product="AEL047Cp"
                     /protein_id="NP_984814.1"
                     /db_xref="GeneID:4621008"
                     /translation="MQENRGERPKSCRRRRGDGSMASELAQIDLNDLLGATLRVEVGP
                     DRVLYGVLVALDCHANYLLDRVVERRGGRERELGLVSVPSEAVGNVKIEAATLRRVRE
                     AKSAFRRAVA"
     gene            <548086..>548292
                     /locus_tag="AGOS_AEL046W"
                     /old_locus_tag="AEL046W"
                     /db_xref="GeneID:4621009"
     mRNA            <548086..>548292
                     /locus_tag="AGOS_AEL046W"
                     /old_locus_tag="AEL046W"
                     /product="AEL046Wp"
                     /transcript_id="NM_210169.1"
                     /db_xref="GeneID:4621009"
     CDS             548086..548292
                     /locus_tag="AGOS_AEL046W"
                     /old_locus_tag="AEL046W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR020W-B (HTL1)"
                     /codon_start=1
                     /product="AEL046Wp"
                     /protein_id="NP_984815.1"
                     /db_xref="GeneID:4621009"
                     /translation="MTHPEPKINLKTITAHQVLSHREKMCELFQLLDDSERHELIIGT
                     AEQRERRLNEFRERRDALRRELGK"
     gene            <548573..>549271
                     /locus_tag="AGOS_AEL045W"
                     /old_locus_tag="AEL045W"
                     /db_xref="GeneID:4621010"
     mRNA            join(<548573..548577,548641..>549271)
                     /locus_tag="AGOS_AEL045W"
                     /old_locus_tag="AEL045W"
                     /product="AEL045Wp"
                     /transcript_id="NM_210170.1"
                     /db_xref="GeneID:4621010"
     CDS             join(548573..548577,548641..549271)
                     /locus_tag="AGOS_AEL045W"
                     /old_locus_tag="AEL045W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL012W (UBC8); 1-intron"
                     /codon_start=1
                     /product="AEL045Wp"
                     /protein_id="NP_984816.1"
                     /db_xref="GeneID:4621010"
                     /translation="MSSSKRRIETDVMKLLMSDHDVELVDDNMQEFHVKFHGPKGTPY
                     ERGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSICLDVINSTWSPLYDLLNI
                     VEWMIPGLLKEPNGSDPLNNEAATLQLKNPQMYEEKIQEYIDKYATEERYVQQFGGAG
                     GDAGDGSEDDEDADENPSDGMDYDEDDEELSEIEVEEEDEEVHISDSDLLD"
     gene            <549753..>551864
                     /locus_tag="AGOS_AEL044W"
                     /old_locus_tag="AEL044W"
                     /db_xref="GeneID:4621011"
     mRNA            <549753..>551864
                     /locus_tag="AGOS_AEL044W"
                     /old_locus_tag="AEL044W"
                     /product="AEL044Wp"
                     /transcript_id="NM_210171.1"
                     /db_xref="GeneID:4621011"
     CDS             549753..551864
                     /locus_tag="AGOS_AEL044W"
                     /old_locus_tag="AEL044W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YEL011W (GLC3)"
                     /codon_start=1
                     /product="AEL044Wp"
                     /protein_id="NP_984817.1"
                     /db_xref="GeneID:4621011"
                     /translation="MAGVPDNVKGVVELDPWLAPYGDILSARRFLADKWRHDIEHAVP
                     GGRRSLVEFARDAYKSYGLHADAQSKSITYREWAPNATRAFLVGDFNGWDETSHELQN
                     KDEFGVFTGVFGPGADGDFMIPHDSRVKVVFELADGSRIHRLPAWIKRATQPSKETAK
                     EWGPSYEARFWNPASPYKFKHERPRLDPNVESLRIYEAHVGISTPEPRVGSYSEFTKD
                     VLPRIRDLGYNAIQLMAIMEHAYYASFGYQVTNFFAVSSRYGTPEELKELIDTAHGMG
                     IQVLLDVVHSHASKNVSDGLNMFDGTDYQYFHSISSGRGEHPLWDSRLFNYGSFEVQR
                     FLLANLAFYIDVYQFDGFRFDGVTSMLYHHHGVGERGAFSGDYNEYLSDHSGVDHEAL
                     AYLMLANDLIHDMLPANGVTVAEDVSGYPTLCLPRSVGGCGFDYRLAMALPDMWIKLL
                     KESKDEDWSMGHIVYTLVNRRYKEKVVAYAESHDQALVGDKTLAFWMMDAAMYTDMTV
                     LKELTPVVDRGIALHKLIRLITHSLGGESYLNFEGNEFGHPEWLDFPNANNGDSYQYA
                     RRQFNLVDDGLLRYKHLYAFDKAMQEAEGKHKWLNTPQAYVSLKHETDKVISFERNGL
                     VFIFNFHPTQSFTDYRIGVDEAGAYRIILNSDREEFGGHRRIEEENSVFHTTDLEWNG
                     RRNFIQVYLPSRTALVLARNP"
     gene            complement(551994..552066)
                     /locus_tag="AGOS_t0109"
                     /db_xref="GeneID:4621012"
     tRNA            complement(551994..552066)
                     /locus_tag="AGOS_t0109"
                     /product="tRNA-Lys"
                     /codon_recognized="AAG"
                     /db_xref="GeneID:4621012"
     gene            <552909..>555767
                     /locus_tag="AGOS_AEL043W"
                     /old_locus_tag="AEL043W"
                     /db_xref="GeneID:4621013"
     mRNA            <552909..>555767
                     /locus_tag="AGOS_AEL043W"
                     /old_locus_tag="AEL043W"
                     /product="AEL043Wp"
                     /transcript_id="NM_210172.2"
                     /db_xref="GeneID:4621013"
     CDS             552909..555767
                     /locus_tag="AGOS_AEL043W"
                     /old_locus_tag="AEL043W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR017C (CWH43)"
                     /codon_start=1
                     /product="AEL043Wp"
                     /protein_id="NP_984818.2"
                     /db_xref="GeneID:4621013"
                     /translation="MTSVNGKHIVHLHSLFASSAFICALVVGYQLHFHKIVRNAHYGY
                     PDEWFPSVSATIGDRYPERSLFQVLIAVTAFPRFLLLLMHWVRSRSALGVMAGFTRTM
                     TCGGWVYITSSDDHDAHDVFMIAYIVLTIPWCVFVVRHATHNRALRKVVGGAFFGTLV
                     PLIYWFIQHNVKKRAGAYSIYAYFEWSLIILDILFDGLSYADMEDLTITFGTQGSRPS
                     VGVLQSKTSTLLSSAGKGLGGGAMEEMLEEVIITQEHEKLVYLPDEPITNQASLFYIV
                     VSTFDSFMFWTNLTALLCMIWFFPLWYMGISGYEAVIAAVLSPVLLYVPFFPTLIQQY
                     GPLLANVIGIGAYIVEKPEWRLMTVAVATGLSTMNFAVTLKSIVKDNARVAQFAITWS
                     LGLVASVVLKMAFYSNNPLWPIMKEENGGWNKTGLAIATAFAMITPYVNRCHYARKKS
                     SEPSGQTYTILPLYKRALASVGFGALVFAIHQSLTESSTLIYWCWEGWSQSAKMGPLA
                     WPFTGLTCVAMVVGVHLSKRFAESPGSTSRWLLALSTAVLSTSHITGWYKFVFGGLPY
                     AVSIMLFIPNYFITMNKASYFSLVGSFVVYILLTLSHVWTVAYAFVPFGWVLRERLHW
                     VLTASTMCILLGSCDYPLSVPISAAFMKRVTIVLVGVMVAIAYSVEQLKPTGVPQPYH
                     PDANLITAGIWTIHFGLDNDLWASENRMIDLIRDMELDLVGLLETDTQRITTGNRDLT
                     ARMSHELQMYADYGPGPNKHTWGAVLLSKFPIVESTHHLLPSPVGELAPVIHAVIEAY
                     GELVDVYVFHSGQEEDVLDRKLQSEALRDIMGARDRPAILLSYLVTKPNEGNYHTYVG
                     EASGMQDIDFEDDDRWCQYILYKNLKRTGFARVSRSTITDTELQVGKFQVHNGVSQGL
                     KRVEKSQVNDTLRFPDKFLGDGVRGHRYHVFNEPRYYE"
     gene            complement(<556385..>558028)
                     /locus_tag="AGOS_AEL042C"
                     /old_locus_tag="AEL042C"
                     /db_xref="GeneID:4621014"
     mRNA            complement(<556385..>558028)
                     /locus_tag="AGOS_AEL042C"
                     /old_locus_tag="AEL042C"
                     /product="AEL042Cp"
                     /transcript_id="NM_210173.2"
                     /db_xref="GeneID:4621014"
     CDS             complement(556385..558028)
                     /locus_tag="AGOS_AEL042C"
                     /old_locus_tag="AEL042C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL156W (HXT11)"
                     /codon_start=1
                     /product="AEL042Cp"
                     /protein_id="NP_984819.1"
                     /db_xref="GeneID:4621014"
                     /translation="MTLVDKLLLRNIEYKGTAYDYFPKVYNVYLVAVVACISGMMFGF
                     DISSMSSMQDFEPYKDYFKHPNELTQGGITASMAAGSLLGSILSPGISDAFGRRVSLH
                     MCSSLWIIGAVLQTAAQNQAMLFVGRIVAGLGVGFGSSVAPVYTAEVSPPKIRGAVGG
                     LFQLSVTVGILVMFLIGYGSVSLNSVASFRVAWSMQLVPGVVLLLATFLLPESPRWLA
                     NHGRWDETTLVVEKVGRSVNVSDEELRIHINEIRERVALDEMARDFTYADLFRRKTQR
                     KIFIGMAAQMWQQLCGMNVMMYYIVHVFKMAGFSGNQNLVSSIVQYVLNVGMTIPSLF
                     LVDRAGRRPVLIIGGVLMFTWLYAVAGILATYSVPRPNGVEGNTTVRIEIPPERSSAA
                     KAVIVCSYLFVCSFAPTWGIGIWVYCAEIFNNIERARGSALCTSVNWAFNFALAMFVP
                     TAFKNITWRTYIIFGTFSVALTIHAFLSFPETKGKTLEEIDEMWDAHIPAWRTASYKP
                     ELAQMAAPKLSSGSISDATGGLHEKKAAAGSPGASAGSS"
     gene            complement(<558296..>559015)
                     /locus_tag="AGOS_AEL041C"
                     /old_locus_tag="AEL041C"
                     /db_xref="GeneID:4621015"
     mRNA            complement(<558296..>559015)
                     /locus_tag="AGOS_AEL041C"
                     /old_locus_tag="AEL041C"
                     /product="AEL041Cp"
                     /transcript_id="NM_210174.2"
                     /db_xref="GeneID:4621015"
     CDS             complement(558296..559015)
                     /locus_tag="AGOS_AEL041C"
                     /old_locus_tag="AEL041C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR016W"
                     /codon_start=1
                     /product="AEL041Cp"
                     /protein_id="NP_984820.2"
                     /db_xref="GeneID:4621015"
                     /translation="MSHVPAWKRIQIRQQQQQLSTDEEDALNVTTHLATGRPRGQHRA
                     ADPAQRIRKPAKREKLPSSERKQRTATVLRDQLRYLLDFYLEKVPDEPLPAALLQQPA
                     VAAYVDARPSAEEAVVAPSWKFSKQKQNWLIKHLHDIDALPSAYDPLLRLYLRGLGDR
                     ARAAVIARCTDTLRSWEDYTAAEEEHARRVVDATAPADGASEPTAAPTPPCSVAVKDR
                     CAGLFEALSAQSSPSAAPDNI"
     gene            559176..559235
                     /locus_tag="AGOS_AgSNR33"
                     /old_locus_tag="AgSNR33"
                     /db_xref="GeneID:4621016"
     ncRNA           559176..559235
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR33"
                     /old_locus_tag="AgSNR33"
                     /product="AgSNR33"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR33; start and end coordinates are
                     approximate; similarity is partial. In synteny."
                     /transcript_id="NR_149376.1"
                     /db_xref="GeneID:4621016"
     gene            <559534..>560013
                     /locus_tag="AGOS_AEL040W"
                     /old_locus_tag="AEL040W"
                     /db_xref="GeneID:4621017"
     mRNA            <559534..>560013
                     /locus_tag="AGOS_AEL040W"
                     /old_locus_tag="AEL040W"
                     /product="AEL040Wp"
                     /transcript_id="NM_210175.2"
                     /db_xref="GeneID:4621017"
     CDS             559534..560013
                     /locus_tag="AGOS_AEL040W"
                     /old_locus_tag="AEL040W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR015C"
                     /codon_start=1
                     /product="AEL040Wp"
                     /protein_id="NP_984821.2"
                     /db_xref="GeneID:4621017"
                     /translation="MARPGFYAACALFAATHVLSLGWSREYIARVSRVPPAQIRCNAL
                     ERAGARYTGRFTRGVVTGYDKYVILGHLVAAVGGADVWYVGDSESDLPCVLRPDVTGV
                     LIYTSDAQLQRLAALLGARAPSGAWRHVQLLHGVWCVRDWGALAALVQQSDRSTTTV"
     gene            <560028..>561554
                     /locus_tag="AGOS_AEL039W"
                     /old_locus_tag="AEL039W"
                     /db_xref="GeneID:4621018"
     mRNA            <560028..>561554
                     /locus_tag="AGOS_AEL039W"
                     /old_locus_tag="AEL039W"
                     /product="AEL039Wp"
                     /transcript_id="NM_210176.1"
                     /db_xref="GeneID:4621018"
     CDS             560028..561554
                     /locus_tag="AGOS_AEL039W"
                     /old_locus_tag="AEL039W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR014C (POL4)"
                     /codon_start=1
                     /product="AEL039Wp"
                     /protein_id="NP_984822.1"
                     /db_xref="GeneID:4621018"
                     /translation="MFKDHSFVFLPNGSTPRARIVAQVLRRHGGSLQEGAGDSPITYL
                     VPDQYLTATGEVKNRELFELEEQRPGTWRKGAVRLSWVSDCVKAGQLLNKENYAVKPP
                     QRAEGKRLGKRRRESEHSAAAAAARPATPLEGNAKVACALQQLAERCRLQGEAFRNRA
                     YLLAREAVLELPYSIQTYEQARSLPNVGDGIAQKIALLAAGGSVPGLELELTPDERIV
                     RYFAACHDVGPGRAQQWRALGFESFADVLRASPQWRLPWAMLYGMRFYEDWQLRIPRD
                     EVGEHAAVLEQCAPAGMSVVIAGSYSRGSTTCGDIDVVLYREGCDDPEVLADDLTALV
                     QRLVSIGYVECPLHLSKRLQPLFDPAVHSLARGLGVSVSGRLSEKDTLARFYSGVRLP
                     GKAPVPPGAPAIPYVAQDRELFAPHASGSARPCRRLDLLTCKWSERGACLLYFIGNDT
                     FNKALRTRASAQGMTLNQHGLFDKSSGACVESADEYRIMELLGFPRLEPTDEQRNRRI
                     "
     gene            complement(<561627..>562973)
                     /locus_tag="AGOS_AEL038C"
                     /old_locus_tag="AEL038C"
                     /db_xref="GeneID:4621019"
     mRNA            complement(<561627..>562973)
                     /locus_tag="AGOS_AEL038C"
                     /old_locus_tag="AEL038C"
                     /product="AEL038Cp"
                     /transcript_id="NM_210177.2"
                     /db_xref="GeneID:4621019"
     CDS             complement(561627..562973)
                     /locus_tag="AGOS_AEL038C"
                     /old_locus_tag="AEL038C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR012W (PGK1)"
                     /codon_start=1
                     /product="AEL038Cp"
                     /protein_id="NP_984823.2"
                     /db_xref="GeneID:4621019"
                     /translation="MGRSWGLLWMACLLYGVFTECRRSSQHAHTGKMSLSSKLTVKDL
                     SLAGKRVFIRVDFNVPLDGKTITSNQRIVAALPTIKYVLEQGPKAVVLASHLGRPNGE
                     RNEKYSLAPVAAELEKLLGQKVNFLDDCVGEHVTAAVNGAAAGSVFLLENLRFHIEEE
                     GSRKVDGEKVKASAEDVQKFRQGLMSLADVYVNDAFGTAHRAHSSMVGFELPERAGGF
                     LLSRELEYFSKALENPTRPFLAILGGAKVADKIQLIDNLLDKVDSIVIGGGMAFTFKK
                     VLENMEIGNSIYDKAGAEIVPKLAEKAKKNGVKIVLPVDFVIGDDFSQDANTKIVSAS
                     EGIPSGWEGLDCGPESRKLFSETIASAKTIVWNGPPGVFEIPKFSEGTQAMLAAAVKA
                     SEAGSTVIIGGGDTATVAKKYGVVEKISHVSTGGGASLELLEGKDLPGVTFLSSKQ"
     gene            <563288..>565171
                     /locus_tag="AGOS_AEL037W"
                     /db_xref="GeneID:9487590"
     mRNA            <563288..>565171
                     /locus_tag="AGOS_AEL037W"
                     /product="AEL037Wp"
                     /transcript_id="NM_001355318.1"
                     /db_xref="GeneID:9487590"
     CDS             563288..565171
                     /locus_tag="AGOS_AEL037W"
                     /note="NOHBY503; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0A10989g"
                     /codon_start=1
                     /product="AEL037Wp"
                     /protein_id="NP_001342268.1"
                     /db_xref="GeneID:9487590"
                     /translation="METEMESALRCVMRYREQEDVDLRYMAVRELCGELRNRQDHVLQ
                     GLDGLPGTLKAVTHEVIVRSLDDQSEVQGMVCRELLAGIGDCAVPYVVAQLVGELGGS
                     GQGRRWEVVLQYLRAVLGGGGRRARDVDEGDVAAYVRALAREREPSALWHRVLAALCS
                     GGTVQSDELVDAVYAEARRAGSADARGAVVAVVGGVGGARAARVLARCEDAELLEQVA
                     RAHALKFGRVWPAVVRRWAVGELGSGPAGFRLVRHLCVLMLRADAELLRAVCARCAEA
                     LATAASWHAEPTVGGGAAEDDADDLQLSDEGSELMLSEDEDQGAARQRDCVQLGAAAV
                     ALLGALPALPAETVQAVQRLPAPFAAELQPQLVALTARHAAFVDWTIRQFGDVAQEAL
                     PALSPAQAAELAAARPERSRFLAPGDGIPAELRAAVYAHANSGSVPTELLQQWQNRRV
                     ASKPYVDSTLRLVADLLALDSVSLNVHQWCIEMLAWVGDEYAFYRATVIPLMIPPLKP
                     PKRFVHVMQVGTMKQREDESTHIRALVARALLSWLEDAAVSWDYNQVTHLLELLKYPL
                     RDVPLKGISLEILDMAVERYGGLLAHYDAELVQSVIDQASVQYPAETAHLAARFALIA
                     SSL"
     gene            <565382..>565807
                     /locus_tag="AGOS_AEL036W"
                     /old_locus_tag="AEL036W"
                     /db_xref="GeneID:4621021"
     mRNA            <565382..>565807
                     /locus_tag="AGOS_AEL036W"
                     /old_locus_tag="AEL036W"
                     /product="AEL036Wp"
                     /transcript_id="NM_210179.1"
                     /db_xref="GeneID:4621021"
     CDS             565382..565807
                     /locus_tag="AGOS_AEL036W"
                     /old_locus_tag="AEL036W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL017C (GNA1) and YOL024W"
                     /codon_start=1
                     /product="AEL036Wp"
                     /protein_id="NP_984825.1"
                     /db_xref="GeneID:4621021"
                     /translation="MSAPSEDFTCLDEPPAPQSTPLACVSQFSRFPTSHYRDELLSRD
                     RSTAAGLPKSSVASGADHPQAIENMVQPRASPRRLQDLLRSASADALVAEEHENESHT
                     QQQAQDSLTGRDRPLLKRRPSLYEDFKKNVYQRLHMFSK"
     gene            <566014..>567252
                     /locus_tag="AGOS_AEL035W"
                     /old_locus_tag="AEL035W"
                     /db_xref="GeneID:4621022"
     mRNA            <566014..>567252
                     /locus_tag="AGOS_AEL035W"
                     /old_locus_tag="AEL035W"
                     /product="AEL035Wp"
                     /transcript_id="NM_210180.2"
                     /db_xref="GeneID:4621022"
     CDS             566014..567252
                     /locus_tag="AGOS_AEL035W"
                     /old_locus_tag="AEL035W"
                     /note="NOHBY501; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0A10945g"
                     /codon_start=1
                     /product="AEL035Wp"
                     /protein_id="NP_984826.2"
                     /db_xref="GeneID:4621022"
                     /translation="MEIKSLKKADTIFDSYVELALCAESSVFHWIYLRDNCTCTECFH
                     DATVQRTLDTFDELPWKVCRQSYSAEAPKEAEFEIREGKLRVRWPDEHVSEFSEDWLR
                     RHSYQPPLSTKPKALSLPAKSHWDRAEFNKLLGDGAHFCTRYDNLPSELPTVLREIYE
                     FGFTFVRNVPVSIEATKTVSELISIIRPTHYDTGVWEFTSDLAKHDTAYTTVGISMHT
                     DGNYWHELPGLQLFHLLEHSGGEGGETQIVDVAKVVDQLRELAAQDESWRTTYKVLTE
                     HPLAFHQSGELDSVFYQADYPTLTLDATGELEQCRWNTSDRISQAPLAPGSPYTVPQV
                     YQALFRLDSLIKDEKNYVQFKMQPGTIFIFDNWRVLHARTSFTGCRRLCGSYLTRDDF
                     LARFRSIVFDREAIKDEIYQ"
     gene            <567441..>569456
                     /locus_tag="AGOS_AEL034W"
                     /old_locus_tag="AEL034W"
                     /db_xref="GeneID:4621023"
     mRNA            <567441..>569456
                     /locus_tag="AGOS_AEL034W"
                     /old_locus_tag="AEL034W"
                     /product="AEL034Wp"
                     /transcript_id="NM_210181.1"
                     /db_xref="GeneID:4621023"
     CDS             567441..569456
                     /locus_tag="AGOS_AEL034W"
                     /old_locus_tag="AEL034W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL023W (IFM1)"
                     /codon_start=1
                     /product="AEL034Wp"
                     /protein_id="NP_984827.1"
                     /db_xref="GeneID:4621023"
                     /translation="MFLLRRSTSVVSRQLLAPGRHAWAPIQPVAWTASRQYAKRPKKA
                     KLKRPKAKLKPLTFPIPPYISANNLANLLKMNINTLIGDLKKLGFEKAKADYIISRDY
                     IELILEEYSYQLPSGREIVTPENVYDELKQPADPKALKDRPPVVTIMGHVDHGKTTIL
                     DYLRKSSIVSQEFGGITQHIGAFQVVTPVSKRKITFLDTPGHEAFLKMRERGANITDI
                     VVLVVSAEDSIKPQTIEAIKHVKKSGNELIVAITKVDKLRSAKEKETVINKIMNDLLQ
                     HEIHAEDLGGNVPVIPISAKSGENMDLLEENIILVSDGMELQAEVGKNTLVEGWILES
                     EVQKTLGNVSTVLIKKGIIRKGAVLLSGNTYCKVRNLIGENGASVAMATPAQAVEVTG
                     WKQLPMAGDQVIQVDSEAIAKKYVGKRLHLIELEKEASTVDKMNEARALVHETPTDLG
                     TDDTEPEPVVPEGPRSVNFIVKADFYGSLEAITESISHLGNDEVICKVVEASVGIPTI
                     NDLSLARITDSVILCFNLGNLPGDVLNNKEKIEIRQYTVIYKLIEDVTERLTENLEPI
                     YEDKVIATADIKEIFMFDLKHKVIRIAGCKVNNGKLTRNSLVKITRGPEEKVIFDGKL
                     ATLKQGKEAAKEVTKGNECGVTFDDFEDYLAGDKILVYEKVKVPRYL"
     gene            complement(<569586..>570872)
                     /locus_tag="AGOS_AEL033C"
                     /old_locus_tag="AEL033C"
                     /db_xref="GeneID:4621024"
     mRNA            complement(<569586..>570872)
                     /locus_tag="AGOS_AEL033C"
                     /old_locus_tag="AEL033C"
                     /product="AEL033Cp"
                     /transcript_id="NM_210182.2"
                     /db_xref="GeneID:4621024"
     CDS             complement(569586..570872)
                     /locus_tag="AGOS_AEL033C"
                     /old_locus_tag="AEL033C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL022C (TSR4)"
                     /codon_start=1
                     /product="AEL033Cp"
                     /protein_id="NP_984828.2"
                     /db_xref="GeneID:4621024"
                     /translation="MHINLKELQRTRGFHPVMSNVEEHASDNESDYGSQPGAVYLGIV
                     DTSIKESDEVTIEDTFIGGEPVWLAEDSVPKEELLRCGACKSGKNLKLLLQAFAPLDP
                     EQTTTICQRKGIKLSTTECINADDDRVIYVFYCTACPRKGNSVISIRGVRRKDAPNDL
                     SAKMDIASPGRDFQLNPFGVGSEHGTGSKNSSANPFSISAAGGNPFASEAANPFSAVD
                     ATSRDDSNKRELKPSTLRKLHEAQPDKVFEASKAFPGFFLFVEEESFKNRTPDHLQLP
                     KNLKIDKTAFEVAPETDELESNPVKLDPRTEKLAKFLDDDVFQKFQEIVGYNPYQVLR
                     YDYGGKPLYYAQAPNNFEDLVPRPSYNPSSARIFELQLMPKMILDLEEEVSIESGMDW
                     GTIMVFTDIENYIPDFDENGVGYVSECVRVQWEPRS"
     gene            571199..571269
                     /locus_tag="AGOS_t0110"
                     /db_xref="GeneID:4621025"
     tRNA            571199..571269
                     /locus_tag="AGOS_t0110"
                     /product="tRNA-Gly"
                     /codon_recognized="GGC"
                     /db_xref="GeneID:4621025"
     gene            <571391..>573652
                     /locus_tag="AGOS_AEL032W"
                     /old_locus_tag="AEL032W"
                     /db_xref="GeneID:4621026"
     mRNA            <571391..>573652
                     /locus_tag="AGOS_AEL032W"
                     /old_locus_tag="AEL032W"
                     /product="AEL032Wp"
                     /transcript_id="NM_210183.1"
                     /db_xref="GeneID:4621026"
     CDS             571391..573652
                     /locus_tag="AGOS_AEL032W"
                     /old_locus_tag="AEL032W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR009W (GCN20)"
                     /codon_start=1
                     /product="AEL032Wp"
                     /protein_id="NP_984829.1"
                     /db_xref="GeneID:4621026"
                     /translation="MSANISAQVRRATSGVDSVVTDYVTGYFNHLSNATFDAVLAKRL
                     DLEQEIFFITELLIDAGADKEKISKLVTEVKAQLLEQLKQNEAKVELTGDTSKRLLDI
                     NVLQNHNSKTNINSSLAMLGVTGDIEHTGRKMETRVDLKKLKKAEEKIAKKVAKRNNK
                     FVKYEASKLINGAKEEDYDSFYMKINPLDFGSGAGKSKDIKIDTFDLYVGDGQRILSD
                     AQLTLSYGRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDDTKVLQS
                     VLDADVWRKQLLSEELKINERLQDIDKLRAEFDEDSLEVKKLDNERDDLESHLQQIAE
                     KLADMESDKAEARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLL
                     DEPSNMLDVPSIAYLAEYLKTYPATVLVVSHDRSFLNEVATDIIYQHNERLDYYRGQD
                     FDSFYATKEERRKNAQREYDNQMAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPV
                     LEPPEEEKSITFKFADCEKLSPPIIQLQDVSFGYDESQLLLKDVNLDVQMDSRIALVG
                     ANGCGKTTLLKVMMEQLRPITGHVSRNPRLRIGYFTQHHIDSMDLNASAVDWMSKTFP
                     GKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSNHL
                     DTAGLDALVQALKNFSGGVLMVSHDISVIDSVCDEIWVSESGTVKRFDGNIHDYKKYI
                     LEAADAAGVVKRH"
     gene            complement(<573729..>576722)
                     /locus_tag="AGOS_AEL031C"
                     /old_locus_tag="AEL031C"
                     /db_xref="GeneID:4621027"
     mRNA            complement(<573729..>576722)
                     /locus_tag="AGOS_AEL031C"
                     /old_locus_tag="AEL031C"
                     /product="AEL031Cp"
                     /transcript_id="NM_210184.1"
                     /db_xref="GeneID:4621027"
     CDS             complement(573729..576722)
                     /locus_tag="AGOS_AEL031C"
                     /old_locus_tag="AEL031C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL021C (DIS3)"
                     /codon_start=1
                     /product="AEL031Cp"
                     /protein_id="NP_984830.1"
                     /db_xref="GeneID:4621027"
                     /translation="MRDEVQNYRHSTVKAQGQSMTTGRKRLSEGLSVTQKVFVRSRNG
                     GATKVVREHYLRNDIPCLSQACTACPAVVAPDAQNELPRFVLSTEPSGGRYVVVDTNI
                     VLQAIDLLENQKCFTDVVVPQVVLEEVRNQSYPVYMRLRTLCRDSDETKRFAVFHNEF
                     CESTYVARAADESVNDRNDRAIRRTVEWYSEHLRERGIVAVLVTNDRENLARAVGAGL
                     EAQSLTEYVESLPNADEIRDAVPNLEPPAVGRDDMARAGFTYPEYYATGRLMGGLKNG
                     SLYQGVVQISEYNFLEGTVSIPNFSKPVLVRGLKNLNRAFNGDQVVLELLPQSEWKAP
                     SMVTMDSEHFDVNDNPDSDEENHEVTVISDKQRRLLAQDAINAQKTTKVQPTARVVAI
                     TRRSWRQYVGQIATNTLDLQDSSTQNVFVILMDKCLPKIRIRTRRAKELLNKRIVVAI
                     DSWPATYKYPLGHFVRELGEVESVEAETEALLLEHDVEYRPFSKKVLECLPAEGHDWR
                     APADLSDPEAISKDPLLPKRRDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVH
                     IADVTHFVKPGTALDTEGASRATSVYLVNKRIDMLPMLLGTDLCSLKPYVDRFAFSVL
                     WELDADANIVNVDFTKSVIRSREAFSYEAAQLRIDDVNQNDELTNGMRALLELSKKLK
                     QKRLDAGALNLASPEVKVHMDNETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIN
                     DAFPQTAMLRRHAAPPSTNFEALNEMLQVRKKMAISLESSKALADSLDRCIDPEDPYF
                     NTLVRIMSTRCMMAAQYFYSGAFSYSDFHHYGLAVDIYTHFTSPIRRYCDVVVHRQLA
                     GAIGYEPLDLTHRDKQKMEMICKNINRRHRNAQFAGRASIEYYVGQVMRNNHSVETGY
                     VIKVFNNGVAVLVPKFGVEGMILLENLTDDFSSAEFVEEEYTLNFKDKTGKTRTVHVF
                     DKVEVEVKSVLDPVTSKRKAQLLLK"
     gene            <576998..>578746
                     /locus_tag="AGOS_AEL030W"
                     /old_locus_tag="AEL030W"
                     /db_xref="GeneID:4621028"
     mRNA            <576998..>578746
                     /locus_tag="AGOS_AEL030W"
                     /old_locus_tag="AEL030W"
                     /product="AEL030Wp"
                     /transcript_id="NM_210185.3"
                     /db_xref="GeneID:4621028"
     CDS             576998..578746
                     /locus_tag="AGOS_AEL030W"
                     /old_locus_tag="AEL030W"
                     /experiment="RACE determination of 5' region of mRNA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL020W (TAT2); Newly annotated start codon"
                     /codon_start=1
                     /product="AEL030Wp"
                     /protein_id="NP_984831.3"
                     /db_xref="GeneID:4621028"
                     /translation="MTHQKDVEKAASELSDTSAVQRVLKKRSSVLEESRLLEESKTNK
                     RGLVRRCIDSFKPPVDGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGG
                     PLAVLIGWTLAGTQMVGTIHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQ
                     WFFVLPLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFGVRGFGEAEFVFSVIK
                     IVTICGFIILCLVLILGGGPTHEFIGARYWHDPGALANGFKGVAAVMVTASYSLGGSE
                     MTCLASGETDPKEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSNVNNSPF
                     VIAIKMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRA
                     GRPLTGILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAM
                     KAQGKSLDELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQ
                     NYLCALILLFMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKK
                     YISEQRWYIRYYHYWC"
     gene            <579017..>580597
                     /locus_tag="AGOS_AEL029W"
                     /old_locus_tag="AEL029W"
                     /db_xref="GeneID:4621029"
     mRNA            join(<579017..579032,579138..>580597)
                     /locus_tag="AGOS_AEL029W"
                     /old_locus_tag="AEL029W"
                     /product="AEL029Wp"
                     /transcript_id="NM_210186.2"
                     /db_xref="GeneID:4621029"
     CDS             join(579017..579032,579138..580597)
                     /locus_tag="AGOS_AEL029W"
                     /old_locus_tag="AEL029W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR010W (UBP6); 1-intron"
                     /codon_start=1
                     /product="AEL029Wp"
                     /protein_id="NP_984832.2"
                     /db_xref="GeneID:4621029"
                     /translation="MGDFEFSIKHAGKVLPIKLPAGSTGADLRKAVEELVQIPADRQK
                     YMVKGGLGDETAVADVVKPGSSVLLLGTPDKDMVVKPRTAEKFIEDLGADAQSGQLSR
                     VPMGIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKKATAEGMDLYHVQLIREIQAT
                     FRKLRDKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELFTQLFHTMQTVF
                     GEELIDRFKIGFKTTIKDTMNEGDVTEKTEDDLKLRCHITGATNFMKAGIKESLKETI
                     EKRSDVTGASSTYSVEKKITKLPEYLTVQYVRFFWKKSTGKKSKILRKVQFPFQLDVA
                     DLLTPEYAQTKIQVREAFREVDKERAESIRERKRSKFNPAPAEGGSTPAEAAEIARSL
                     EESTREKWARAFAAKTPADLGRGENPSCVYDLIGVITHQGANSESGHYQAFMRDEFDD
                     DKWYKFNDDKVTAIEKEKIESLAGGGESDSALILIYKGFGL"
     gene            complement(<580758..>581456)
                     /locus_tag="AGOS_AEL028C"
                     /old_locus_tag="AEL028C"
                     /db_xref="GeneID:4621030"
     mRNA            complement(<580758..>581456)
                     /locus_tag="AGOS_AEL028C"
                     /old_locus_tag="AEL028C"
                     /product="AEL028Cp"
                     /transcript_id="NM_210187.2"
                     /db_xref="GeneID:4621030"
     CDS             complement(580758..581456)
                     /locus_tag="AGOS_AEL028C"
                     /old_locus_tag="AEL028C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR011C (AIM13)"
                     /codon_start=1
                     /product="AEL028Cp"
                     /protein_id="NP_984833.2"
                     /db_xref="GeneID:4621030"
                     /translation="MRAGCRRAERQAGRAGQYAGRAGQRAGRAGSAAIGRRAALTQSA
                     QGAGFSGQKISPMAGRGIVERGLRLLHGTPRSTAQHSGMGFFSRQPTETKVFTPSSPV
                     NISPGLLSQLVSTKETDFTRQQLNDKFLEEKVAQRYAQREEETLKKFEVKLNSALLKD
                     SAADEQELSSSAVQQKVASLTERLAQLETRTKPKANKEVADARGQVARCLAANEGRPL
                     NCYEEIQQFKKVAL"
     gene            <582081..>584108
                     /locus_tag="AGOS_AEL027W"
                     /old_locus_tag="AEL027W"
                     /db_xref="GeneID:4621031"
     mRNA            <582081..>584108
                     /locus_tag="AGOS_AEL027W"
                     /old_locus_tag="AEL027W"
                     /product="AEL027Wp"
                     /transcript_id="NM_210188.2"
                     /db_xref="GeneID:4621031"
     CDS             582081..584108
                     /locus_tag="AGOS_AEL027W"
                     /old_locus_tag="AEL027W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL019W and YFR012W (DCV1)"
                     /codon_start=1
                     /product="AEL027Wp"
                     /protein_id="NP_984834.2"
                     /db_xref="GeneID:4621031"
                     /translation="MGFRFGLSGLIWLAQTAALAFLVVSCITAPVVSDLGLADADGVQ
                     YGVFGYCIQDRGCSPVSASYGPERVFSGTQWAMGQDMRRVLGRILVVAPVAAGLTLLA
                     VVSNFVSQFSGVHRHAGIFVSNLLWTILAFFSSALLCIVVWLLFWPHLTWCAYVLLAA
                     AVIHLFCVPLTFLAHSQVCQDSDDESLHGALSSQKLMKREDDYANSFNMNELHKTAID
                     SDVKQPGYYKVAPVTTGDVTDSTKTDYTDIYGSQQAPPPQPYLRSTPQNRNSYVATEP
                     QTTSAGGNGEESGKWEQPTLAPYPMTGGFSAQGYNRPSGPPIPPYPSTGSTKDRTANY
                     DRERHDARSGMGPTGDPSYYPAGMEGVQQPYSAINDASKNGIPAGSTGDHAKNKLPYA
                     TSTTARNADPSASGVRGPYAEGLPTASSSNYEVTQLSSGRITARPAQSPAYPSSAGEP
                     VKQQPYPRQSRNLDYPNQQDFDDEEFVRQNTVDPEERPPIEEDDGIKDDDSDFTSVSQ
                     RGINPNYYTIAGKQAPYPQTFSAPLPHNQAIYPDQPYAGPPPPDAYQTSNSLGMSRQG
                     AHQQYVSQGYTPQPQGYQASGYYSAPSTSQPRAPDTSDMLLQNNPDFMIGGAASNKAA
                     RFGGPGQRVQQSAGSTTAPATLYKPAYKKRMQKSKGMVAASLSRDSPYGGR"
     gene            complement(<584558..>585607)
                     /locus_tag="AGOS_AEL026C"
                     /old_locus_tag="AEL026C"
                     /db_xref="GeneID:4621032"
     mRNA            complement(<584558..>585607)
                     /locus_tag="AGOS_AEL026C"
                     /old_locus_tag="AEL026C"
                     /product="AEL026Cp"
                     /transcript_id="NM_210189.2"
                     /db_xref="GeneID:4621032"
     CDS             complement(584558..585607)
                     /locus_tag="AGOS_AEL026C"
                     /old_locus_tag="AEL026C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL018C (TLG2)"
                     /codon_start=1
                     /product="AEL026Cp"
                     /protein_id="NP_984835.2"
                     /db_xref="GeneID:4621032"
                     /translation="MYRDRTNLFLSYHRTFPHQRHWRSQQGPGAGGEPGDVEAVGEIG
                     AAEEAHPMLEMAQKQAAQLPPGFFEEVQRIDAELAGNDVHMVALAKLYRKNALPGFVD
                     KTADEREIEALSFKTIAGLQRCYEAIKRLQAGREAQRFQGRALGRGELAILENCCRAY
                     AAKIQAASHRFRVMQNNYLKFLNNDDFKPLPAATNDQETLQLLEEEGEREAQQELDSY
                     SQQTLQKQRQKQRETQYLEDRDAEITQLAKGVLEVSTIFREMQTLILDQGTVVDRIDY
                     NLENTNIDLKQAQRELDQAVGYQKRTQKCKVIMLLSLLVVFFFFVVLLKPRSSGTPDK
                     GAGARPEDRPAEDRN"
     gene            585729..585813
                     /locus_tag="AGOS_t0111"
                     /db_xref="GeneID:4621033"
     tRNA            join(585729..585767,585778..585813)
                     /locus_tag="AGOS_t0111"
                     /product="tRNA-Tyr"
                     /codon_recognized="UAC"
                     /db_xref="GeneID:4621033"
     gene            <586077..>587687
                     /locus_tag="AGOS_AEL025W"
                     /old_locus_tag="AEL025W"
                     /db_xref="GeneID:4621034"
     mRNA            <586077..>587687
                     /locus_tag="AGOS_AEL025W"
                     /old_locus_tag="AEL025W"
                     /product="AEL025Wp"
                     /transcript_id="NM_210190.2"
                     /db_xref="GeneID:4621034"
     CDS             586077..587687
                     /locus_tag="AGOS_AEL025W"
                     /old_locus_tag="AEL025W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR028C (CDC14)"
                     /codon_start=1
                     /product="AEL025Wp"
                     /protein_id="NP_984836.2"
                     /db_xref="GeneID:4621034"
                     /translation="MGKRVYLDNTIEFLKGRVYLGAYDYAPQDSEEVVFFTVEDTLFY
                     NRFHLDFGPMHIGHLYRFAVIFHEILNDPENHGKAVVFYSSTSTRQRANTACLLCCYM
                     VLVQGWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVVYGIWRAKETGLVDLN
                     TFRLEVYEKYERVENGDFNVLTPDFIAFASPEEDMRRPYVSGRTRLNQPFKRVLEFFK
                     DNNVQLVVRLNSHLYRAQHFEDVGIKHLDMIFEDGTCPDLSIVKNFVGAAETIINQGG
                     KIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMVVGPQQHWIYLNQNT
                     FREWKYTMKLSIEPSDLICGLYPLVTLEEYKLQKKALRKSKADHEGDYTVDENTVTPP
                     NKTLASRNNEFSHTNAVPQESPGQPRKGQDGSNTIEDINNKTKPVSSNGKPPRKVDEN
                     TSRVHHSNNSDNEEDSMLIDSSNATTKSPLSSMTKKQTTNTSMDDEFALRQILPKNRR
                     LASSGLATTDKRSASGAGVRKVSGTAKR"
     gene            complement(<587963..>588763)
                     /locus_tag="AGOS_AEL024C"
                     /old_locus_tag="AEL024C"
                     /db_xref="GeneID:4621035"
     mRNA            complement(<587963..>588763)
                     /locus_tag="AGOS_AEL024C"
                     /old_locus_tag="AEL024C"
                     /product="AEL024Cp"
                     /transcript_id="NM_210191.2"
                     /db_xref="GeneID:4621035"
     CDS             complement(587963..588763)
                     /locus_tag="AGOS_AEL024C"
                     /old_locus_tag="AEL024C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR027W (ECO1)"
                     /codon_start=1
                     /product="AEL024Cp"
                     /protein_id="NP_984837.2"
                     /db_xref="GeneID:4621035"
                     /translation="MAGVKKNRSPRKPTKLLQSRLKFAHSSATLKKCTECQMSYIIDS
                     PADCAEHKKYHDLHLYGKKWLASWGTAIQDTCSSQYITPPSTSGGNASGNGAKADRED
                     YIVYITPGKTAEVKAMMEIMYIVNNELTAPHDENDFWSEEGTSSMGRAFVYIKDGRAV
                     GAITVEYLKEDDSRGRWMRVSTRELVPEVVPRVRLGISRIWVCRKQRGQGIATRLLEC
                     VRKYAILGNEVARWEMAWSQPSESGGKLATRYNSVRHKSGELLIPCYI"
     gene            complement(<589141..>593517)
                     /locus_tag="AGOS_AEL023C"
                     /old_locus_tag="AEL023C"
                     /db_xref="GeneID:4621036"
     mRNA            complement(<589141..>593517)
                     /locus_tag="AGOS_AEL023C"
                     /old_locus_tag="AEL023C"
                     /product="AEL023Cp"
                     /transcript_id="NM_210192.2"
                     /db_xref="GeneID:4621036"
     CDS             complement(589141..593517)
                     /locus_tag="AGOS_AEL023C"
                     /old_locus_tag="AEL023C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIR019C (MUC1)"
                     /codon_start=1
                     /product="AEL023Cp"
                     /protein_id="NP_984838.2"
                     /db_xref="GeneID:4621036"
                     /translation="MQFKKASTVALSGWLLPALAAAQGPGTANHANLVPRTAIGGAGV
                     QVTPYDNCPQYDFTWKAKNSGYAPYKVSVEKVEWEYDNVYTVTIRAKGTDPTPLKSLW
                     SLKIIGVDSPDGSSFQLFGYNEHTFLIDNPSDYQATFRVYAQDGGDGKVCMPEYKIQY
                     EYCQGHTDCSDWKYGTTAIDLEMGCSNVDNMNHSQKDSPAYCWPRGELPHTKPPHSTE
                     PGTETGTTTTVPVTPTSVLPKTSDSMSSESVSSTTSCSKTTKSKVPPSSAPETPTSVL
                     PKTSESMSSESVSSTTSCSKTTKSKVPPSSAPETPTSVVPKTSESSVPPSSAPETPTS
                     VVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAP
                     ETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVP
                     PSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTS
                     ESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSV
                     VPKTSESSVPPSSAPETPTSAVSKTTESVSTHRSSSQSYTASTVTTTVSGSVVTLSTT
                     VPCEPTGTTSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSA
                     PETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSV
                     PPSSAPETPTSAVSKTTESVSTHRSSSQSYTASTVTTTVSGSIVTLKTTVPCEPTGTT
                     SVPPSSEHKPSGSTNSSIPVTTGTSVLPKTSENVSSTTGSSAESYTTQTVTTTVSGSV
                     VTLKTTVPCTPTGNTSVPVSSAAKPSASTSVPSSSGKVPSGSAGSSIPATGTSVLPKT
                     SENVSSTTGSSAESYTTQTVTTTVSGSVVTLKTTVPCTPTGTTSVPPSSEHKPSGSTN
                     SSIPVTTGTSVVPKTTENVSSTTGSSAESYTTQTVTTTVSGSVVTLKTTVPCTPTGNT
                     SVPVSSAAKPSASTSVPSSSGKVPSGSAGSSIPATGTSVLPKTSENVSSTTGSSAESY
                     TTQTVTTTVSGSVVTLKTTVPCAPTGTTSVPPSSEHKPTGTTSVPVSSGQKPSGTTSV
                     PVSSGQKPSGSAVSSTPVGSAPPKPSGASESIIVITSDDITTTYTSVIEQVVTITNCD
                     NGECETVTTFAPATEPTPVSASASASASTAPVTTSPVHETGSSVPASKAVPSVPVTHA
                     FVHNTGSSVSAPPNATPTPVPAAEDDTTTIIVQDIVVTVTYNEAYAESTTTHMVNGTT
                     SVATHTTKVKELPPVVTGTGTNSNGLTTVTATLGNKTTKTVCPEGGCQLSTPTTVPPA
                     TETPVGGQPTGNKPGAQCPEGNCHTSAPPHPSVTSSSGYPSRVSSSATAPSSSISVFD
                     GAGVKKHPSLLALAIPFFYLLG"
     gene            <594169..>595203
                     /locus_tag="AGOS_AEL022W"
                     /old_locus_tag="AEL022W"
                     /db_xref="GeneID:4621037"
     mRNA            <594169..>595203
                     /locus_tag="AGOS_AEL022W"
                     /old_locus_tag="AEL022W"
                     /product="AEL022Wp"
                     /transcript_id="NM_210193.2"
                     /db_xref="GeneID:4621037"
     CDS             594169..595203
                     /locus_tag="AGOS_AEL022W"
                     /old_locus_tag="AEL022W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR025C (HIS2)"
                     /codon_start=1
                     /product="AEL022Wp"
                     /protein_id="NP_984839.2"
                     /db_xref="GeneID:4621037"
                     /translation="MCRRTSQRNLRMFSHHSHSGEYVAHGADTLEAVVAEALRQGFHT
                     YCLTEHMPRLDEAYLYPEERSGAAARDLRGLAELFGRYVEHAARLRQHVDGMAVLVGM
                     EAEACDRQHVAYAKRLLQDFGSHVQFCVGSVHHVYGIPIDFSQTLWDSALQQAGGNLK
                     RLLADYFDWQYYMLRELQPEVVGHFDLIRLYLPRDRFWVELGTGAVSDTYLGGNWTHI
                     ALVSARIVSLWEDVQSRVVRNLEYIASYGGLVEINSAGLRKGLADPYPHRDVALLVKR
                     YAGARFVLSDDAHSVSQVGTEYVRTLEYVENVLQLEGLFYLAEASSGPTALEAKYMSL
                     QEIKESRFWK"
     gene            complement(<595323..>597335)
                     /locus_tag="AGOS_AEL021C"
                     /old_locus_tag="AEL021C"
                     /db_xref="GeneID:4621038"
     mRNA            complement(<595323..>597335)
                     /locus_tag="AGOS_AEL021C"
                     /old_locus_tag="AEL021C"
                     /product="AEL021Cp"
                     /transcript_id="NM_210194.1"
                     /db_xref="GeneID:4621038"
     CDS             complement(595323..597335)
                     /locus_tag="AGOS_AEL021C"
                     /old_locus_tag="AEL021C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR020W"
                     /codon_start=1
                     /product="AEL021Cp"
                     /protein_id="NP_984840.1"
                     /db_xref="GeneID:4621038"
                     /translation="MPLNEQFALLALDAECAAPVKQLVFKPKVAKSAIAVPVVVVALQ
                     STTTPVGVVAHASGSKDPRLARDELFQSHFGVETAKAFDLSHLEQAQHGFQLLVDREL
                     AALADEAAVGLSGVAVEKGALMAYLQKHGAVEVDFAQEVQAAAPKAKKGAAVVKESAA
                     LADAKLIGITVDKALDFPGWYQQVLVKGDLLDYYDISGCYILKPASYCIWERIQEWFN
                     GKIRSMGVQNVCFPMFISSRALEKEKDHIEGFAPEVAWVTKAGSSDLEEPIAIRPTSE
                     TAMYPFFAKWVQSYRDLPLKYNQWTSVVRWEFKHPQPFLRTREFLWQEGHTAHLTKEE
                     ATDEVMQILDHYEQVYVELLAVPVVKGTKTENEKFAGADFTTSVEGYIPQTGRGIQGA
                     TSHHLGQNFSKMFNICVENPLGPQHPKVHAYQNSWGLSTRSIGVMVMTHSDNKGLVIP
                     PRVAQHQVVILPVGITAKTKEDVRSKIHDSARAIENRLHKAGIRVLGDYADNYTPGWK
                     FAQYELKGVPLRLEFGPKDMEKAQVTAVRRNDGAKISVPLADLEERIPQILDEMHQLL
                     YQKAKKSFDDHLITVTEWKDFVPTLNKKNIILSPWCGVPECETDIKASSAKKDDGDEY
                     EVDEKAPSMGAKSLCVPFEQPVLAPGQKCIKCDKPAVNYCMFGRSY"
     gene            <597558..>599213
                     /locus_tag="AGOS_AEL020W"
                     /old_locus_tag="AEL020W"
                     /db_xref="GeneID:4621039"
     mRNA            <597558..>599213
                     /locus_tag="AGOS_AEL020W"
                     /old_locus_tag="AEL020W"
                     /product="AEL020Wp"
                     /transcript_id="NM_210195.2"
                     /db_xref="GeneID:4621039"
     CDS             597558..599213
                     /locus_tag="AGOS_AEL020W"
                     /old_locus_tag="AEL020W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR019C (DED81)"
                     /codon_start=1
                     /product="AEL020Wp"
                     /protein_id="NP_984841.2"
                     /db_xref="GeneID:4621039"
                     /translation="MSIYINELTGADEAGRGTEEAPFKSAAFGLFAQQDGEEPKVFTY
                     KSDEGAGGYVEISASGLKKARKGAEGLRKAAAKEVEQQRRRAEQEARDAAKKLELMSI
                     KIEEDASLPPAVGLKVGKAHGAVGTRVKVSGWIHRLRMGKAVVFLVLRDGTGYLQAVL
                     SKDLARAYQTSTLTLESTVTLYGTVKQLPEGKTAPGGVELDVDYYEIVSLAPSGDDSF
                     SNRVQEGADPSLLMDMRHLMLRGESLSAVMKVRAAFLRAIRRVYEDEGLLEVTPPCMV
                     QTQVEGGSTLFKLDYYGEEAFLTQSSQLYLETCLPALGDVFCIQESFRAEKSHTRRHL
                     SEYTHIEAELGFVDFDQLLRHTERVITSLVRYVLEDPVAGPLVKQLNPDFVPPQMPFM
                     RLEYKDAITWLNEHGIKNEEGEEFKFGDDIAEAAERKMTDTIGKPIFLTRFPLELKSF
                     YMKRCADDPRVTESFDVLMPTVGEVTGGSMRIDSLDELMAGFKREGVNPEPYYWFSDQ
                     RRYGSCPHGGYGLGTERILAWLCNRYTVRDCSLYPRYTGRCKP"
     gene            <599599..>601008
                     /locus_tag="AGOS_AEL019W"
                     /old_locus_tag="AEL019W"
                     /db_xref="GeneID:4621040"
     mRNA            <599599..>601008
                     /locus_tag="AGOS_AEL019W"
                     /old_locus_tag="AEL019W"
                     /product="AEL019Wp"
                     /transcript_id="NM_210196.1"
                     /db_xref="GeneID:4621040"
     CDS             599599..601008
                     /locus_tag="AGOS_AEL019W"
                     /old_locus_tag="AEL019W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR018C (ARG4)"
                     /codon_start=1
                     /product="AEL019Wp"
                     /protein_id="NP_984842.1"
                     /db_xref="GeneID:4621040"
                     /translation="MSSGKQKLWGGRFAGDTDPLMHLYNASLPYDYKMYKADILGTKV
                     YTEGLQKTGLLTKDELESIHEGLKQVEQEWEQGVFVKHVDDEDIHTANERRLGEIIGR
                     HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGY
                     THLQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLNQSPLGAGALAGHPYGIDREYL
                     ACELGFDGVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDLIIYSTAEFGFVKLA
                     DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLAGFLMSLNSIPSTYNKDMQEDKEPL
                     FDCLLTLEHTSLIATGVLSTLSVVKEKMFQALTVDMLATDLADYLVRKGVPFRETHHI
                     SGSCVALAEQLALSGIDQLTLEHYKGIDPRFEEDVFDVFDFELSVERRQSTGGTARAA
                     VLKQVDNLEEQLKRMHNNT"
     gene            complement(<601134..>602285)
                     /locus_tag="AGOS_AEL018C"
                     /old_locus_tag="AEL018C"
                     /db_xref="GeneID:4621041"
     mRNA            complement(<601134..>602285)
                     /locus_tag="AGOS_AEL018C"
                     /old_locus_tag="AEL018C"
                     /product="AEL018Cp"
                     /transcript_id="NM_210197.1"
                     /db_xref="GeneID:4621041"
     CDS             complement(601134..602285)
                     /locus_tag="AGOS_AEL018C"
                     /old_locus_tag="AEL018C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR017W (YSC83)"
                     /codon_start=1
                     /product="AEL018Cp"
                     /protein_id="NP_984843.1"
                     /db_xref="GeneID:4621041"
                     /translation="MAERWINACFEAYDTTIRHAEDVGAQAVQSARAVYNVACETVSE
                     IARRAGTEERGVAVLAEKPAGGVAAAREHILAAVVGLAGRPRVRAAAAAAAAGLLVYV
                     AGRALVPAVAARVVGERETVLVLGEMTDPITRALVYDLHRRGFCVFVCSTSEKRDRQL
                     EDEYEKVPSPWDQEGGVCHMAATPEAVARLTEFLQREERRLRGVLVVPSSCFFTSGMF
                     TNIPEGQVRSELQENLVNTWAVVTRLLPQFDSASRDKLQVVVFNPSLSQKLNLQYHSL
                     ELLMSSTMESLYRILANECGYLADVYQCHLGILNIAGNASNYKYLTINGSHITKALCE
                     PIYELLLSRDNMWVRFKRWLQGPVLYCGKGSRLACWLRSYAPLWLLEFI"
     gene            <602492..>603843
                     /locus_tag="AGOS_AEL017W"
                     /old_locus_tag="AEL017W"
                     /db_xref="GeneID:4621042"
     mRNA            join(<602492..602538,602640..>603843)
                     /locus_tag="AGOS_AEL017W"
                     /old_locus_tag="AEL017W"
                     /product="AEL017Wp"
                     /transcript_id="NM_210198.1"
                     /db_xref="GeneID:4621042"
     CDS             join(602492..602538,602640..603843)
                     /locus_tag="AGOS_AEL017W"
                     /old_locus_tag="AEL017W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR024C-A (LSB3) and YHR016C (YSC84); 1-intron"
                     /codon_start=1
                     /product="AEL017Wp"
                     /protein_id="NP_984844.1"
                     /db_xref="GeneID:4621042"
                     /translation="MGLNNPLPRSLTAETKKAAKVLASFVKPDQMLGADEVIPPHVLK
                     NAKGLAIITVLKAGFLFSGRAGSGVIVARLADGRWSSPSAIALAGAGAGGMVGVELTD
                     FVFILNTADAVKSFSHAGSITLGGNISVAAGPLGRNAEAAATASLGSVAAVFSYSKTK
                     GLFAGVTLEGSVIIERREANRKFYGSNCTAKAILSGSVSPPPGVDPLFRVLRSRAFNH
                     TSSRSGTEEPYFRDDDYYGDIPSNLDSEGNSRRNSWRNSFRRSRHGVEGYHDDVGGYD
                     GCSDDDNVSDYYTNRRRGDGSALSNSTLSGNLRSSTKWEDDEYDQGIVNTSGKPEQNS
                     QRRAPARPTSAKPDFGSHSTSSGAIPKAVALYTFKGEQKGDLPFRKGDVIMILKRTES
                     QDDWWTGRINGQEGIFPANYVDLV"
     gene            complement(<604193..>606229)
                     /locus_tag="AGOS_AEL016C"
                     /old_locus_tag="AEL016C"
                     /db_xref="GeneID:4621043"
     mRNA            complement(<604193..>606229)
                     /locus_tag="AGOS_AEL016C"
                     /old_locus_tag="AEL016C"
                     /product="AEL016Cp"
                     /transcript_id="NM_210199.2"
                     /db_xref="GeneID:4621043"
     CDS             complement(604193..606229)
                     /locus_tag="AGOS_AEL016C"
                     /old_locus_tag="AEL016C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR023W (PES4) and YHR015W (MIP6)"
                     /codon_start=1
                     /product="AEL016Cp"
                     /protein_id="NP_984845.2"
                     /db_xref="GeneID:4621043"
                     /translation="MASSEANSATPLNSISLNVQRQSNIQDKSTNHHNMANSIVKHVK
                     ITINNHDVLPGEEDDDDDNKDEEGSTEVTKVEKNESRSISSQSTSSSGTDGTDIVKLG
                     RSKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYG
                     YLNFSNEEDAERVIEEFNYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLAL
                     TTRVFYDAFKKFGKILSCKLDRRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILCGI
                     HFDRNVRKSPEFEKRKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNAVFIKNLPL
                     NPDSDLLLDYFSQIGPVKSIFTSNVSKLNSAWAFITFKKGSDAQDAIDNLNHSQLLGR
                     TIELSRAQKNFQTDIDAANAGAGNNSSTTRSNDSDPCSTQHSSSYKLTVYLSSLSSIC
                     SEQFLQCFCAEERIKTKRISIRFYDEATLTFSGFVQCQTRNDANRLFELLNNKLLGDS
                     TVKASWKPSKEAKPINTAVATVPLTPHLKLQQHNHKKPATSVNIRREPYIYRAPAPEY
                     RGYNPLKNKMLQQQVLMAPLNVKAVAKDPNAKEALAALKKEVRRYIDFLKFPLATREQ
                     NLSIISKYILEVFYQNRVEAITRVLLMKQNHNYFERQFQEQVEESIAQLGLEGR"
     gene            complement(607290..607362)
                     /locus_tag="AGOS_t0112"
                     /db_xref="GeneID:4621044"
     tRNA            complement(607290..607362)
                     /locus_tag="AGOS_t0112"
                     /product="tRNA-Ala"
                     /codon_recognized="GCU"
                     /db_xref="GeneID:4621044"
     gene            <607707..>609074
                     /locus_tag="AGOS_AEL015W"
                     /old_locus_tag="AEL015W"
                     /db_xref="GeneID:4621045"
     mRNA            <607707..>609074
                     /locus_tag="AGOS_AEL015W"
                     /old_locus_tag="AEL015W"
                     /product="AEL015Wp"
                     /transcript_id="NM_210200.1"
                     /db_xref="GeneID:4621045"
     CDS             607707..609074
                     /locus_tag="AGOS_AEL015W"
                     /old_locus_tag="AEL015W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL069W (NUF2)"
                     /codon_start=1
                     /product="AEL015Wp"
                     /protein_id="NP_984846.1"
                     /db_xref="GeneID:4621045"
                     /translation="MSSDNFPLLDIPELVTCLQECDFSLATIQNVERPSSQFVITLYK
                     QIIDTFMGVSPDSLLEDSRNFVENGDTSEQEVYDASLVYHDTLKILALNKICYKFFLD
                     IGVSDFNVMDLYKPDPHRTRRFLSAVANYARFREEAMLELDGDQHPDGVRYLEQTDKL
                     LKELRLKFDANNLLHSRVQKYKEFQKSDDLEALESDNKNMESELRHLNQVQETLTVDY
                     ERYKAEKQRHLSELETLGYELIELESERDKLRKYSQTDAEVLRKGVRELSLLLEQQQV
                     QLEKLEQKQKNLQISFETFQASTQELYEVLQIVSTDLQDSHLKESTLLDAKHKLMQNH
                     KNLNNLLSAGIMAKITLLQEQLDSQKRKLAELELNTQAKESENSATLKRLRKQHTDDV
                     LPEVRNIEQRYKTKVADTITNYESQMRNIKVDFDNEVALIENECSLLFNHIKNYMTTI
                     GEKLG"
     gene            complement(<609119..>609886)
                     /locus_tag="AGOS_AEL014C"
                     /old_locus_tag="AEL014C"
                     /db_xref="GeneID:4621046"
     mRNA            complement(<609119..>609886)
                     /locus_tag="AGOS_AEL014C"
                     /old_locus_tag="AEL014C"
                     /product="AEL014Cp"
                     /transcript_id="NM_210201.1"
                     /db_xref="GeneID:4621046"
     CDS             complement(609119..609886)
                     /locus_tag="AGOS_AEL014C"
                     /old_locus_tag="AEL014C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL043C (PRP11)"
                     /codon_start=1
                     /product="AEL014Cp"
                     /protein_id="NP_984847.1"
                     /db_xref="GeneID:4621046"
                     /translation="MDYQNRAGSKKGGGGIASQSQQNVHRRKQVEDLLRGGEDVPYTF
                     QHDSADKADDEAKLKRNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNLLR
                     RGGSTAGADDDALSKQDREFHTKVEEMRQQIKHNGVVPKVQFTKVKDPETEHIGIAVR
                     VDYKVEGTAASGDEEEPPCLRILSGLELPGAEDDDKKYLVVAYEPFENIAIEIPDKEI
                     VMSKRQSAVESIDELNGRCSYWDRDDKAFYVQLFFKQ"
     gene            complement(<610209..>611888)
                     /locus_tag="AGOS_AEL013C"
                     /old_locus_tag="AEL013C"
                     /db_xref="GeneID:4621047"
     mRNA            complement(<610209..>611888)
                     /locus_tag="AGOS_AEL013C"
                     /old_locus_tag="AEL013C"
                     /product="AEL013Cp"
                     /transcript_id="NM_210202.1"
                     /db_xref="GeneID:4621047"
     CDS             complement(610209..611888)
                     /locus_tag="AGOS_AEL013C"
                     /old_locus_tag="AEL013C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL042C (SIR2) and YOL068C (HST1)"
                     /codon_start=1
                     /product="AEL013Cp"
                     /protein_id="NP_984848.1"
                     /db_xref="GeneID:4621047"
                     /translation="MSESASMLQGSKRGTDSSVDVGGAKRTKVDMDDGSSSNNDEKEL
                     LEATKADELDEVVDDYAEQNDHSAQEVAGEYVPKKPEQPIMLTKDSNSGKYVFPPISK
                     EDSLNARYFLKYHGSAQFLDSYLPEDLNSLYVFHLIKLLGFQLKDRELLTAVQKAVQN
                     DVTSGVSSVVGTNPMVERVSPPQLSASTPSGDGYDDPLEKKHAVRLIKDLQKAMNKVL
                     STRIRLANFFTLDHFISKLKSAKKVLVLTGAGISTSLGIPDFRSSKGFYSQVTNLGLD
                     DPQDVFNLDIFMENPSVFYTIAEKILPPEHKFSPLHSFIKMIQDKGKLLRNYTQNIDN
                     LESYAGIFKENIVQCHGSFATASCVTCHLKMPGERIFQQIKDREIPLCAYCYPKRQEE
                     YPTVSDDPGTKNGQQSSHNSSSIFHMSRSFGVIKPDITFFGEALPLEFHTNIRQDVLQ
                     CDLLICIGTSLKVAPVSEIVNMVPAHVPQVLINRDPVKHAEFDLTLLGLCDDVAAFIA
                     QKCGWDIPHENWPQLKQRNIQYDELERGMYYVYDPVKEQAKDTGQRQVQAP"
     gene            complement(<612182..>612748)
                     /locus_tag="AGOS_AEL012C"
                     /old_locus_tag="AEL012C"
                     /db_xref="GeneID:4621048"
     mRNA            complement(<612182..>612748)
                     /locus_tag="AGOS_AEL012C"
                     /old_locus_tag="AEL012C"
                     /product="AEL012Cp"
                     /transcript_id="NM_210203.1"
                     /db_xref="GeneID:4621048"
     CDS             complement(612182..612748)
                     /locus_tag="AGOS_AEL012C"
                     /old_locus_tag="AEL012C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL067C (RTG1)"
                     /codon_start=1
                     /product="AEL012Cp"
                     /protein_id="NP_984849.1"
                     /db_xref="GeneID:4621048"
                     /translation="MTSFPGSIPSSVLSSCTIASERSERKRRDNINDRIQELLNVIPE
                     EFFQDYYQKKKDQESESGTPGALPKNKGTGTRDGKPNKGQILTQAVEYVTYLQNQVDL
                     RNREEVELILKVKELCRQTGSIVNDVNLENTSAELALAKIGVGPLAGVLGEYCGTQGS
                     STQGSSKPPQERNNNFEYGGYAEYGDGA"
     gene            <612964..>614277
                     /locus_tag="AGOS_AEL011W"
                     /old_locus_tag="AEL011W"
                     /db_xref="GeneID:4621049"
     mRNA            <612964..>614277
                     /locus_tag="AGOS_AEL011W"
                     /old_locus_tag="AEL011W"
                     /product="AEL011Wp"
                     /transcript_id="NM_210204.1"
                     /db_xref="GeneID:4621049"
     CDS             612964..614277
                     /locus_tag="AGOS_AEL011W"
                     /old_locus_tag="AEL011W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL007W (RPT2)"
                     /codon_start=1
                     /product="AEL011Wp"
                     /protein_id="NP_984850.1"
                     /db_xref="GeneID:4621049"
                     /translation="MGQGASTYGKGQKGKKDKKQKPKYEPPVQSKIGRKKRKGPATAE
                     KLPNVYPSTRCKLKLLRMERIKDHLLLEEEFVTNSEILKPFEMKQEEERKQLEEIRGT
                     PLSIGTLEEIIDDDHAIVTSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVL
                     QDDADPMVSVMKIDKSPTESYNDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKG
                     VILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAP
                     SIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESL
                     DPALIRPGRIDRKILFENPDVSTKRKILGIHTSKMNLSADVDLETLVTSKDDLSGADI
                     KAMCTEAGLLALRERRMQVTVEDFKQAKERVMKNKVEENLEGLYL"
     gene            <614734..>615753
                     /locus_tag="AGOS_AEL010W"
                     /old_locus_tag="AEL010W"
                     /db_xref="GeneID:4621050"
     mRNA            <614734..>615753
                     /locus_tag="AGOS_AEL010W"
                     /old_locus_tag="AEL010W"
                     /product="AEL010Wp"
                     /transcript_id="NM_210205.2"
                     /db_xref="GeneID:4621050"
     CDS             614734..615753
                     /locus_tag="AGOS_AEL010W"
                     /old_locus_tag="AEL010W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL006W (PTC1)"
                     /codon_start=1
                     /product="AEL010Wp"
                     /protein_id="NP_984851.2"
                     /db_xref="GeneID:4621050"
                     /translation="MGYNETEPAIDGDNNEQRINEDMSTLEHTSNNNGNGLEPVEAGP
                     DSGIPAVEGGGSVSGQSPQHEPPAYELSYVVGVAENKNAKFRRTMEDVHTYVENFASR
                     LDWGYFAIFDGHAGNQASKWCGSHLHTIIEERILQGDDRDVRDILNDSFVYVDQQINS
                     TLEGNSGCTAAVGILRWEAPTPIPNMPINLEQHKRMLYTANVGDTRIILFRNGRSVRL
                     TYDHKASDIIEMQRVEKAGGLIMKSRVNGMLAVTRSLGDKFFDSLVVGNPFTTSVEIT
                     TSDQFLIIACDGLWDVVDDQEACEMIKDIEDANEAAKTLVRHALEHGTTDNVTVMVVF
                     FDNNQ"
     gene            complement(<615924..>616955)
                     /locus_tag="AGOS_AEL009C"
                     /old_locus_tag="AEL009C"
                     /db_xref="GeneID:4621051"
     mRNA            complement(<615924..>616955)
                     /locus_tag="AGOS_AEL009C"
                     /old_locus_tag="AEL009C"
                     /product="AEL009Cp"
                     /transcript_id="NM_210206.1"
                     /db_xref="GeneID:4621051"
     CDS             complement(615924..616955)
                     /locus_tag="AGOS_AEL009C"
                     /old_locus_tag="AEL009C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL005C (MED2)"
                     /codon_start=1
                     /product="AEL009Cp"
                     /protein_id="NP_984852.1"
                     /db_xref="GeneID:4621051"
                     /translation="MIKELQGGNMATKFKTDEEMRGDRLTQCLDDIMRASTEMMVQQQ
                     LKTIQLNSDVAAGFRKALSKSLGDRVRAFHSILDGVETTLTTASQYLDAVEEAAVKMK
                     QWKQQQEEEQRRKHQAELEKNKRQQEHDAATKAAAAQQLMAQQSPVDLTAPTPTGLAS
                     NLDKSNRVGGVKPFSAEFGHLDEMDLSMFGGIDGHGDFSLEDFNMGGNSVPLNGGRPR
                     NMVMADAGGFPARGGMGRGGATAINNGAQEIKTSTNEASTNNRNNDGTGGASNPRISS
                     NYNSAVADHESIGLRVDANGQNTKQSGQQSGAGLNPDDYLTLNDFNDLGIDWNTGENN
                     ELDLNDFNI"
     gene            <617521..>617997
                     /locus_tag="AGOS_AEL008W"
                     /old_locus_tag="AEL008W"
                     /db_xref="GeneID:4621052"
     mRNA            <617521..>617997
                     /locus_tag="AGOS_AEL008W"
                     /old_locus_tag="AEL008W"
                     /product="AEL008Wp"
                     /transcript_id="NM_210207.2"
                     /db_xref="GeneID:4621052"
     CDS             617521..617997
                     /locus_tag="AGOS_AEL008W"
                     /old_locus_tag="AEL008W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL004W (ATP16)"
                     /codon_start=1
                     /product="AEL008Wp"
                     /protein_id="NP_984853.1"
                     /db_xref="GeneID:4621052"
                     /translation="MFRLTSARALFRVANVAARRTYAEAAADALKLNFALPHETLFAG
                     TAVKQVNLPVKTGQIGILANHVPIVEQLVPGVVEVLEGSESKKFFVSGGFATVQPDST
                     LSITSVEAFPLDSFSAENVRALLAEAQKNAGAADSRVAAEASIQIEVLEALQAALK"
     gene            <618517..>620310
                     /locus_tag="AGOS_AEL007W"
                     /old_locus_tag="AEL007W"
                     /db_xref="GeneID:4621053"
     mRNA            <618517..>620310
                     /locus_tag="AGOS_AEL007W"
                     /old_locus_tag="AEL007W"
                     /product="AEL007Wp"
                     /transcript_id="NM_210208.2"
                     /db_xref="GeneID:4621053"
     CDS             618517..620310
                     /locus_tag="AGOS_AEL007W"
                     /old_locus_tag="AEL007W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL003W (MCD1)"
                     /codon_start=1
                     /product="AEL007Wp"
                     /protein_id="NP_984854.2"
                     /db_xref="GeneID:4621053"
                     /translation="MSQINEHQQSKLLHLQTKTGSLAQIWLASTMTNLNRTYLRTDIV
                     QSVEEISKATTREGGDDGGDPITLRVSGELLHGVVRVYSQKANFLLTDVSDLLHRLKS
                     VFRGNMSRTTAVRVDTVARLDQVVLADTVTEMDVLAMPEIDFLDTTSSSKGLMRRERS
                     MERHVQGANTVTDPWDMSLEVGRRYAPDDDLEQQTSLLDLNFELSDMQNSKSWGEGTH
                     NSEEISANVLAESQRQELPGNEGIEREEDLDWNLGFTEPAIVVPSSDFEHDNSIEVGR
                     RAVPNADLQETVDLGFDLDIAKGDIEATAGEQDAGQLQSELSGSISTSSGTTVSSQRR
                     GQAALVNAKVLQVDHQPELHDRLLRDTPQTAASVDMTAIPLPSPPKKRAYSELASTMD
                     FLPEFALDHFTAFVSQKRRHAESPAARTIAHEVSSAESVDETHIDISLDLNDDLLRSD
                     AIEAGTEEEIEGEDAILDVPSSPRAQTASASPDLHEYSHISTEDVGFSLPRREVEVTT
                     GDHVAKSTVDMANTIRSELMDVESTTFSHLLKSKYGEESGAITKSQASKAFFEMLVLA
                     TADCVDLSQQASTGDITITGKGALYEKFIDI"
     gene            <620573..>628048
                     /locus_tag="AGOS_AEL006W"
                     /old_locus_tag="AEL006W"
                     /db_xref="GeneID:4621054"
     mRNA            <620573..>628048
                     /locus_tag="AGOS_AEL006W"
                     /old_locus_tag="AEL006W"
                     /product="AEL006Wp"
                     /transcript_id="NM_210209.2"
                     /db_xref="GeneID:4621054"
     CDS             620573..628048
                     /locus_tag="AGOS_AEL006W"
                     /old_locus_tag="AEL006W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL004W (UTP20)"
                     /codon_start=1
                     /product="AEL006Wp"
                     /protein_id="NP_984855.2"
                     /db_xref="GeneID:4621054"
                     /translation="MAKQSTTTKSAKRYRYSSFKDKIDDLKIEPAKNLSKRAHDYVES
                     SHFLSSFEHWKEFNMSADFTEFAQEVVNLVQTLPQILYHDDKIYDILSKHIGKHDDKS
                     LQPLLELLSQFCHDLGPDFLKFYERTLLLLINLLDESIKFENSDVFEWGFNCLAYIFK
                     YLSRQLTQDLIPTFTMLFPLLSHKKEYMSRFAAEALSFLIRKSSPKNLLPFVHNSCKT
                     LNQLENNNLYDGLHSLFSEALKSTSDTLYSKSNAIVSVLLQVALDKDQSLVAVTLFCD
                     IMMDALRHASAENAAPLYQLIIEKLDEFLSQKQEGDDLDKVIKILAVVTFAESGKKVN
                     NWEALSSCLQGALHHPRSESISPETLAFCFSVILRNADLKTVTSLHRTMFEFYMENYP
                     SFFLEFVKTVIDMDKGRFSSFNCSRFIGQFIKSHWKEHQKKIALLLLDLESKPELSST
                     LNFTIPEEFVTSLTSDLQSLDALAAEDNIFELYWRNIILKRCDTDNTAVIVPNLKTLL
                     EFPKPNDFVKDLIGDLLMGLSLSSQDTLQPICLQIAENFELYRDSTLFIQGYTRVIQS
                     EGLDAHETREQLLHKITDNFILPDRNLRYHSMMLLIKILEKSGQDVPQLFRDLLIIDD
                     IPLTLTNGRDITLRVRKLGADYSITEGTPLLNNGFFKYIFGLLTVRFSPLWDGINEIL
                     PNIYGKAQRLVWDLVLHLINALDNPHTLQYIEAPVSEPFAESFWTVSTTRLNDVLQSA
                     SDVFNMYVALDTSLIDTFKGRRGSLGYPGMIRNQALKILIALPQLAEQNSRFIVPFVL
                     KRNDQFDANQDEDHLGELAVHSADTWSETDRNLILKLLGKFKNIKAIYKSEDVRQRLM
                     ELLGSRTLEVQKLALDALLAYKDPVAVKYRDNLKNLLDDTLFNDEVTKLFAQNESRVI
                     VNTDERLLMPFILRILFGRVQTPNTSGIKKTRKTAVITVLPNLGEKNITDFLALGSNG
                     INYQYFFEENAVIPDSELTAINFRRMLGFINVLSASLNVLGSNFPEAVKTTIKPLVYA
                     IHMSGRTGQNKELQGSIDSLTASVRQQGMKCLFQLFGCIGEVIDWDEYLPIIHDHVIQ
                     PRVANFEHENLQSPSSIMKLICYWSTSKSFYPFLYYADYSAARALMALFSNEHAKESV
                     LHVLLDCFTKIIKQPTTEDSYIDLASLVAATSLQVLPSLLLRLVEPDGISLAIDLLLN
                     ITEAGYVQDNDTTKLLVEALTSAVEKDLNGIKPADKVKVFACLSALLSSYVCQWNDLE
                     RLYVACSKMYRTLRDRKQRESLNTVFSSMGKRFEHIQPVAKLLCDLNSYSTSRMQEYD
                     FETILSAFKVFTEETYQQFNEQHWLPILYTCLYFINDKEELALRTNSTHALTKFIDYA
                     NENPSAEQATAAISLIKDVLLPNLKLGLRSASDEIQAEYITLLAYIVTNSRYFTDFED
                     MKVLLFNNDEEANFFINIRHIQLHRRQRAIKRLGEASDKLNENSISHYLLPMIERYIF
                     VEDEKYRNLCNETIATIGILSNYSSWNQYKAILRRYISMMKQKPNHLKEIVNVIVAVT
                     RSFKNTLECIRSSNSSIPCIRNFPSKADEPNAYVENEIYPILHKILSTRDDETIIQRI
                     PLAHSLINLVLGLPNERIVSLLPGILTSLCQVLRSRSEELRDVVRKNLGNIAVVLGPE
                     YLTFVIQELKSALARGSQIHILSYSLHHVLVSMSEALGHGDLDDCASMIIDIVMEDTF
                     GAAGQEKDAEGYTSKIKEVKFNKSYDTSELLAANINLPVFGTLLRPVKALLLERIGIK
                     TQRKLDEVLRRYSLGLGHNSQASSPDVLKMCHEIYTLSQVFSPGSAKQRKEYNEKEDF
                     FLIRLDAKRVDVQVECSHYIETLQKLSLDLLRVAISRNRNLLDTTYLEGFIPILKESL
                     LSDNDGVVISTLKVLMLFIKLQFSEDSEAIFKNCARKVLTIIKDSPSTSGELCQVGLK
                     FLSALIRYKDIELKDSALEYVLGRIEPDLMEPNKQGLAFGFLKSLVSKHIVLPKLYDI
                     IDNVAEVMVTNHAKEIRDVARSVYYQFFMEYDQSKGRLEKQLKFLVNNLQYPSQEGRQ
                     SVMELLNLLINKSGPALLMKLSSSFFVFLANVSVNDDSPKCRKMASLLLTNLFKNLGQ
                     ENMGTIEKYIQAWLKQVDNVLFVSLGMKIYKIYLLELGLGCNASLDGVALARIKAVLS
                     DTEVGSDSLWDMVYTALETFAVFAQKSGDEVYSPAYKPTWDSIVACLLYPHEWVRLSA
                     SRLINVLLANMERLEVPLSDYEIQTIAYRTFHLLAAPSSSANVGSKEVSVKVLVNIAQ
                     YWNKHSTPYISKNNEDEVRYSTAMEFAISRISAILRNEENKSESHASKMSAIQLLAML
                     IQILDAAQLAQYGEAIILAVYTYVENNSGIDISEQFAELQQMSQEALNMLEEKLSTSD
                     FTRAYTAAKQVVIKRRQERRAKRAQLAVTAPAIAAEKKLKKHARSREKRKHEKDENGF
                     YQRKNKKKRTI"
     gene            complement(<628253..>628930)
                     /locus_tag="AGOS_AEL005C"
                     /old_locus_tag="AEL005C"
                     /db_xref="GeneID:4621055"
     mRNA            complement(<628253..>628930)
                     /locus_tag="AGOS_AEL005C"
                     /old_locus_tag="AEL005C"
                     /product="AEL005Cp"
                     /transcript_id="NM_210210.2"
                     /db_xref="GeneID:4621055"
     CDS             complement(628253..628930)
                     /locus_tag="AGOS_AEL005C"
                     /old_locus_tag="AEL005C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL002C (NHP10)"
                     /codon_start=1
                     /product="AEL005Cp"
                     /protein_id="NP_984856.2"
                     /db_xref="GeneID:4621055"
                     /translation="MVDQNNKDLALAIKELTEQNDTLSLAIQRTRLSVKRLRLEYAVL
                     LERLEARIEKDPSLHYEEPLPTLASFKNNLLESLPSSRSRKRRSKEKRDPNLPKRPTN
                     AYLLFCEMNKDKIRHEHAANNVDMTKVLPEIWKNMDEEAKKPYYDLYNADRLRYQREM
                     TAYSQNKTTEEANVDVKNESGNEEEEGDEPEHEPDADEIDVNDSDVTQLDDGIGDVAS
                     SVMSSEM"
     gene            <629314..>630741
                     /locus_tag="AGOS_AEL004W"
                     /old_locus_tag="AEL004W"
                     /db_xref="GeneID:4621056"
     mRNA            <629314..>630741
                     /locus_tag="AGOS_AEL004W"
                     /old_locus_tag="AEL004W"
                     /product="AEL004Wp"
                     /transcript_id="NM_210211.1"
                     /db_xref="GeneID:4621056"
     CDS             629314..630741
                     /locus_tag="AGOS_AEL004W"
                     /old_locus_tag="AEL004W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL001W (RMD1)"
                     /codon_start=1
                     /product="AEL004Wp"
                     /protein_id="NP_984857.1"
                     /db_xref="GeneID:4621056"
                     /translation="MSDEQEPLLKEETNGAPLEMRTVVSGTAVVPAIPGNPDSLMPTG
                     IPECSSTISSAIAETPIGSSGSATGNTATTLLLADNKGHKSYMQKAGVSISAPVRSGP
                     KVITGSRVGPQRTSRTAQKLKLLPEEPFQRSQEQEDDSVDREVYSQVNRITDKPARRD
                     AEKLGKSHRHLLPRVTAYCTASSYNMKELVRWLKDCKRTHHTHPKLFDECLYTPFIYT
                     DWRGDKRFEHEDVIRLDDEGGEINVSDKQPDLFIFEYGVVVMWGFTEREEKAFLNDLE
                     RFEKEKLAEEDVQVEEFNYYITQSYQPRIYNDFITLRDGSNYMIKLSISHAISQSVKI
                     SLFEELVDNTIEDTQDIPQEIASSGKVSMSKADIMKSIGELFILRININLHGSVLDSP
                     EIMWSEPQLEPIYQATRGYLEINQRVALLNQRLEVVSDLLQMLKEQLGHSHEENLEFI
                     VILLLGVEVLISVVNIIVDIVADTK"
     gene            complement(<630921..>631316)
                     /locus_tag="AGOS_AEL003C"
                     /old_locus_tag="AEL003C"
                     /db_xref="GeneID:4621057"
     mRNA            complement(<630921..>631316)
                     /locus_tag="AGOS_AEL003C"
                     /old_locus_tag="AEL003C"
                     /product="AEL003Cp"
                     /transcript_id="NM_210212.1"
                     /db_xref="GeneID:4621057"
     CDS             complement(630921..631316)
                     /locus_tag="AGOS_AEL003C"
                     /old_locus_tag="AEL003C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL003C (HTA2)"
                     /codon_start=1
                     /product="AEL003Cp"
                     /protein_id="NP_984858.1"
                     /db_xref="GeneID:4621057"
                     /translation="MSGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRKGNYAQRI
                     GSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVT
                     IAQGGVLPNIHANLLPKKSAKATKASQEL"
     gene            <631902..>632285
                     /locus_tag="AGOS_AEL002W"
                     /old_locus_tag="AEL002W"
                     /db_xref="GeneID:4621058"
     mRNA            <631902..>632285
                     /locus_tag="AGOS_AEL002W"
                     /old_locus_tag="AEL002W"
                     /product="AEL002Wp"
                     /transcript_id="NM_210213.1"
                     /db_xref="GeneID:4621058"
     CDS             631902..632285
                     /locus_tag="AGOS_AEL002W"
                     /old_locus_tag="AEL002W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL002W (HTB2)"
                     /codon_start=1
                     /product="AEL002Wp"
                     /protein_id="NP_984859.1"
                     /db_xref="GeneID:4621058"
                     /translation="MAPKAEKKPASKAPAAKKTTASTDASKKRTKTRKETYSSYIYKV
                     LKQTHPDTGISQKSMSILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLIL
                     PGELAKHAVSEGTRAVTKYSSSTQA"
     gene            complement(<632504..>632879)
                     /locus_tag="AGOS_AEL001C"
                     /old_locus_tag="AEL001C"
                     /db_xref="GeneID:4621059"
     mRNA            complement(join(<632504..632779,632838..>632879))
                     /locus_tag="AGOS_AEL001C"
                     /old_locus_tag="AEL001C"
                     /product="AEL001Cp"
                     /transcript_id="NM_210214.1"
                     /db_xref="GeneID:4621059"
     CDS             complement(join(632504..632779,632838..632879))
                     /locus_tag="AGOS_AEL001C"
                     /old_locus_tag="AEL001C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL001C (ECM15); 1-intron"
                     /codon_start=1
                     /product="AEL001Cp"
                     /protein_id="NP_984860.1"
                     /db_xref="GeneID:4621059"
                     /translation="MSKLHTLVDICMVPLGTSSPSVSDYVTKIEKRIRESHLKSTMHS
                     FGTTIEGPWDEVMSLIGQLHEYSHELGYVRIHTEMRLGTRTDKQQTAQDKVDVVEKKL
                     SDY"
     centromere      633935..634125
                     /note="Chromosome V centromere"
     centromere      633935..633944
                     /note="Chromosome V centromere CDE I element"
     centromere      633945..634107
                     /note="Chromosome V centromere CDE II element"
     centromere      634108..634125
                     /note="Chromosome V centromere CDE III element"
     gene            complement(<634510..>636726)
                     /locus_tag="AGOS_AER001C"
                     /old_locus_tag="AER001C"
                     /db_xref="GeneID:4621060"
     mRNA            complement(<634510..>636726)
                     /locus_tag="AGOS_AER001C"
                     /old_locus_tag="AER001C"
                     /product="AER001Cp"
                     /transcript_id="NM_210215.1"
                     /db_xref="GeneID:4621060"
     CDS             complement(634510..636726)
                     /locus_tag="AGOS_AER001C"
                     /old_locus_tag="AER001C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR001C (NTH2) and YDR001C (NTH1)"
                     /codon_start=1
                     /product="AER001Cp"
                     /protein_id="NP_984861.1"
                     /db_xref="GeneID:4621060"
                     /translation="MLQGMPKRSGSISELHDPFSSPDVYYGPATDPRRQKQPNKYSRT
                     RTMSIIENVSTFKSAGKQYNIRRRGSEDDSMLASSGHRKFYIKDVDKTLEELLESEDT
                     DGNYQITIEDRGPKTLRVGTANSNGFRHVQIRGTYMLSNLLQELTIAKNFGRKQVILD
                     EARLNEDPVNRLTRLITHQFWDSLTRRIDYNSIAAIAADTKVDTPGAKVPRIYVPHGC
                     PEQYEYFIECSQLNPSLNLEVKYLPDVITPEHVQSLNESPGLLALAMESHRDPITGES
                     TLVGFPYVVPGGRFNELYGWDSYLMALGLLDCNKVDIARGMVEHFIFEIEHYGKILNA
                     NRSYYLCRSQPPFLTDMALKVFEKFGGDQNPTAVDFLKRAFIAAIKEYKSVWMAEPRY
                     DKTTGLSCYHPDGIGFPPETEPDHFDAICRKFAEKHNVTIPEFRCMYDAGEVHEPELD
                     EFFLHDRAVRESGHDTSYRLENVCAYLATIDLNSLLYKYEKDIAYVVSKYFDDSITDY
                     AGETTTSSHWEALADIRKQRITKYLWDEETGFFYDYNVHIGKRTSYDSATTFWAMWAG
                     LATQEQANAMVEKALPRLEMLGGLVACTEESRGEITMNRPSRQWDYPYGWAPHQMLAW
                     TGLDNYGFTGVARRLAYRWLFLMTKAFVDYNGIVVEKYDVTRGTDPHRVDAEYGNQGA
                     DFKGVATEGFGWVNSSYILGLKFMNTYAKRALANCTVPDIFFKHMKPEEKARYALI"
     gene            <637287..>637919
                     /locus_tag="AGOS_AER002W"
                     /old_locus_tag="AER002W"
                     /db_xref="GeneID:4621061"
     mRNA            <637287..>637919
                     /locus_tag="AGOS_AER002W"
                     /old_locus_tag="AER002W"
                     /product="AER002Wp"
                     /transcript_id="NM_210216.2"
                     /db_xref="GeneID:4621061"
     CDS             637287..637919
                     /locus_tag="AGOS_AER002W"
                     /old_locus_tag="AER002W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR002W (YRB1)"
                     /codon_start=1
                     /product="AER002Wp"
                     /protein_id="NP_984862.2"
                     /db_xref="GeneID:4621061"
                     /translation="MSQEAKPATPAPTSEEGPKPPTASVFTMFGGKKADDKKADDKKT
                     AEEQTGANSDSKAEDAAAEEDAVESPEVHFEPVVTLEKVEVKTMEEDEEVLFKVRAKL
                     FRFDGEAKEWKERGTGDVKFLQNKSTQKVRLLMRRDKTLKVCANHYISPEYVLKPNVG
                     SDRSWVYSCTADVAEGEPEAFTFAIRFGNKENADKFKEAFERAQAENKKR"
     gene            complement(<638023..>638847)
                     /locus_tag="AGOS_AER003C"
                     /old_locus_tag="AER003C"
                     /db_xref="GeneID:4621062"
     mRNA            complement(<638023..>638847)
                     /locus_tag="AGOS_AER003C"
                     /old_locus_tag="AER003C"
                     /product="AER003Cp"
                     /transcript_id="NM_210217.1"
                     /db_xref="GeneID:4621062"
     CDS             complement(638023..638847)
                     /locus_tag="AGOS_AER003C"
                     /old_locus_tag="AER003C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR002C (RER2)"
                     /codon_start=1
                     /product="AER003Cp"
                     /protein_id="NP_984863.1"
                     /db_xref="GeneID:4621062"
                     /translation="MNDSRDFTQNSWLISRLKDVFVSVLRSSGRVPKHVGFIMDGNRR
                     YAKKHNIEVREGHSAGFMSMNKVLELCYESGVTTATVFAFSVDNFRRSAFEVDSLMEL
                     AKERVMQITQHGELAEQYGIHVRIIGDRSLLPADVQEEMARAEKATEANTRAVLNVCI
                     PYTARGEILHAMKGTIADAQSDGAPITEADLDAHMYTGGLPPLDLLIRTSGVSRLSDF
                     LLWQVCQKGVVIELLSCLWPDFGPLTMAWILLRYAFKKSDEFSGGDEDVADSKKSK"
     gene            <639098..>640525
                     /locus_tag="AGOS_AER004W"
                     /old_locus_tag="AER004W"
                     /db_xref="GeneID:4621063"
     mRNA            <639098..>640525
                     /locus_tag="AGOS_AER004W"
                     /old_locus_tag="AER004W"
                     /product="AER004Wp"
                     /transcript_id="NM_210218.2"
                     /db_xref="GeneID:4621063"
     CDS             639098..640525
                     /locus_tag="AGOS_AER004W"
                     /old_locus_tag="AER004W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR003W (COQ1)"
                     /codon_start=1
                     /product="AER004Wp"
                     /protein_id="NP_984864.2"
                     /db_xref="GeneID:4621063"
                     /translation="MIRSGSVRLLRETSAAGRCYTSRRSKSTFETAMDAVTRLVTPAS
                     WLNRSPTFLVSDEMKTLSKNIARLIGSGHPVLNRVTSYYFDSGGKKVRPMLVLLLSRA
                     LSEIPLDQRDRMRIDYTDVPEDPVYSQVPKSILFEHPVNNISPLHILHGIKPLNPLTK
                     GPEPLPQEFDRERGILPKQRRLAEIVEMIHTASLLHDDVIDHSGTRRGKPSGNVAFTN
                     KMAVLAGDFLLGRATVSISRLRNPEVVELVSNCIANLVEGEFMQLKNTVVDGDLETIN
                     NGTQQIPPASKTIPLPVHDYRVNTTLASGISHEVMIETAFDYYLHKTYLKTAALISKS
                     CRAAAVLSGARDPILDECYHFGKNLGICFQLVDDMLDFTTSGELGKPVGADFELGIAT
                     APVLFAWKEDPSLGPIIQRNFSQPGDVARALEAVHQHDGIKKTAEVAREYRDKALHNL
                     RAALPESDSRAALEFLTNSILTRRK"
     gene            complement(<640753..>642036)
                     /locus_tag="AGOS_AER005C"
                     /old_locus_tag="AER005C"
                     /db_xref="GeneID:4621064"
     mRNA            complement(<640753..>642036)
                     /locus_tag="AGOS_AER005C"
                     /old_locus_tag="AER005C"
                     /product="AER005Cp"
                     /transcript_id="NM_210219.1"
                     /db_xref="GeneID:4621064"
     CDS             complement(640753..642036)
                     /locus_tag="AGOS_AER005C"
                     /old_locus_tag="AER005C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR004C (GPI18)"
                     /codon_start=1
                     /product="AER005Cp"
                     /protein_id="NP_984865.1"
                     /db_xref="GeneID:4621064"
                     /translation="MECFKRLTTVFFTVKLVQYLLVYFAPGQFDTSTPLFLEKYQPLQ
                     PEKWYHKLLSWDSVYFVKNGLQAVTHTNAYGYVSLPEYEHEWMFSPFVWSQTLKTAGG
                     ATLRNWAAPIDTLLVRATLLNLVLHYVSVWLLYALTLRTFPKNRELAYKTSLLFILSS
                     AAGFLLAPYSEPLSFAFSFLGMLLRMLAVEHNVYGGITLAWYNWLPYTLSGICFSVAA
                     ANRPNCVLLGVYYIYDVLKLVRQRNWVRAVLFPCIAGSMMLGIFAYMHYYLPSVVFCP
                     ERESWCKHSLPWIHIPYKSFYSFVQGYYWRNGFLNYWTWNNVPNFLFALPNLVILWYS
                     TVYFSYQYPLESIRPLVYITRALLLIITFFAHVQIINRISSFIPLHLWYLSDRMIKTT
                     GEAKGDDRLVYLYVNWLILWIPLQTVLFACFLPPA"
     gene            <642949..>643482
                     /locus_tag="AGOS_AER006W"
                     /old_locus_tag="AER006W"
                     /db_xref="GeneID:4621065"
     mRNA            <642949..>643482
                     /locus_tag="AGOS_AER006W"
                     /old_locus_tag="AER006W"
                     /product="AER006Wp"
                     /transcript_id="NM_210220.1"
                     /db_xref="GeneID:4621065"
     CDS             642949..643482
                     /locus_tag="AGOS_AER006W"
                     /old_locus_tag="AER006W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR005W (RCR1) and YDR003W (RCR2)"
                     /codon_start=1
                     /product="AER006Wp"
                     /protein_id="NP_984866.1"
                     /db_xref="GeneID:4621065"
                     /translation="MSEILTGLAVDSYDSDHLAKKIPWAIFTVWIIALLLCIFLVNLR
                     RRRRGLQPIMGTAWLAPPSYGQSQRQYNMPPVDPAAVPVPEYTTHPNANIDLGYYDNE
                     GKFHPADSSLPKPPPAATANTVPSSYTSAPVREQFDAEYERPAGAPPGAQVRQTSSSR
                     GHAMPGVTDSGAHYYAP"
     gene            <643863..>645350
                     /locus_tag="AGOS_AER007W"
                     /old_locus_tag="AER007W"
                     /db_xref="GeneID:4621066"
     mRNA            <643863..>645350
                     /locus_tag="AGOS_AER007W"
                     /old_locus_tag="AER007W"
                     /product="AER007Wp"
                     /transcript_id="NM_210221.1"
                     /db_xref="GeneID:4621066"
     CDS             643863..645350
                     /locus_tag="AGOS_AER007W"
                     /old_locus_tag="AER007W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR006W (UGA2)"
                     /codon_start=1
                     /product="AER007Wp"
                     /protein_id="NP_984867.1"
                     /db_xref="GeneID:4621066"
                     /translation="MGFQSFKPTFRNEDLVRRGAYINGEWITSAKESFNVTDPATDQV
                     IAELPDFDSGEAEAALKAAHASFQSYKKTSPTQRSEWLRNLYDLIMENAEDLAAIVTW
                     ENGKSLREALVEIRYGATFFKWFSEEALRLYGTTIQPSNPGNRAFTIRQPVGVCALIC
                     PWNFPNAMISRKAAPALAAGCTVIIKPDPQTPLSSLALAHLAEKAGFPPGVINVVPTS
                     KYTKDIGVLLCESSLVRKVSFTGSTAVGKILMQQAASTVKKVSFELGGNAPVIIMGDA
                     DMEKTVEEVLATKFRGMGQTCICANRLYVHRSIIDDFSSRLVKKVEGLKLGNGFQEGV
                     THGSLINNAAIEKVERHAKDAIERGAKVLLPGGRAPELGPHFYSPTVLSDVKPDSVLT
                     REETFGPLCAMIPFDTVEEVVGYANDTQYGLASYVFSENIKTVYSIAEALDFGMVACN
                     TGLFSDSMVPFGGIKESGFGIEGSLHGINDYTVLKTVTIGNVPTL"
     gene            <645585..>647117
                     /locus_tag="AGOS_AER008W"
                     /old_locus_tag="AER008W"
                     /db_xref="GeneID:4621067"
     mRNA            <645585..>647117
                     /locus_tag="AGOS_AER008W"
                     /old_locus_tag="AER008W"
                     /product="AER008Wp"
                     /transcript_id="NM_210222.1"
                     /db_xref="GeneID:4621067"
     CDS             645585..647117
                     /locus_tag="AGOS_AER008W"
                     /old_locus_tag="AER008W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR004W (RAD57)"
                     /codon_start=1
                     /product="AER008Wp"
                     /protein_id="NP_984868.1"
                     /db_xref="GeneID:4621067"
                     /translation="MDLYEQLPSSQLVFDAQFQFLLECSQQQGVSVLDFLTLSPQQLV
                     KMLNRSVSEISKFQELLREEFRAEVFQANPILPASALKKVQCFTTGDVGIDALLNGGI
                     YTHGITEVFGESSSGKSQFLMQLSLAVQLPLELDGSAGQCVFITTESDLPTKRIESMI
                     KSREIFSAGRVSQSNIFTATCNDWTSQNHILSVQLPILLERNPNIRLVIIDSISHHLR
                     VELAAKTFQQSLDNRSLIDQMAQNLLHLSQKHAVAVVVANQVGDKPIPDLPLKQTIMD
                     YDYQLGFMIGWKDSSIYYRHLRSAGVFDEEVLTDDDDYQKVVSTHERMILRKSQQQQQ
                     ERQQQQQQQQQQKAQEYQEPSDESLQTQLKLGESSSSPGATVYASKSFPDANTQLSTI
                     SPQPSLKKANHINSSLGYTVNTTPSPVIRKKKRVDTKTPNLGLTWANHLSTRIKLSKT
                     HIASQLIEEQDLDYDSIVDSTSLWQVKRSLKVVFSTHADQGLIEYFIRNEGLVTKKEK
                     SG"
     gene            complement(<647414..>648763)
                     /locus_tag="AGOS_AER009C"
                     /old_locus_tag="AER009C"
                     /db_xref="GeneID:4621068"
     mRNA            complement(join(<647414..648601,648758..>648763))
                     /locus_tag="AGOS_AER009C"
                     /old_locus_tag="AER009C"
                     /product="AER009Cp"
                     /transcript_id="NM_210223.1"
                     /db_xref="GeneID:4621068"
     CDS             complement(join(647414..648601,648758..648763))
                     /locus_tag="AGOS_AER009C"
                     /old_locus_tag="AER009C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR005C (MAF1); 1-intron"
                     /codon_start=1
                     /product="AER009Cp"
                     /protein_id="NP_984869.1"
                     /db_xref="GeneID:4621068"
                     /translation="MKFIDELDLELVNQTLNFETSESKISGGCDIFTTKPVASDKKLY
                     KTIDRHLESLLQENESYNAAIQQQIELENKRRDPKQAGSDCAEPAEDSPTRNANSFWE
                     QKRRMSVSESPRADTSPLFKSQKLNDQQLKELVSHPLEVPGCKSPSNETSARGVLRRS
                     TSAGSFENNAGSAEQQKRRTSSIGSAANGTKSPILRRSSFNRETINIGPFGPISETAS
                     RRTFAYLIGILNASYPDHDFASLKPTDFVKSSRKQLVSKFENSIIALGKQPQEWIWET
                     INAHMDLADCVFYQYNPQESFLDDEPGHLWSLMWFMFNKKRKRVAYFYLSAFRVKNPP
                     STGGSVALDEYYDSNSKPELREKRRRLTIEHETNDFEGEYDLTYTSSGDGAVEDEDED
                     MNDAD"
     gene            649057..649128
                     /locus_tag="AGOS_t0113"
                     /db_xref="GeneID:4621069"
     tRNA            649057..649128
                     /locus_tag="AGOS_t0113"
                     /product="tRNA-Glu"
                     /codon_recognized="GAG"
                     /db_xref="GeneID:4621069"
     gene            complement(<649250..>651544)
                     /locus_tag="AGOS_AER010C"
                     /old_locus_tag="AER010C"
                     /db_xref="GeneID:4621070"
     mRNA            complement(<649250..>651544)
                     /locus_tag="AGOS_AER010C"
                     /old_locus_tag="AER010C"
                     /product="AER010Cp"
                     /transcript_id="NM_210224.2"
                     /db_xref="GeneID:4621070"
     CDS             complement(649250..651544)
                     /locus_tag="AGOS_AER010C"
                     /old_locus_tag="AER010C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR007C (DSF2)"
                     /codon_start=1
                     /product="AER010Cp"
                     /protein_id="NP_984870.2"
                     /db_xref="GeneID:4621070"
                     /translation="MPFFDPNNPSPLDDIRIQEEYEGVDLNPRNRSKPRANSLLHDQQ
                     SLISFDSIQTADRLLDKLDLSIEDELLLQQALREEEEERRIATQEYPDDIYFSMTQSS
                     RPMIPMTTARPAHRPVLCIPASSFPSLRHAGGTARHKTNVAPPVHQSSHAILEDLNDN
                     EKLVSSKGNVVEDHISKFRYSYLVQEGSGDEAEDTPQNEDGSETLDALQIEKYRRKLA
                     QTNRYYGTGSSPTELTHGSGSASVSNPQSRAKSSTHVLEQATHNETASSHTPSNSVSS
                     LALQNHTTASSFESDLTARTAENGPNNGSSTLLSTPKTSRKSLECDSPGHPSSPSIWN
                     KGHKKKNSFSLKNLFKSPKVTSETESSPKADNSSNEEHDAAAYSEQMPPITAPSAHRQ
                     SEHHHHSASAYPKKPLQKLQHSYKLLIEPRPMLPVVRSDEVALLKHRRSASLPKNGPR
                     PGTQRDPNTWEQQDRATLLQHAKILQQQKQLPQISSSHSHAHNKRPPVPPKDIPVGSQ
                     QPKMHTQQGANKMHKPATSVVQRTGSLGNKRVPDPPLPVSADGRLTPEQKVQLALELR
                     NRRQYAECTKLLREACEAGDRTGFLLYGLALRHGSGIPTNLPESFKWIFKASGVKDEA
                     AEVLSLNIDPFKLKNVPLVPPEPEAPALYECGISYLKGYGFAKPDELKGLKYLEQAAS
                     LGHIDSICLCGTIWSKRSRNRPRDSCRAAAWFRIADAMGADLIGANWIYKEKYMRPSP
                     ESSAAVGSYKEQKATPPVPTKHKP"
     gene            complement(<652495..>655164)
                     /locus_tag="AGOS_AER011C"
                     /old_locus_tag="AER011C"
                     /db_xref="GeneID:4621071"
     mRNA            complement(<652495..>655164)
                     /locus_tag="AGOS_AER011C"
                     /old_locus_tag="AER011C"
                     /product="AER011Cp"
                     /transcript_id="NM_210225.2"
                     /db_xref="GeneID:4621071"
     CDS             complement(652495..655164)
                     /locus_tag="AGOS_AER011C"
                     /old_locus_tag="AER011C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR006C (SOK1)"
                     /codon_start=1
                     /product="AER011Cp"
                     /protein_id="NP_984871.2"
                     /db_xref="GeneID:4621071"
                     /translation="MDQARTHTNTPPAETIALKSEPTAGRVSQADAGSSSPGSGGPNT
                     MATAASSPEDNAEGEEARSAGPGLKQPDPRQQLTDYMQDMRALGSQGYITPSQQQGVA
                     DEGPARRLERERGGPADSSFNTTMTHNNTTIFKPFDTQTGQFLSTPASAASALARGDS
                     AATAVSASSASAASSQEHRSRNDQRPSAGRLRRMKFRSHSVPTILHSSCRRLNASSLT
                     ASVSTSSATQLRDAQAPPQLEPAYANSAVSSTSTVSSGSMPPASQFAGIKKKKHGGKG
                     NQGSLRNAILMSHRLPPASGQDLSIDDRIRHIKMQSDPMPLPPINLQCLREIDLSEIV
                     KNPQLRHDIVFDPLLQFRPNLDGERGVKKRQIADKYWAEVENEIIVYNQRPEVFDYSR
                     TRLVPLFDTLKDVLVTIVPQKEISTVENVLDTELLIQELLKGSLIMTNLSDWLAQLFK
                     HHCAPMRDPWVDGMQCKFREAQEEKSVIKLVEALKLVFQILEAMKLDIANHQIRILRP
                     ALLSNAVEFERQYFRSLMNSQRVNLKSSLKWFKDKYDESVRDGSLKSDQLTKIPDIYR
                     LCIRNIISLLSCRKMVREYPTSLAFDHARLILLRADIRQAVCLLVCKLLFKQLVVNDT
                     TADRATKEYVVAKYNNKRLKEEIVSIITDEHGNCRWTKNTMSIAIHLCKTIDELKQEF
                     ETLKLQNTRQLGATRTFAAAHQASITNPKTTSTPISKTLTQLDSKNIDFAKSWLSKQT
                     QPLSEVYGVLENRVFNSLEESIFRRSNCTKDGVVKQDFINLCNSNSQGTTSSGMSGVN
                     TNHSVAGASCSPSSSVFSTPSRNHHLSAPAAAHGGAHPSGFPENDSAGSMASLDMEEF
                     ESLYRHLYAVVNFHWSVFGCHYVEALGDNVERI"
     gene            complement(<655702..>656013)
                     /locus_tag="AGOS_AER012C"
                     /old_locus_tag="AER012C"
                     /db_xref="GeneID:4621072"
     mRNA            complement(<655702..>656013)
                     /locus_tag="AGOS_AER012C"
                     /old_locus_tag="AER012C"
                     /product="AER012Cp"
                     /transcript_id="NM_210226.2"
                     /db_xref="GeneID:4621072"
     CDS             complement(655702..656013)
                     /locus_tag="AGOS_AER012C"
                     /old_locus_tag="AER012C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR009C (HHF1)"
                     /codon_start=1
                     /product="AER012Cp"
                     /protein_id="NP_984872.2"
                     /db_xref="GeneID:4621072"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEDVRAVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <656295..>656705
                     /locus_tag="AGOS_AER013W"
                     /old_locus_tag="AER013W"
                     /db_xref="GeneID:4621073"
     mRNA            <656295..>656705
                     /locus_tag="AGOS_AER013W"
                     /old_locus_tag="AER013W"
                     /product="AER013Wp"
                     /transcript_id="NM_210227.1"
                     /db_xref="GeneID:4621073"
     CDS             656295..656705
                     /locus_tag="AGOS_AER013W"
                     /old_locus_tag="AER013W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR010W (HHT1)"
                     /codon_start=1
                     /product="AER013Wp"
                     /protein_id="NP_984873.1"
                     /db_xref="GeneID:4621073"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <656845..>657477
                     /locus_tag="AGOS_AER014W"
                     /old_locus_tag="AER014W"
                     /db_xref="GeneID:4621074"
     mRNA            <656845..>657477
                     /locus_tag="AGOS_AER014W"
                     /old_locus_tag="AER014W"
                     /product="AER014Wp"
                     /transcript_id="NM_210228.1"
                     /db_xref="GeneID:4621074"
     CDS             656845..657477
                     /locus_tag="AGOS_AER014W"
                     /old_locus_tag="AER014W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR007W (TRP1)"
                     /codon_start=1
                     /product="AER014Wp"
                     /protein_id="NP_984874.1"
                     /db_xref="GeneID:4621074"
                     /translation="MVVAKVCGVRDAGAAAAAAAAGAGFVGMVCVPGRRRTVGREEAR
                     AIAAAVRGAPGTRLVGVFQDQAPEEVLRLQRELGLDAVQLHGAEDWAAFRAQLPASTL
                     LIKSFVFPRDCEAALAMHRAARGRNCMVLFDAAGGGSGARLDWAALAAWGAAHADVQF
                     MLAGGLTPANVAEAARLPGVVAVDVSSGVETGGAKDGNKIRQFVENAKGI"
     gene            complement(<657500..>658363)
                     /locus_tag="AGOS_AER015C"
                     /old_locus_tag="AER015C"
                     /db_xref="GeneID:4621075"
     mRNA            complement(<657500..>658363)
                     /locus_tag="AGOS_AER015C"
                     /old_locus_tag="AER015C"
                     /product="AER015Cp"
                     /transcript_id="NM_210229.1"
                     /db_xref="GeneID:4621075"
     CDS             complement(657500..658363)
                     /locus_tag="AGOS_AER015C"
                     /old_locus_tag="AER015C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR011C (IPP1)"
                     /codon_start=1
                     /product="AER015Cp"
                     /protein_id="NP_984875.1"
                     /db_xref="GeneID:4621075"
                     /translation="MSYTTRQIGAKNTLDYRVFIEKAGKVVSPFHDIPLYADEENQIF
                     NMVVEIPRWTNAKLEITKEEAMNPIIQDTKKGKLRYVRNCFPHHGYIHNYGAFPQTWE
                     DPNVAHPETKAYGDNDPLDVLEIGETIAYTGQVKQVKVLGVMALLDEGETDWKIIVID
                     VHDPLAPKLNDIEDVEKHLPGLLRATNEWFRIYKIPDGKPENQFAFSGEAKNRKYALD
                     VIRECHEAWCQLVAGKAADDKKVSLANSTLQESVAYAPEVAAAVPAANPLPDAPIDKS
                     IDKWFFISGSA"
     gene            658655..658727
                     /locus_tag="AGOS_t0114"
                     /db_xref="GeneID:4621076"
     tRNA            658655..658727
                     /locus_tag="AGOS_t0114"
                     /product="tRNA-Thr"
                     /codon_recognized="ACU"
                     /db_xref="GeneID:4621076"
     gene            complement(<658761..>659204)
                     /locus_tag="AGOS_AER016C"
                     /old_locus_tag="AER016C"
                     /db_xref="GeneID:4621077"
     mRNA            complement(<658761..>659204)
                     /locus_tag="AGOS_AER016C"
                     /old_locus_tag="AER016C"
                     /product="AER016Cp"
                     /transcript_id="NM_210230.1"
                     /db_xref="GeneID:4621077"
     CDS             complement(658761..659204)
                     /locus_tag="AGOS_AER016C"
                     /old_locus_tag="AER016C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL008W (APC11)"
                     /codon_start=1
                     /product="AER016Cp"
                     /protein_id="NP_984876.1"
                     /db_xref="GeneID:4621077"
                     /translation="MQLQINNIQCVASWYWDVPKELKRDSPVYEDEDEEDVCGICRGS
                     YNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIR
                     INEPHRDKFEKVLMKARQQSVVSVAGANPVGPDQDDVIIDQEFIR"
     gene            complement(<659326..>659976)
                     /locus_tag="AGOS_AER017C"
                     /old_locus_tag="AER017C"
                     /db_xref="GeneID:4621078"
     mRNA            complement(<659326..>659976)
                     /locus_tag="AGOS_AER017C"
                     /old_locus_tag="AER017C"
                     /product="AER017Cp"
                     /transcript_id="NM_210231.2"
                     /db_xref="GeneID:4621078"
     CDS             complement(659326..659976)
                     /locus_tag="AGOS_AER017C"
                     /old_locus_tag="AER017C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL010W (GRX6) and YBR014C (GRX7)"
                     /codon_start=1
                     /product="AER017Cp"
                     /protein_id="NP_984877.2"
                     /db_xref="GeneID:4621078"
                     /translation="MLPKSNSKFISRRGMRMLLVTGVLLVLTYFIIQNGTTSDQFVTP
                     IAPRPVPNAPSVQDTVEAEEPSVQLLSKGAEGAVAASKEDVDVARAQQQSKVLFDAAK
                     TYNEILSLSSMVVFSKSTCPLSSGLKQLLNNNYEFLPDYQVVELDKHANGAELQKYVT
                     KTTARSTVPNLVINGVSRGGHDSIMELHKTGELLESLRKWANGKITVTQKQRPSNS"
     gene            complement(<660224..>662044)
                     /locus_tag="AGOS_AER018C"
                     /old_locus_tag="AER018C"
                     /db_xref="GeneID:4621079"
     mRNA            complement(<660224..>662044)
                     /locus_tag="AGOS_AER018C"
                     /old_locus_tag="AER018C"
                     /product="AER018Cp"
                     /transcript_id="NM_210232.1"
                     /db_xref="GeneID:4621079"
     CDS             complement(660224..662044)
                     /locus_tag="AGOS_AER018C"
                     /old_locus_tag="AER018C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR015C (MNN2)"
                     /codon_start=1
                     /product="AER018Cp"
                     /protein_id="NP_984878.1"
                     /db_xref="GeneID:4621079"
                     /translation="MLRRKYSKTLKLSLITVALGALFLVTNRWLPGEFPSVYTEYLQN
                     RLPNLGSFGKQQHMEEQESQTRQMIEEGEMRSKPSELLEEEAARTEQAERKSQIFAFY
                     QKVFELLAEHSPSGQISHKSGRQCQVSQVVLQGHLDDTSHWPLLTREHLSKCLKMTQK
                     DKQMVSDKHMHYVDALSNLKLSKRAYSGAGIVTVGGGKFSMLALLLIKSLRKVGTSLP
                     VEVLIPPGEEEEYDYCSKLLPEVGAKCIYLKDVLPPAVINNHYFEGYQLKSAAIIASS
                     FKDLLLLDADNIPILNLDDIFQSKPYVEHGLVLWPDFWRRSTSPDYYEIARVQVDYNR
                     RVRNHIDNLTPASVYTQNMKDLSSIPMHDMEGTLPDPSTESGQLLIDKERHLSTVLLS
                     LYYNVNGETWYYPLFSQGAPGEGDKETFIAAANFYRKPYYQVRTSTGAEGYHTKKGFS
                     GVAMLQHDFREDYRRYEAAREDVKTKYAKSQQYDPEYTVEGFYKKYFEDPNQPPVDVM
                     FVHANLPKFEPLKMSEKQLLMENGSHFRSYSHLDKLHNYDIELESFRVLNEYLCVRKV
                     QLKFYKDKLSRPAKWNSMCKYVEDRLKFLESTHEEALRKT"
     gene            <662958..>664064
                     /locus_tag="AGOS_AER018WA"
                     /db_xref="GeneID:9487591"
     mRNA            <662958..>664064
                     /locus_tag="AGOS_AER018WA"
                     /product="AER018W-Ap"
                     /transcript_id="NM_001355327.1"
                     /db_xref="GeneID:9487591"
     CDS             662958..664064
                     /locus_tag="AGOS_AER018WA"
                     /note="NOHBY539; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AER018W-Ap"
                     /protein_id="NP_001342269.1"
                     /db_xref="GeneID:9487591"
                     /translation="MRRGGILAGIMFVSTAARWPGAAWAGSILDVCGGSTAGCSADGD
                     IHNALLDPVLAAAQELALRTFYCEGDPFSKIYVRLKALELTTTPEDIKRILETWPRWG
                     LRGAGAANESTLYDAILREALEAEVADLVAREEAGEADAALLGGAWDFAQDIALFERP
                     IMEVAAAYVDALRGLKAILQEPGNVNTDVVRAWINDWFVKSPMMFRLALLQIKSSAKR
                     MALERKYRRYYLQRILTGAWFYVDITHAAQRLFGEYRTGFDDVYPEVYNKFLHNLNSS
                     FVEEFNSFYRRPNFASESPTDGDPQEIMFRMLEYSLRGVFALKEPMATCFLGVAFVSA
                     HDECYKCIVNTSQRELVLMYKLITMYMSMKTKSS"
     gene            complement(<664087..>666411)
                     /locus_tag="AGOS_AER019C"
                     /old_locus_tag="AER019C"
                     /db_xref="GeneID:4621080"
     mRNA            complement(<664087..>666411)
                     /locus_tag="AGOS_AER019C"
                     /old_locus_tag="AER019C"
                     /product="AER019Cp"
                     /transcript_id="NM_210233.1"
                     /db_xref="GeneID:4621080"
     CDS             complement(664087..666411)
                     /locus_tag="AGOS_AER019C"
                     /old_locus_tag="AER019C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL076W (MDM20)"
                     /codon_start=1
                     /product="AER019Cp"
                     /protein_id="NP_984879.1"
                     /db_xref="GeneID:4621080"
                     /translation="MNKHEEEILTLVQKDSYKQAINAVSKVVRQFPSSTYFRLLEQYV
                     RFKQSPSKYQYELMLGPLLEANTTLPHDAKSLDLLRTFLLELYSPIPPLKPYETAMKK
                     YPTFDLCYRWFQQAIQDLDFNSLNRATFQLSRFCKDVRAAKFWNAVVLLSWARVRPAT
                     MAKQEQQLLPQLAYKILVQLKPYPKEEELVVFCQVCELLDEDKAAEIVDEILTFWGAE
                     KANSLDLYLKDLLLDNLLKLERHADLYEVCGKLLVHLDDFVLCKTLAQSAHKLGLPRA
                     DVESQLPATRNGLLTHLELGVLYNGRVTTDDLQPYLARFHDKTCCPVDLEHYMEHIDR
                     SQLLTLFSSFERSIDHDVNWARICPETTMDQFSNLFLEYRPTLLTKPDTNYSCCSHLI
                     LQLVQNLVVDSRITLGNVLTAISLLESYQAQDAYNYDTRIWLIVLYQYLGITPAAHKH
                     YENLKVKNVQNDIVDHLLYTRYASFFPNKSHPYVQALCLAEDEQPIYQSLGGLPTLLK
                     IAFERKSYTKLPGMFSFYDQLRRSIMRWHKIGEHLKLLRICNDKRASHLKRIQMEILN
                     LNLPESNSLADNRDFNVVFETANDKNAFSTLSGYMRVDDAYVRLQLCQEFMLEGISAG
                     AFSPVVEILAPAQKDFKQFTRYEKWAWDVISNVYEHMDDIQEEFLMDHLQKIPDFGLE
                     RDWKLVHGYSTVLLTLKTLDGIKRIKSPTLKKLMKDQLQHVRGRCSSIFDEYAEEIAT
                     CSVDIEFLSRFGCQPASESATQSLREVFKALRNL"
     gene            <666836..>667714
                     /locus_tag="AGOS_AER020W"
                     /old_locus_tag="AER020W"
                     /db_xref="GeneID:4621081"
     mRNA            <666836..>667714
                     /locus_tag="AGOS_AER020W"
                     /old_locus_tag="AER020W"
                     /product="ribosome biogenesis protein BRX1"
                     /transcript_id="NM_210234.1"
                     /db_xref="GeneID:4621081"
     CDS             666836..667714
                     /locus_tag="AGOS_AER020W"
                     /old_locus_tag="AER020W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL077C (BRX1)"
                     /codon_start=1
                     /product="ribosome biogenesis protein BRX1"
                     /protein_id="NP_984880.1"
                     /db_xref="GeneID:4621081"
                     /translation="MSSIYKALSGKNQKKKDGNAGAEKQYMNKQRVLLISSRGVTYRH
                     RHLIQDLHSLMPHSRKEPKLDTKKDLGQLNEIAELYNCNNVAFFEARKHQDLYMWLSK
                     PPNGPTVKFYLQNLHTMDELNFTGNCLKGSRPVLSFDKRFDTQPQYRLFKEMFIHTFG
                     VPPQARKSKPFIDHVMSFSIVDDKIWVRNYEISHAARNNSEYEDKQDEDISLVEIGPR
                     FVMTPILILEGAFGGPKIYENKQYVSPNVVRAQLKQEAAKEARARADAAVQRKIKRRD
                     NVLAMDPLSNDALFKN"
     gene            complement(<667792..>667989)
                     /locus_tag="AGOS_AER021C"
                     /old_locus_tag="AER021C"
                     /db_xref="GeneID:4621082"
     mRNA            complement(<667792..>667989)
                     /locus_tag="AGOS_AER021C"
                     /old_locus_tag="AER021C"
                     /product="AER021Cp"
                     /transcript_id="NM_210235.1"
                     /db_xref="GeneID:4621082"
     CDS             complement(667792..667989)
                     /locus_tag="AGOS_AER021C"
                     /old_locus_tag="AER021C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL077W-A (ATP19)"
                     /codon_start=1
                     /product="AER021Cp"
                     /protein_id="NP_984881.1"
                     /db_xref="GeneID:4621082"
                     /translation="MGAAYTILGRTFQPHQLSLATIGLASLLVIPNPFKKAEAKPVWK
                     AASEDEEKFIQEYLEKHSAKQ"
     gene            complement(668114..668186)
                     /locus_tag="AGOS_t0115"
                     /db_xref="GeneID:4621083"
     tRNA            complement(668114..668186)
                     /locus_tag="AGOS_t0115"
                     /product="tRNA-Ala"
                     /codon_recognized="GCU"
                     /db_xref="GeneID:4621083"
     gene            <668634..>670208
                     /locus_tag="AGOS_AER022W"
                     /old_locus_tag="AER022W"
                     /db_xref="GeneID:4621084"
     mRNA            <668634..>670208
                     /locus_tag="AGOS_AER022W"
                     /old_locus_tag="AER022W"
                     /product="AER022Wp"
                     /transcript_id="NM_210236.1"
                     /db_xref="GeneID:4621084"
     CDS             668634..670208
                     /locus_tag="AGOS_AER022W"
                     /old_locus_tag="AER022W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR139W"
                     /codon_start=1
                     /product="AER022Wp"
                     /protein_id="NP_984882.1"
                     /db_xref="GeneID:4621084"
                     /translation="MRVSRLGFSCLALAGWASAMIMQNPFSAIMRGEGDAGSTTWLDG
                     LESWPVLGQDGKLAKWYAQGMSEPRNMLQKIALRGSDFEVMRHKSNPDYALRVKKQDP
                     AKLGVDTVKQWSGYLDYKDEKHFFYWFFESRNDPANDPVMLWLNGGPGCSSFTGLLFE
                     LGPASIGKDLKPVHNPHSWNNNASVIFLEQPVGVGFSYGDSVDSTAVAGADVYAFLRL
                     FFQKFPHLAKNDFHIAGESYAGHYIPQIAHEIITSKEENSEEIPNFNLTSVLIGNGFT
                     DPRTQYKYYEPMACGKGGVPAVLNEDQCSRMNASSSRCDRLMNLCYLTNRAIPCLAAT
                     VYCERYITQVYEETGLNYYDMRRKCESPDSDLCYRGLDYVQQYMNQKEVQEALGSEVE
                     LYEGCNKRVGARFALSGDHGKPFQQYVSQLLDRAIPVLIYAGDKDYICNWLGNKAWSD
                     EVGWRHTYKYRTLPLKPWVNKNTGKTAGEVKSFGALTFLRVYDAGHMVPYDQPESSAY
                     MIESWLNKNYNLDYKV"
     gene            complement(<670299..>673418)
                     /locus_tag="AGOS_AER023C"
                     /old_locus_tag="AER023C"
                     /db_xref="GeneID:4621085"
     mRNA            complement(<670299..>673418)
                     /locus_tag="AGOS_AER023C"
                     /old_locus_tag="AER023C"
                     /product="AER023Cp"
                     /transcript_id="NM_210237.2"
                     /db_xref="GeneID:4621085"
     CDS             complement(670299..673418)
                     /locus_tag="AGOS_AER023C"
                     /old_locus_tag="AER023C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL078W (AVO1)"
                     /codon_start=1
                     /product="AER023Cp"
                     /protein_id="NP_984883.2"
                     /db_xref="GeneID:4621085"
                     /translation="MDSAVAARLNRLRAGFLKGCPEEDQMKRVIKPYGDATTDEALRQ
                     LYVDREGHDLLVHLESPPISESYLGSMMPRTKKMSEERVGADEDKAESVVERSSRVLG
                     ARREDAAGAGLELPVLAVNGASEESFAGTSVSSTVSESKYDASQGPGKAKAVKGKSRF
                     RSIFRKKSSTDALRVQGAPKGAPRRTSLYDSSFGFEGIIDEDDDEEDNEDLDAEANKR
                     FFYMNGDLRDSIYPDVSNNSDEPKPKPIKKGNFLDNFSLNPQANIQNHDGRHVAGQKE
                     EESSPPKLGKPRNPETEEDYIIDSFINQKDLEPLELTENPPHDADVRNTSAARASLRS
                     DRPSYVEDADDDEAGGESGLASDAASSYGASLLYSDSSASDFRPNAVMDSSADTGMNP
                     IEYLHYSVPSTRGFAIYTVADDSSSVVNKLSSANRFRGSDTPNSEFKDSGSTPLLSKD
                     GNHSGVSDKKWSASLQPHSKSVRIRNSLPSFIMTGSIKSRAGRQYQHKRSTSDVNRAS
                     MQAFPEPLVIKKVNVSDGKPHKSHLSSLLQKTENKADINPLEYFASASGANLPRGSVL
                     DLDVYIQLSKTYKKTPFSIRVKKTASVFETLGYALYCYVTKFRPGDLENDGLVIHEVE
                     NPNYFTLNIVDEDGEPFEDNFGLLERTQCIGTVSDNEVVICRVEDNEQFTKNDSMTPL
                     PHDFVKRATTIAETTCRTTSVNNNPPASAMTTISKDDNLTFKVYMYPNTNPRASGTTI
                     NIPGYCKIYDLVLQCCKAKALDPTKYHLKPLGKNVLLDSNDLVNKLDGITSLELIKHK
                     DSKSMAVEKLRQRRPSLPTIQGSYMFNELTLDLGDQFIRAGDTANTKREDMVPGQNGG
                     SKTTNNANKKYHSIYKLGISRQHSLTAGHGAGIGGGIFRNKNSSKSSLTTNTQPPNVL
                     AGGSSYKDMFAGAYYKYKVWRRQQVSFINKHERTLAIDGDYIYIIPPENGYHWHQETG
                     KTKSFHISQVSLVKRSKRVPEYFKIFVIKPNNEKRYYFEAVSPEECVEIVTRLQNLSG
                     AYKMNRKIK"
     gene            <673637..>674494
                     /locus_tag="AGOS_AER024W"
                     /old_locus_tag="AER024W"
                     /db_xref="GeneID:4621086"
     mRNA            <673637..>674494
                     /locus_tag="AGOS_AER024W"
                     /old_locus_tag="AER024W"
                     /product="AER024Wp"
                     /transcript_id="NM_210238.1"
                     /db_xref="GeneID:4621086"
     CDS             673637..674494
                     /locus_tag="AGOS_AER024W"
                     /old_locus_tag="AER024W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL080C (REX4)"
                     /codon_start=1
                     /product="AER024Wp"
                     /protein_id="NP_984884.1"
                     /db_xref="GeneID:4621086"
                     /translation="MVLSSNWSKLSKTQEKRVKKAEHGKSDGKSDGKTAGVGSRASGT
                     PPETAQRRKSKAKTSKIMEMVAKMNREMANSRQNSAEKNEVQKGALEEKISVDMAQSG
                     KAGKVGSVGKFVAMDCEFVGVGPDGKESVLARVSVVNYYGQEVLDLYVRPKEKVTDWR
                     TWVSGITPAHMKQAVTLEEAQRRVAAMLKNRVLIGHGLHHDLEMLMVSHPKAQIRDTS
                     MHGPFREKYGAGKTPSLKKLAREVLNIDIQGKEHSSVEDARAALLLYKSDKVEFERLH
                     QQRFSRRKA"
     gene            complement(<674619..>683354)
                     /locus_tag="AGOS_AER025C"
                     /old_locus_tag="AER025C"
                     /db_xref="GeneID:4621087"
     mRNA            complement(<674619..>683354)
                     /locus_tag="AGOS_AER025C"
                     /old_locus_tag="AER025C"
                     /product="AER025Cp"
                     /transcript_id="NM_210239.2"
                     /db_xref="GeneID:4621087"
     CDS             complement(674619..683354)
                     /locus_tag="AGOS_AER025C"
                     /old_locus_tag="AER025C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL081W (IRA2) and YBR140C (IRA1)"
                     /codon_start=1
                     /product="AER025Cp"
                     /protein_id="NP_984885.2"
                     /db_xref="GeneID:4621087"
                     /translation="MVKNLICRIFNRLEQLLPTELNDFVYSEVERHPIFSNARLALLN
                     AGVTQGLQLVVDPLLEVVERIAEKNRPESGSTSGISSAVATLSVMESYTEDVLHSLLV
                     MLRLLNDIIEVTWQSYESNHAGDEAEPGREAGTVNGFYSTYKVGFATEKEWTHAMAPP
                     ALETTAAQQLLRISNRFKTRSQTLEILKKIANSLHRPETLNSRLKVPDTLHNERSQTR
                     SELLDKIDDNCEALMKHVAASNPHEYHSYINTRIISPLLVTQTQNETDIATYLDAFSF
                     YFITNKYLVSFLELVSKMVTYFKKSVYQEVLLKFVSQAMTTWILSRPQEYLDVIDRIK
                     YHPEDQSTQLLIKEASFLFEEIYNSFSVTHILTESPTLQSTMSSPTSAGGSTSSIPGD
                     GTSPAKGSNAAHSISSATIVITNSVDDPMRPSTVPDTGEHASNHPRMTGNPDNVENIT
                     HMSVLSFLSCMVMLHPGAFEEINNTSFRNIPDDPHLNESKEDITDSLYATTSGTTSVN
                     SDERIRHSQHRRLKSFKKLTAFSTHSSNHHKVKFLSALVDNLTGIHAVSDAAIVDSLR
                     TLILISSLAASVFQFEKDAPSIHFSRRLFPVLCDSLQLCSEQNARRNPLIAKCLFRHY
                     TLHSSLQIDYFPVACSLEPDAFNLRLQEYLEQRNNSLGHLHILTEGLKAYVCVQRNMP
                     SEFKTLLATIGLLRRTAYGLSCVLIEGSPLFDDRSSVSAVIDDLLEGRLIDELNIDDS
                     DDGDPRIPAFMNAFVPKESMKSFPQTPSVPSFTSSSFNEKTPSAPFIFPNKSDHDAVR
                     IRRPSIGSPQPTLHGRLTTTSSLPHDLERVQYSMRASMDRGVRPPLRMSSRGRYGSQD
                     SIMHLMRSTSFVGNEALQEVRKDASNLYIVRKIIGNIYAIYKAVLHFSMSVLEAEKIS
                     PLHIDDYKDVVKPVFAALIDDGADSHSAVKAYCYVGITCIDELAGEHANKYMPSVFKA
                     NGYLIALLAASLFNVSLTDSKREQIFGYLTDFWEFRQAIVKYFEKRGILSKISDEELY
                     TFPVIRGATGRALCVSMYSHNPNIHRLLKIGFRLFQKEIANHHLVNGHRVTTGQFNLQ
                     FIKAMGRDSYLSTGALAFQRRLRSDILARIKHPDRILYDSLRLIYNHWYSLLTAEHRS
                     DTESNHFRNCAGFIAASCGVFLAADDDILEKFSYLYQVRDSMVEKIDYFIYKQCQSIN
                     NEDLLTRENSRDIVSSELHPLAFALLFKHLKKKAKDLFDIKITQPENELHYVLLEQII
                     LVIRVILERDDDTDVLICVSLDLIELLGDIFKIIELMPRDSPKYYKIIIQISKMLRSF
                     EHSEQKICISGCMLIKNKWLRLTMRWFESTIFREYDLENLGKPHRSMDLQRRDLDYLY
                     IDTSIESSKALAYLTKDLVLEAPQSMSEKELSRSKEVVFGNYFTILLKGLEKSTGIKK
                     FPPTLRHKIGMLNDNIITSLTNLLNYNVDVGFKYALPIGYSPNRNIKLAFLKVFVNIV
                     SNFDVTKKRLEEERSAAIETLLDRAVEDPKLLSKAARVCPANDIDSLAGSFVTLYDIK
                     NAAHLIVIELIIDEISRATRYMDVLRRNSCATRSLSMFSRLKGGAYLINVLKPVLEEV
                     VATGETFDVEKIEPDDPDCQIHVDLFCKYLNKLVDSIVGSVADFPPEFFVICQSIYSS
                     VKENFPDSAEIAVGSFIFLRFFCPALVSPDSEGITDPLYPKARRSFMILAKVIQNIAN
                     GSVSSLKWPALQSEVEFLKTISDRIFCYLKEISDPTRKVEIRTKPENRASVDDFHMLH
                     RFLYYHGFEIRREFINDVKSAEDMGRLREFCRLADRLLSLLGQPRMEFKSAISPYIRD
                     HMDTNPELYEFMSRHSLKNILPEDTPFVREGVSPDGFPIIVLTWHLCDRILKRESDAL
                     VFRIFQIYSKVWTTSHYCVIDCTGFDCQKYEEPVRKLSNLFYKLIPHDAAKNCTGFYY
                     YNMTENLLDLWLPIFRDKARYLSGLKIPHHFINSNSPTKAISMLGLSDYSLEVYTDVR
                     VTLHDASVYNSKDKKFYPVTLKIGNKHFQVIHDTPKSINLGIMETALDIYFNDVYDIA
                     EIKSTGLSNEVGVPYEFTIIMDDGNKLIFTSTKCLEILKIFYYSQVRLEEEFRDDEFG
                     VSSMAHDHNKRKDMTYTIGHILMIVFVGLTSEDDAAESVAYNLMAATQSTFDLDCGHK
                     LTVPPEVYVSGDNSAFYNSILNTLAVTTPELCECIWTYALDLLENVLNKKQITALLIA
                     LSPWTKNLYEYVYLANDEEGPEITTQIIRRLIRITMKQELHSILYAQLIFSNILLEGD
                     LTELLFDEVIHHCVDRASEGSEWKRIIVILTKVPTTEVCGLVLRKIQKISNSFLPTLQ
                     LETSTHSWSELIILVEVAVSLFFDSLLLAQLHLSEILCIVSLLIDVGPTELRSALHRL
                     LMNVCHSFVNNERLYEPQKENLKKISITLSRQKLKFMFGFSQDKGRVLQNFSPSSFLT
                     KFTTLEHFISNLLELMGNASVNHSTVLCWKTKYLKYIMDVVTNVESFLSSRAMMIIGI
                     ISKNGINDNLCYKLLRQTFRTLSVPWITEESIFYAISHIFAYSKIVNGLQPTSKLLPQ
                     MFWFSTTYIRSPKSMVYQGGLLLMMNSAQRMSLASGGENAPPLLSQLYKERQFVEAVM
                     DEQGRVDGMRFTEANFIHILMAYLSKGLLIPFVRTTAVEALITFFRLTFHKSPYQADD
                     NYLVFMFFIYLVQRPDHFNEMLNEMDPDSEIISLDDTTGIDSRLLSWMENGSDTALFA
                     LYQGAVYFSSRNSDEPGKVRFLLLLKHLVVKQPFMVFKVYNVIRDELGRINTYDVSNT
                     NTVTVAFFVIRLMVVQKDYLKLDDIQQEMQNHLATRGLSGISDIDIDAAKKESELSPE
                     KQIESILPRKVHALQIVDQMLSLSG"
     gene            complement(<683666..>684670)
                     /locus_tag="AGOS_AER026C"
                     /old_locus_tag="AER026C"
                     /db_xref="GeneID:4621088"
     mRNA            complement(<683666..>684670)
                     /locus_tag="AGOS_AER026C"
                     /old_locus_tag="AER026C"
                     /product="AER026Cp"
                     /transcript_id="NM_210240.1"
                     /db_xref="GeneID:4621088"
     CDS             complement(683666..684670)
                     /locus_tag="AGOS_AER026C"
                     /old_locus_tag="AER026C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR141C"
                     /codon_start=1
                     /product="AER026Cp"
                     /protein_id="NP_984886.1"
                     /db_xref="GeneID:4621088"
                     /translation="MLARKRRSITGKSAVKHTPAIKPSKARKVIRRYHVLLQKRRAIC
                     KLLGIPVAENDEVLNERQIARYVTDAGLQEQYRLGADMAHPDEKVERELLKIQKMRES
                     PLLVQMLGYVMAEINGPRGLQNYQAASTVGQTASRGGDTSRQLVPWLREAGTPADARA
                     LEIGALSAANCISTCGLLRTVVRIDLHSNDSTAIEEQDFMLRPLPQADADAFDLISCS
                     LVLNFVPTPLARGEMLLRFRSFLRGPRPLLFIVLPLPCMENSRYMNSEYFCNMMTALG
                     YNCLYQRSAKKLIYFLFASRTGMPAPYPLKYTRKHQLADGPAMNNFSITLPALSSPRI
                     "
     gene            <684897..>687155
                     /locus_tag="AGOS_AER027W"
                     /old_locus_tag="AER027W"
                     /db_xref="GeneID:4621089"
     mRNA            <684897..>687155
                     /locus_tag="AGOS_AER027W"
                     /old_locus_tag="AER027W"
                     /product="AER027Wp"
                     /transcript_id="NM_210241.1"
                     /db_xref="GeneID:4621089"
     CDS             684897..687155
                     /locus_tag="AGOS_AER027W"
                     /old_locus_tag="AER027W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR142W (MAK5)"
                     /codon_start=1
                     /product="AER027Wp"
                     /protein_id="NP_984887.1"
                     /db_xref="GeneID:4621089"
                     /translation="MSPTNNGRNKKLGPRRKVPGRVSKSKSRAKVQAGDAKRVLDANA
                     LKWEKVDVPDTLGDFGGFYGLEEIDGVDVEVVDGKVQFVARDESRLKSPADAVDGTDM
                     VEVDEDAGMEDVTEFRNLDDVAEGELSALSDEGSASEDDGSDSSGSSDMDEDDDQELQ
                     SEIFNKDIGLDEAEAPELPSWTNTMKLSATVLQGLSRLGFSNPTEIQLQSIPKALDGH
                     DIMGKASTGSGKTLAYGIPILEGIIRDDTDSRPIGLIFTPTRELAHQVTDHLREVGAL
                     LVKRNPYSIMCLTGGLSIQKQERLLKYKGSARVVVATPGRFLELLEKDQTLIDRFAKV
                     DTLVLDEADRLLQDGHFEEFERILKHLSRARKFTNGKKHGWKTMIYSATFSLDYFNKL
                     SNTSWKKMKKAPSENEMEEVLKHLMTKIPFRGKPLIIDTNPEQKVASQIKESLIECLP
                     TERDLYVYYFVTLYPGTTLVFCNAIDSVKKLNAYLHNLKISAFQIHSSMLQKNRLKSL
                     EKFQEQAKKNQALNKPTVLIASDVAARGLDIPGIQHVIHYHLPRSADVYIHRSGRTAR
                     AENEGVAVTICSPQEAMGPLRKLRRVLAGKAGSKGKRWQNEIALLPVEPDIVSQLRER
                     SRLASALADSEIATSSLSKDDNWLKKAADDLGIDVDSDDETKDTFLAKNKTKKLNKQL
                     DKSTSKSYKMELNALLNTPIRKDARKSYLTGGLSNLADDLTKKKGHSSIIGHDKVDAL
                     TLLKSKSKRAKR"
     gene            complement(<687320..>688636)
                     /locus_tag="AGOS_AER028C"
                     /old_locus_tag="AER028C"
                     /db_xref="GeneID:4621090"
     mRNA            complement(<687320..>688636)
                     /locus_tag="AGOS_AER028C"
                     /old_locus_tag="AER028C"
                     /product="AER028Cp"
                     /transcript_id="NM_210242.1"
                     /db_xref="GeneID:4621090"
     CDS             complement(687320..688636)
                     /locus_tag="AGOS_AER028C"
                     /old_locus_tag="AER028C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR143C (SUP45)"
                     /codon_start=1
                     /product="AER028Cp"
                     /protein_id="NP_984888.1"
                     /db_xref="GeneID:4621090"
                     /translation="MDSGEAEKNIKIWKMKKLVKSLEKARGNGTSMISLVIPPGGQIS
                     QTQKKLTDEYGTASNIKSRVNRLSVLSAITSTQQKLKLYNQIPPNGLVLYCGDVITEE
                     GKVKKVTFDIEPYKPINTKLYKCDNKFRTEVLSELLEADEKFGFIVMDGQGCLFGMLS
                     GNTRTVLQKFTVDLPKKHGRGGQSAVRFARLREEKRHNYVRKVAEVAVQNFITNDKVN
                     VKGLILAGSADFKTDLAKSELFDLRLAAKIVKIVDVSYGSENGFNQAIELSAEALANV
                     KFIQEKKLLTEYFDEISQDSGKFCYGVDDTLKALDLGAVEKLIVFENLEIVRYVFKTS
                     EDEEVIKFATPTQEDKSYAIDKATGTEMEVKEEQLLIEWLAEHYKEFGANLEFISDKS
                     SEGAQFVTGFGGIGGILRYKVNFDQLADDSEDEYYDDDEGSDYDFI"
     gene            complement(<689025..>690722)
                     /locus_tag="AGOS_AER029C"
                     /old_locus_tag="AER029C"
                     /db_xref="GeneID:4621091"
     mRNA            complement(<689025..>690722)
                     /locus_tag="AGOS_AER029C"
                     /old_locus_tag="AER029C"
                     /product="AER029Cp"
                     /transcript_id="NM_210243.2"
                     /db_xref="GeneID:4621091"
     CDS             complement(689025..690722)
                     /locus_tag="AGOS_AER029C"
                     /old_locus_tag="AER029C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL082W (ATG19) and YOL083W (ATG34); Tandem gene
                     duplication in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AER029Cp"
                     /protein_id="NP_984889.2"
                     /db_xref="GeneID:4621091"
                     /translation="MERESPCKVCPVAEGERVLIDGPNVHAVETVRRILASKRPKMPM
                     EAMHAMCEQQGAKCRATAQNTDSDAPSVVTIAKEQWERLVSSINSLSLGPDGPAAAGE
                     STEHKGVRCDGCWSKYGDGAGFIRGLRYRCVCCDDFNLCAECEATGYTGSQHDSGHAM
                     LKIKNPQHPWWRALRMPVHYRVVCDGCNPGVIRVVDTETCSEEGYIQGPRFHCLQCLD
                     HDYCARCVANEMGTGTHRPSHSMELIRLPGYRPTHTYASPRSGGMRCAGRCESDLTGR
                     QYYRCIQCDAFHLCVDCFHKGVAIVEHVNAHGISCQDTSPASLFVGEPSPGELPSLIR
                     APLASVCIFAPDISVAAATLFSQVHDVKDLERIASQCAAYESLVPRFGASAEELERKL
                     SSLPPKATEDEFGISVTVSRVDFALTFRLRNYTTDAIPSSSSLVFSHHPVGGSSHTRT
                     MSIGPHELPPGSSKQLNICYPHQTSDGDPYSLSLVSPAGTALYSGKASSMPADILLAC
                     PGGTPASSAAFNAMYTNQSSASVPAPVVNAPFRQSNSPVMPSDEEYDLLSDSDIEVV"
     gene            complement(<691116..>693743)
                     /locus_tag="AGOS_AER030C"
                     /old_locus_tag="AER030C"
                     /db_xref="GeneID:4621092"
     mRNA            complement(<691116..>693743)
                     /locus_tag="AGOS_AER030C"
                     /old_locus_tag="AER030C"
                     /product="AER030Cp"
                     /transcript_id="NM_210244.1"
                     /db_xref="GeneID:4621092"
     CDS             complement(691116..693743)
                     /locus_tag="AGOS_AER030C"
                     /old_locus_tag="AER030C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL084W (PHM7)"
                     /codon_start=1
                     /product="AER030Cp"
                     /protein_id="NP_984890.1"
                     /db_xref="GeneID:4621092"
                     /translation="MADANDSSDSNSTSSFVSALILYGIIGLVYTLIFLALRKRYRRV
                     YEPRTLDDVRTLQPSERVESAPAGYVWWLPHLLYKPHKSLLQHMGVDAYFFARYLAVF
                     GTLALIGCFILLPILLPVNAAGGRHLRGFERISFSNVAMSRRLYAHVFLSWIFFGLVL
                     YVIYRELYYYVSMRQALQTSPYYSSLLQSRTVLFTDVRGGTDAESVLRGAFTGVEEVV
                     YAKDHTELRKLVKERNKTANKYESALNKVVNKSVKVRRKAELKGNTVLQQREDLKDDD
                     FERYVKKRPTHRLGKIPCVGEKVDTLKHCASRLGSLNSRVKSEQEEWETSQPLNTCFV
                     IFSTQRDAQEAYQRAPVALPKGSYDRCIIGCAPDDVNWDSLSMSKSVRRSKRLVGNSI
                     LTAMIIFWAIPVAVVGCISNINFLTEKVHFLRFINNLPDVLMGLITSLLPTIMLAVLM
                     SLVPIFIQLVANKTGSISRQETQLYCQRWFYAFQVVHVVLVVMLASSAASTVTAIIDD
                     PNNAFEQLAQNMPLSANFYLSYVMLFAFIFASGVLLQLTGFVLSFILGRILDSTPRQK
                     WTRYNTLNLPTWGVMYPLMELQVCIMLAYAIVTPVLLIISTLALLFAYVAYMYVFNYV
                     YGLKHDYKGRNYVNALFQVFVGLYLAEVFLFALFIMGRAWGPLVLNVIMLAFTVLVHL
                     YLQRRFLPLVDAVPLSLLDGAAGSVGKDQGWAEVVRAGRARPLDGLVALTNRLTGAAT
                     PAHPAPVNPDAEKAALSRSAPAAASSALARVKNFFHPSAAYNYDLAKSRLPDTYDKPL
                     EYAEGYTRSAYTDPCIRDKEPVLWVPEDPMGVAARQAAIAEQHGVKVSTSHTGFDEKG
                     AAIYTDNPPDYTPYDYVNH"
     gene            complement(<694421..>695416)
                     /locus_tag="AGOS_AER031C"
                     /old_locus_tag="AER031C"
                     /db_xref="GeneID:4621093"
     mRNA            complement(<694421..>695416)
                     /locus_tag="AGOS_AER031C"
                     /old_locus_tag="AER031C"
                     /product="AER031Cp"
                     /transcript_id="NM_210245.2"
                     /db_xref="GeneID:4621093"
     CDS             complement(694421..695416)
                     /locus_tag="AGOS_AER031C"
                     /old_locus_tag="AER031C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YGR192C (TDH3)"
                     /codon_start=1
                     /product="AER031Cp"
                     /protein_id="NP_984891.2"
                     /db_xref="GeneID:4621093"
                     /translation="MVKVAINGFGRIGRLVMRIALSRANVEVVAINDPFITVDYAAYM
                     FKYDSTHGKYAGDVQYEGNTLVIDGKKIKVFQERDPAQLPWGEEGIDIAIDSTGVFKE
                     LDSAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYAGETIVSNASCTTNCLAPLAKV
                     IDEQFGIEEGLMTTVHSLTATQKTVDGPSMKDWRGGRTASGNIIPSSTGAAKAVGKVL
                     PQLNGKLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKAAIKAASEGKLKGILGYTED
                     AVVSTDFLGDNNSSIFDASAGIMLSPKFVKLVSWYDNEYGYSTRVVDLVEHVAAN"
     gene            <695995..>697050
                     /locus_tag="AGOS_AER032W"
                     /old_locus_tag="AER032W"
                     /db_xref="GeneID:4621094"
     mRNA            <695995..>697050
                     /locus_tag="AGOS_AER032W"
                     /old_locus_tag="AER032W"
                     /product="AER032Wp"
                     /transcript_id="NM_210246.1"
                     /db_xref="GeneID:4621094"
     CDS             695995..697050
                     /locus_tag="AGOS_AER032W"
                     /old_locus_tag="AER032W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL086C (ADH1) and YBR145W (ADH5)"
                     /codon_start=1
                     /product="AER032Wp"
                     /protein_id="NP_984892.1"
                     /db_xref="GeneID:4621094"
                     /translation="MSAPTIPRTQKAVIFYENGGPLQYTDIEVPKPKATELLINVKYS
                     GVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCM
                     ACEYCEKSNESNCPEADLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGI
                     TVYKALKSANLRAGDWVAISGACGGLGSLAIQYATAMGYRVLGIDGGEEKEQLFRQLG
                     GEVFIDFRKSKDIVADVVKATNGGAHGVINVSVSEAAIESSTEYVRSNGTVVLVGLPG
                     GAKCKSDVFSHVVKSISIVGSYVGNRADTREALDFFARGLVKSPIQVVGLSELPQIYE
                     KMEKGAVVGRYVVDTSM"
     gene            <697282..>698121
                     /locus_tag="AGOS_AER033W"
                     /old_locus_tag="AER033W"
                     /db_xref="GeneID:4621095"
     mRNA            <697282..>698121
                     /locus_tag="AGOS_AER033W"
                     /old_locus_tag="AER033W"
                     /product="mitochondrial 37S ribosomal protein MRPS9"
                     /transcript_id="NM_210247.1"
                     /db_xref="GeneID:4621095"
     CDS             697282..698121
                     /locus_tag="AGOS_AER033W"
                     /old_locus_tag="AER033W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR146W (MRPS9)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS9"
                     /protein_id="NP_984893.1"
                     /db_xref="GeneID:4621095"
                     /translation="MFARMASLRALVPVRALLWRAPVRSVHRAAVRETRIVPQLPTFY
                     SANPAHEAHMDRLEALLRKHTKQQARRVAVERTASDRPRWLSFDQYALIGGTSRLKPT
                     QYRQLVSVLDRLHAIDPQLSNGEIAATLEAFLRKSRLEEQNVVRQELDHLGRACAVGR
                     RKTSSAKVWLVRGSGEVLVNGRTFADYFSKIKDRDAIMYPLRVLDAAGKYNIFAAVRG
                     GGVTGQAEAIMHAVAKALVVFNPLLKTRLHRAGVLTRDYRHVERKKPGKRKARKMPAW
                     VKR"
     gene            complement(<698191..>698523)
                     /locus_tag="AGOS_AER034C"
                     /old_locus_tag="AER034C"
                     /db_xref="GeneID:4621096"
     mRNA            complement(<698191..>698523)
                     /locus_tag="AGOS_AER034C"
                     /old_locus_tag="AER034C"
                     /product="AER034Cp"
                     /transcript_id="NM_210248.1"
                     /db_xref="GeneID:4621096"
     CDS             complement(698191..698523)
                     /locus_tag="AGOS_AER034C"
                     /old_locus_tag="AER034C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL086W-A"
                     /codon_start=1
                     /product="AER034Cp"
                     /protein_id="NP_984894.1"
                     /db_xref="GeneID:4621096"
                     /translation="MPEIDQHKKRLVGQLKGKLWFCIEQQVRRELPYGVTFTPKFINA
                     LVELCFAQLDELGGDLEAFARHAGREVVASDDVMLRLRKNPELQAFLRRELAQLRAPG
                     AARTAQRR"
     gene            <698712..>701732
                     /locus_tag="AGOS_AER035W"
                     /old_locus_tag="AER035W"
                     /db_xref="GeneID:4621097"
     mRNA            <698712..>701732
                     /locus_tag="AGOS_AER035W"
                     /old_locus_tag="AER035W"
                     /product="AER035Wp"
                     /transcript_id="NM_210249.2"
                     /db_xref="GeneID:4621097"
     CDS             698712..701732
                     /locus_tag="AGOS_AER035W"
                     /old_locus_tag="AER035W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL087C"
                     /codon_start=1
                     /product="AER035Wp"
                     /protein_id="NP_984895.2"
                     /db_xref="GeneID:4621097"
                     /translation="MNQYTITYGLSPPQSARNRNMHILPVMKMLPLPDGFLTGGRDGT
                     VVKHCYCEVSHNYQKRVRMQVHSDWVSDLVELSAGTYLSVSHDFSVHLLLLQTRNDGW
                     ETRILGYHDDYVKCICVLQRGGADSSRSSSSERSRGESGSGGRALFATGGLDKKVKFW
                     ELQGREARVLFEYDNAQPQETGSVYALCALSPQEVVIGDNNGDLKIISAVTGELVHVV
                     SGAHGSNVRLAQLLDQGRRLITTSSDGAVKLWDVAALCAGEAEAALVHEWQWQCPVWS
                     VAGLSESTLLFGDAWGNITRIRHTGQDTASWGRAVQDVLYGAAPDVEVYTNGILSMCF
                     MEQSKLWFSCSRNSNIYLMKLDAEGVQTDRKIQSLEGGSALLKSCLLTNRRHVITLNT
                     LNQVQKWDIVSCELLDTYRPTDGSFDDLVNKNNTKEILPHWCSVSIRTGKLFIKFNDR
                     FTATEVYGTALKQYKLINDVVLNDDQRYNLGRLAINSILYEFIKYELHMDKFARLEAV
                     NSKRSSSSSSNIIPQLPNNIPQDLQKQQGYLGQDYDQQGRIPQLVLYPLQRATTTGNI
                     DDTPDKPVSKERKRLNIFPKMPGTSSVNNSAHSEAGTPKSDTMSPILGESIDQTPRPA
                     PSEDETITPSLPLTAGADEVGLERATPATAPELGPKQSSSNLSLLSRFRRQSTHILGP
                     PTLNNFPSMQRCESPPETQTSEESPEKEPPATQNGLKSNGPGSEKALPATPVSLKTMA
                     DLLHANKEIYRQQATTKGGAFKKFGRKLLESQFLRDDEAPLIEIKNGCLILINYWRTG
                     SCGDTVLFSTYLPAPDYSWHFDDPDSDAGNEHPSNELTRMDRIYRFRIFRSLEQHFPY
                     WFARQLFHEEKTAKNYPKLNFLIKPYVSPDGEANTAEPEEKVRSSHMLFSKKSQELPA
                     ALPPITDGKMRLSAPDMIKVKRIKQYIVDRFESKTPEMRNKISVSEWLELLCKDSLLD
                     DDLTLAAIRTLHWKSNNEIVLEYRRKVRQTSRKR"
     gene            <702063..>702710
                     /locus_tag="AGOS_AER036W"
                     /old_locus_tag="AER036W"
                     /db_xref="GeneID:4621098"
     mRNA            <702063..>702710
                     /locus_tag="AGOS_AER036W"
                     /old_locus_tag="AER036W"
                     /product="AER036Wp"
                     /transcript_id="NM_210250.1"
                     /db_xref="GeneID:4621098"
     CDS             702063..702710
                     /locus_tag="AGOS_AER036W"
                     /old_locus_tag="AER036W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR154C (RPB5)"
                     /codon_start=1
                     /product="AER036Wp"
                     /protein_id="NP_984896.1"
                     /db_xref="GeneID:4621098"
                     /translation="MDQDNERNVSRLWRAFRTVKEMVRDRGYFITQEEVDLSLEDFKA
                     KYCDSMGRPQRKMMSFQSNPTEETLKKSPNMGSVWVEFCDEPSVGIKTMKNFVIHIGE
                     KNFQTGIFIYQNGITPSALKLLPSVAPATIETFNETALVVNITHHELVPKHIKLSDEE
                     KKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVVKIIRKSETSGRYASYRICL"
     gene            complement(<702856..>703596)
                     /locus_tag="AGOS_AER037C"
                     /old_locus_tag="AER037C"
                     /db_xref="GeneID:4621099"
     mRNA            complement(<702856..>703596)
                     /locus_tag="AGOS_AER037C"
                     /old_locus_tag="AER037C"
                     /product="AER037Cp"
                     /transcript_id="NM_210251.1"
                     /db_xref="GeneID:4621099"
     CDS             complement(702856..703596)
                     /locus_tag="AGOS_AER037C"
                     /old_locus_tag="AER037C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR153W (RIB7)"
                     /codon_start=1
                     /product="AER037Cp"
                     /protein_id="NP_984897.1"
                     /db_xref="GeneID:4621099"
                     /translation="MALIPLSQDLADILAPYLPTPPDSSARLPFVTLTYAQSLDARIA
                     KQKGERTVISHEETKTMTHYLRYHHSGILIGSGTALADDPGLNCRWTPAADGADCTEQ
                     SSPRPIILDVRGRWRYRGSKIEYLHNLGKGKAPIVVTGGEPEVRELGVSYLQLGVDEG
                     GRLNWGELFERLYSEHHLESVMVEGGAEVLNQLLLRPDIVDSLVITIGSKFLGSLGVA
                     VSPAEEVNLEHVNWWHGTSDSVLCGRLA"
     gene            complement(<703680..>704474)
                     /locus_tag="AGOS_AER038C"
                     /old_locus_tag="AER038C"
                     /db_xref="GeneID:4621100"
     mRNA            complement(<703680..>704474)
                     /locus_tag="AGOS_AER038C"
                     /old_locus_tag="AER038C"
                     /product="AER038Cp"
                     /transcript_id="NM_210252.1"
                     /db_xref="GeneID:4621100"
     CDS             complement(703680..704474)
                     /locus_tag="AGOS_AER038C"
                     /old_locus_tag="AER038C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR152W (SPP381)"
                     /codon_start=1
                     /product="AER038Cp"
                     /protein_id="NP_984898.1"
                     /db_xref="GeneID:4621100"
                     /translation="MAIRHFRRQREQVTSGSSSDTETSDVSEQDTGAGEGPTEAETRA
                     EGAEQGAWERAPSVAGSEAGESDEDDSESSSSDDEEVVLHRPVFLKKRDPGAGPAART
                     GAVSGAQERTLDQVQHHNAVQDKERALKQIATSYSTDKELLHRIAQLETDGDTDSDSE
                     RREHELWAQRRHQRMLRLREEERRRQSELEENEAARLTNSALPMDDAGIQTAGGAERG
                     TRPASSSDARKRRGPEAKFKPSKVQKPQLKRTASPSRADENEFSIL"
     gene            <704810..>705556
                     /locus_tag="AGOS_AER039W"
                     /old_locus_tag="AER039W"
                     /db_xref="GeneID:4621101"
     mRNA            <704810..>705556
                     /locus_tag="AGOS_AER039W"
                     /old_locus_tag="AER039W"
                     /product="AER039Wp"
                     /transcript_id="NM_210253.2"
                     /db_xref="GeneID:4621101"
     CDS             704810..705556
                     /locus_tag="AGOS_AER039W"
                     /old_locus_tag="AER039W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOL088C (MPD2)"
                     /codon_start=1
                     /product="AER039Wp"
                     /protein_id="NP_984899.2"
                     /db_xref="GeneID:4621101"
                     /translation="MRVCSVFLLVWGAVALASVVSIKSEDQFYALVDNGRYSLIKYYT
                     AWCSHCKHLAPVFVELSDRELAMPAGAEVQFLEVDCDRFGNSLCARLPGFPVLELVRP
                     SAQDGPEAAPQPPAAGGWRRVLHWLHALLPQQHPFRVPEDRIAEFRGSRTADTIASFI
                     QQVVRNDRLEELAQRVLDGAAQEDEPLVHNGRAYLASVAGKDLREERNRLETLLGSDV
                     GISKAEELRLHLSIVSKLQEADSALLDDEL"
     gene            complement(<705634..>706539)
                     /locus_tag="AGOS_AER040C"
                     /old_locus_tag="AER040C"
                     /db_xref="GeneID:4621102"
     mRNA            complement(<705634..>706539)
                     /locus_tag="AGOS_AER040C"
                     /old_locus_tag="AER040C"
                     /product="AER040Cp"
                     /transcript_id="NM_210254.1"
                     /db_xref="GeneID:4621102"
     CDS             complement(705634..706539)
                     /locus_tag="AGOS_AER040C"
                     /old_locus_tag="AER040C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR151W (APD1)"
                     /codon_start=1
                     /product="AER040Cp"
                     /protein_id="NP_984900.1"
                     /db_xref="GeneID:4621102"
                     /translation="MGLLSYIRSAYEGDESEHTDLREMEKHIELCSSCDACSPEWEAE
                     VARDTQVFARLKIEREASLYGTSKPASVHFVVPTSQMDWAHSACDERPGSVQQRVAAW
                     VAQQDAGPDGMPMRCSVSSQPIDILDVEVMRGHKNNVLILPHFIKLVGLTADRVEQVL
                     DELLPLLRANDMPALLARPDIWECPEDSFIFLCSHTTRDKRCGITAPVLRKHICAHLQ
                     THGLYRDVSDARPHGCTVAFVNHVGGHKYSANAVIFLKRSRTMLWLGRVSPVHAEPIV
                     KHLLLPAVPQLPFPENVRCVRKYDF"
     gene            <707007..>708317
                     /locus_tag="AGOS_AER041W"
                     /old_locus_tag="AER041W"
                     /db_xref="GeneID:4621103"
     mRNA            <707007..>708317
                     /locus_tag="AGOS_AER041W"
                     /old_locus_tag="AER041W"
                     /product="AER041Wp"
                     /transcript_id="NM_210255.2"
                     /db_xref="GeneID:4621103"
     CDS             707007..708317
                     /locus_tag="AGOS_AER041W"
                     /old_locus_tag="AER041W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR380W (CSR1)"
                     /codon_start=1
                     /product="AER041Wp"
                     /protein_id="NP_984901.2"
                     /db_xref="GeneID:4621103"
                     /translation="MTQTAAPGRVQTLTKEQEKVLKQVWVHLFQFWGIDVDGSAVLTA
                     KEPEPAAPSGKGRKLLGLFGKRKDATGAARKESNGKAAAKVYDAEKVEDSDAEKEKPT
                     PQKVEGLEEMYELLKELDGAAVSKEFWSMLRCDYPDNLLLRFVRARKWDINKAMIMMA
                     HSLRWRLNEGKPEDIVFGGERGAQKADKKGIVKQLELGKATVRGFDKNGCPIVYVRPR
                     LHHAADQTEAETSEYSLLIIEQARLFLKEPCDTATILFDLSGFSMANMDYAPVKFLIT
                     CFEAHYPECLGKLFIHKAPWIFPPIWNIIKNWLDPVVAAKIAFTKTAADLEEFIPAEQ
                     IPLELGGKDEYNFDGFVMPDGSADTKLSDEKGKAAVLEEREAIIKRFIDATISWIEST
                     SDEESAKWLEKKIDLSKELSENYSKLDPYIRSRSFYDVNGTLKV"
     gene            <708514..>710544
                     /locus_tag="AGOS_AER042W"
                     /old_locus_tag="AER042W"
                     /db_xref="GeneID:4621104"
     mRNA            <708514..>710544
                     /locus_tag="AGOS_AER042W"
                     /old_locus_tag="AER042W"
                     /product="AER042Wp"
                     /transcript_id="NM_210256.1"
                     /db_xref="GeneID:4621104"
     CDS             708514..710544
                     /locus_tag="AGOS_AER042W"
                     /old_locus_tag="AER042W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR381W (CTF3)"
                     /codon_start=1
                     /product="AER042Wp"
                     /protein_id="NP_984902.1"
                     /db_xref="GeneID:4621104"
                     /translation="MLQSVTDPVQRLLDCTKETGPSQLRSVLSDLYERAPRHGISPAK
                     ILELIGFLCSAEFIAVSTRVYIVENCLIPNGYLSSSTVFEVLKHLGPSTPQNAFKLIV
                     EPAFQVALVKWLCHVLVIIPDYQKVLQRTYPIWFQLWMVDYLQDWTTYLLIWGTESKI
                     QVTEYRVRVLERIGSNPGYRNGKPLASFLLHKFLQLKPSKIVQHAIAELRCNAKRLMT
                     VQKVQLESKFMDGLQHVLSAGGVFESLQFKDSVNSQLNALKVLDDNNTNDTAQTPIGK
                     QLTLEQFANQIERMPCPSGHLNSLDINGYERLLLPLMAPEAKEALHLWLEYLLRTEGN
                     PTTLKRAMALLRAVDKTDIPFESLLLCDNFSSTDALKSLHMLYLVAEVPESNIIVNAL
                     LKSHKCLRSGKSPYAPQFILGLCILVMCKISQGELSKFLLQICSTFLKTLVNMCLLGK
                     EAPKTALILIHPLLYTLENAPSSAIPRDELTSVFVLPDIINSLVALNDPLVIALICEY
                     LVSAKDRVKGFTVDNSYVRKLNRCILDMANYLWRNKLFTEPYTWGLPKTFWAKISSNL
                     YLPEPEIRQKHLYSLPNFYPFRFISEEVLRRLEGQENTEVIYSKPLTEAGYRCWRKEL
                     ELNGKTWLSKVNNYDSFRKRLLMGIQEDSTYAGVPLFMQTYLKSFTESQAGS"
     gene            complement(<710604..>713225)
                     /locus_tag="AGOS_AER043C"
                     /old_locus_tag="AER043C"
                     /db_xref="GeneID:4621105"
     mRNA            complement(<710604..>713225)
                     /locus_tag="AGOS_AER043C"
                     /old_locus_tag="AER043C"
                     /product="AER043Cp"
                     /transcript_id="NM_210257.1"
                     /db_xref="GeneID:4621105"
     CDS             complement(710604..713225)
                     /locus_tag="AGOS_AER043C"
                     /old_locus_tag="AER043C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR382C (NAM2)"
                     /codon_start=1
                     /product="AER043Cp"
                     /protein_id="NP_984903.1"
                     /db_xref="GeneID:4621105"
                     /translation="MRGFPGAWCKRSLNTASDAVDLVKVGQKWKSKVLSGVPQPAAEG
                     TRPHMYVLSMFPYPSGMLHIGHLRVYTISDALNRFYRMKGYEVVHPMGWDAFGLPAEN
                     AALERGIAPADWTRQNIARMKQQKGDMLAHFEWGREVTTCDPEYYRFTQELFLELWHH
                     GMAYKKEAEINWDPVDKTVLANEQVDAQGRSWRSGALVEKRKLNQWFLRITRFAHELS
                     HDLDGLDGWPAKVKAMQKHWIGEVEGTEVRLCTGDGEAIVAFTPRIEAVFGLQYVAIS
                     TEHALTKKMAERLPELCEFLQRPLVLSESDLSGFQLPGTYVQHPFAKDHGHRIPVFVS
                     PYVPADGAGAVLGTPAHDEFDHKFWRANKPAEPVISSFEASGECDDECHIQTKGILNA
                     KAGNLKGISSQDAKQVLADKLVATGDGRQTTQYRLRDWLISRQRYWGAPIPIIYCDSC
                     GTVPVPKQDLPVMLPNIAGLSKKGNTLEHIPEFVNTSCPSCGGPAKRETDTMDTFMDS
                     SWYFFRYLDSHNQKEPFGYDKATRSMPVDMYIGGVEHSILHLLYARFISKFLASIGKW
                     DGSACNGEPFKRLVTQGMVHGKTFIDPENGSFLKPEELDMSNPADPIICRTGQKPRVS
                     YEKMSKSKYNGADPAQCISKHGPDAIRAHILFQAPISDVVNWDETKIVGIERWLARII
                     KLAHTLAADSQLKHGPVAKLTNMHEIALFNEVQKLLGSITDSFSRTLSLNTVISDYMK
                     LTNLLDQALKNKDINPAWLLTHFKKLVSVIHPTVPAVSEEAADIIKGHLQLLTWDHYV
                     WPTVDAQQKDNSVGYRVFVDGKMRFIYPAPSAFINDKNGVLKALLAHPDGGKYLAGRQ
                     VKNLILKKNIISLVLQK"
     gene            <713543..>716854
                     /locus_tag="AGOS_AER044W"
                     /old_locus_tag="AER044W"
                     /db_xref="GeneID:4621106"
     mRNA            <713543..>716854
                     /locus_tag="AGOS_AER044W"
                     /old_locus_tag="AER044W"
                     /product="AER044Wp"
                     /transcript_id="NM_210258.2"
                     /db_xref="GeneID:4621106"
     CDS             713543..716854
                     /locus_tag="AGOS_AER044W"
                     /old_locus_tag="AER044W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR383W (SMC6)"
                     /codon_start=1
                     /product="AER044Wp"
                     /protein_id="NP_984904.1"
                     /db_xref="GeneID:4621106"
                     /translation="MTNDKRTIDDVDREVTSLLQEADEARERQAQNKRRKRFAPMTQY
                     GTDTVDGEDWEGTPAGYMKRITLKNFMCHEHFELEFGPRLNFIVGSNGSGKSAILTAI
                     TVVFGAKASDTNRGVSLKSLIREGCGTARIAIVLANQGLGAFEQGVYGSEITIERTLK
                     RDGQSSHFSIKSENGREVSNKKRDLQRIVDYFSIPVLNPMCFLSQDAARSFLTASTPQ
                     DKFRHFMRGTLLEEIDMNLAKAEEILRSSKSNLDYHGENMKALREDYEHAKRLFKEIY
                     STHDWNERKKTLQGKLCWLNYKENERRLRKFKKRQEEISQKIVACDEKITERNLKIER
                     YKADQDSTHEEVDQKMTSLQDHQIKFEEAEQELGQFREKHEVLKEERRKVEREIASLE
                     VSLKAHRQQVKQLEQELAEALGGSKEQMVTEKRQVDEEIKTLKGNLPSLEDKFQQCRD
                     RELEYSHQRNTAIQQLQTSINLKKQEYRESTANRSQDSYAVYGRNMNRVVAEIRNRRH
                     EFSKPPIGPLGLEVSIKPGYEQWARSIQSIVGPSLGGFVVSTSRDNLLLRQILRKYPD
                     TRNTSIVTYALTEFNYEHGKAHTAHPTISDVLGFSRRDLECLFVDQHRIETIILVDNK
                     DDAYNVLKQSPQNITRALSLKDNRSGFQSSLAPSGGFRLDTIEYQQHLLFARTSGNNN
                     ASDTQYLKAVIEEEEGELRRIQTHYASLGSEIKEEGRKLEEQMRSIRSRIVSLELRSK
                     HLKVKIEKEVDTGALDAHKAALNVETSQIAQHRGAIAAINDQLLQLKDEVEPYKRKHE
                     SARQLVAKVKEELEDLKEMIRVRSHRIDKMTDDITIYNKKKVAYQEEFQSIQTNVDSF
                     TPVLDSLREDAERHCSEEVAYGSEIPNTEEEVRMEMRIADRHIKQAEKSVGMTQEEVA
                     RLLESTREKFYDAQEKYSAVDRALWSLHESLEQRRITLMNNIKSTCREADSDFRTTIR
                     VRNGFSGALNFDTPGALMVLVKTANDETPRNVDTLSGGEKSFSQITLLLSTWSTMRAR
                     IIALDEFDVFMDQVNRTIGTRMIMKKFSTNIRTQTIIITPQDIGKIADIRDPGIKIHK
                     MRDPQRRNNSDFYST"
     gene            complement(<716959..>720837)
                     /locus_tag="AGOS_AER045C"
                     /old_locus_tag="AER045C"
                     /db_xref="GeneID:4621107"
     mRNA            complement(<716959..>720837)
                     /locus_tag="AGOS_AER045C"
                     /old_locus_tag="AER045C"
                     /product="AER045Cp"
                     /transcript_id="NM_210259.1"
                     /db_xref="GeneID:4621107"
     CDS             complement(716959..720837)
                     /locus_tag="AGOS_AER045C"
                     /old_locus_tag="AER045C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL058W (USO1)"
                     /codon_start=1
                     /product="AER045Cp"
                     /protein_id="NP_984905.1"
                     /db_xref="GeneID:4621107"
                     /translation="MDLIQGLIQPPKAPSVEATIPTLCERIESSTLLSDRRSAILGLK
                     SFSRQYRELVVASGLKPLIGTLKRDYEDEDSVKAILETLLILFLRGEGNEDLTRNWAA
                     QYSRLQGGKYPSPMLVKKQIEHFDQFSLWIADALTQGEDIVDLLVQLLETDSFHVRLY
                     TIQLLGAIVTTRPEAGNRAIIAIPTGISTLVSLLDDVHDPIRDETVLLLTVLANNNSH
                     IQKLVAFENVFDRIFRIIADEGGMRGSLVVSDCLNLLSVILRYNASNQSLFFETSNLP
                     HLGGLLDEVLSDEEEFYWNEQRVTNLKTALSIVRRMVEPGNTTTPRHQQLFADTNILM
                     IILRLTFFYGTPNSIRPHALLTIADMVRGSPKIQAQLGNIDVPYWDPALPQVVPSSDP
                     VVMPVLDLLLRWILFANSIHTFDIRTAALELVKAYLVGNPELQETFLCAQIDLYKKQA
                     EVLSTADQRTSIVAVLLGYDPHADLNPFKLFFSVDLLLFLFKSEDGNAKLRDLFRGIQ
                     DGDSAAGEEVLSSVQTVVELSVASISSKESRIPISYLSFLIVLLFEDFHTVNEFLSND
                     SNVKSLLNLVPVAQDEGITVKCLVVMLLGVAYEFCTSSSPLPRAQLYESLVATIGVDD
                     YTSKIKQFKECSLFKEVVDSYFDPTFDETGLPKIYFSTYFSELFRENSYRIQSALSRS
                     PDIDPNGKISFEAFEELQQRFTTVNKELCELSSSSMEEIHKLELDLRKCQEQYKQLMK
                     AKQESDTQVSDLDEKLAQLKTQLDEANSKVEDLSTKKTTLEAAKADCLKKLASHEGQV
                     NSLKNRTTQLEKQLATVSEQKSTAEAGINKMNRELFNLTKEKDSLTAVMNKLQKEGEK
                     KLQEAEKEKVRITQLLSQRDRDIENLRNELQDQGTQKKKLEDEHAGLLKEIADLKSQC
                     ASQDSLIPKLKEKLKTLAESLKDTQNEHATLQKQVGNIQATSHAEITQLNAELQKLKD
                     ENVILISRKDELTQELEKLQAQTAAGEKQTSDIALLNTQKSELSAKLSRAEKELVNQK
                     AKAEGLFQERAELKDKLNTSEKQLQESSQKLSNAQSELNEIRSRLKANEHDLITSRQE
                     AEKLKKQNQQQSSKKDIHKLDELSKEADSYKAQVSKLSAELESTMGQLQKSSVEQTDR
                     IENLIKENKDLNTTIATLEKEKKAQVVVNAHQENARANNKAVVDNKQKAKSQPATPLV
                     NSKVQELEEQLEALQRKCSEMETLQKEVKELKENATQLESERDDLMLLVSDLDEKNQK
                     YRSRLEELGHPVSSDEEDESEIDDNDEDED"
     gene            <721434..>722048
                     /locus_tag="AGOS_AER046W"
                     /old_locus_tag="AER046W"
                     /db_xref="GeneID:4621108"
     mRNA            <721434..>722048
                     /locus_tag="AGOS_AER046W"
                     /old_locus_tag="AER046W"
                     /product="AER046Wp"
                     /transcript_id="NM_210260.1"
                     /db_xref="GeneID:4621108"
     CDS             721434..722048
                     /locus_tag="AGOS_AER046W"
                     /old_locus_tag="AER046W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL059C (RAD59)"
                     /codon_start=1
                     /product="AER046Wp"
                     /protein_id="NP_984906.1"
                     /db_xref="GeneID:4621108"
                     /translation="MSDYTNVSWDNVTYYGGNGVALDELELKVSWHNRPASSWSVRRI
                     GALQHKIEQYTFKIYHVNRYGKHSLSQVIPTHVLIQFANEAFGYNGWSSAVEEVLITD
                     VKQRERVRDGAAIELYTVTAEARVKLTLQDGTNTEATGLSKITLPSKGDAYGKAKKEA
                     SADALKRCLLSFEGIVIEHEQKVASNYYTDGEFGSRKAGDKRDR"
     gene            complement(<722152..>726126)
                     /locus_tag="AGOS_AER047C"
                     /old_locus_tag="AER047C"
                     /db_xref="GeneID:4621109"
     mRNA            complement(<722152..>726126)
                     /locus_tag="AGOS_AER047C"
                     /old_locus_tag="AER047C"
                     /product="AER047Cp"
                     /transcript_id="NM_210261.2"
                     /db_xref="GeneID:4621109"
     CDS             complement(722152..726126)
                     /locus_tag="AGOS_AER047C"
                     /old_locus_tag="AER047C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR384C (IKI3)"
                     /codon_start=1
                     /product="AER047Cp"
                     /protein_id="NP_984907.2"
                     /db_xref="GeneID:4621109"
                     /translation="MRNLVSLNKGSLQPSSEAHPNLGLYASCFDTLSDSVTCVLGAAD
                     VGAIVVHQYMKSGAVRELASFFTQDYEDELVSFAHFADVNQLVFVFAHGDIMMATYGD
                     EGAGLDATVVEIVGSIEDGIAAAEWSHDEETLALVTGGRSVVLLSRQFEPVADIGLEL
                     DDLKLSKNVTVGWGKKETQFRGKGARAMEREALQSLKASGLVGNELRDPTMPYMVDSG
                     AITELDPRTVGISWRGDCEYFVVSTIETVQDPDDDSATLERRALRVYSRHGKLDSASE
                     PVDGLEHALAWRPQGSLIASIQRKVNVPGNESLDLVFFERNGLRHGEFETRLAIDERI
                     KSLAWNASSDILSIALEDRIQLWTSKNYHWYLKQELYTECTKFVKWHPEKDFTLMYGD
                     GDTVNVVDFAYKMIRGPTFEPNDCGMTVVIDGRTVNITPFAMANVPPPLSYRDFDAPD
                     NVLDAAVGLSNTVFAAVTREALVVASIESLANMKSGRHPIIASTFQKHLFATELDTIR
                     QVAFINDSVVGILLDSGQLSRIALVNIQDPIQPELIKVVDTYTKVVLVKSSFDYSTLV
                     YETRDGTVVQLDAEGGTVEITKFPQLVNDFCVKRILTDGKTEWQPAESKLVAFGLTSS
                     GKLYADSVQLASAVISMDITDELLLFTSAQHYLQFVHLNTPEFKPLPTLEGDIMDERI
                     RSIERGSILINIIPSKAAVVLQAPRGNVETIYPRIMVLAEVRKYIGLKRYKDAFVICR
                     THRIHLDILHDYAPDLFYANLKTFVDDIERVDYLDLFISCLVEEDVTVTKYKETLNMS
                     TDAVFDVAPPPPTEMEEYIKKKSFNPLKSKVNKICQVLLEVLLGTAQYKAKYLQTIVT
                     CYACQNPPKVKDALALISQLRDEEAKDSTVTYLCFLQDVLFVYKEALALYDVNMALLV
                     AQKSQMDPREYLPFLQNLNEQEPLRRKFMIDDHLKNYEMALTHLVGIDEPTGAVSDET
                     REYIQQHELYKKALDLYRYNTQLQNSVYAIYGAHLASKQEYNEAGIIYELLGNWEKAM
                     EVFTMGNKWSPALAIASQHFPDRVLDIATELVDSLQYEHRYAEAAHVELKFMKNVRSA
                     VSLYCKAYDYEQGILLCITEGTPELINELVDPALGDGFSVLAELLADCKGQINSQLRR
                     LRELRAKKEEDPYAFYGQETEEADDVSIAASETSTKESFFTRYTGKTGGTAKTGASRR
                     TAKNKRREERKRARGKKGTIYEEEYLVKSIGRLIDRLKQTLPDGVKLVDALLRRNMRE
                     QAYQVQKGFVSMEALLKANIVEIYNISEKDRERIDDNGNVYQLPVIPVPEIPAFPVRQ
                     IIDY"
     gene            complement(<726236..>726619)
                     /locus_tag="AGOS_AER048C"
                     /old_locus_tag="AER048C"
                     /db_xref="GeneID:4621110"
     mRNA            complement(<726236..>726619)
                     /locus_tag="AGOS_AER048C"
                     /old_locus_tag="AER048C"
                     /product="AER048Cp"
                     /transcript_id="NM_210262.1"
                     /db_xref="GeneID:4621110"
     CDS             complement(726236..726619)
                     /locus_tag="AGOS_AER048C"
                     /old_locus_tag="AER048C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR385C (SWC7)"
                     /codon_start=1
                     /product="AER048Cp"
                     /protein_id="NP_984908.1"
                     /db_xref="GeneID:4621110"
                     /translation="MEYKYNVTLLLLQVVLHRQQELAHQDKTLSQISLLREPVVDTAV
                     LERFSAHRVVRLYAPELCGLRLEELQAVVREVFARGLAGSAEDTPVTLITLANHYYRL
                     RVQELELQELPKLKELMESAAGLRT"
     gene            <726846..>729475
                     /locus_tag="AGOS_AER049W"
                     /old_locus_tag="AER049W"
                     /db_xref="GeneID:4621111"
     mRNA            join(<726846..726849,726906..>729475)
                     /locus_tag="AGOS_AER049W"
                     /old_locus_tag="AER049W"
                     /product="AER049Wp"
                     /transcript_id="NM_210263.2"
                     /db_xref="GeneID:4621111"
     CDS             join(726846..726849,726906..729475)
                     /locus_tag="AGOS_AER049W"
                     /old_locus_tag="AER049W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR386W (VAC14); 1-intron"
                     /codon_start=1
                     /product="AER049Wp"
                     /protein_id="NP_984909.2"
                     /db_xref="GeneID:4621111"
                     /translation="MDKSVIKGLNDKIYEKRKAAAQQLEKVVRDCVANEDHEMIDRII
                     EELYRDYAYALHQPMARNAGLMGLAAAAIALGNKYVAEYLNKILPPVLACFGDQNDQV
                     RFYACESLYNIAKIAKGDILVYFNEVFDVLCKISVDNDTSVKGAAELLDRLIKDIVSE
                     CASTHVAAVNHDPKDIPTATTTDPQTGDVLQVDQNIYDKERPVLAFSLPDFIPLLSER
                     IHVLNPDTRMFMVSWLQVLESIPDLELITYLPHFLPGLFTYLGDTHNDVRMVTLALLN
                     SLLHEVERVTQLQASLLVQELQYQQQLDDVPGKKPADGALITERKKSLMNQLEQLSAT
                     ENINELTKDNEDASSQNNLPDSMTSSTDPVKVPELRNGEVYHPGQDVHLDFPKIIEIL
                     INNLSCTEPEIQSVVLNWLQTILRISPNNILPFLSKILSVLLKILSDSDPHISEMAKQ
                     VNARLIELTTKYDTTDKINYGPIVNILTLHFLDSNVTTKIACLDWLILTYSKNPQQLI
                     DHDESTHLTVLKSLSDKDPRLISKALELISDLCNGSNEAYIKKFLKNLLKLFKENDKL
                     LKTRSNYIIRQLCAKLSPERIYKTLSSIVEMDDDISFVRMVIYSLTTNLITSPELSSL
                     RKKLRSGEDWAFFVTLFKSWSYNPISLVSMCLVSENYELAYSVLQNYVDYDLTVNDLL
                     QIDILVQFLESPVFTRLRMQLLEPERYPYLHKCLYGILMVLPQSKAFEILNARLSSVS
                     RLSTSVYNSNNTQKATESAIRASAQKKTQYQVLLDHFKSICEKERQNTPKQPTHDDHM
                     LGLNDIFSTQSGSENKLKIHLSNGDENINGATDCDSVVFTGRVGANTASLAGIEGIGG
                     S"
     gene            complement(<729512..>730699)
                     /locus_tag="AGOS_AER050C"
                     /old_locus_tag="AER050C"
                     /db_xref="GeneID:4621112"
     mRNA            complement(<729512..>730699)
                     /locus_tag="AGOS_AER050C"
                     /old_locus_tag="AER050C"
                     /product="AER050Cp"
                     /transcript_id="NM_210264.1"
                     /db_xref="GeneID:4621112"
     CDS             complement(729512..730699)
                     /locus_tag="AGOS_AER050C"
                     /old_locus_tag="AER050C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR387C (REH1)"
                     /codon_start=1
                     /product="AER050Cp"
                     /protein_id="NP_984910.1"
                     /db_xref="GeneID:4621112"
                     /translation="MSTIMYTCNACMIQFKSSDLQRYHMKTEWHRYNLKRRIADLPPI
                     DADIFTQKMQISEREKRLHEVDEFGFPVLKPVGHSGGRRRNTNGAILRGRRDGDGKKK
                     APFRSDSPALSIASQMSKISVRSTDYDEHSASEYAFTDESQAESEDITDKEDAGEDGE
                     ERPDVVDCVYCGVHCNTVAENLDHMSVAHGLYVPERRYLENAAGLINFLIERIVISKR
                     CMCCNFHGSSLESIRAHVASKSHCRIPYESKEERATIAAYYNFNEDQVADNTAVSDSE
                     SDPDLSIEDTEEEDINSNYTIAHVDDTGVELTLPTGTRLGHRSMRRFYRQNLALPSTQ
                     ADGTRTLAVVDRRFAGGISANEYARNMKHSQLLASRAQSKNIKRQAKRDNFQKHYRDE
                     LLQ"
     gene            complement(<730981..>733314)
                     /locus_tag="AGOS_AER051C"
                     /old_locus_tag="AER051C"
                     /db_xref="GeneID:4621113"
     mRNA            complement(<730981..>733314)
                     /locus_tag="AGOS_AER051C"
                     /old_locus_tag="AER051C"
                     /product="AER051Cp"
                     /transcript_id="NM_210265.1"
                     /db_xref="GeneID:4621113"
     CDS             complement(730981..733314)
                     /locus_tag="AGOS_AER051C"
                     /old_locus_tag="AER051C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL060W (TSR1)"
                     /codon_start=1
                     /product="AER051Cp"
                     /protein_id="NP_984911.1"
                     /db_xref="GeneID:4621113"
                     /translation="MAGHSHRSSVKKGHKTFKSKHASKGALKRLHKGKVEQETAAGVK
                     GVRVVRKQDRKNAAKQLRQQKISSTSQLRRLFEGANGAAKIVAVIPLTPDVDAGDIVQ
                     RLVQGCDEDVSGMQTPCVRDFRIGKFRSTLKVIVPDMGSFLSIMDAAKVADYVVLGLS
                     GTSEVDPVFGEQVIRVLELQGIASYMGVVSNLSKVHPKEKFQLDVKQSLESYFRHFFP
                     TEDRIYNLEKASDSLNAQRILCQQYPRGVSWRDSRGYLVAGSVDYVESGPDAGELVVD
                     GTVRGVGLHPNRLVHLPGLGDFQVSAIEKIAASSRSSEDNGEGSGVFLPDAQQDTLEE
                     FAPHDLDMEEWDDNQFEYDNLTSARYDDHGFLPGREQSLERAKVPKGTSEYQARWYVD
                     NVVDVSDDDAEDEMELEMGSNEVGTVADDTMMDAEDAQSDDASEADMATMVDEMFVDL
                     SPEEEERQLQEYRAMEKDDLEFPDEIELDPSESAIERLKRYRGLKNLHNCVWNVDEQD
                     PHCPSEWKRMLRIGSYKNLKARTNKSVAAEASVVAGDKVRLRIRFPKHLLERLKDPRI
                     APFVVYGLLPHEHKQVVANLSIQRWEEFEDPVPSGESLIVQYGVRRYTIQPQFSSASN
                     VPNNVHRFERFLHHNSASIATCMLPLDLTQSPAIYFKENPSDPKGLTFVGHGTFLNAD
                     HTRILAKRIILTGHPFKFHKRVVTVRYMFFRPEDVEWFKSIPLFTKSGRSGFIKESLG
                     THGYFKATFDGRLSAQDTVAMSLFRRVWPKTSLPWFY"
     gene            <733644..>733985
                     /locus_tag="AGOS_AER052W"
                     /old_locus_tag="AER052W"
                     /db_xref="GeneID:4621114"
     mRNA            join(<733644..733653,733810..>733985)
                     /locus_tag="AGOS_AER052W"
                     /old_locus_tag="AER052W"
                     /product="40S ribosomal protein S29"
                     /note="5'UTR intron"
                     /transcript_id="NM_210266.2"
                     /db_xref="GeneID:4621114"
     CDS             733815..733985
                     /locus_tag="AGOS_AER052W"
                     /old_locus_tag="AER052W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR388W (RPS29A) and YDL061C (RPS29B); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S29"
                     /protein_id="NP_984912.1"
                     /db_xref="GeneID:4621114"
                     /translation="MAHENVWFSHPRNYGKGSRQCRVCASHSGLIRKYGLNICRQCFR
                     EKANDIGFHKYR"
     gene            734311..734501
                     /locus_tag="AGOS_AgSNR34"
                     /old_locus_tag="AgSNR34"
                     /db_xref="GeneID:4621115"
     ncRNA           734311..734501
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR34"
                     /old_locus_tag="AgSNR34"
                     /product="AgSNR34"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR34; start and end coordinates are
                     approximate; similarity is partial. In synteny."
                     /transcript_id="NR_149377.1"
                     /db_xref="GeneID:4621115"
     gene            complement(<734590..>737631)
                     /locus_tag="AGOS_AER053C"
                     /old_locus_tag="AER053C"
                     /db_xref="GeneID:4621116"
     mRNA            complement(<734590..>737631)
                     /locus_tag="AGOS_AER053C"
                     /old_locus_tag="AER053C"
                     /product="AER053Cp"
                     /transcript_id="NM_210267.2"
                     /db_xref="GeneID:4621116"
     CDS             complement(734590..737631)
                     /locus_tag="AGOS_AER053C"
                     /old_locus_tag="AER053C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR389C (STE23)"
                     /codon_start=1
                     /product="AER053Cp"
                     /protein_id="NP_984913.2"
                     /db_xref="GeneID:4621116"
                     /translation="MIFLSSVQLRRFYTSHFIHRHLQVQSATRRSNLSPLFYSRSMSN
                     NISGVSGLRELAATLEQPLLDDRKYRYIELPNHLRVLLVHDKNTDKSAASLDVNVGAF
                     EDPEDLPGLAHFCEHLLFMGSKKFPNENEYASFLSKHGGASNAYTASQNTNYYFHVNH
                     ENLYDALDRFSGFFSCPLFNESSTEKEIKAVDSENKKNLQNDMWRLYQLGKSLTNPIH
                     PYHKFSTGNFETLWSIPRSKGVNVRDELLKFYNRSYSANLMKLVILGREDLDTLAQWA
                     YELFKDVPNHGTKVPEYHAQAFTPEHLMKVIKVKPVKNLKSVEISFVVPDMDKHWQVK
                     PARYLSHLIGHEGTDSLLAYLKNNSWAIDLSAGATTVSEGNAYFSVNVDLTDEGVVQY
                     EAVICAVFQYINMLKEVLPQEWVFTELKDIGEAHFKFKQKGNPAATVSSLSKNLQKAY
                     LPVQVILNTSLMRQYEPGLIMEYLNSLTLENSRVMLISQKVETNLSERWYGTEYSVAD
                     YTKDFVSKIRSLGANPALKIPAPNEFIATRFDVHKDEGNVKPLLEPFLLRDDRCGKLW
                     YKKDDMFWVPKGYIYISMKLPHTHSSIVNSMLCTLYVDHINDSLKDLAYNAECAGLEI
                     SLRKTNQGLDLSLSGYNDKLLVLLARFFEGIQKLFLREERFMVLKQRLIQKLHNHLYD
                     TPYTQIGRLYSSLINERSWTTQEKLDITEQLTFDHLANFVPTIYEQMYFELLVHGNFS
                     HEEALEVYDLVSSLVPNEIRNSEGRNSKLRSYFIPAGGAYHYETALADKENVNSCIQK
                     VIQLGAYSELLSAKGSLLAQMVNEPCFNTLRTEEQLGYVVFSSKLNTHGTVNLRILVQ
                     SERSSSYLESRIDNFLSKFGSTLEMMSDAEFEKHKDALCKTLQQKYRNLGEENDRYVT
                     CIYLGDYNFLYKERKAQLVRQLTKKEMLDFYQQTICSKQAASLVVHMQAQAGVQDSPA
                     DKVDGYPTGNAITDVGAFKSQLYLAPIRAPIKKFEVTTPKL"
     gene            <737957..>738211
                     /locus_tag="AGOS_AER054W"
                     /old_locus_tag="AER054W"
                     /db_xref="GeneID:4621117"
     mRNA            <737957..>738211
                     /locus_tag="AGOS_AER054W"
                     /old_locus_tag="AER054W"
                     /product="AER054Wp"
                     /transcript_id="NM_210268.1"
                     /db_xref="GeneID:4621117"
     CDS             737957..738211
                     /locus_tag="AGOS_AER054W"
                     /old_locus_tag="AER054W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR390W (ECM19)"
                     /codon_start=1
                     /product="AER054Wp"
                     /protein_id="NP_984914.1"
                     /db_xref="GeneID:4621117"
                     /translation="MARIRAYELITIGIVSAFGIYSGVNFFEPIVVNQLRQDGHLRQD
                     VEVPEFDADGNLLEQKLGAKTPAAPAPVSDGSATDGSKSH"
     gene            <738431..>740272
                     /locus_tag="AGOS_AER055W"
                     /old_locus_tag="AER055W"
                     /db_xref="GeneID:4621118"
     mRNA            <738431..>740272
                     /locus_tag="AGOS_AER055W"
                     /old_locus_tag="AER055W"
                     /product="AER055Wp"
                     /transcript_id="NM_210269.1"
                     /db_xref="GeneID:4621118"
     CDS             738431..740272
                     /locus_tag="AGOS_AER055W"
                     /old_locus_tag="AER055W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL063C"
                     /codon_start=1
                     /product="AER055Wp"
                     /protein_id="NP_984915.1"
                     /db_xref="GeneID:4621118"
                     /translation="MAKSRKKLRSNKARVNPILRDAAKDAQVRSKRIQPLMQQLQSAA
                     VNDRQMALGSISVLCEDAHMRELFLREKLLQEVMSRLLTDDNTEIVVEAYGLLRNLCL
                     EQGYDVAIYMWRSDIWVSISAGLEKLVESLSSLSSNAKASIESRRLLFDFGDNLISLV
                     VALADGASEIQEQLVAEHLPQLFHVITQILKYGFIVGDDSKTCTLKITTQLFNSVLDL
                     IYDFASDSAAFMDALHGHPDLSQFVQTLPELNILNGSELTQVLVQGILLQLLDESITF
                     QQAESILDRTCAAIQPIDLALMKHTLNTAEQEKELSSLKNTEEFSSMIRKQSDNTKKA
                     MMQMQSLELSLEIVTAVTELLASQVEQRREPLPGTLVNILKQVLPDFFNVLAEDFTSH
                     VLMAWNNLLWLFLSLEINVFELANEPWKQLWSCIYQAGNVDPRVRFGKLSCVWALLKA
                     VQLQANPTEYLDLLQVATVDFVQSIRREYDNAGDAGPEDQLDLRLRCCHVLFVLATFQ
                     QHIDVNREVGLFFLHILSQKDTHPQLLVEVADHFIDIYSDAAFDYDHPNFVGLGFLDT
                     LRKDIVPNLRAAFKFVDKNKDPQLKAECHELFTTLGSFVAYKEGERS"
     gene            complement(<740412..>740943)
                     /locus_tag="AGOS_AER056C"
                     /old_locus_tag="AER056C"
                     /db_xref="GeneID:4621119"
     mRNA            complement(join(<740412..740847,740906..>740943))
                     /locus_tag="AGOS_AER056C"
                     /old_locus_tag="AER056C"
                     /product="AER056Cp"
                     /transcript_id="NM_210270.1"
                     /db_xref="GeneID:4621119"
     CDS             complement(join(740412..740847,740906..740943))
                     /locus_tag="AGOS_AER056C"
                     /old_locus_tag="AER056C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL064W (UBC9); 1-intron"
                     /codon_start=1
                     /product="AER056Cp"
                     /protein_id="NP_984916.1"
                     /db_xref="GeneID:4621119"
                     /translation="MNSLCLQRLQEERKKWRKDHPFGFWAKPTKKEDGSMNLQKWEAG
                     IPGREGTIWKDGVYPITIEYPDDYPSKPPRVKFPAGFYHPNIYPSGTVCLSILNEDQD
                     WKPAITMKQILLGVQDLLTSPNPNSPAQEPAWRAYAKNLQEYEKKVLEQARRYAK"
     gene            <741145..>742083
                     /locus_tag="AGOS_AER057W"
                     /old_locus_tag="AER057W"
                     /db_xref="GeneID:4621120"
     mRNA            <741145..>742083
                     /locus_tag="AGOS_AER057W"
                     /old_locus_tag="AER057W"
                     /product="AER057Wp"
                     /transcript_id="NM_210271.1"
                     /db_xref="GeneID:4621120"
     CDS             741145..742083
                     /locus_tag="AGOS_AER057W"
                     /old_locus_tag="AER057W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL065C (PEX19)"
                     /codon_start=1
                     /product="AER057Wp"
                     /protein_id="NP_984917.1"
                     /db_xref="GeneID:4621120"
                     /translation="MTEAVDEYDDLDAYLDDGGKPEKEAEKKTEEEQKHGEQQQTRKS
                     GKFGAEQTGGTDAEVAEMINDLQTQFQQMLRPETDGADKDTVDNFRQLLETLGQAAPE
                     AAGAGAADAGAAGKESGQGSEDFKDIISNALGRLKVNSSKIDSKLEQEKKAQTSDDLL
                     SQLLEQMAGVDEGDGDGTMDGAILNILNQMSSKEVMYQPMKEMQLEFVQWMQGNAELE
                     EHREKIATYRQQLDTVNAIVALYERADYSNEKYRGEITDLIDKLEQLGDSPVNKGFSN
                     EGNQELNDLAKMLEVDGDDPSLGNIDKEIQETCKQQ"
     gene            <745294..>746022
                     /locus_tag="AGOS_AER058W"
                     /old_locus_tag="AER058W"
                     /db_xref="GeneID:4621121"
     mRNA            <745294..>746022
                     /locus_tag="AGOS_AER058W"
                     /old_locus_tag="AER058W"
                     /product="AER058Wp"
                     /transcript_id="NM_210272.2"
                     /db_xref="GeneID:4621121"
     CDS             745294..746022
                     /locus_tag="AGOS_AER058W"
                     /old_locus_tag="AER058W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR390W-A (CCW14)"
                     /codon_start=1
                     /product="AER058Wp"
                     /protein_id="NP_984918.2"
                     /db_xref="GeneID:4621121"
                     /translation="MRSTTFVSSAALAVALYASQAVATPPACLLACAGKVSKESSHPL
                     NDVAHFCTKESDAMQKCFSSICPEGKAEGALSAFKANCAEHGKPVSSASSSSAASSST
                     AASSSAGSSSASATASSSAEKSSAAPSSSASSGAKSSAAPSSSAAPSASASASPASSA
                     APVASSAAPSASSAAPSTTVLTPTGTGHAASSATPSVPVVSASSSSASDVPPPIDHPF
                     EGAANKVKAGMSLAGGLALAGLLL"
     gene            complement(<746321..>747613)
                     /locus_tag="AGOS_AER059C"
                     /old_locus_tag="AER059C"
                     /db_xref="GeneID:4621122"
     mRNA            complement(<746321..>747613)
                     /locus_tag="AGOS_AER059C"
                     /old_locus_tag="AER059C"
                     /product="AER059Cp"
                     /transcript_id="NM_210273.1"
                     /db_xref="GeneID:4621122"
     CDS             complement(746321..747613)
                     /locus_tag="AGOS_AER059C"
                     /old_locus_tag="AER059C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR392C (ART10)"
                     /codon_start=1
                     /product="AER059Cp"
                     /protein_id="NP_984919.1"
                     /db_xref="GeneID:4621122"
                     /translation="MTTKITLKLNPPHNGRYYTEDDIISGSVVLKLAKATAVKQLRVI
                     LKGTSQTMTLAEADRHSSRLPQDPQTQYTKEKSTHILFHQGVQLLPPTGVEDSIKLGQ
                     DTYKYGFEFRLAGGPKCVSGHQATSHSFLEDKAHEHYGEQLPPSFNDRHEGGGVTTEE
                     LFFYNLGKVRYTVRAEADVATGNKWAPKSPLHDTMVISFLPLQCQAYVENACTSAGSD
                     DTLVNYTALPRTYRAAADVVLSDGLSVTPEVRSNALAYVHRLDYLFRESSGKFGNIFM
                     VFSGDPTKHSVKLTRLVLSLHEKVSFTANGHTNKNLSQLKLMDTPLDDELQLRDLHIL
                     EDGSREGKLNLGDHPVLSRLRFNEEDYIHRGNTLFSFTTCNIKREYYFQLDLHWKVDA
                     TAVRSEIIVDPVTVYAESAPPAFEGLPPYPEKPPKYEA"
     gene            <747947..>748765
                     /locus_tag="AGOS_AER060W"
                     /old_locus_tag="AER060W"
                     /db_xref="GeneID:4621123"
     mRNA            <747947..>748765
                     /locus_tag="AGOS_AER060W"
                     /old_locus_tag="AER060W"
                     /product="AER060Wp"
                     /transcript_id="NM_210274.2"
                     /db_xref="GeneID:4621123"
     CDS             747947..748765
                     /locus_tag="AGOS_AER060W"
                     /old_locus_tag="AER060W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR393W (ATP10)"
                     /codon_start=1
                     /product="AER060Wp"
                     /protein_id="NP_984920.2"
                     /db_xref="GeneID:4621123"
                     /translation="MVIWRRYLSGTAQPLVFKKMNKALAQAAPREHVVRRLEQPVGMP
                     QPPTAATRYVEGNSMLDMFSEEKTSRRAAELAAEFSKSGLYDAATFRKTNGRVFLPPA
                     SYWRAEHARYFPHLGGRTLTGARGSVEDVLAGKVSVVKVFSCETGEGLASSYFRHEGH
                     DYLREDDVAPAQIVEISLTESWIKDWLVRLMAGRLRSLVPAARHERYFICRRAQLPFT
                     VRESLELGNLYTGYVLVVDPQLKIRWMACGGAEKRDAELLWKCVRGVQRECAAV"
     gene            complement(<748897..>750174)
                     /locus_tag="AGOS_AER061C"
                     /old_locus_tag="AER061C"
                     /db_xref="GeneID:4621124"
     mRNA            complement(<748897..>750174)
                     /locus_tag="AGOS_AER061C"
                     /old_locus_tag="AER061C"
                     /product="AER061Cp"
                     /transcript_id="NM_210275.1"
                     /db_xref="GeneID:4621124"
     CDS             complement(748897..750174)
                     /locus_tag="AGOS_AER061C"
                     /old_locus_tag="AER061C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL066W (IDP1)"
                     /codon_start=1
                     /product="AER061Cp"
                     /protein_id="NP_984921.1"
                     /db_xref="GeneID:4621124"
                     /translation="MLGRGRMLGRRLFSGSRAAARIRVKTPVVELDGDEMTRIIWERI
                     KQQLVLPHVDVELKYYDLSITSRDATSDQVTVDAAHAIKQYGVGVKCATITPDEARVR
                     EFGLKKMWRSPNGTIRNILGGTVFREPIVIPRIPRLVPGWEKPIIIGRHAHGDQYKAT
                     DAVVPGAGTLDLVFRPADGSAPTSLHVYDFAGPGVALAMYNTEESIRGFAHASFRLAL
                     AKQLNLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEFERLGIYYEHRLIDDMVAQMV
                     KSKGGFIMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHFR
                     QHQAGKETSTNSIASIFAWTRGLAKRGELDNTPDVVNFAHALEAATTNTVQLDGIMTK
                     DLALACGRSDRSAYVNTNEFIDAVEARLKKELA"
     gene            complement(<750338..>750553)
                     /locus_tag="AGOS_AER062C"
                     /old_locus_tag="AER062C"
                     /db_xref="GeneID:4621125"
     mRNA            complement(<750338..>750553)
                     /locus_tag="AGOS_AER062C"
                     /old_locus_tag="AER062C"
                     /product="AER062Cp"
                     /transcript_id="NM_210276.1"
                     /db_xref="GeneID:4621125"
     CDS             complement(750338..750553)
                     /locus_tag="AGOS_AER062C"
                     /old_locus_tag="AER062C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR395C (COX8)"
                     /codon_start=1
                     /product="AER062Cp"
                     /protein_id="NP_984922.1"
                     /db_xref="GeneID:4621125"
                     /translation="MFQQVTRLASRRAFSSTVRRQAHYEEGVYSNIPMKIHNRRIPYA
                     VLHFGFFALGFSLPFVAVYVQFKKAGL"
     gene            <750765..>750947
                     /locus_tag="AGOS_AER063W"
                     /old_locus_tag="AER063W"
                     /db_xref="GeneID:4621126"
     mRNA            <750765..>750947
                     /locus_tag="AGOS_AER063W"
                     /old_locus_tag="AER063W"
                     /product="AER063Wp"
                     /transcript_id="NM_210277.1"
                     /db_xref="GeneID:4621126"
     CDS             750765..750947
                     /locus_tag="AGOS_AER063W"
                     /old_locus_tag="AER063W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL067C (COX9)"
                     /codon_start=1
                     /product="AER063Wp"
                     /protein_id="NP_984923.1"
                     /db_xref="GeneID:4621126"
                     /translation="MSAIAPITGSLKKRIMKDIAVGMGLGTVLGSYWWWGFHKPKIAA
                     RENYYTQLAEQKAAEE"
     gene            complement(<751009..>752955)
                     /locus_tag="AGOS_AER064C"
                     /old_locus_tag="AER064C"
                     /db_xref="GeneID:4621127"
     mRNA            complement(<751009..>752955)
                     /locus_tag="AGOS_AER064C"
                     /old_locus_tag="AER064C"
                     /product="AER064Cp"
                     /transcript_id="NM_210278.1"
                     /db_xref="GeneID:4621127"
     CDS             complement(751009..752955)
                     /locus_tag="AGOS_AER064C"
                     /old_locus_tag="AER064C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR396C (VPS33)"
                     /codon_start=1
                     /product="AER064Cp"
                     /protein_id="NP_984924.1"
                     /db_xref="GeneID:4621127"
                     /translation="MSVDLNTRKLEKQVKERLFEQLNQCTRQDPILLLIQPSLVPYIN
                     ALCTFSELTKHTRVNVIMTLDESCLGNLLSMDVGLTKLVVLLDVRSDLKVPDQLHEII
                     RGLSLRKLDVISASWKEHTEIEEAKVFPDYLQLQLDEVALRVHKWCMLPVCYLDDDFL
                     NCNVLMTSDGQNLYYPATPSLAGTTRNVLVNHLKESLVSLCLENDITITHSVALGPNS
                     KRLVDALQTDLRDLVTQEAQAQQKVLYGKRHSGLQTDLIVFERQIDNMTPLLSQLTYV
                     GMLNDVFTFTADSKLQDLRVGDVLENPEDQRAVHLDYKEDGVWNELKYVNFGAVGTKL
                     NTWAKELKGQYDARHQVETVGEIKRFVSGLGDLQQRQKLLKLHTGISSKIMEHVNHGA
                     IFQQLIETEQDFCMNNLDNRASCERILDLMYSGAPKDVVLRLCCLLSLTKNGIRDREF
                     LTLKTEILDAFGVEVLPELERLTAHGLFLSKTVFPARSAVKDFQTLAAWYDLCPQLDR
                     PIDPLDPREPTFTLCGVIPLSVRILQSLYDRSVALQHYSSQQPFVISRAPSLARLEPL
                     FAAQYGRDTAHQRVWDRSADPATIAVGAPGRAPDLALLVFVGGVTPAELATVAFLQRA
                     LRAKNVRKRFVVLADGLLRAAPPV"
     gene            complement(<753168..>755492)
                     /locus_tag="AGOS_AER065C"
                     /old_locus_tag="AER065C"
                     /db_xref="GeneID:4621128"
     mRNA            complement(<753168..>755492)
                     /locus_tag="AGOS_AER065C"
                     /old_locus_tag="AER065C"
                     /product="AER065Cp"
                     /transcript_id="NM_210279.2"
                     /db_xref="GeneID:4621128"
     CDS             complement(753168..755492)
                     /locus_tag="AGOS_AER065C"
                     /old_locus_tag="AER065C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR397C (AFG2)"
                     /codon_start=1
                     /product="AER065Cp"
                     /protein_id="NP_984925.2"
                     /db_xref="GeneID:4621128"
                     /translation="MAPKASGGVGSGTKKKAGSDTNSEKKTSSKPKLPALYITRPVGN
                     DITKRSTVAVLSPEVLQASEFRVGEICLVAKEGQRGVAAIIQSGSEDQPAAVVQLAAP
                     LRAVGGVLLGDRVTVRKLPVQPSYATNVTVASLEGHVLGSGTKAIEKLLNDAGIIMPG
                     QIFKDVLLDESSGLRGNIVVTDINSNADLADEVAKLAVTDSADVDVCLSPPGLFLKGK
                     TTVFYSQSHQVHQRFRLPQRINYQSVGGLSKEIQQLKETIEAPLCDGEFYHECGVEPP
                     RGILLHGPPGTGKTMLLRCVANENDAHVQIINGPSLTSKFLGETEERLRAIFDEARQF
                     QPSIILIDEIDSIAPSRDSDDAGEAESRVVATLLTLMDGVDSSGSIVVVATTNRPNKI
                     DPALRRPGRFNVEVEIGVPDAAARLEILMKQVSRMAESRRGFTDQDIAEIAAKTHGYV
                     GTDLSGLCALAVGKSKHRAVKQEIPLSQVKISLCDFEAALLEVKPSAMREIFLETPKV
                     YWSDIAGQDQLKREMEEVIELPLKGAEKLKRLRITPPKGILLYGPPGCSKTLTAKALA
                     TESGFNFFAIKGPEVLNKYVGETERTVRELFRKAKVAAPSIIFIDEIDELAKTRDEDA
                     GSSAAANVLITLLNEIDGVEELNGVVVVAATNKPHIIDSALIRSGRLDKHIYVAPPDF
                     EARLQILRNNTRTFGLDDPDAILKRLAEQTAHCSGAAVAQLCRDAAIAATREDYEGGN
                     VEERHFLEALPRLTRDVTPDVLLPYQTFAEKRGI"
     gene            <755657..>756337
                     /locus_tag="AGOS_AER066W"
                     /old_locus_tag="AER066W"
                     /db_xref="GeneID:4621129"
     mRNA            <755657..>756337
                     /locus_tag="AGOS_AER066W"
                     /old_locus_tag="AER066W"
                     /product="AER066Wp"
                     /transcript_id="NM_210280.1"
                     /db_xref="GeneID:4621129"
     CDS             755657..756337
                     /locus_tag="AGOS_AER066W"
                     /old_locus_tag="AER066W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL069C (CBS1)"
                     /codon_start=1
                     /product="AER066Wp"
                     /protein_id="NP_984926.1"
                     /db_xref="GeneID:4621129"
                     /translation="MVLVLPTIICKDAIKLFSAQAARKACKKKALELSNRPAVDEQSL
                     KLPKGCLQKDMVKLRNIFELMGGPQAGLRVVKAEELRKCLYIDRTIPINIDTMPAPVT
                     VTDLKIAGEKLLSGEIVAWRERIRKSVQSPYLVLPPFLSDNTKHPKLLEFFLKKAQLK
                     EIARVRTPALHIKAQMMRQYDRYVFCSMIGYFYLTNDRETMQRFLDESITKRLFRYIL
                     AEPQLSRY"
     gene            complement(<756351..>760199)
                     /locus_tag="AGOS_AER067C"
                     /old_locus_tag="AER067C"
                     /db_xref="GeneID:4621130"
     mRNA            complement(<756351..>760199)
                     /locus_tag="AGOS_AER067C"
                     /old_locus_tag="AER067C"
                     /product="AER067Cp"
                     /transcript_id="NM_210281.2"
                     /db_xref="GeneID:4621130"
     CDS             complement(756351..760199)
                     /locus_tag="AGOS_AER067C"
                     /old_locus_tag="AER067C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR398C (SKI2)"
                     /codon_start=1
                     /product="AER067Cp"
                     /protein_id="NP_984927.2"
                     /db_xref="GeneID:4621130"
                     /translation="MYLDSDITSKLSEYTQGWGNMASTATDDLDQLFASLRLLDEHSS
                     PRHKVPVPRHDTVNYQEQLKSKYASQSNVLSWPLLDLLQDVPQAAANGSKANAHGSGD
                     VYDYEDFVQLPEHISRMSYRFKRKGLRGEIASYKEEVDLVEVANANAANSLLLTRKVD
                     HRANAIKGSTSQLPFTPGGISMTTMKLQSNISETGVATSRLHRDADGLFDIPQGFDRG
                     IMLVDNPEEGAEQVVDLHSLDQVDTELANKQELEGIKKHKEQELAVGGTGSMLWKPAA
                     GAERNLADVDDLLPVGIEFGRTIHDRNKVPLKHEWAHVVNLSHTLENLDELVPNPART
                     WPFELDIFQKQAIYHLEQGDSVFVAAHTSAGKTVVAEYAIAMSTRNMTKTIYTSPIKA
                     LSNQKFRDFKEDFDDVSVGLITGDVQINADANCLIMTTEILRSMLYKGADLIRDVEFV
                     IFDEVHYVNDQDRGVVWEEVIIMLPSHVKFILLSATVPNTFEFADWIGRTKHKNIYVL
                     STPKRPVPLEINVWAKDTMIPVINENREFLAKNFSKHADLLANSGSSNTAKKTASTRG
                     NKAPTRGDKANKVITKGSRGVGAKGSNRSSFFKRDGPNKQTWPRLVNYLRSRDLLPVV
                     IFVFSKKRCEDYAGFLEGTDFSTAKERSQVYMFIEKSIARLKKEDRDVPQIQQVRSLL
                     ERGIAIHHGGLLPIIKELIEMLFAKGFVKVLFATETFAMGLNLPTRTVVFSEIEKHDG
                     NGLRYLSPGEFTQMAGRAGRRGKDKVGTVIVMSYNHPLDVTSFKDVTLGVPTRLKSQF
                     RLTYNMILNLLRIEALRVEEMIKYSFGENTKQNLLPEQELKVKALREKLNESPDVNCM
                     HCSQILDKAVELTTRHRDSIRGIITEANSRNILFGLLRQGRLIVYRDSDNNAKLGFVF
                     RNDASSNRCVVVSFTKPCCLSDGKPNNLPYLTICRRFVKKAFQPLKLAPATMESVPFE
                     NIELISRYHLNVSLADLLNGDQKAKDAFQEKIQTVLHIAPKLKPADMDKHITLKIQQH
                     LSDHATVVKEFMELDACKCPKFAEHFAVRYSKYKIEQEIADVVHLMSEQNLTLLPDYE
                     QRLAVLKECGFIDSSNNVLLKGRIACEINSGFELALTELILDNFLGDFEPEEIVALLS
                     AFVYEGRTKEEMPVVITPRLAKGKERIEQIYSQLMSTYETYQVPLTKDEAEFLEKKRF
                     AIMNVVYEWARGLSFKAIMQISPEAEGTIVRVINRLDEVCRELKTAAVIIGDSNLHMK
                     MTQAQELIKRDIVFAASLYL"
     gene            complement(<760666..>762573)
                     /locus_tag="AGOS_AER068C"
                     /old_locus_tag="AER068C"
                     /db_xref="GeneID:4621131"
     mRNA            complement(<760666..>762573)
                     /locus_tag="AGOS_AER068C"
                     /old_locus_tag="AER068C"
                     /product="AER068Cp"
                     /transcript_id="NM_210282.2"
                     /db_xref="GeneID:4621131"
     CDS             complement(760666..762573)
                     /locus_tag="AGOS_AER068C"
                     /old_locus_tag="AER068C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR399C (BDF1) and YDL070W (BDF2)"
                     /codon_start=1
                     /product="AER068Cp"
                     /protein_id="NP_984928.2"
                     /db_xref="GeneID:4621131"
                     /translation="MTEMEQPMLQQHTGVGNVHTAVGQSRTGGEGLALKDEAAVSAAT
                     TASSTLAEGPEEGGRAAAPPPEPDMTQLPAEPMPKHQQKHAQTSIKAVKRLKDAKPFL
                     QPVDPVKLNVPHYFQHIKRPMDLSTIERKLAVGAYETPEQVAQDFNLMVDNCAKFNGA
                     SSVIAQMARNIQASFEKYMLNMPPRDQPVQPRKRRKSSEEAAVVIRRAETHTGRPKRE
                     IHPPKSKDIYPLENAKPQSKKHQTEMKFCQQVLKELTAKKHASFNYPFLEPVDPIALN
                     CPSYFDYVKEPMDLGTIGKKLGNWEYADYDDFERDVRLVFKNCYAFNPDGTLVNMMGH
                     RLEDVFNSKWADRPIVADEDSDEGEDDSEYESDVPYTEEDIDESLITNPAIQYLEQQL
                     ARMKVELQQLKRQELERIRKERRLARGLSNGGSSSTGRRKRSRTARKKGGAGAAAAAG
                     GSSGGGAGLGNGSGGSGLVKKKRKLKTVVTYDMKRIISERIGDLPEAKLERAVDIIKN
                     SMPDIVGADGEVELDIDQLDDTTILTLYNTFFRQYGAPSSSVAEDELRTNSLSPPSAA
                     SSKANKRRRSKALSEEEQNKQIEKIKNKLAILDSASPVSPNLLGLLSGNNEGSSEDDD
                     DDDISSESEEE"
     gene            <763090..>763596
                     /locus_tag="AGOS_AER069W"
                     /old_locus_tag="AER069W"
                     /db_xref="GeneID:4621132"
     mRNA            <763090..>763596
                     /locus_tag="AGOS_AER069W"
                     /old_locus_tag="AER069W"
                     /product="AER069Wp"
                     /transcript_id="NM_210283.1"
                     /db_xref="GeneID:4621132"
     CDS             763090..763596
                     /locus_tag="AGOS_AER069W"
                     /old_locus_tag="AER069W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL072C (YET3)"
                     /codon_start=1
                     /product="AER069Wp"
                     /protein_id="NP_984929.1"
                     /db_xref="GeneID:4621132"
                     /translation="MSLYYSLVFAMLVCESAVFALLAVPLPMAVRRPLTRALARPFES
                     ATVQMVLKVLLGFVLLLFVDTTNRLYVVNREYERARHVEFAHGRRELLSRKFLAQRNM
                     YLTGITLFLTFMLGQTFNLVLELLALKGATERPGATTAAGLRAEIEECEKELARLKAQ
                     ADALAEDM"
     gene            complement(<763613..>765556)
                     /locus_tag="AGOS_AER070C"
                     /old_locus_tag="AER070C"
                     /db_xref="GeneID:4621133"
     mRNA            complement(<763613..>765556)
                     /locus_tag="AGOS_AER070C"
                     /old_locus_tag="AER070C"
                     /product="AER070Cp"
                     /transcript_id="NM_210284.1"
                     /db_xref="GeneID:4621133"
     CDS             complement(763613..765556)
                     /locus_tag="AGOS_AER070C"
                     /old_locus_tag="AER070C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR401C (DUS3)"
                     /codon_start=1
                     /product="AER070Cp"
                     /protein_id="NP_984930.1"
                     /db_xref="GeneID:4621133"
                     /translation="MSSTEGGAKRVAEDGSEVSEAKRVGRIEGVAQLKPEYVVAGAAQ
                     LRAAESDEELTSERMVEPEGGTRKKSKKARGQNKNRDNRQAKEEHQLCPRLAQGNADA
                     CAFGAQCRYLHDVRTYLEHKTAEIECPQFTGCPVFAATGRCPMGFKCRFLSSHCNMET
                     LELATTPEDERAKLWSVNHEVNHIASDRKLDLVKRRAPFPRSEHVLEIIDAIQQEFRD
                     EMQGAAAAPEGAVAEVPQVQQREEQLSNKRARQRELYAQYHETRYFAQEKKPLDLHHK
                     KIVSPLTTVGNLPFRRLMRQLGADVTYSEMALAVPLIQGTNSEWALPKAHCSELPGFG
                     VQLACSKPWQAAKAAEALADNVGDGLSEINLNSGCPIDLLYRQGSGSALLDNPARMIR
                     CLNAMNYVSKDVPVSVKLRTGTRDGHPIALGLCKRLVMETDVAAITLHGRTRQQRYTR
                     SADWDYVGQVADALRSYETERAEKLKDREGKLRIQFVGNGDCNNWEDWYRHLENENVD
                     SVMVARGALIKPWIFEEVDARQYIDKSSSERLEILRDYARFSMDHWGTDEYGIALCRR
                     YFCEFMSFFHRYVPMGICERYPVLLNERPPNWRGRDDLETLLGSTDAADWIKLSEQFF
                     GPTPDKFVFQPKHKSNSYAPSVQ"
     gene            <766224..>768077
                     /locus_tag="AGOS_AER071W"
                     /old_locus_tag="AER071W"
                     /db_xref="GeneID:4621134"
     mRNA            <766224..>768077
                     /locus_tag="AGOS_AER071W"
                     /old_locus_tag="AER071W"
                     /product="AER071Wp"
                     /transcript_id="NM_210285.2"
                     /db_xref="GeneID:4621134"
     CDS             766224..768077
                     /locus_tag="AGOS_AER071W"
                     /old_locus_tag="AER071W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR403W (SFP1)"
                     /codon_start=1
                     /product="AER071Wp"
                     /protein_id="NP_984931.2"
                     /db_xref="GeneID:4621134"
                     /translation="MDVTTATSTTPNIYITEAQPGHQAGGGHAAHPVQHHLGTQQHQH
                     QMAKFRRESIAHSQGMGGVSWGSLTVGSWLKDEVMIHAHTKDGFNSNLAASNMVSFAS
                     PPSSSGSYLPNLEKQYCKDYSCCGQLLPGLHDLLRHYEEAHIATSPGYVSIAGGASLT
                     NSMATHALQGSGMARKKVGNLSQPHQTQHSQPTQHSQQQQPTQQQPTHAWVAQHSAVQ
                     ASHGASHNIQPRYGHPGSHHAELQQQQVQIPNQHHHRQALNTGAQIHAQSGMGSSQQQ
                     LHLNGNLVDAVCTNDVFLQTNNVNNAVAAAGAGAAAPSVSKIGMSSGKGLGSGMLHSK
                     ANKRNSQQPQQMNFNNYSLQMNASRNNSGTPGLQQQVQSRLMQKRSAINSAAAGVDLD
                     FMDQDMIDEFNPDSGATLMGMQHLGTLVDGPSVLTGHISAHTSSQTQGMVKKKQPRSM
                     NSGGNSAGTSSALGKRSSSALTASSSGRHSMSSDDDDDDDDDDQDDDLDEDEPPGKSR
                     KQQGYIDDPARRLYVMDHEEHKPFKCPVIGCDKTYKNQNGLKYHKTHGHQNQKLHENP
                     DGTFSIIDPESNEPYPDGMGFEKDKPYRCEVCGKRYKNLNGLKYHRGHSTH"
     gene            <768675..>769460
                     /locus_tag="AGOS_AER072W"
                     /old_locus_tag="AER072W"
                     /db_xref="GeneID:4621135"
     mRNA            <768675..>769460
                     /locus_tag="AGOS_AER072W"
                     /old_locus_tag="AER072W"
                     /product="AER072Wp"
                     /transcript_id="NM_210286.2"
                     /db_xref="GeneID:4621135"
     CDS             768675..769460
                     /locus_tag="AGOS_AER072W"
                     /old_locus_tag="AER072W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR404W (FLD1)"
                     /codon_start=1
                     /product="AER072Wp"
                     /protein_id="NP_984932.2"
                     /db_xref="GeneID:4621135"
                     /translation="MQINVLWPLQWVPWATYAAVILWVQVVVILPLATVLWQDFYSQL
                     LPSESHFERQLRPVKAPASAAGSVNYMWSMELWRQTVSPQDVTSTPPSAGHEQLAVQS
                     GIPYLLVIDLQLYCFDQEPIHVVTVEVAAHTEYFTVTCFPSVEHAMRSPWTAQPLATR
                     IQHEFENRLQLPDILLSADTRMVNVTIQSTARLRFGHRSAYSLSMQVGGIRYAMLHWY
                     RTCHILGTTLFVGVISAWFYISFSIAFMVIGFLRGAGAKNTKS"
     gene            complement(<769776..>772937)
                     /locus_tag="AGOS_AER073C"
                     /old_locus_tag="AER073C"
                     /db_xref="GeneID:4621136"
     mRNA            complement(<769776..>772937)
                     /locus_tag="AGOS_AER073C"
                     /old_locus_tag="AER073C"
                     /product="AER073Cp"
                     /transcript_id="NM_210287.2"
                     /db_xref="GeneID:4621136"
     CDS             complement(769776..772937)
                     /locus_tag="AGOS_AER073C"
                     /old_locus_tag="AER073C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL073W"
                     /codon_start=1
                     /product="AER073Cp"
                     /protein_id="NP_984933.2"
                     /db_xref="GeneID:4621136"
                     /translation="MVESTGRDVGMLQSLQRFVTMISGGAAASNKNVAFFLRLNLLTQ
                     LRQLQSGPGGHEGRGQRDALVQWWITLLNYLNSDLNGGRHHTPAAETVSVALECISRV
                     VTVLMPRAGDEARDFEIYAHHLLLTVHYITNRLVDNSKRRKVVAQNAQLPAAQIKATL
                     LYVQAYNGLLRAFMGKVIAYAYMYLPAAMRYDVQVLRFLVGNVVAVPLTRNEVVPWKP
                     VRFELEDEATSQQMSPKMVGNEEDLKIFQVMISYLQNDQVFSTFYWHYWYILLQLHLS
                     AGQNGELQLGGCPGVLLLLDHVGNSLSRDLSKFAQYMRTQDLKEPSLAQGNSSAALAT
                     RLNNMPLTVASDKLNSFVYTKFQSVKIWECLRNLVGCFRRLTRTSADQLLHRLIQEHD
                     VRLLEATSKIPAYDSVVGNLVYNKLLQFIVFQFAGSQPSFLQDLNWTGWIKGLEGMLC
                     TLNSNCQSIALLCLFNIWDAIPTPQRRAIQDILLSDLWHRLAIETEFHIVRILFMKLL
                     VFRVVPDDELDSSLLRTNLSMVHESAKDLSKKITVDTDCMDIKNILAFNGNKKLTLIS
                     NNPVTEEALILEERKKYETNANTAQQQPVIPPSFPMVSTLSNVRPSVVLLKGKYPFDV
                     FDEMVSRAALILADKKVREKMNEEKQGVSRRSSWHSNDDNNEHVASSQSTPSAWHSII
                     SKLSSYHTHSSSTSALPSQGHASTRGMRSRTEEMLCSDSLDVESGELLSMYSNNSQVS
                     NLTNSSEDHADPSKRYSYGGRGVSQLKNCSQESLPSTQSKKRKLLAPPELKYSSSVTE
                     KDKITHIFRLTMTQTPSAAGSFANLITKLREANEKWGVKAHVEKPLPYDKPLPSSPEM
                     PGTKDYTLIDGFDFNSLSSSIMGDIQQISDLTSQSMATNKSTPSLISIPTDGVPEPNW
                     GFLSIFGRKRSPSADDVDTLGNLTITDSKLVPENDTVHFTPEVSVEPSCGSNASLVPG
                     LELSMEYTENVTPEDSIKRGHTVSMFQRTRLQKFLRIILTYNATVQEFFTFVDCVNDT
                     CEVGNIFMDFDVGQQANRHLRPN"
     gene            <774205..>776136
                     /locus_tag="AGOS_AER074W"
                     /old_locus_tag="AER074W"
                     /db_xref="GeneID:4621137"
     mRNA            <774205..>776136
                     /locus_tag="AGOS_AER074W"
                     /old_locus_tag="AER074W"
                     /product="AER074Wp"
                     /transcript_id="NM_210288.1"
                     /db_xref="GeneID:4621137"
     CDS             774205..776136
                     /locus_tag="AGOS_AER074W"
                     /old_locus_tag="AER074W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL074C (BRE1)"
                     /codon_start=1
                     /product="AER074Wp"
                     /protein_id="NP_984934.1"
                     /db_xref="GeneID:4621137"
                     /translation="MEEPAAKRPKLSDRSEPLTQRDVVLFQKEALFRQLNRYRAEARA
                     GQVQVEELRRAHGQVGERLAAVCGVVRSVARAVADARGDGDARALCERVAGGDDDEVV
                     ARAAEFAAVVAGGLGRGAAAGEGWHRLEAVNSRLAAENAQLAAELGAVRGFYAELLRR
                     YDRDESETVRRVFKVEESEPPRAATPVEESSAKGAASDGEAATAVVEREMQIEELQTE
                     IRVLEDTVAQLTDWKRLNEQELTKLRQMASSAELSQRHPTPPSSSNLSADLQVLRSKV
                     EKLSHENKELAQLNEAYLGKFQQLSADREIFNNRLSAEFQTAQETLKKHNSNLEKDLV
                     RIRTARDELLSKVAVLEAQKSKSDMLEDLEKMLALQQEQLKALSEHKPEPARDAVMKE
                     LQDLEKAFKELSQYSNKKYSEYVNQESLMSKLTVEKTKADQKYFAAMRSKDSILIENK
                     NLSKNLSKSNELIQQLKDIEKSLQAKIENLNKQLHISRINEKRLLDSNKTTSLKIMDL
                     TSQLSKANKSSTLVQQECNKLIEEKAKMESKLNDLEIETKNLATKLTYQENKSKKLHK
                     TLVSNGGDNGALAEELENFRTVVYCSLCSKNWKDTVIKTCGHVFCADCCKERLAARMR
                     KCPTCNKGFSSNDLLVVHL"
     gene            <776506..>777564
                     /locus_tag="AGOS_AER075W"
                     /old_locus_tag="AER075W"
                     /db_xref="GeneID:4621138"
     mRNA            <776506..>777564
                     /locus_tag="AGOS_AER075W"
                     /old_locus_tag="AER075W"
                     /product="AER075Wp"
                     /transcript_id="NM_210289.1"
                     /db_xref="GeneID:4621138"
     CDS             776506..777564
                     /locus_tag="AGOS_AER075W"
                     /old_locus_tag="AER075W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR405W (DUS4)"
                     /codon_start=1
                     /product="AER075Wp"
                     /protein_id="NP_984935.1"
                     /db_xref="GeneID:4621138"
                     /translation="MPTVPSFIPKPKKLTPENDPLHIIKTRRITHNRPATIAGPMVRY
                     SKLPFRQLCRHFNVDIVYSPMILAREFVRNEHARMADFTTNSRDTPLIVQVGVNNVVD
                     LLRFVEMVSPYCDGIGINCGCPIREQVREGIGSALIYNQPLLCEMVRAVKEKYKDTVR
                     LETKIRIHDDLAQTVTLCNALASAGVDWITIHGRTRTTRSSVPANIAAIRYIKEHITD
                     KELPIVANGDCFTLDDCHRIAAETGADGIMAVRGLLANPALFSGYKTCPWHAVELLWH
                     YAMEFGTLPYQLLQHHLHCMLENMGADKTLLKQMMDIKNFCELIDWFDEHFVLRRKSQ
                     EELSDIPDIPYRHRAPRP"
     gene            777956..778010
                     /locus_tag="AGOS_AgSNR63"
                     /old_locus_tag="AgSNR63"
                     /db_xref="GeneID:4621139"
     ncRNA           777956..778010
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR63"
                     /old_locus_tag="AgSNR63"
                     /product="AgSNR63"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR63; start and end coordinates are
                     approximate; similarity is partial. In synteny."
                     /transcript_id="NR_149408.1"
                     /db_xref="GeneID:4621139"
     gene            complement(<778134..>778553)
                     /locus_tag="AGOS_AER076C"
                     /old_locus_tag="AER076C"
                     /db_xref="GeneID:4621140"
     mRNA            complement(join(<778134..778421,778497..>778553))
                     /locus_tag="AGOS_AER076C"
                     /old_locus_tag="AER076C"
                     /product="60S ribosomal protein L31"
                     /transcript_id="NM_210290.2"
                     /db_xref="GeneID:4621140"
     CDS             complement(join(778134..778421,778497..778553))
                     /locus_tag="AGOS_AER076C"
                     /old_locus_tag="AER076C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL075W (RPL31A) and YLR406C (RPL31B); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L31"
                     /protein_id="NP_984936.2"
                     /db_xref="GeneID:4621140"
                     /translation="MAGLKDVVTREYTINLHKRLHGVTFKKRAPRAVKEIKKFAKLHM
                     GTEDVRLDPRLNTEIWKRGVKGVPFRMRLRISRRRNEEDNAKNPLFSYVEPVVVASAK
                     GLHTVVVEEEEA"
     gene            <778959..>779804
                     /locus_tag="AGOS_AER077W"
                     /old_locus_tag="AER077W"
                     /db_xref="GeneID:4621141"
     mRNA            <778959..>779804
                     /locus_tag="AGOS_AER077W"
                     /old_locus_tag="AER077W"
                     /product="AER077Wp"
                     /transcript_id="NM_210291.1"
                     /db_xref="GeneID:4621141"
     CDS             778959..779804
                     /locus_tag="AGOS_AER077W"
                     /old_locus_tag="AER077W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL076C (RXT3)"
                     /codon_start=1
                     /product="AER077Wp"
                     /protein_id="NP_984937.1"
                     /db_xref="GeneID:4621141"
                     /translation="MSMTATTEGDDGYRRRQSEIYRMQETLLDTTQTAETAGAAERVQ
                     EADPDGQGAGVDSGELLEVVERHYGARRCALGTIRYEAARAGRLTGGAGAALPFPYEV
                     GQQTVPVPLLPRMGTAAINRLVTVELSAEDLESALATGENARVRNRELWGVDVYTCDS
                     DPLLVLVHCGVLDAELSGQGAGSGPRRRTPANRANPDCVTRGVSAAPSVRRGAYHFDV
                     RAQLLMLPPLQRYASAERFGLQSREWNTLHDGLSYGLYEVTILLRDPTLRDVGGADQI
                     TKVDW"
     gene            <780087..>780740
                     /locus_tag="AGOS_AER078W"
                     /old_locus_tag="AER078W"
                     /db_xref="GeneID:4621142"
     mRNA            <780087..>780740
                     /locus_tag="AGOS_AER078W"
                     /old_locus_tag="AER078W"
                     /product="AER078Wp"
                     /transcript_id="NM_210292.1"
                     /db_xref="GeneID:4621142"
     CDS             780087..780740
                     /locus_tag="AGOS_AER078W"
                     /old_locus_tag="AER078W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR407W"
                     /codon_start=1
                     /product="AER078Wp"
                     /protein_id="NP_984938.1"
                     /db_xref="GeneID:4621142"
                     /translation="MSGDRGADAPYSVADSRRKSRARPGLRSSVSSWMHKFRANLCKV
                     TSEALAETSGSDSGRSTVDALFDGATETADGRELEGDTEARSSTSQTLVAKSEEEAAL
                     GKHSQSWTFETFDPHEQRQVLHGDSSVPFVDGPKLWHIRRELWTAPTANNSVQEAAEH
                     RASFRKIKPHYYPRIYRKLVLDDRPLSQPINLEDVMKIMDAGWLETNKWERASRGLA"
     gene            complement(<780801..>781154)
                     /locus_tag="AGOS_AER079C"
                     /old_locus_tag="AER079C"
                     /db_xref="GeneID:4621143"
     mRNA            complement(<780801..>781154)
                     /locus_tag="AGOS_AER079C"
                     /old_locus_tag="AER079C"
                     /product="AER079Cp"
                     /transcript_id="NM_210293.1"
                     /db_xref="GeneID:4621143"
     CDS             complement(780801..781154)
                     /locus_tag="AGOS_AER079C"
                     /old_locus_tag="AER079C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR408C (BLS1)"
                     /codon_start=1
                     /product="AER079Cp"
                     /protein_id="NP_984939.1"
                     /db_xref="GeneID:4621143"
                     /translation="MELDQDVNRIIKSKTATKVSAMQAEIEANHAYIYDVQLKKLLRL
                     HDEELQERCHTPLRKLYAKYSSRAEGNRDLQTWAEHVERDLRLLETTLRLVREGKAQD
                     TEQAPGKGDRIFRSD"
     gene            <781322..>784420
                     /locus_tag="AGOS_AER080W"
                     /old_locus_tag="AER080W"
                     /db_xref="GeneID:4621144"
     mRNA            <781322..>784420
                     /locus_tag="AGOS_AER080W"
                     /old_locus_tag="AER080W"
                     /product="AER080Wp"
                     /transcript_id="NM_210294.1"
                     /db_xref="GeneID:4621144"
     CDS             781322..784420
                     /locus_tag="AGOS_AER080W"
                     /old_locus_tag="AER080W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL077C (VAM6)"
                     /codon_start=1
                     /product="AER080Wp"
                     /protein_id="NP_984940.1"
                     /db_xref="GeneID:4621144"
                     /translation="MLRAELVNAIPCQGAQCVAVVDGVRQLVVVRNNRDFLVYSSMDE
                     RGLRLVQTYTELLGPNYGVEELLYSERLRTIFVRTTKCLLLLHSSNLQHYDKIVDKRG
                     IDHAWLFEHPCGKAETWMTVLVYSVTGSSKIKMLTWVGRQFQAVHEVALGTRSEVISS
                     VSGGPACCVVLTSTTVYQWRYMSSELVRVDRVIKPTWPRELYDTVKEVETAQVEASTQ
                     GKEYADDVSSLISVESLSQLSRKTNLSNFWFKKPQGRAFKDVRLAFLPSDSVYPVIMD
                     GKTEMMLQLERADKESLYITVHDCRHFYERNRDFETVQYYMSRYLLLSNSNFVRIVDY
                     YRGFIFMEIYVSKGIKCVYPISESSLLIRTLDDELQLFKISCEDDLSKTTVHDCRSIP
                     NNAEEAHFDNLKRRIIFYESLLDTQKGLTMFSISGSSDNGDQAELYALKLRDLSLLFA
                     IKSFERFAGSQTLTLSKKLDERVNRLQELLAKQLFDLFLAFLAPPELVLRRCLPYNVA
                     AEIDDLLTPPILASEVKRTDLSPKLINRWCLPYLTDIRRHLHNLQRQGPNATVLWAFG
                     AYKLQVGIEFFQLDHSKASGLLNLLRIIDTALFQLYMHYNKPMVGPLIRVDNNCDLVK
                     VEAALKENKMFQELIDFYYNKSEHGKALNLLIHLSDYVDKSFATNVMQEKVKNLVIDY
                     LSKLPSEYLDTIFEYTAWLLKNYSDKDFIISSIFMNDSPACGKFNYEKVYSFIDKCNK
                     QLSVTYLEYIVNIYHHTDSKIFNYLILRYIQDISNEKCAKKLKAILKTTAYYEPRVVL
                     RYLSTALEDDTLTAENIKWLKLLKTWPLGRLGEHETALGILVDDLGNYNQASLYCNEL
                     YATNKNAGTAALMNLFEKLLAKVEFSGWRNVHLFLLENGSKLDAITLFEKLPPNIPIN
                     TLNEFLSRRIKSASMKKNQSRIQNNLLKVNLIGSTYRLSQIISEFLVVDEDNRCYVCQ
                     KNLTLGSSELFSLFNLRGSNILTHYNCGRSLQEIIAADDCKSGSMSHVKTLGDYKDEK
                     KR"
     gene            complement(<784487..>787558)
                     /locus_tag="AGOS_AER081C"
                     /old_locus_tag="AER081C"
                     /db_xref="GeneID:4621145"
     mRNA            complement(<784487..>787558)
                     /locus_tag="AGOS_AER081C"
                     /old_locus_tag="AER081C"
                     /product="AER081Cp"
                     /transcript_id="NM_210295.2"
                     /db_xref="GeneID:4621145"
     CDS             complement(784487..787558)
                     /locus_tag="AGOS_AER081C"
                     /old_locus_tag="AER081C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR409C (UTP21)"
                     /codon_start=1
                     /product="AER081Cp"
                     /protein_id="NP_984941.2"
                     /db_xref="GeneID:4621145"
                     /translation="MEKSWYPTRELAAASPNHQQQCSKSVAYRQRSCVVKAGRVVVSF
                     CLMKLVFRDLKNLYGHRARCTSLTNSQAYSSRLRSARPLLINMAESDVAKRQRTGKNV
                     SGQAAHASRIFSPFRVVGNVTNETPFAVGTLGTTFYIATSVGKSFQIYDASNLHLLFV
                     SAQQTSSPITCLATHHHYLYAGFGKHVGIYKRGQLERLLTLPDCNATVRHMCVFGGYL
                     CVSADDNSVYVFKTEGGSKYPTEFYTKFNIGSLLGGEILELVHLPTYLNKLVVVTHSN
                     IVLYNIRTRKMLFSSDEFPDRITAAECAPALDVLALGTITGEVVLYNMKKGRKIRSIQ
                     TTNRVSSLSFRTDGSAHMAIASTNGDLVFYDLNRKTRIHVLKGIHRDTYGGISKVSFL
                     NGQSIVVTSGGDNQLKEFAFDPSLSQSESETVVQPPRLLRSRGGHSQPPSRICFADSH
                     SHFLMSASKDRSLWGFSLRKDAQSQEFSQRLHKNKDGSRIGGSTMKEKFPEIIALAIE
                     NFREGDWENVVTAHNGERAARTWNTKTKRVGRWTLSTSDDGLVKSVAMTQCGNFALIG
                     SSNGGISVYNLQSGIKRKVYKMHKGSVTGLAVDGMNRKMVSCGLDGLVGFYDFTTNSF
                     LGKLQLGAPITQLVYHRASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITAFDFS
                     PDGRWIVSASLDSTLRTWDLPTGTCIDGVRLESVATNVQFSANGDILATTHVAGNGIA
                     IWSNRSQFKAISTRQIDEEAFARLLLPSASEDGGVSMLEGAFDAEDEEQSMGTYKSLE
                     QINESLITLSLGPRNKMNTLLKLDVIRQRSKPKEAPKKPEKAPFFLQLTGEKVGDDAS
                     GREDALNANATTSLKEQEEKAASMQVQDQLAKFKPTTKLGFESEFTKLLRTSAAESDY
                     NNFLVHLVNMSPASIDLEIRSLNAFEPFEEIVWFIEALVEGLKSGKNFDLYEAFMSLL
                     FKAHGDIINANNKHEGIARSLQEWRAIHNSREHLDDLVKFCSSIINFVTTT"
     gene            <787876..>791304
                     /locus_tag="AGOS_AER082W"
                     /old_locus_tag="AER082W"
                     /db_xref="GeneID:4621146"
     mRNA            <787876..>791304
                     /locus_tag="AGOS_AER082W"
                     /old_locus_tag="AER082W"
                     /product="AER082Wp"
                     /transcript_id="NM_210296.1"
                     /db_xref="GeneID:4621146"
     CDS             787876..791304
                     /locus_tag="AGOS_AER082W"
                     /old_locus_tag="AER082W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR410W (VIP1)"
                     /codon_start=1
                     /product="AER082Wp"
                     /protein_id="NP_984942.1"
                     /db_xref="GeneID:4621146"
                     /translation="MSEDNCLQPQLSPLFLSCSTKKAMESIAPILEGFTPKTSSSENT
                     SLKLPPASLTTDEEEDADENLDPNALARTVSVQSQQSAVGGTGAVTYNSLAAPDENAE
                     TFAKHGAAHGLEQITSSQALEECACEEGNCTDACQAVSPGAYKGQSPRKPADDATEKN
                     EGWQHSVHPPVQQTGHEGANSDSATPAPSSSSSSRKSSTSITKPQLPRVGKIGVCAMD
                     AKVLSKPCRHILNRLIENGEFETIIFGDKVILDENIENWPTCDFLISFFSSGFPLNKA
                     IDYVMLRKPFMINDLIMQKVLWDRRLCLRLLEAAQVPTPPRLEITRDGGPRVDDALRS
                     KLLERGVHVKPIREPIWRMLDNDTLEVNGEIMTKPFVEKPVDGEDHNIYIYYHSKNGG
                     GGRRLFRKVGNKSSEFDPALVAPRSEGSYIYEKFMDTDNFEDVKAYTVGESFCHAETR
                     KSPVVDGIVRRNTHGKEIRYVTELTEEEKQMAARVSKTFSQMICGFDLLRVNGKSFVI
                     DVNGFSFVKDNSMYYDSCAKILRDTFVNAKKQIDLEKRNLPVIQEEKRQKWFFKGLVT
                     VIRHADRTPKQKFKHSFRSQIFISLLKGHKEEVVIRNVSDLQIVLQALRIAMEEGVED
                     PNKLEVLANALEKKLNFPGTKIQLKPVLNDDNEVEKVQFILKWGGEPTHSARYQAQEL
                     GEQMRQDFDLLNKNILRNIKIFSSSERRVLASAQLWAMALFGADELGSDEISIRKDLL
                     DDSNAAKDLMDKVKKQLKALLREGKEAPPQFAWPLKMPQPYLVIKRVVELMNYHKKIM
                     DHNFSHKSLEEMQRRWCCGEDPTLFKERWDKLFKEFVSVDKVDPAKISELYDTMKYDA
                     LHNRSFLERIFSPDEADELNEDAACQHSLVDRYPINILAKNNFKIPETTLGKTTSNSV
                     GSLGWVLEKESGMKAHCSNPNSIFDHPRYMQLRELYRLSKVLFDFICPQEYGIEDNEK
                     LDIGLLTSLPLSKQILNDIDDMKSKDTPACIAYFTKESHIYTLLNIIYEAGLPMRIAR
                     NALPELDYLSQINFELYESADSGGQKSHAIRLKMSPGCHTQDPLDVQLDEKHYISCIP
                     RISLTKHLDMDYVSQKLRNKFSRVNMPQKFTPVHITQPDLSYKRPAMKDSSTES"
     gene            complement(<791730..>793007)
                     /locus_tag="AGOS_AER083C"
                     /old_locus_tag="AER083C"
                     /db_xref="GeneID:4621147"
     mRNA            complement(<791730..>793007)
                     /locus_tag="AGOS_AER083C"
                     /old_locus_tag="AER083C"
                     /product="AER083Cp"
                     /transcript_id="NM_210297.1"
                     /db_xref="GeneID:4621147"
     CDS             complement(791730..793007)
                     /locus_tag="AGOS_AER083C"
                     /old_locus_tag="AER083C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL181W (PRS1)"
                     /codon_start=1
                     /product="AER083Cp"
                     /protein_id="NP_984943.1"
                     /db_xref="GeneID:4621147"
                     /translation="MRKCKVFMGTSHPELGKLVCEKLGIEPAPCTLKKFANGETSVQI
                     GVSVRDEDVYVIQSGSSTINDHIMELLILVSACKGGSARKVTAVIPQFPYSKQCKMKK
                     HRGAITARMLANLLIIAGADHVVSMDLHASQMQGFFTKPVDNLYGGPSLAKWIRENVE
                     DYQHAVVVSKNPGGTKRVTALADSLKINFAMIHTDRRRSKDLYSQTKDMKQLRMRKQS
                     MLRKNRPIVRPGAAEDEEENIILTNGIQTARIINGHVIDDDVDDAYHSDVVVSDQEGS
                     LASDSYPIGGSYEAAADSEDEEAPQEKQEKLITLVGNVNGRSAIILDDMIDRPGSFIS
                     AAEHMVKNCGAKRVYVVATHGIFTGDCLEQLEQSDAVYQVIVTNTYPINRDRMKRSQK
                     LVVIDTSSIFAECIRRDHYGESISVLFDSLASL"
     gene            <793468..>794280
                     /locus_tag="AGOS_AER084W"
                     /old_locus_tag="AER084W"
                     /db_xref="GeneID:4621148"
     mRNA            <793468..>794280
                     /locus_tag="AGOS_AER084W"
                     /old_locus_tag="AER084W"
                     /product="AER084Wp"
                     /transcript_id="NM_210298.1"
                     /db_xref="GeneID:4621148"
     CDS             793468..794280
                     /locus_tag="AGOS_AER084W"
                     /old_locus_tag="AER084W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR412W (BER1)"
                     /codon_start=1
                     /product="AER084Wp"
                     /protein_id="NP_984944.1"
                     /db_xref="GeneID:4621148"
                     /translation="MSGRQMRERQRNGVLDFKQALQRCRTEVQESRMFADLTTHLEPH
                     KERLTRIRCLALGKFHEEAPARWQLALLLELVDYLGHEVQCSLYDPAFTAEELSYVEQ
                     LGERWSVDEQSPWSTESSDKLLFFLPHAPLSLTESVVEAEQPRLWLANQLVQHTDRYT
                     KAQLFEKYPLISKLVSYLDSGSKVGTASTDGFSAFVPKRSRRQRRNKAVYREPDIDYG
                     SVKSYFTGCTVLTDFSGGELLRDKPWLNAFSDLALHRIELGVKQVERPADSI"
     gene            complement(<794379..>800694)
                     /locus_tag="AGOS_AER085C"
                     /old_locus_tag="AER085C"
                     /db_xref="GeneID:4621149"
     mRNA            complement(join(<794379..800546,800685..>800694))
                     /locus_tag="AGOS_AER085C"
                     /old_locus_tag="AER085C"
                     /product="AER085Cp"
                     /note="5'UTR intron"
                     /transcript_id="NM_210299.2"
                     /db_xref="GeneID:4621149"
     CDS             complement(794379..800519)
                     /locus_tag="AGOS_AER085C"
                     /old_locus_tag="AER085C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL182W (FAS1); 1-intron"
                     /codon_start=1
                     /product="AER085Cp"
                     /protein_id="NP_984945.2"
                     /db_xref="GeneID:4621149"
                     /translation="MSGITTRSLALGHGALEHTLSVPTGLYLTASQLAASFAKEQVAP
                     TEGYASDEEPASSAELLAKFVGHVAAQAGAGGEVAAVLELALDEFEASYMCGEEVHRV
                     AARLLADDEQPTALPKVKELVQHYVYGSVRAQRPLMHRRPALLESATRGDARVVAVFG
                     GQGNTDDYFEELRELHQMYGVLVEDVLDTAAEQLNELLRTTEGAEKMYTQGLDFRQWL
                     AQPERTPDNDYLLLIPISCPLIGILQLAHYAVTARIVGITPGELRACMVGVTGHSQGL
                     STAVAVAEADTWESFFCALRKTVSLLFFIGVRCYQVYPKTSLPPSILEDSLENGEGKP
                     SPMLSVSNLTQEQVQEFVEKTNAHLPSEKHIVISLVNGARNLVVSGPPQSLYGLNLAL
                     RRAKAPAGLDQSRIPHSERKLKFTNRFLPIESPFHSHLLEPALELIKQDLHDADLEFK
                     QESLAIAVYDTYDGHDLRQHSGSIVERIASCITKLPVYWETATTFKSTHILDYGPGGA
                     SGLGVLTHRNKDGTGVRVIIAGALDHNIDDEYGFKQELFDVNPTSLKFASNWLEEFHP
                     KLIKTGSGKVYVDTKFSRLLGRPPLLVPGMTPTTVSPDFVAATINSGYHIELAGGGYF
                     SPQGMTEAIDSVVAQIKKGSSLGINLIYVNPRMLQWGIPLIKELRSKGYPIQSLTIGA
                     GVPSLEVASEYIETLGMTHLGLKPGSVDAISQVITIAKAHPTFPIVVQWTAGRGGGHH
                     SFENFHAPMLQMYGKLRRHSNIILIAGSGFGSSEETYPYLTGEWSTRFNYPPMPFDGF
                     LFGSRVMVAKEAKTSLAAKKAIAACTGVPDELWEQTYKKPTGGIVTVRSEMGEPIHKI
                     ATRGVMLWKELDETIFNLPKNKLQPALDAKRDYIIQKLNSDFQKPWFATVNGEARELT
                     DMTYKEVAERMVELMFIKSTGKWIDVTLRNFTGDFLRRVEERFTKDKSVSVLQSYSDL
                     ETPSKVLADIFSAYPAAKSQFVNAQDVAYFLECAQRPTQKPVPFIPVLDHRFEFFFKK
                     DSLWQSENLEAVVDEDVQRTCILHGPVAAQYTKEINEPIQHILDSIHDGHINKLLKDY
                     YSDDISKVPVVEYFGGENPREVDYPTVKKTPDTIVYNATSATDFRTWFNVLAGSQKSW
                     RHAFFSIPRVVQGSRYSENPTFKVFKPCDNMVVTIKHPETPDKTEVILQEPVQGTLKT
                     TATVTFSGDVIQLSMIENRTMDGIPVALPLLYKYNPTDGFAPIVEIMEDRNQRIKEMY
                     WKLWLKDPFNLDFDPRDPIESEDFTITSKDIAAFTHAIGNNCEDFVTRPGRPLLAPMD
                     FAIVIGWRALVKAIFPNNVDGDLLNLVHLSNSYRMIPGAKPLQENDVVNVSALIKSVV
                     NQENGKLVEVVGTIKKSGKPVIEVTTSFLYRGKYSDFENTFQKSTDPVYVIQINSPKD
                     IAVLKSKEWLHFDNDKIDLLGRTLTFETETEVTFKNRTVFSSVHCEGRVLMELSTKEN
                     VQIGVVKYDAGESHGNPVIDYLSRNGSTLEHKVNLENTIPIATIEAQSPGTNETYARV
                     SGDLNPIHVSRHFANYADLPGTITHGMYTSGAVRALVETWAADSVSSRVRAYSCQFVG
                     MVLPNTLLTTRIEHVGMINGRKLIKFETRNDKDEPVLAGEAEVQQPVSTFVFTGQGSQ
                     EQGMGMDLYDKSPVARQVWDRADNHFKQTYGFSILEIVRTNPKELTIYFGGEKGRKIK
                     ENYTSMIFETIVDGEIASERIFKSITESSTSYTFKSDTGLLSATQFTQPALTLMEKAS
                     FEDLKSKGLIPAEATFAGHSLGEYAALASLADVMSIESLVEVVFYRGMTMQVAVPRDS
                     EGRSNYGMIAVNPSRVSTGFTQEALQFVVERVGKITEWLVEIVNYNVEDQQYVAAGDL
                     RALDTLTNVLNFVKLQKIDLVKLQATMPLEQVEEHLDEIITEISKKSLSKPQPIELER
                     GFACIPLRGISVPFHSSYLRNGVKPFKNFLKKNIIKENVKVDRLIGKYIPNLTAKPFA
                     ITKEYFEDVYKLTGSEKIKAVLDNWESYQN"
     gene            complement(<800884..>801693)
                     /locus_tag="AGOS_AER086C"
                     /old_locus_tag="AER086C"
                     /db_xref="GeneID:4621150"
     mRNA            complement(<800884..>801693)
                     /locus_tag="AGOS_AER086C"
                     /old_locus_tag="AER086C"
                     /product="AER086Cp"
                     /transcript_id="NM_210300.2"
                     /db_xref="GeneID:4621150"
     CDS             complement(800884..801693)
                     /locus_tag="AGOS_AER086C"
                     /old_locus_tag="AER086C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL183W (LOT5)"
                     /codon_start=1
                     /product="AER086Cp"
                     /protein_id="NP_984946.2"
                     /db_xref="GeneID:4621150"
                     /translation="MNADRPCCQFVTTKPTVENVTPFAQFQLTQPRLKGVSLQQLSAL
                     PILYGGGRNFLFGRFTDSEPQLQDTDLFVLDSCILLWPAHALRGLRIPYDAVIYHAVR
                     RADVLELVLAVERDATLDSLFPPAPGPQPFALSTLELRLRPRYATYDRHYSGAVEQLF
                     TFRDFGLNRGDAMVANCNTAIATCMEFHHRAAAADDDDDDDDGPAAHVTPLAELLAPA
                     GHVPIYANHGSADDLTDDGLTDDGPQGGAAAGMALAFCSAARVPTKRRRQD"
     gene            complement(<801766..>803118)
                     /locus_tag="AGOS_AER087C"
                     /old_locus_tag="AER087C"
                     /db_xref="GeneID:4621151"
     mRNA            complement(<801766..>803118)
                     /locus_tag="AGOS_AER087C"
                     /old_locus_tag="AER087C"
                     /product="AER087Cp"
                     /transcript_id="NM_210301.2"
                     /db_xref="GeneID:4621151"
     CDS             complement(801766..803118)
                     /locus_tag="AGOS_AER087C"
                     /old_locus_tag="AER087C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL184W (SPE1)"
                     /codon_start=1
                     /product="AER087Cp"
                     /protein_id="NP_984947.2"
                     /db_xref="GeneID:4621151"
                     /translation="MIAKEIAPALAQDQPEEVKHDSLCQARDHVTTGLAGLVATDPTT
                     QKTGAHEQAHQAVFQAMKEHVERVNKDTCDAGEENSFFVCDLGEVERLLRYWRRELPR
                     VQPYYAVKCNPDVRVLERLASLGVNFDCASKAEIERVLQLGVAPERIIYANPCKVSSF
                     IRFAAARGVRQSTFDNVEELYKIARFHPESQLLLRISTDDSTAQCQLSAKYGCSPDEV
                     DPLLAKVAELGLNLVGVSFHIGSGASDFSSLTQAVVDARRVFDRAAHFGLPALRVLDV
                     GGGFQFDTFHQSSAILNAALDTHFPPGSGVELIAEPGRFLVATAFTLSSHVIAKRELP
                     ERGSMLYINDGIYANMNCILFDHYQPTPRVLYHAAAFHYFDTTSSKSRTAACPHRTSI
                     WGPTCDGLDCITDEYYLRYDLAVGDWLYFANFGAYTSSAATPFNGFEAAVEVIYIDTA
                     "
     gene            complement(<803518..>804765)
                     /locus_tag="AGOS_AER088C"
                     /old_locus_tag="AER088C"
                     /db_xref="GeneID:4621152"
     mRNA            complement(<803518..>804765)
                     /locus_tag="AGOS_AER088C"
                     /old_locus_tag="AER088C"
                     /product="AER088Cp"
                     /transcript_id="NM_210302.2"
                     /db_xref="GeneID:4621152"
     CDS             complement(803518..804765)
                     /locus_tag="AGOS_AER088C"
                     /old_locus_tag="AER088C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL185W (ASH1)"
                     /codon_start=1
                     /product="AER088Cp"
                     /protein_id="NP_984948.2"
                     /db_xref="GeneID:4621152"
                     /translation="MARIVPAGQPVASAGSELRRKWSLGDLMLPSLQAARRPALAQES
                     PYFFDVRGRAASAPSSPQNATVLTPTTSPRVQSLQSSPQVSLPPLRHLRLLPNPDRQQ
                     HAPAYPDTCEHTHRWRHDLVRWCAEAKREHFKHIEAEMAQLDVRSFPGLHMLANAAYV
                     SSIVSPRDHFFQLADSSASEWIVMTPPVSPREEGQQPASPGLFTHAVSEKLVQTIRRK
                     RLSASSHKKSNSFQAREMKKLLDSRSNLAPSGAGKISKKLPAAPVQQLMATINLGCSQ
                     QPECCEPPNLTPQRPAADLHPTRSIPCHQLAQLVRTPMGPRTPSRRASMRRCLSCHCT
                     ESPCWRPSWSDRRQDQLCNSCGLRYKKTHTRCLNSACRRIPSKGELAQMKTNPIVSEI
                     LENGLRVEGLRCLFCNCVVETRD"
     gene            <805363..>805866
                     /locus_tag="AGOS_AER089W"
                     /old_locus_tag="AER089W"
                     /db_xref="GeneID:4621153"
     mRNA            <805363..>805866
                     /locus_tag="AGOS_AER089W"
                     /old_locus_tag="AER089W"
                     /product="AER089Wp"
                     /transcript_id="NM_210303.1"
                     /db_xref="GeneID:4621153"
     CDS             805363..805866
                     /locus_tag="AGOS_AER089W"
                     /old_locus_tag="AER089W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL186C (MTR2)"
                     /codon_start=1
                     /product="AER089Wp"
                     /protein_id="NP_984949.1"
                     /db_xref="GeneID:4621153"
                     /translation="MNAPGAGHSQAAETFVKKLLAHLDECDVDRLQQALPLFQPHCRI
                     VVNTQPFASPAAFLQTWLQAVVATQHTLTSLDYHVIPGTATLVCNAACKVRFDESGRD
                     KMGGDAVLPAPAARAQPRARRWGTYYGLSLQLVLDERVLAGDAAAAIAALNYTLVFRP
                     DDTLMSI"
     gene            <806459..>808489
                     /locus_tag="AGOS_AER090W"
                     /old_locus_tag="AER090W"
                     /db_xref="GeneID:4621154"
     mRNA            <806459..>808489
                     /locus_tag="AGOS_AER090W"
                     /old_locus_tag="AER090W"
                     /product="AER090Wp"
                     /transcript_id="NM_210304.1"
                     /db_xref="GeneID:4621154"
     CDS             806459..808489
                     /locus_tag="AGOS_AER090W"
                     /old_locus_tag="AER090W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR413W and YKL187C"
                     /codon_start=1
                     /product="AER090Wp"
                     /protein_id="NP_984950.1"
                     /db_xref="GeneID:4621154"
                     /translation="MLKVLVAGKPNNAALGVSLFLTMVVMVMWGVYMGGLTKTSGPIY
                     NIYHGRAEIEHVNVTKILPISAPILQFLGGALLSKNVSNEMIFGSLKRMAQTEALAPM
                     LQLLTNTTNSVGTLAELAAANSGKEKPVAPLKGLLDIMQTSKNASAVVEGLSLVAKGV
                     EAAKKENASVKSDAEILALMAVAGNDVPKAVHSLNTLAAIPSEDRLKLSSILITLNLS
                     PDPKAFATALEDFLNKGLKLDDVREIISQFNAKIQRSTNASEIAGIADEIAKAEKQDS
                     SAAVSAMGAVLGHAASPFGALNVLNSSAELLNQPGAKPAAGALKGMMEAASNTTKAID
                     FIMERASHPKAGAAEQVMGLDMVLQNAVNSSETFANIIKMQMASTEESQKALPSLLGL
                     LSYSTDKIESMKSVIKLIEFGEKSPDVLNPVLEVLQASVKVNRLIPSKEILDLTPTIL
                     ENFNVAARYRLGIFTICKLFLNGTQKACSKPHVVQGFDYRNILYTDLMDSDLAPYIKT
                     LRVGPNDLYLEGKLLEKQPMYEPSIRAHLAFDILGLLSAFILLFTLAGAMTGALSLGM
                     HAWVNRLLVAAVAGFALLSATVIQIVTAVVKWGAKIDNYGVVYKQGTAQATLSWVAFV
                     LEAIVVLIVWGAYYAGGKSQGVVNVEEGRASTSDEDIDKEKISRPHPAHPDI"
     gene            <808951..>811356
                     /locus_tag="AGOS_AER091W"
                     /old_locus_tag="AER091W"
                     /db_xref="GeneID:4621155"
     mRNA            <808951..>811356
                     /locus_tag="AGOS_AER091W"
                     /old_locus_tag="AER091W"
                     /product="AER091Wp"
                     /transcript_id="NM_210305.1"
                     /db_xref="GeneID:4621155"
     CDS             808951..811356
                     /locus_tag="AGOS_AER091W"
                     /old_locus_tag="AER091W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL188C (PXA2)"
                     /codon_start=1
                     /product="AER091Wp"
                     /protein_id="NP_984951.1"
                     /db_xref="GeneID:4621155"
                     /translation="MLEFYKAHRIRILKASYLVLLVVTVKNLAQGKDAAERKAAGEPQ
                     DRKKPRSRANSAINVHYLRSLLGQTNGIESNSDESAAESDDGDYDGPSVDQKRSSFLI
                     KLLLRDPRCLLTFLLQASLLVIRTMLSLRVATLDGILVSKLVKGQFSEFVKVLLGQWM
                     TLGIPASMVNSLLTYTTRLCAVTINRKVSYHLLDKYLSSHHSFYSVNNLPSDKNKALS
                     LAMSESKENSPNTRREANPPIYVSDIPVQFLTRDVGAFSYNASVLLNQLLKPTLDLIL
                     CSFKLAQSSSSGMMAEGTLVLGLIVYFSNLCLKLIQPNFVQLTVKRTHLEGYFRSLHS
                     KLRSSNEEIALFKGQSTELWNLDFSFYQLTLFLAGEIKSRALYDFATSFVVKYVWGAA
                     GLILCSIPVFFRSNMAEDVTADFITNRRLLLTASASIGRYVELRRSIQQLKGEALRLT
                     NFNDRLDAGSSSKTDGKKVIIEYDDSKIQFVHVPLVTPANQVLIPELNFELKHGNHLL
                     IIGPNGCGKSSLFRVLGGLWPVLQSFTNPKKPTKLIMPRRNAENGESPIYYLPQRAYM
                     SNLSTFREQIIYPDKINAFEKKYNGDYQRGDKELADILSVLELDDLIAENMALIMAKR
                     SSTEGSGQPTEVSLTEAFGITRNWSEELSVGIQQRLAMARMYYHRPKFAVLDECTSAV
                     SPEMEQKMYTHAQSLNISLISVCHRTTLWHFHNLLLKFDGNGGYTFGPFDPEQRLTDE
                     QRLAELNKIIEQDVPIWKKKLDELVIAKKSNVLRKSQTNLKSLQESRLPLIQGMSPMT
                     SNT"
     gene            <811542..>813128
                     /locus_tag="AGOS_AER092W"
                     /old_locus_tag="AER092W"
                     /db_xref="GeneID:4621156"
     mRNA            <811542..>813128
                     /locus_tag="AGOS_AER092W"
                     /old_locus_tag="AER092W"
                     /product="AER092Wp"
                     /transcript_id="NM_210306.1"
                     /db_xref="GeneID:4621156"
     CDS             811542..813128
                     /locus_tag="AGOS_AER092W"
                     /old_locus_tag="AER092W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR417W (VPS36)"
                     /codon_start=1
                     /product="AER092Wp"
                     /protein_id="NP_984952.1"
                     /db_xref="GeneID:4621156"
                     /translation="MGSTVNYLSYWQYAETTASGHPVLREGERDIYVEQDVGLYHGKI
                     KILNKQKGRCYLTSQRIIYVDDTFHAKESVSIELDDVEKARYNAKFLKRATKTVLFLK
                     PNSKHSLGGKASRSNVDQKTFKRIVEKSQWTCAICMAHNEVNMEIQGYMPPCVNCGIS
                     VDFEMISKSLTIVYADDATDAAKNKCPACTFDNHVHMNNCEMCGTRLPNMCPTALTRN
                     QQLGGDPRVHIELEGNPGFTSRDIPFVQLSFRRSDGSLFFEALCKQLEDWESDQKKHM
                     FNQDLTKVNGVGLETPIFEQDTRFSTLGIASLEKSREEQLLKNDILLNKALTDLGNLA
                     ALASDIEKLYHDGESAPSNTNPTLVIDRDKFLSKSAFIDEIAREIYQLTVSEFKDQRE
                     KHGTILVPLVDLYALYNKSMRIGTGYVSPEEMREACERFGKLGLTDLSLSRINGRVLC
                     IASANSFEAVKRKIMSTIEHSPGADLLQITKQLNRENDNAWAIGIIMEVLQNCVKEGN
                     LLIDEQISGIHYYINVCWRI"
     gene            complement(<813241..>814329)
                     /locus_tag="AGOS_AER093C"
                     /old_locus_tag="AER093C"
                     /db_xref="GeneID:4621157"
     mRNA            complement(<813241..>814329)
                     /locus_tag="AGOS_AER093C"
                     /old_locus_tag="AER093C"
                     /product="AER093Cp"
                     /transcript_id="NM_210307.1"
                     /db_xref="GeneID:4621157"
     CDS             complement(813241..814329)
                     /locus_tag="AGOS_AER093C"
                     /old_locus_tag="AER093C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL189W (HYM1)"
                     /codon_start=1
                     /product="AER093Cp"
                     /protein_id="NP_984953.1"
                     /db_xref="GeneID:4621157"
                     /translation="MTFWWKKSPKTPGDYVKHLTEQLARFELAVSDNRKKIQDECTKY
                     ITGTKDFILGETDPAPSGEAIDELYFAIYDADLLYDLLVHFHELDFESRKDVALIYAT
                     CLRRSKDNKFTTVDYLVTKPKILAYMLRIAEMALNKPNGTEVFLTTGGMILESIKYEQ
                     LCRLLLKNPQIWTFFDFARLSSFEVSTESLQILTELFTTHTKLVATEFFNQDANIKKF
                     IDRINMLMAHGNYVTKRQSVKLLRTMILNRAYGQLMNSYINSPENLKLNMILLSDRSK
                     NLQLESFNVFKVVVANPRKSKPVLDILIKNRDKLLKFFENFGVDTKDTTLLDEKEFVV
                     AQIEGLPRLMSSNTENNLGSSPQKNLVA"
     gene            815576..815659
                     /locus_tag="AGOS_t0116"
                     /db_xref="GeneID:4621158"
     tRNA            815576..815659
                     /locus_tag="AGOS_t0116"
                     /product="tRNA-Leu"
                     /codon_recognized="UUA"
                     /db_xref="GeneID:4621158"
     gene            complement(<815696..>819892)
                     /locus_tag="AGOS_AER094C"
                     /old_locus_tag="AER094C"
                     /db_xref="GeneID:4621159"
     mRNA            complement(<815696..>819892)
                     /locus_tag="AGOS_AER094C"
                     /old_locus_tag="AER094C"
                     /product="AER094Cp"
                     /transcript_id="NM_210308.2"
                     /db_xref="GeneID:4621159"
     CDS             complement(815696..819892)
                     /locus_tag="AGOS_AER094C"
                     /old_locus_tag="AER094C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR419W"
                     /codon_start=1
                     /product="AER094Cp"
                     /protein_id="NP_984954.2"
                     /db_xref="GeneID:4621159"
                     /translation="MAKKSSKGKPAASPAPIDDAKGKKGKKNKEETPKDDGKAKQREN
                     RVKVSATVSWTGKLPHTLLHETVQKRKWNKVEYEMKKIGDKGMLAIAILSYTDPKTKE
                     VLSVRMHDPSYDKATGKGLLVPQETPIEARHYAATVALHRIAFNTNMHMMLPPNHKKL
                     WYALEDFRKQLAKADTRQCDRTFSVDPFKVLLDDRIVKESRKREMEIKKQQEDKMRKP
                     PTLVTSIGQSKANQGKINKPVAARRAVSFPKSVWQSAPFIDLEESSRNLIEITLKKHI
                     DWQSRLHGDVEMQSREDLELQLLFFGFRKAHVTEAMQYKDPLSFLIFNLPEDDLPPFF
                     HKRQEDSKVKVELATLPLATRNMISRLMEFGASYDEVLLALEKTEYNEPEAAGLLTRS
                     VTPMTMSPIEFSEEESSNIWRDELESLSSIYTDKIEVIDRDSCYMIDISGKFNLKLKV
                     YKTKQYPGTLPGIIISTFDKNYKLPNYIKQQIIKNLLHHVINSGLVGDMLVFDMFEWL
                     NENLEGIIENPGPLLIFNGVEDKRQKIITSTDSGVNMKKKSNIRKTLNAAQLKQVKAD
                     YKARIESAAFGKMLKARSKLPAWNKQESITNMVLKNDVVLITGETGSGKSTQIVQFIL
                     DHLIKVEEDYGVKIICTQPRRISAIGLAERVSEERATQCGGEVGYVIRGTNKSTAATR
                     ITFMTTGILVRILQGDITFLKNAIVVVDEVHERSVDTDLIVIMLKNLLGKIQGLKIIL
                     MSATVNVDVFKAYFKDLQTCHIEGRTFPVEDYYLEDVLEALDFKVKRDRFHQDDMRGD
                     HDSAFIRPNVDSKIFKSGQINYELVVETALHIHQRLLDEENDGSIIIFMPGVAEINRC
                     CDKLEQCKFSKEFMVLPLHSALPPDSQKRVFKRFPGKRKIIVSTNIAETSITIDDCVA
                     TVDTGRAKVMHYDPKNHSTALIEAFISKAEANQRRGRAGRVRNGYSYKLYSKDTYTNM
                     ANSPLPEIKRIPLENLYLSVKAMGINDVIKFLGTGIDPPPMNSILKAEQMLTTTGLLD
                     ESGKSLTELGRYISLMPVMDSKHGKLLIYSIIFGCTDLGVLIASVLSIGMTPFIAPFE
                     NRDKIKSILSRYKHKGDILATVEVVRQYLAQREKSARRRYMDENLLSYAKLNEIMSAR
                     SQFYSNLEDVGFLPLGYKPGDIPALNKNCDNLNVIKCILTGAFYPQVARVQLPDPRYM
                     ATSSGSMEMDADAKATKLWIRNEEYIDLISTADPATSIDANKLPATRAFLHPSSVFFA
                     GSVPREQDLVTLDESTANLMVATKMPALNAPFAIYGTANATSKLFLRDLTLTSVLAVL
                     LFGGPLRYDINGTTHSPGMVVDNWLPIRTWCKNGVLIKELRLLLDQAIKQRLERSPIL
                     NTDNPEEEFIRLVLQIVQLE"
     gene            <820095..>821162
                     /locus_tag="AGOS_AER095W"
                     /old_locus_tag="AER095W"
                     /db_xref="GeneID:4621160"
     mRNA            <820095..>821162
                     /locus_tag="AGOS_AER095W"
                     /old_locus_tag="AER095W"
                     /product="AER095Wp"
                     /transcript_id="NM_210309.1"
                     /db_xref="GeneID:4621160"
     CDS             820095..821162
                     /locus_tag="AGOS_AER095W"
                     /old_locus_tag="AER095W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR418C (CDC73)"
                     /codon_start=1
                     /product="AER095Wp"
                     /protein_id="NP_984955.1"
                     /db_xref="GeneID:4621160"
                     /translation="MKLSQLRDLLKHNAELQLLTEDEKITDDISVAKNLKIASEIMSL
                     DELTDFKLEDSQVPLRVVVHCWLHRDSSAADYLADCQTKDLTNVSFLQRNDLIQWLSG
                     TTQVSQYVGPEEGEVVEEGAVAGDVGYQEDEILKEILTRERYLADHNSSLRGSKPRNF
                     GYLIKDVELKVVNQLKSTRRSKPAAGVSKSSISRTPINDPIILIPSAASSIFTIANIK
                     QFLEDSQYINPRELPTVTNDLTTVVKKLDRISRPVKFVIVNNTRLFTKPEYWNRVVAI
                     FTTGHEWQFKNYQWSNPTDLFQRCKGYYFHFAGDVIPKTVNQWNVQKLELEKNKRIKD
                     LEVLRIFWTMMEKELLARGFH"
     gene            complement(<821575..>822166)
                     /locus_tag="AGOS_AER096C"
                     /old_locus_tag="AER096C"
                     /db_xref="GeneID:4621161"
     mRNA            complement(join(<821575..822050,822115..>822166))
                     /locus_tag="AGOS_AER096C"
                     /old_locus_tag="AER096C"
                     /product="AER096Cp"
                     /transcript_id="NM_210310.1"
                     /db_xref="GeneID:4621161"
     CDS             complement(join(821575..822050,822115..822166))
                     /locus_tag="AGOS_AER096C"
                     /old_locus_tag="AER096C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL190W (CNB1); 1-intron"
                     /codon_start=1
                     /product="AER096Cp"
                     /protein_id="NP_984956.1"
                     /db_xref="GeneID:4621161"
                     /translation="MGSAPSKILEDLLDDTNFDREEIERLRKRFMKLDRDSSGSIDKN
                     EFMSIPGVSSNPLAGRIMEVFDADNSGDVDFQEFISGLSVFSGRSDKEEKLRFAFKIY
                     DIDKDGYISNGELFIVLKIMVGNNLEDEQLQQVVDRTIMENDVDGDGKLSFEEFKSAV
                     ETTEVANSLTLQCDI"
     gene            complement(<822309..>824057)
                     /locus_tag="AGOS_AER097C"
                     /old_locus_tag="AER097C"
                     /db_xref="GeneID:4621162"
     mRNA            complement(<822309..>824057)
                     /locus_tag="AGOS_AER097C"
                     /old_locus_tag="AER097C"
                     /product="AER097Cp"
                     /transcript_id="NM_210311.1"
                     /db_xref="GeneID:4621162"
     CDS             complement(822309..824057)
                     /locus_tag="AGOS_AER097C"
                     /old_locus_tag="AER097C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL191W (DPH2)"
                     /codon_start=1
                     /product="AER097Cp"
                     /protein_id="NP_984957.1"
                     /db_xref="GeneID:4621162"
                     /translation="MSEAALVPPALSTNQTEETFNFQQYELLRQDRAAHLGPGITDLA
                     SLKERIRSYYAIESLADHLNSHAEYRSITLQFPDDLLFDSALVAEELQALLPDLQCAR
                     TDAPAQADTTCSCGTQKTCADSKDSADGRKIWILADTAYSPCCVDEVAAEHVQADVVV
                     HFGDTCLNPVETLPVVYIFGEPYLDRAKVISLFTERYDKDAKVCLMANAPYSRHLESL
                     SGELSQLGYSNLVFTDVALPDTPNAAATILGVSDSHPISHKLYASGDRVYYGAKEQLL
                     CEEQLQSFELFHIGLPPDPRLLFLSTKFQGVTAYDTQKRQIAKGPFPAMMRRYRFMHV
                     ARTASTIGILVNTLSLKSTRSLISSLVELIRSCGKKHYMFVVGKPNVAKLANFEPVDV
                     WCVLGCGHGGIVLDHANEFYKPIVTPYELTLALAPELSWTGAWVVDFNTVIDGISADL
                     GLQAGAIPAENVPEFDAVTGKYVGNSRPLRELNHLEIESPQESITTGSTELVKKFSGA
                     LTIGSTVSTSAQFLQARQWTGLGSDFNAEDSYEEEGATVEEGLSGVARGYQYDVSNAE
                     HTDADVPKTSGRVMNT"
     gene            <824360..>825445
                     /locus_tag="AGOS_AER098W"
                     /old_locus_tag="AER098W"
                     /db_xref="GeneID:4621163"
     mRNA            <824360..>825445
                     /locus_tag="AGOS_AER098W"
                     /old_locus_tag="AER098W"
                     /product="AER098Wp"
                     /transcript_id="NM_210312.2"
                     /db_xref="GeneID:4621163"
     CDS             824360..825445
                     /locus_tag="AGOS_AER098W"
                     /old_locus_tag="AER098W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR420W (URA4)"
                     /codon_start=1
                     /product="AER098Wp"
                     /protein_id="NP_984958.2"
                     /db_xref="GeneID:4621163"
                     /translation="MEEIELGVTCDMHVHVREGPMAELVTPTIREGGVSVAYIMPNLQ
                     PPVTTLERVIQYKQSLEQMSPQTTFLMSFYLCRELTPELIHEAAQAGAIQGVKCYPAG
                     VTTNSTSGVDPNDFSAFYPVFRAMEEEGLVLNLHGEKPSVSDDSEDIHVMNAEESFLP
                     ALKQIHAAFPNLKIVLEHCTTAAAVAAIEELNRGVSAAAEVRVAATLTAHHLSLTIDD
                     WAGNPVNFCKPVAKLPSDRRALVRAATSGKPYFFFGSDSAPHPVENKSRHAGVCAGVY
                     SQSLAIPYLAQVFDAHGALPQLKAFVSDFPLQFYGVGRDTLRSGDRAVLYRSRQQVPA
                     HITDGRGIVVVPFKAGETLDWAVRWDA"
     gene            complement(<825489..>825806)
                     /locus_tag="AGOS_AER099C"
                     /old_locus_tag="AER099C"
                     /db_xref="GeneID:4621164"
     mRNA            complement(<825489..>825806)
                     /locus_tag="AGOS_AER099C"
                     /old_locus_tag="AER099C"
                     /product="AER099Cp"
                     /transcript_id="NM_210313.1"
                     /db_xref="GeneID:4621164"
     CDS             complement(825489..825806)
                     /locus_tag="AGOS_AER099C"
                     /old_locus_tag="AER099C"
                     /note="NOHBY514; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0D02904g"
                     /codon_start=1
                     /product="AER099Cp"
                     /protein_id="NP_984959.1"
                     /db_xref="GeneID:4621164"
                     /translation="MLPREAVVAHVGALREGSAELRELLALLPEGVRRDRGMLLECVR
                     GPFFTQAVDGLSRQLRAREAAYGLAQALRYPYRGEGVNGFLDGVREQGRRERAERDGA
                     ERE"
     gene            complement(<825873..>826337)
                     /locus_tag="AGOS_AER100C"
                     /old_locus_tag="AER100C"
                     /db_xref="GeneID:4621165"
     mRNA            complement(<825873..>826337)
                     /locus_tag="AGOS_AER100C"
                     /old_locus_tag="AER100C"
                     /product="AER100Cp"
                     /transcript_id="NM_210314.1"
                     /db_xref="GeneID:4621165"
     CDS             complement(825873..826337)
                     /locus_tag="AGOS_AER100C"
                     /old_locus_tag="AER100C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR421C (RPN13)"
                     /codon_start=1
                     /product="AER100Cp"
                     /protein_id="NP_984960.1"
                     /db_xref="GeneID:4621165"
                     /translation="MDTVRSISARDPVRFRAGVCQYDEESKQCTPKAAGGTVTIQPSE
                     EAEGFYDFVWRPEEEARGADAIELILIPGETRWVHIQSCKTGRVFCLVFSSGEKYFFW
                     MQERSAEDAGALSEQDRQALARIENALRVAEEGGEEEDVEMADAEPSAPEHM"
     gene            <826523..>827095
                     /locus_tag="AGOS_AER101W"
                     /old_locus_tag="AER101W"
                     /db_xref="GeneID:4621166"
     mRNA            <826523..>827095
                     /locus_tag="AGOS_AER101W"
                     /old_locus_tag="AER101W"
                     /product="AER101Wp"
                     /transcript_id="NM_210315.1"
                     /db_xref="GeneID:4621166"
     CDS             826523..827095
                     /locus_tag="AGOS_AER101W"
                     /old_locus_tag="AER101W"
                     /note="NOHBY515; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0G16588g"
                     /codon_start=1
                     /product="AER101Wp"
                     /protein_id="NP_984961.1"
                     /db_xref="GeneID:4621166"
                     /translation="MSRPIETTRAVSTDFPPPRARQLVEEVARELCARGATVAVSEAA
                     CGGLLSSFLVSVPGASRWFHGGTLVYSLKSRLKLSGWSQADIASYTGPSPAVALRLAR
                     NLRFELGATYVLSETGYASAATPADPPAGTAHFGVAGPAGDASWTYVSGCADRRANMQ
                     LFAERGLECLLEMIRRGPPDPEQETSEAAD"
     gene            <827372..>833080
                     /locus_tag="AGOS_AER102W"
                     /old_locus_tag="AER102W"
                     /db_xref="GeneID:4621167"
     mRNA            <827372..>833080
                     /locus_tag="AGOS_AER102W"
                     /old_locus_tag="AER102W"
                     /product="AER102Wp"
                     /transcript_id="NM_210316.2"
                     /db_xref="GeneID:4621167"
     CDS             827372..833080
                     /locus_tag="AGOS_AER102W"
                     /old_locus_tag="AER102W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR422W"
                     /codon_start=1
                     /product="AER102Wp"
                     /protein_id="NP_984962.1"
                     /db_xref="GeneID:4621167"
                     /translation="MGKRFDWQPTGRLVRGRIIRAFLPLKRHPQQLLDNPNYTNLYPG
                     DEVYSFEETADGRWCRVYQVVQPLPEDFISTMKRFSDKLPEEQHRVVVCPKAFVHWYD
                     DEVVTFPFLDLPDEREVKREVAETDVPSLHDLLHRDDLGDLELFRQLRRTRPIRPAYP
                     FFKLFNKTVVDELHVILFQLCAHIYSMYSVGEFEIYEWLTRVYYKMDELRVPYAEDNI
                     LTEEERFFAVQECIALSSKISRYLALKGVSNVFDRKKMFDVDPSGYDAILSRHHQSGE
                     LLAYDALPRYISSVTMLHSLTPNFPISNESDLVLKADQNTMLDPSAPSQLLVDFKDVK
                     GAPEFQRALTRLTAYLYLRTSKKRLTETFAVQVNSDKILTLDNISATLFNNIPATEIE
                     NSRIYLVVELVESLDVAHVDFAYFNDLYPSFVPFQSPNEDQIDQIRKGIAVGVADISR
                     VFTRHRKAISQETVFHYKISLFSSYVKSEHKAERTIQPNGQFHNSTPSGEFCKMKALH
                     AAENNGWGELVDRIILDSDKGIAVTPRALSLTVTVKEITNTNSSILEERKHTSAIKPV
                     PSYFYDVLAEPMDRIYVTIGKVKVCHNFAPDAKMSNITIVISATNKNITFRNGSNESP
                     SDNWKFISVRSGESVGETVRIDGVAAMEKDETLRISAYYGTLLAKAKFYIKKGNQILE
                     YKKHSAFQLMSADNKPLIEVEVGTEYVGQKYNMERTIYDILALWRRPKAVALCLTGDE
                     TEESLSTKIMALKSIDTVQLVKYFDPILVRLLELNYAVLVAEKDKSSANFKDTTFFSL
                     IQFLDKSIIRQETYRNKFNDFIDRFSGENSNLPPVGPVLIASLSKVFLNAQTEWNYVG
                     RTACRAYATVVRLALVSSQNMKEELVTALRGLFNALVGFFSFNKSSALTDHICVLEEF
                     DIVITVVSDYFDCDDLLGICSGFFMACTEKEHSTGMDKNQLNTREQKFVNTKLLLLRR
                     MLDNPPLGQYLFAEEVQSNAVLSFINQVVEWSFQVFLKKNIKDLDMSSIRLANGILVT
                     LLENSKSIILRRNLIRLLPTLCRFFILVWKYTQGNPQLKFGRTFTALFPTNFPFTEIT
                     VDSMVNERAISEPLIELGTILATLAKIVEEIYGHGSSFIQVVEDCANDPIFTSVFYIT
                     RFTKEDIISAVNTVTILTKDGYMPSRKWISLHALFLRTCVTILEMYKSLLIQYNVPPD
                     GNASEFDWELWAAYLNALLLVGNNRVTSTIKLADLPRKAVVRVTGDLRQRIAVTLEEV
                     WSSLLAEPTKEDHDRFAVTPSSLYNVILLKNSPSVLQHVWSFAFQRHSKARSIGTWML
                     WSTCVYSWKLLGHLDTVAELSISILYAVYQNGKVVPSKYCLTNFFTAVMHTVHVRPDD
                     EAFNCVIDYFKNMYSLLHVISEMQDLPAVEEFDDLRTAGQLTIYGYLLATNKPEAFHN
                     LINDLFVRSIKKKDYIQAGLALELLASTYDWTPNDLLPAIKKPPLPLQSSFERKEYLY
                     KEAARNFARGYKLEKAMTIYKDLAEAYEKINYDLNGLAYVHGQIANLYTDLQNVDRLV
                     PSYFKITFLGYGFPTTIRNRVFIYEGLPFEHITSLHSRMMKLYPGTELVQSQEEADGL
                     LVEPPMGRFLHVVSVEPKFDISDGYANTDKRTANNNKVRSYIENRNLKTFSCSRRLPG
                     TTSVTSLWVREFVYETVSTFPTLLNRSEVKSVIEIDRSPLDNAVRSLQVKIHDLSGLE
                     SMCYKLLKDNDDCGELFGELSRELNGTIDAPVNGGIAQYRDFFTLSGPDALNEADLAK
                     LKYLFDELALVLGRCLTLHRELCPPTLMKSYEAMLEQYEKNFGDEIKRNNIDINKLGS
                     EVLEILGVLNGSDHSLNRNITIGSQSSQGTGGKSSTSSNYSSKGTLSLRNGPMLNFMT
                     RS"
     gene            <833254..>833625
                     /locus_tag="AGOS_AER103W"
                     /old_locus_tag="AER103W"
                     /db_xref="GeneID:4621168"
     mRNA            <833254..>833625
                     /locus_tag="AGOS_AER103W"
                     /old_locus_tag="AER103W"
                     /product="AER103Wp"
                     /transcript_id="NM_210317.1"
                     /db_xref="GeneID:4621168"
     CDS             833254..833625
                     /locus_tag="AGOS_AER103W"
                     /old_locus_tag="AER103W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL192C (ACP1)"
                     /codon_start=1
                     /product="AER103Wp"
                     /protein_id="NP_984963.1"
                     /db_xref="GeneID:4621168"
                     /translation="MLSSFIRATPRAFRYASLQRSTPLASAFVVTPLRFYSAAQLNRD
                     EITKRIINVVKAFDRTPTSAEVTEKSVFSKDLGLDSLDVVELLVSVEEEFDIDIPDKV
                     ADEIKSVSEAVDYVASTSDAA"
     gene            <833997..>835046
                     /locus_tag="AGOS_AER104W"
                     /old_locus_tag="AER104W"
                     /db_xref="GeneID:4621169"
     mRNA            <833997..>835046
                     /locus_tag="AGOS_AER104W"
                     /old_locus_tag="AER104W"
                     /product="AER104Wp"
                     /transcript_id="NM_210318.1"
                     /db_xref="GeneID:4621169"
     CDS             833997..835046
                     /locus_tag="AGOS_AER104W"
                     /old_locus_tag="AER104W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL193C (SDS22)"
                     /codon_start=1
                     /product="AER104Wp"
                     /protein_id="NP_984964.1"
                     /db_xref="GeneID:4621169"
                     /translation="MSDSGAPQSKDISESNASHHDGEPVRELRSEIVPDMHPEYLQAD
                     SELTADLPEDTTVIDLVHLKIESLEALDLHRFKKLERLYLRQNLIESISEVEVLPAET
                     VEELDLYDNRIKHISRNVNKLVNLKSLDLSFNKIKNIKNIDKLTKLERVYFVQNKIAV
                     IENLNTLGNLKSLELGGNRIAEIGPESLQGLGGLEEIWLGKNSISRLANLQYLKNLKI
                     LSIQSNKLRNIEGLDELENLEELYLSHNFIEHIEGLEKNTKLTTLDVTANRLTRIENV
                     SKLTALTDLWASFNKIDQSFESLAEELKDLKALETIYLEGNPIQTKNATTYRRKLVLN
                     LGPSLQKIDATYIRG"
     gene            <835224..>836597
                     /locus_tag="AGOS_AER105W"
                     /old_locus_tag="AER105W"
                     /db_xref="GeneID:4621170"
     mRNA            <835224..>836597
                     /locus_tag="AGOS_AER105W"
                     /old_locus_tag="AER105W"
                     /product="AER105Wp"
                     /transcript_id="NM_210319.1"
                     /db_xref="GeneID:4621170"
     CDS             835224..836597
                     /locus_tag="AGOS_AER105W"
                     /old_locus_tag="AER105W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL194C (MST1)"
                     /codon_start=1
                     /product="AER105Wp"
                     /protein_id="NP_984965.1"
                     /db_xref="GeneID:4621170"
                     /translation="MRLPLVRARPWGGARKSIQKRYVASTSADNDTAAVVAREVSSRQ
                     DLYLTDPISPGSTFFLPNGTKVFNKLIQFMKLQQQNKFGFQEVITPLIYRKSLWEQSG
                     HWENYKDDMFRVEGNDCAKEEYGLKPMNCPGHCVMFKRFDRSYTELPLRFSDFSPLHR
                     NEASGALSGLTRVRKFHQDDGHIFCTPEQVEGEIEKCLQLVDLCYGSVLPLGETSDRA
                     ELYTMCLSTRPEKYVGELDVWNHAESVLKSILDNSGKQWSINEGDGAFYGPKVDIKVK
                     DHTGKYHQVATIQLDFQLPERFDMRYKDADNTYKRPIMIHRAVFGSVERFMALLLDSN
                     KGNWPFWLNPHQCMVLPVSASNGEMVQAAKALVDKLCGRDTSSTKPVELNSFHFNAEI
                     DLRDESVGYRLRDAISRKYSYIVLIGARELAQNKVAVRSRDSSKIQMMSTEELYDMFC
                     DLERKYK"
     gene            complement(<836668..>837909)
                     /locus_tag="AGOS_AER106C"
                     /old_locus_tag="AER106C"
                     /db_xref="GeneID:4621171"
     mRNA            complement(<836668..>837909)
                     /locus_tag="AGOS_AER106C"
                     /old_locus_tag="AER106C"
                     /product="AER106Cp"
                     /transcript_id="NM_210320.1"
                     /db_xref="GeneID:4621171"
     CDS             complement(836668..837909)
                     /locus_tag="AGOS_AER106C"
                     /old_locus_tag="AER106C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR423C (ATG17)"
                     /codon_start=1
                     /product="AER106Cp"
                     /protein_id="NP_984966.1"
                     /db_xref="GeneID:4621171"
                     /translation="MSSSNQVKGFYFNAQRRLSRAQALCQNSQDTLHNMQLLLVRWQR
                     TVSKLQFTIHCICNQTVFLAECILKKTVGQQLIETEWKRMLLDELQGEMQRSQEEITG
                     KIDALRRTKNELDGSGATLADFISMENIFLLGDKLKDVPVVQEQVEHIKVQYESLVDK
                     VVEQLQNNRVRKLEADFAAAFRSGKNDFNAFSMKYLQKIRQLETDLADILKSLTDHYD
                     KCSLLKAGDLPAAEQAELFEVVKNDDQELDSIMGVLEVIVRDIKSLAKNVSIRLRQKE
                     RDKQQLKNAMGKAHSELLKYEEHLTVFQGIDDLIRNFKASCLHNVSKVRELCEFYDNF
                     LNSYQVLLREVERRRRVAKQMEDILQACEGQLMALSDTDLKQRQQFLMRHGDYLPENI
                     WPGNIDDLSPLYDLEYRIKKV"
     gene            <838014..>839924
                     /locus_tag="AGOS_AER107W"
                     /old_locus_tag="AER107W"
                     /db_xref="GeneID:4621172"
     mRNA            <838014..>839924
                     /locus_tag="AGOS_AER107W"
                     /old_locus_tag="AER107W"
                     /product="AER107Wp"
                     /transcript_id="NM_210321.1"
                     /db_xref="GeneID:4621172"
     CDS             838014..839924
                     /locus_tag="AGOS_AER107W"
                     /old_locus_tag="AER107W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR424W (SPP382)"
                     /codon_start=1
                     /product="AER107Wp"
                     /protein_id="NP_984967.1"
                     /db_xref="GeneID:4621172"
                     /translation="MEGISHLAQQDGNPTGSVMQPKRRRVEDGASSDGEVRGEIKRKY
                     GIGAQLMAKMGYKEGSGLGKEGTGRTTPILVEQRPQGMGLGANVSISSDSEQSEVELV
                     TREAVKFESKGVETDTSRIADKIAKLEIAGVQVPAEVMSLRSGTKTLGYQRAAAMERV
                     LSELLQVGEQLATLQLREDQLQQGLDAAIQSSDSVEQVLNALQQPTALPERVAAILAL
                     EDPETVDILCASSIREYFTECKDWDPLDPLDPSYLILLELVDVLSYVMDSSTSTLNQT
                     QTVIYNIVWERLHGFWTNIDMQKGHVLAGILLDYKSILDFVHCSDYIYGNYVSAQLAH
                     ILERWDVSELLVDHSAITDLVLILPPHISDEIRQLVQAKFTEYCSAWYHRDSPIPVPN
                     LVFIRQLLGEGTVEDISRRCLLPNFIDQLWEKYFDPTFELEDPACNDGSLYFVARLRE
                     CEDLLPSKEYRMILRAVFDRLNRLLYQWHLYCPQRAAEARSWFNWYINSGFHAPTNTQ
                     VQEIKRTLRFLAEPGTPIHDEQLDLVAALGLAPENKETLQNLPLARVSVTFKDVVTDY
                     CEAHGLLLEKTGDVATLRVYQHARTVPVFTVTHVHRRRRVALCEDVLWVQEGIGFKPT
                     YLYELETLLKSA"
     gene            complement(<839963..>840763)
                     /locus_tag="AGOS_AER108C"
                     /old_locus_tag="AER108C"
                     /db_xref="GeneID:4621173"
     mRNA            complement(<839963..>840763)
                     /locus_tag="AGOS_AER108C"
                     /old_locus_tag="AER108C"
                     /product="AER108Cp"
                     /transcript_id="NM_210322.1"
                     /db_xref="GeneID:4621173"
     CDS             complement(839963..840763)
                     /locus_tag="AGOS_AER108C"
                     /old_locus_tag="AER108C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL195W (MIA40)"
                     /codon_start=1
                     /product="AER108Cp"
                     /protein_id="NP_984968.1"
                     /db_xref="GeneID:4621173"
                     /translation="MFRQVSVRALRRAAGRSVCASRAQMVRHSSTLGGGKGSYNLDMP
                     ALALAAGVTLLAGYMVYPRAPKAKQAAVQSVAPVNENVEQASASLQASAPVQATSESA
                     EAGEEEAYGEESGAVNEEAAGEPEEAAAEVGETQAEQAPAVETEQAAEAEQAAEAAAE
                     DKASAGEAAQGQQGAYNPDTGEINWDCPCLGGMAHGPCGEEFKAAFACFVYSEAEPKG
                     IDCVEKFQVMQDCFRQHPEHYAEQLESEEQAVRETEAAAESAKSDEGH"
     gene            <840977..>841579
                     /locus_tag="AGOS_AER109W"
                     /old_locus_tag="AER109W"
                     /db_xref="GeneID:4621174"
     mRNA            <840977..>841579
                     /locus_tag="AGOS_AER109W"
                     /old_locus_tag="AER109W"
                     /product="AER109Wp"
                     /transcript_id="NM_210323.1"
                     /db_xref="GeneID:4621174"
     CDS             840977..841579
                     /locus_tag="AGOS_AER109W"
                     /old_locus_tag="AER109W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL196C (YKT6)"
                     /codon_start=1
                     /product="AER109Wp"
                     /protein_id="NP_984969.1"
                     /db_xref="GeneID:4621174"
                     /translation="MKIYSIAILRNSGNKALELCSAKDLSQFGFFERNGVSQFMTFFG
                     ETVAGRTGAGQRQSIEEGNYVGHVYSRSEGLCGVLITDKEYPVRPAYTLLNKVLDEYL
                     VAHPPAEWRDIAQTSDQLKLRELEMYLAKYQDPSQADSIMRVQQELDETKIVLHKTIE
                     SVLQRGEKLDNLVDKSESLSASSRMFYKQAKKTNSCCLIM"
     gene            <841780..>845697
                     /locus_tag="AGOS_AER110W"
                     /old_locus_tag="AER110W"
                     /db_xref="GeneID:4621175"
     mRNA            <841780..>845697
                     /locus_tag="AGOS_AER110W"
                     /old_locus_tag="AER110W"
                     /product="AER110Wp"
                     /transcript_id="NM_210324.2"
                     /db_xref="GeneID:4621175"
     CDS             841780..845697
                     /locus_tag="AGOS_AER110W"
                     /old_locus_tag="AER110W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR425W (TUS1)"
                     /codon_start=1
                     /product="AER110Wp"
                     /protein_id="NP_984970.2"
                     /db_xref="GeneID:4621175"
                     /translation="MYDAYRDRDHDMDETKPKLPQLPPLVTKAAAGIDHRTRIAWTPF
                     DDHERPTGLGQGKGLGGARSRRPPPPPAEGLGVGVPAGHRLSGDGTRPGRTEEAHTPE
                     RGGTPEAEEGIIYPSPFVGDDTVTMVRGPRGSPTGRGSPTARGSPGRLPGSPVGRSSP
                     MRRRSPSGPQVSPVGRGSPGGPRGSPARCAELPDVMFGDEEPALRPLPGLSAAREGIP
                     PSVSTVGSRRDHKPGLHSAAPSSRARLLSDRTFSETLSSYYTCSSYTFNEYARHGSFG
                     SVMGGQPLEHVPSVNAPTQPLSIELLSEEKLYQCYCVHKLSDIYEWLLKVYFEWFNEY
                     ILGKIEFIQLVQLLLEFQLPNTYEQEVIDKNVDHIIGSLVKQGAVRFEPNPQQTRGDI
                     TIIVAGLNVQGVFTELLSCYSLTHKKEMNTEEGYVCYSKLCASQMFNETRPLMRVSEV
                     LSRPVGLWTEYWKLTDEELSEINPKEVKRQSYIFDLIVLEEKSLNLAHAAVEIYGAQF
                     SPALLPTDENFASLAFDIFYPLIDLHKELLLTPIFGKLQTKGKFIDGVGKIYIKWCNE
                     ARATYLHYAESMAVVHEIISWEKQHETRFAAWLKEIDESPEITRSKLYHDVIFFGGFF
                     KSLQNMPVTLRSILKCTDPSMDDYEYLNTAINEIEKLSTEVDTVHGMAVDQRKIVRFS
                     RQILFSSSSATVGYVNINDEDKVIRQEKLNLKLTEKTRKLLREGVVYKKRELWLDPVP
                     VYIVLLDNYFLITEIVTKGNEKKYKLTERPIPLDYLSLERKEDLKANSAEKEVTLMNV
                     NSNNIDGLTAKSPSPNQLADPSNVPRHVYRTNASTMALDVPDDLIYSFKVRNTATNDS
                     FTFHTFTVEERDAWISAIVESFRIHTETNDQRVFKLHVLSDLFKYDERQAPTNLLVAP
                     EGSVIDVALKDYKKTQREKKTPVAADINCSGKFVYESKTFVICGSNHGIYMTIADNPT
                     GWKLVLHVLKVVQVEVSLKLNLLFALSDKRLCYFSLPSLICAYYDPVQYLPNNQVVGV
                     ILQDKVTYFTMAEDFGNSRQLFFERKGKIVVLTPELDAITAAFKLFKPYKRYKLPLTS
                     SFTSVEVYGIVVFRTSFIVCTSKGAILYNDTFNDHGITLPQLLNDPDLVQRLNHMQIA
                     NNPFKTTMEAAARHDSSKQKMAEYVKFDIAANKTRPVTCFQLSPNDFILVYDEAVIRM
                     NKYGEIANWKADILVLDFYCTAACMTSEFLILTGENLVQIYDFNYTGNIMNNALSRLT
                     PVQIIKGKKIRLLNASKTPDPVIALSHPSYPGRQLLLAFSLTR"
     gene            <845989..>847024
                     /locus_tag="AGOS_AER111W"
                     /old_locus_tag="AER111W"
                     /db_xref="GeneID:4621176"
     mRNA            join(<845989..846068,846121..>847024)
                     /locus_tag="AGOS_AER111W"
                     /old_locus_tag="AER111W"
                     /product="AER111Wp"
                     /transcript_id="NM_210325.1"
                     /db_xref="GeneID:4621176"
     CDS             join(845989..846068,846121..847024)
                     /locus_tag="AGOS_AER111W"
                     /old_locus_tag="AER111W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR426W (TDA5); 1-intron"
                     /codon_start=1
                     /product="AER111Wp"
                     /protein_id="NP_984971.1"
                     /db_xref="GeneID:4621176"
                     /translation="MNTDLFAQLVLVPILRFPIAFCVLLSRVLDTPCPRLAAALTVYT
                     VVVNACLSANRRAKLAGPWTPLEQMPDATCVLTGGAQGLGACILRNLLAQFPRLTVVV
                     VDVADPAVVHRRVRFLRADLSKPADVERVLEQVTREYSRVDVLINCAGMRSRYQGLQA
                     VAPEELHKTFQVNVFAPQRFIQKLAPRDDRQFYLVTVGSTLGILAPARLSAYAATKAA
                     TIAYHDSWTFELLSSGRQRVRTLLVVLGQMDTRMFQGFRPPRQFLAPVLESEELARRI
                     VHCCSIGMRGQLCAPLYVNFMYLVAALPYTLLRLARQFSQMDVCLPEETDT"
     gene            complement(<847042..>847551)
                     /locus_tag="AGOS_AER112C"
                     /old_locus_tag="AER112C"
                     /db_xref="GeneID:4621177"
     mRNA            complement(<847042..>847551)
                     /locus_tag="AGOS_AER112C"
                     /old_locus_tag="AER112C"
                     /product="AER112Cp"
                     /transcript_id="NM_210326.1"
                     /db_xref="GeneID:4621177"
     CDS             complement(847042..847551)
                     /locus_tag="AGOS_AER112C"
                     /old_locus_tag="AER112C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML055W (SPC2)"
                     /codon_start=1
                     /product="AER112Cp"
                     /protein_id="NP_984972.1"
                     /db_xref="GeneID:4621177"
                     /translation="MSNAINVYSAPEVHTAIEESLPAVFSRLGYKQDFRLLDTRLLLG
                     YLTAITAAVSFVLDRKFKWDDVLIYQKALVGLYVVFSSAFWLFSRYGERHAVYQGQQG
                     QERITVRMQPEPGSEHSLVTLEDGAGGRLEARLAAPGVFSADGHLQFGKLHRWFEEQL
                     GLLVQKKRQ"
     gene            <847768..>849765
                     /locus_tag="AGOS_AER113W"
                     /old_locus_tag="AER113W"
                     /db_xref="GeneID:4621178"
     mRNA            <847768..>849765
                     /locus_tag="AGOS_AER113W"
                     /old_locus_tag="AER113W"
                     /product="AER113Wp"
                     /transcript_id="NM_210327.2"
                     /db_xref="GeneID:4621178"
     CDS             847768..849765
                     /locus_tag="AGOS_AER113W"
                     /old_locus_tag="AER113W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR427W (MAG2)"
                     /codon_start=1
                     /product="AER113Wp"
                     /protein_id="NP_984973.2"
                     /db_xref="GeneID:4621178"
                     /translation="MAGRAGIANPLHQLDRESFHHDRTTPARPQQKAGRTPEQAQHVR
                     MGLQNTKGACGADGKARSSENGAARGGLNEGQRATHAPAAGAARRRSGRGRGGYGSGR
                     RRGERPAQSQGAAEDDLEARIQGELQKGAFRAHGRRAQISIGHLLELEVGESAARGGG
                     AGCERPGARRRRRRGSEEHVHLQGEAYVNASYRFLVDPRADCAAQTVDPNVPLPADSI
                     RRVVAPRGQACPICLAEEVVAPRMAPCGHILCMTCMLQFFAAETGREVARAPGAYVRR
                     PPKECPLCGSIVRKERCMPVLLADDAEAAREPVAGQEVELQLMCRPRGSLLALPVRLG
                     VDPAAVGPFPPAGDETLAQYCRVLTCDASYARQLYMRDIEAIQTQCEIDRALYNDGGA
                     FVAPAIAEIEERIAQCADDEPSLPDLERLSLAALPEYDDSNAYFFYQTAFAAVTRYFL
                     SPLDVRLLRETFGAYAHLPPVLRVRIEHVHRGSVVTDATVQRHRYFGHLPTGCELAFL
                     DVDWRGHPAVPHAVFQHFAADLATRRRQLRVRQLREDKLKKRYEEQLEREQSDFYQRE
                     NGSLPQLSAPPRPAAATFQSLVDPTDSPADHIEPTRLQSTVWGTKILLSEQDPSPEDA
                     AFEQMLLQLSEEHTRPVSGKRNKNKKSLVTLLSSNQARGSL"
     gene            <849910..>851869
                     /locus_tag="AGOS_AER114W"
                     /old_locus_tag="AER114W"
                     /db_xref="GeneID:4621179"
     mRNA            join(<849910..849914,849973..>851869)
                     /locus_tag="AGOS_AER114W"
                     /old_locus_tag="AER114W"
                     /product="AER114Wp"
                     /transcript_id="NM_210328.1"
                     /db_xref="GeneID:4621179"
     CDS             join(849910..849914,849973..851869)
                     /locus_tag="AGOS_AER114W"
                     /old_locus_tag="AER114W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR429W (CRN1); 1-intron"
                     /codon_start=1
                     /product="AER114Wp"
                     /protein_id="NP_984974.1"
                     /db_xref="GeneID:4621179"
                     /translation="MSGKFVRASKYRHVFGQSTKKELFYENLKVTINAWDSNLIKTNG
                     KFISVTWNSSGGGAFAVVPVEEVGKAPDQIPLFRGHTAQVLDTDFDPFDERMLVSGSD
                     DGRIGVWEIPATYSFHNAQDEDGNVEHVAPVKFLTGHQRKVGHVLYHPTAQGVLASSS
                     LDHTVRLWNVEQGTNPIVLTHPDMVTSMSFSYGGTYLATVCRDKMLRVWDIRKGEVVS
                     EGMGHSGPKNQRVVWLGNSDRLATTGFSKLSDRQIAVWDAFNLEKGQLGGFYNVDQSS
                     GILMPFYDDSNKILYVAGKGDGNIRYYEFQDDELYELSEFQSTEPQRGFAVAPKRSVN
                     VKENEVLRAYKTVRDQCIEPISFFVPRKAEVFQDDIYPDAPSGKPALTAEEWFAGKSV
                     DGPILFSVQSLYDGSDPVFCPTDNSPARGTEASSPKRPAQKNSSPARSSPVRREQAAA
                     SDAATTKTAPTKASAVKAASPRPSTDADKLLQTDDTVNQMLQKACSFDEVNRAENPAR
                     DTSGWDSDDEKSASPKLSPMRKASNSRTRLSPQAVAHETPHRDLSPMARESPRPRLQV
                     DGHPTTPLSAKSMDLRQSVEKLSALVQQLDTVATKLAAAADEKDQRIKKLEERIQQLI
                     DSQSSQRSR"
     gene            <852205..>858288
                     /locus_tag="AGOS_AER115W"
                     /old_locus_tag="AER115W"
                     /db_xref="GeneID:4621180"
     mRNA            <852205..>858288
                     /locus_tag="AGOS_AER115W"
                     /old_locus_tag="AER115W"
                     /product="AER115Wp"
                     /transcript_id="NM_210329.2"
                     /db_xref="GeneID:4621180"
     CDS             852205..858288
                     /locus_tag="AGOS_AER115W"
                     /old_locus_tag="AER115W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR430W (SEN1)"
                     /codon_start=1
                     /product="AER115Wp"
                     /protein_id="NP_984975.2"
                     /db_xref="GeneID:4621180"
                     /translation="MSGAVSMEELERLALGYKNKIEQVYEGVYHNESDLLTDILHNLI
                     PRLGGDDVHLFCNRHFQPVAVFSLTLFSFQNHPEAVQWLQARLNAPLSRCRECVTQFV
                     KGKSKMIQHFAVNRRIPHAKVGSFNELICMWRAQMVLPLLRDFDACKVSDAVILAMYE
                     ILLNPQMLRCSPELKYYYDLAFKGMYETGHELLDHTKEQGINLLVPGVVYSQMYGCPE
                     QSSWATRLLRHFFENEYSITNENVTTELLDEITYHFIQLQLSRSNSSYLSMIGLFWSK
                     MCPFFALMHVDVLKEYFIELKNIKSLRSTTNVHIESVFKVFYHHLIMQVRSKPLDILL
                     RILKLFLEKLGPEFWDLVQPYTFHSAPDTLFNGDFTNCILRLQNNPICKEGPDTWLHP
                     EGSISDLVMWTLPYYRSLSKAYKIQMVRKIAFGFLGVVNSSSFIHSVPKGLLMNAATL
                     LLNQSLKIDEESRALLYSSDGNFETTIFTIADVRNPLNNEATLKTVVDTATNPDALYP
                     GFPTASISNSAIEVLANCVNVDILNLCETTYKLYYGKVPNPKTTHEVKVSTLLITKLV
                     SSLNLRMDATCNSKAAALLGSLRNVNGLLVLKDNGDKHSIQQNHMTQKYLELIIQLIG
                     KCSEIPPRTMSSVLSMKGAIEGFWSCIFSPGQELYQEATNLLYETFDVEGRLEGFQEL
                     FNHNLTGNLQAICMVLNQLIKNEFYEPCPRAVRVLMDVINVFTDPVSGMFANYKTLKT
                     AETDASLFAFWKDTWKFLDMIYRVTLRWATKYPYTELENFTKDTLEISNLLMNSYREF
                     ADIITRDSTNNDDDLFKCAMSPFKHMLYWLRLSDEDLLASCVNLIVSAADLSKEKNFT
                     FDDSLVSEMACYASKSRKYLNKLTSQQSNLLLSRAKYFNEKLTETIIQDADKYHKEKE
                     QAKKDSSPDVIVSSSHSVTQMAQPQQRVDYLQRKAVASSITGRPKVQSSITSFGVLKR
                     GFVSAPSIPPKPLSKMELERRKLLADRVVHPPSQNVFNPRSKKQLKGHEDGDSSSENS
                     DIDDANELFAIAKPKQRSTPVLLDINGKEVRPQKSKIDIKKQEEEFMRKRLNVDLNPF
                     YDQVLRWDYTKKDEYPDDGTSEKYKDVADQFSSPEEYQAVMEPLLLLECWQGMCAARD
                     REVHKAFSFIVGNRTVVSDFYEVYAAISKKVVQQADINEADMIVLGYFPDINPNKTLT
                     NDDFKRAQHTCFAKVRGIKNAKGDNMDLTLRIHRSHKFANFLTLRTEIHAVKVMQMTT
                     VEREYTSLKGLPFYDLVGQILTASPTDDIPLEQSEVEAVQRNYKLNTSQAKAVISSVK
                     KLGFSLIQGPPGTGKTKTILGVVGFFLTTAKALPSNVIRNPTESNATSTEMLLQKQKV
                     LICAPSNAAVDELVLRLREGLVDTDGKLFKPKLVRIGKSDAVNAAIRDLTLEELVDKR
                     ALNQSYEINHDPNLDQSFHDAVAERRKLRDMMNKEDGSPTSKLSTDEISKIQLKLRDL
                     SKKINELGKQRDELRERNAVNYRNRELNKRKAQARILAESDIICSTLSGSAHDVLASL
                     GVKFDTVIVDEACQCTELSSIIPLRYGGKRCIMVGDPNQLPPTVLSGAASNFKYNQSL
                     FVRMEKNCKPHLLDVQYRMHSMISAFPSLEFYDGRLKNGPNMDQVNTRPWHESQPFGP
                     YRFFDIITGKQQQNAKTMSYVNYDECQVSIEMIDKLLSQYEKKVDFSGKIGIISPYRE
                     QMQMMKRAFRSYFGGTIFKYIDFNTIDGFQGQEKEIIIISCVRADDSKGGVGFLKDFR
                     RMNVALTRAKASLWILGHHKSLYKNKLWMHLISDAKGRDCLQMACPGFLDPRNRAAQD
                     ALHRFKNHHNYIENADDYGPEPVMTKSRGRNRSSRKRKHMEDNPDDNYDPVAEFKKEN
                     QRESNTGTGGYRADTSNHRLAPARNDSKKAKTCSNAAGISEATSEDGDRGQKGHGTKK
                     KSSIFGNFMPPVDDATPAAHVYDPKERKPKNAASAKRLALGAEGGTKSARHISFSENV
                     SFIDSKESSKD"
     gene            complement(<858363..>859586)
                     /locus_tag="AGOS_AER116C"
                     /old_locus_tag="AER116C"
                     /db_xref="GeneID:4621181"
     mRNA            complement(<858363..>859586)
                     /locus_tag="AGOS_AER116C"
                     /old_locus_tag="AER116C"
                     /product="AER116Cp"
                     /transcript_id="NM_210330.2"
                     /db_xref="GeneID:4621181"
     CDS             complement(858363..859586)
                     /locus_tag="AGOS_AER116C"
                     /old_locus_tag="AER116C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR431C (ATG23)"
                     /codon_start=1
                     /product="AER116Cp"
                     /protein_id="NP_984976.1"
                     /db_xref="GeneID:4621181"
                     /translation="MNHERILEKRETILQYCHRLTEMHRAALFDEEESPRNLSLQQLR
                     KNIHICLKDLCRLNTWLTEQDGGFRKALGSLERYESKLAALLAKERQLGEERQAWEAA
                     VPAGAGDDSGGVFTVHGGHQRHLNAYIESMGVDNTGLGKEPDALPRLSRQQALGHVAV
                     LRLAQAAVSREISQAEGLLKSFRKDQTFIKAELAKLEAFVRAQKLAVERELEGVRRSQ
                     EHIFRKIGLLKLPAREREPLGLGRRPAADLESMKAQMEEFLHVRKSALKAMLSEHKQE
                     TQLLKSQQEVWKEVTTLVEDLEDRIRTRFATAAKVDPVELRRLITDAITQIKSLHYEE
                     SYPDVLTCIRDEIAALEKANDQLPFSKQKSITDKLVPVNTGAGFLVNSTSPPKVGLTK
                     SIVPSSSMATNKKSV"
     gene            <860733..>862462
                     /locus_tag="AGOS_AER117W"
                     /old_locus_tag="AER117W"
                     /db_xref="GeneID:4621182"
     mRNA            join(<860733..861186,861348..>862462)
                     /locus_tag="AGOS_AER117W"
                     /old_locus_tag="AER117W"
                     /product="AER117Wp"
                     /transcript_id="NM_210331.2"
                     /db_xref="GeneID:4621182"
     CDS             join(860733..861186,861348..862462)
                     /locus_tag="AGOS_AER117W"
                     /old_locus_tag="AER117W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML056C (IMD4) and YLR432W (IMD3); 1-intron"
                     /codon_start=1
                     /product="AER117Wp"
                     /protein_id="NP_984977.2"
                     /db_xref="GeneID:4621182"
                     /translation="MTYRDAATALEHLATYAEKDGLSVEQLMDSKTRGGLTYNDFLVL
                     PGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCT
                     AEEQAEMVRRVKKYENGFINAPVVVGPDATVADVRRMKNEFGFAGFPVTDDGKPTGKL
                     QGIITSRDIQFVEDETLLVSEIMTKDVITGKQGINLEEANQILKNTKKGKLPIVDEAG
                     CLVSMLSRTDLMKNQSYPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVL
                     DSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSIC
                     ITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGM
                     LAGTTESPGEYFFRDGKRLKTYRGMGSIDAMQKTDVKGNAATSRYFSESDKVLVAQGV
                     TGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEG
                     GVHNLHSYEKRLFD"
     gene            861218..861297
                     /locus_tag="AGOS_AgSNR54"
                     /old_locus_tag="AgSNR54"
                     /db_xref="GeneID:4621183"
     ncRNA           861218..861297
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR54"
                     /old_locus_tag="AgSNR54"
                     /product="AgSNR54"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR54; start and end coordinates are
                     approximate; in synteny"
                     /transcript_id="NR_149399.1"
                     /db_xref="GeneID:4621183"
     gene            complement(<862755..>864500)
                     /locus_tag="AGOS_AER118C"
                     /old_locus_tag="AER118C"
                     /db_xref="GeneID:4621184"
     mRNA            complement(<862755..>864500)
                     /locus_tag="AGOS_AER118C"
                     /old_locus_tag="AER118C"
                     /product="AER118Cp"
                     /transcript_id="NM_210332.1"
                     /db_xref="GeneID:4621184"
     CDS             complement(862755..864500)
                     /locus_tag="AGOS_AER118C"
                     /old_locus_tag="AER118C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR433C (CNA1) and YML057W (CMP2)"
                     /codon_start=1
                     /product="AER118Cp"
                     /protein_id="NP_984978.1"
                     /db_xref="GeneID:4621184"
                     /translation="MVRLSWSGDREQQSSSKQEMPSSDLLHEAHENTRKINAALNVIE
                     SKPQDGTGRKKSLSIYTLEDGTKVSTKKRVVKSVPPVAKRLPTDEELFDADGLPNHEF
                     LREHFRKEGRLSEEQAVRILEMATDILSREPNLLQVSAPITICGDLHGQYYDLLKLFE
                     VGGDPKTTPYLFLGDYVDRGSFSFECLLYLYSLKINYPDHFWMLRGNHECKHLTSYFT
                     FKTECLHKYNLRIYDLCCHSFNALPLAAVMNGQYFCVHGGISPELKTVEDVNRINRFR
                     EIPSRGLMCDLLWADPSETYDEDADDPSTLAYTPNIIRGCSFAFSYKASCEFLQRTGL
                     LSIIRAHEAQDQGYRMYKNTKNLGFPSLLTLFSAPNYLDTYKNKAAVLKYSDNVMNIR
                     QFNMSQHPYWLPNFMDVFTWSLPFVGEKVTEMLVSILNICTEEELEEETFVIREDLGA
                     TLKSKNTEQVVTVIPGSKKSKKKRSILDDDAKRRALRSKILAIAKVSRMYSVLREESD
                     KVQYLKTMNSGVLPRGALSRGSEGLNEALSNFERARRADLENERLPPSLADVEKSREQ
                     YYRKKLEEFNEKEEK"
     gene            <864833..>865450
                     /locus_tag="AGOS_AER119W"
                     /old_locus_tag="AER119W"
                     /db_xref="GeneID:4621185"
     mRNA            <864833..>865450
                     /locus_tag="AGOS_AER119W"
                     /old_locus_tag="AER119W"
                     /product="AER119Wp"
                     /transcript_id="NM_210333.1"
                     /db_xref="GeneID:4621185"
     CDS             864833..865450
                     /locus_tag="AGOS_AER119W"
                     /old_locus_tag="AER119W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR435W (TSR2)"
                     /codon_start=1
                     /product="AER119Wp"
                     /protein_id="NP_984979.1"
                     /db_xref="GeneID:4621185"
                     /translation="MTTHIDVTDYVEAETGRGSLQFSDEKQQARFALGVCMYVYRWDA
                     LSIAVENNWGGPQSAEKRDWVSSILLDLFKNERIVDVTLIEETLLFAMADEFETNVED
                     DSALPIAAGIINLYRQCEAGNYNEVDQMYAQWQANKQNQTSRKVQVVADPHNPDISES
                     EDDDNCDEEDEEMGDADEGEAQARPVPELDEDGFEIVKKSGRRRH"
     gene            complement(<865505..>869614)
                     /locus_tag="AGOS_AER120C"
                     /old_locus_tag="AER120C"
                     /db_xref="GeneID:4621186"
     mRNA            complement(<865505..>869614)
                     /locus_tag="AGOS_AER120C"
                     /old_locus_tag="AER120C"
                     /product="AER120Cp"
                     /transcript_id="NM_210334.2"
                     /db_xref="GeneID:4621186"
     CDS             complement(865505..869614)
                     /locus_tag="AGOS_AER120C"
                     /old_locus_tag="AER120C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR436C (ECM30)"
                     /codon_start=1
                     /product="AER120Cp"
                     /protein_id="NP_984980.2"
                     /db_xref="GeneID:4621186"
                     /translation="MGNSDSKLTAYREHIEKLAGPKEIPLYSCKSTSHAAVLFYKQHG
                     SDSQSAGNESSREGTGEPSGGATAREPGSGAGIMGWRTLRRNGKPATPGTSSARSVSM
                     RSARPASARSAPVRSASVRVANAQADGGRSAASAGVPEAPEAAGEGDIYCEFFTCLAQ
                     ERFSAEDIYALLSAHELRHIFMSNSRNYQNLVRFACFKICSLTTQLQMKRSEEDFNKR
                     CMEAINCIRILTKIMPVFFEMDKDESLEKALMWDRNSAEVTNYNAKSASTTAATVGAS
                     LSSPEVDPFGFNLASPAPLGDVSSPSARGSRLGLSPDSLCVAVGNNSLGEEVVPLGVI
                     LVQSCLNLLFMEGFTLPVSPHKHGQESDLHTDFYAQGYGRVSFSLWEPGINIEEMSSA
                     PANPRLDSNRLEILRLLITLCSTNLYKQDAINRYLTVLCTMMPNYNTVCLVSSLVNVL
                     CKYCSETDENHYNPQTYSSQVKTSQLNLLRKSLSGACISMLNLMLRFQLPEENTAVNS
                     FVYSLSSIQVKQVIEHTPKAYLSSLSKEFDLKLILRSLASIIKSPMDIAVEQESNPFT
                     WSQPGSVDRRHTSNGIGPSSAGQQGPHNPAIVPIRSASAQGANGVAKQNGFQGNNYRP
                     QSSSTSSSGSFNSATTELFSLNLQAFVFLWELMKCNRAFENYVADKYSNKLILVSIFY
                     LKYYQDVPEFSTTLIPVIGGFVTYLSSKNLVLYKMMDPLNLNYYTNKIPNIFKLSSGN
                     ITLTTYRDFAIIHLSNIAITQVTNQLPLKPYMFELIYNLLSTPSEFTGDELSLLSSNK
                     RSAHSTGLSYQASTNLLLLLSKMATMGYLSTSSYSETSRKSYTYSSGAKLDNLALLLR
                     GILTYILFYFQDSKNLLFALCRNERIIYQLDNALKEFSDGLTEDQLRQLYSPDDRRSR
                     KLLDKEDDMAMPRMSHLNDSRRVFTNHALYFNPYIENDVPDQTSPNENDDYSGSDDEN
                     DLDDANNFGPTWAGPAGISLANNKSAKVYEHLDYDRDLTMKDTKLYLSLRPTWPLGLT
                     LRGKWKTKLHTPLHKGWLGAATLSQLMQVVRVVNGQFPQIAEIKTNQYYDLLKKIGDW
                     EQEFLHTIETSLTPEIKAMDGNYETLKLDWDENSTASRWYLSVIWGNIFTAHSHPYSL
                     SAVDKAAYKQHNLTSRSSLDNSTANYNTSRADSASSVVNSSLGSDYPPNGANAASPNL
                     GRPSWHSAASSRDISSKESQTSSNYTSNGASSVFRMGWLNFSRGVAGSDRDNGTADSG
                     TRSQSRQFVPDVGLLRPNIWVGTRITMFKVKVEIKEEFSLMEMTGSFFRSLRLNTSAT
                     LNSSDYYCGSAADNRGHSPADTRIRAQRRSLSGQQSLLPTKPTMLASYK"
     gene            complement(<869973..>870557)
                     /locus_tag="AGOS_AER122C"
                     /old_locus_tag="AER122C"
                     /db_xref="GeneID:4621187"
     mRNA            complement(<869973..>870557)
                     /locus_tag="AGOS_AER122C"
                     /old_locus_tag="AER122C"
                     /product="AER122Cp"
                     /transcript_id="NM_210335.1"
                     /db_xref="GeneID:4621187"
     CDS             complement(869973..870557)
                     /locus_tag="AGOS_AER122C"
                     /old_locus_tag="AER122C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR437C (DIF1) and YML058W (SML1)"
                     /codon_start=1
                     /product="AER122Cp"
                     /protein_id="NP_984981.1"
                     /db_xref="GeneID:4621187"
                     /translation="MCLYVNKEHPYTQASGPWPACLPRRWQLYKDQRRLHRPGGRRPM
                     STSDSHLGSPRKRQLQRAAPAAPQHSEYQQQLSTLGMRIRQAVDNGYRAPQDPVRAAV
                     PHAVPAAACVQDNTLYTVPDYKRVPLAADRAPPMLVNQRTVSSTSSLQAWESQLDERL
                     SLIDSSIMHNKLGAGEFMLGGTKRAFDQLETDNW"
     gene            <870925..>872229
                     /locus_tag="AGOS_AER123W"
                     /old_locus_tag="AER123W"
                     /db_xref="GeneID:4621188"
     mRNA            <870925..>872229
                     /locus_tag="AGOS_AER123W"
                     /old_locus_tag="AER123W"
                     /product="AER123Wp"
                     /transcript_id="NM_210336.1"
                     /db_xref="GeneID:4621188"
     CDS             870925..872229
                     /locus_tag="AGOS_AER123W"
                     /old_locus_tag="AER123W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR438W (CAR2)"
                     /codon_start=1
                     /product="AER123Wp"
                     /protein_id="NP_984982.1"
                     /db_xref="GeneID:4621188"
                     /translation="MAVEFNLSSKQTVEYEQEYSAHNYHPLPVVFHKASGAHVWDPEG
                     KEYLDFLSAYSAVNQGHCHPEIVQALVDQASRLTLSSRAFSNDCFAAFAKYVTEYFGY
                     GMVLPMNTGAEAVETALKLARRWGYMKKGIAADEAIILGASGNFHGRTFGAISLSTDE
                     EDTRKHFGPFLKNTTAELPDGSGEQIRFGELADLERAFKHAGERIAAVILEPIQGEAG
                     IVVPPEGYLEGVQRLCREHNALFICDEIQTGIGRTGKMLCYEHSEGVRPDIVVLGKAI
                     SGGILPVSCVLADKDIMLCFEPGSHGSTYGGNPLSSRVAVAALEVIRKENLVERARVL
                     GEKLRAKLESLQAESNGIISEVRGKGLLSAIVIDPSKANGRTAWDLCLLMKDAGVLAK
                     PTHEHIIRLAPPLVISEEDLMHGVDVIKSSLEKLPTVEKAAH"
     gene            <872566..>877134
                     /locus_tag="AGOS_AER124W"
                     /old_locus_tag="AER124W"
                     /db_xref="GeneID:4621189"
     mRNA            <872566..>877134
                     /locus_tag="AGOS_AER124W"
                     /old_locus_tag="AER124W"
                     /product="AER124Wp"
                     /transcript_id="NM_210337.1"
                     /db_xref="GeneID:4621189"
     CDS             872566..877134
                     /locus_tag="AGOS_AER124W"
                     /old_locus_tag="AER124W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML059C (NTE1)"
                     /codon_start=1
                     /product="AER124Wp"
                     /protein_id="NP_984983.1"
                     /db_xref="GeneID:4621189"
                     /translation="MVDGTYVNSSVEAISGEADTAAVAELANQMVMNFLYESSSWLAQ
                     STGPFLWKGFRFLFLRLPSSLLVYLINGTVPFYLVVLGSVFTPIIVYLILRSRVLSAY
                     SRLKGDNEDEVIDKKKQLVNDSEAMLMGGPDGKRRSGFSSYLDEFLSAIKIFGYLDKL
                     VFHELTKSMRTQRLEQGEVMLLDDSVGFAIVVEGGLHIYHKIAHSQGSTRESMPLPED
                     RSFDSNEDDLTINGERFQLLNKVKAGNPVSSLVSILKLFTDNHTPTVVDSSKSSPKQS
                     AQVPIRQLISPFLDGNVERNKATLNMKQVPTAEYEIPSAERAGSNVSSFTQQLYESML
                     PKDHAAEDVREPLPEIVAYAASDCAIAVIPASSFKRLMVKYPRSASQIIQVILTKLYR
                     VTFQTAHSYLGLTKEIMHTEVVLNNSTNFELPYYLQEAILRKIKNGSKESSVQESIHR
                     ATLRSKNVHAHNSPTPNKISRHIALESRDQYNPGDLLSNVPLSRKGSKTASSSSVSIP
                     RISSLRHQKEAASSPLATLRRLEGNDSQNFAPLSSSSPMSVSEKPSVVGGGAHDNISQ
                     ISFSSALEETEESSWRMALVESMFGYLGITNESIMPPTEDLLFLNNRASSGSSVCSVS
                     SYSHPQTINQDLFRCLSPELVRTKKKAPRQKYTEEMPINVDFNTAKEEFAEGLETLFI
                     PSGATIVEQNGNNKGLYYIVSGELLVCWKNEEDNIEYVLYTVKPGGIAGYLASLIGFK
                     SFVSLRAKTDLYVGFLPIEVLERLCDKYFMIYLKIAETLTKLLSPKILKLDYALEWIH
                     LEASETLFNQNDPANAIYVVLNGRLRQLHQKSKNEERLSRPTTQRKKRKDDNQPNVQV
                     VGEYSQGCSFGEVEVLTAMNRVSTVVAVRDTELARIPRTLFEVLALEHPSIMIRVSRL
                     VAHKILQRSSDIREPTKIVNSANGYRYDFNLTIPPSAGTSSWGNNSDGGSISYKTITI
                     LPITYGLPVEEFANKLVSTFRQVGRSTIGLTQCTTLKHLGRHAFDKLANLKQSGYFAE
                     LEELYELVVYIADTPVKSSWTSTCISQGDCILLLADASSDPEIGEFERLLINNRTTAR
                     TELLLLHPERYVEPGLTHKWLRKRTWVHQHHHMQFVSSQNPSERVDSKAPPIPGAPPN
                     LIGRLKKRERLNQLTKRTQENFARLLPDSIKLTVENISMKYIQKKQKYYTPVSAHKND
                     FLRLARILSGQAIGLVLGGGGARGISHLGILKAIEEHGIPIDMIGGTSIGSFVGGLYA
                     KDYDLVPTYGRVKKFAGRIGSIWRMLSDLTWPVTSYTTGHEFNRGIWKAFGDIRIEDF
                     WIQYYCNSTNITESMQEIHTFGYAWRYVRASMSLAGILPPITDNGNMLLDGGYLDNLP
                     VLEMKARGCKTIFAVDVGSVDDRTPMDYGDSLNGFWIVLNRWNPFSKHPNVPSMAEIQ
                     MRLGYVASVNALEKAKTTQGVVYFRPPIEDYATLDFAKFEEIYQVGTAYGATFLHELE
                     QNGKLPRIPGNEPANGPGIHLLHRRNSI"
     gene            complement(<877180..>877431)
                     /locus_tag="AGOS_AER125C"
                     /old_locus_tag="AER125C"
                     /db_xref="GeneID:4621190"
     mRNA            complement(<877180..>877431)
                     /locus_tag="AGOS_AER125C"
                     /old_locus_tag="AER125C"
                     /product="AER125Cp"
                     /transcript_id="NM_210338.1"
                     /db_xref="GeneID:4621190"
     CDS             complement(877180..877431)
                     /locus_tag="AGOS_AER125C"
                     /old_locus_tag="AER125C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR438C-A (LSM3)"
                     /codon_start=1
                     /product="AER125Cp"
                     /protein_id="NP_984984.1"
                     /db_xref="GeneID:4621190"
                     /translation="MSDTPLDLLRLNLDERVYVKLRGARKLSGTLQAFDSHCNIVLSD
                     AEETIYQLIDGELKSETKSSEMVFVRGDSVTLVTAAADE"
     gene            <877581..>878606
                     /locus_tag="AGOS_AER126W"
                     /old_locus_tag="AER126W"
                     /db_xref="GeneID:4621191"
     mRNA            <877581..>878606
                     /locus_tag="AGOS_AER126W"
                     /old_locus_tag="AER126W"
                     /product="mitochondrial 54S ribosomal protein YmL4"
                     /transcript_id="NM_210339.2"
                     /db_xref="GeneID:4621191"
     CDS             877581..878606
                     /locus_tag="AGOS_AER126W"
                     /old_locus_tag="AER126W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR439W (MRPL4)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL4"
                     /protein_id="NP_984985.2"
                     /db_xref="GeneID:4621191"
                     /translation="MENYYTLSGNQEGVASCYRIAEDSEGVISMWVFQRGLHSSRSVL
                     ARTRYTKPKPKPPRRSKVRAPTQTTHHDTDLKVTAPIPPAAANLECNPEHPLWQFFDG
                     GRFMRSAEELDDKSRPWTVPELRRKSFDDLHSLWYACLKERNILAREMHLRRNMQEEG
                     SAHAQLDERVRTTMWRIRHVLSERDWAYRLAHAELGTQQAPLLREVEEAFLAVPEAED
                     GEAFDMLARLQRAVFGISEYIEENLVDRRFVDGLKYIATLKLRRFAPRDAAVEQLLQA
                     SEGGITDAGEAFVIFTAENTLADVKEAADAVNELREQGNKVDRYEEIATVAQYLKKLA
                     NAKKVAA"
     gene            complement(<878694..>879869)
                     /locus_tag="AGOS_AER127C"
                     /old_locus_tag="AER127C"
                     /db_xref="GeneID:4621192"
     mRNA            complement(<878694..>879869)
                     /locus_tag="AGOS_AER127C"
                     /old_locus_tag="AER127C"
                     /product="AER127Cp"
                     /transcript_id="NM_210340.1"
                     /db_xref="GeneID:4621192"
     CDS             complement(878694..879869)
                     /locus_tag="AGOS_AER127C"
                     /old_locus_tag="AER127C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML060W (OGG1)"
                     /codon_start=1
                     /product="AER127Cp"
                     /protein_id="NP_984986.1"
                     /db_xref="GeneID:4621192"
                     /translation="MKFNRLIFPKGEIVLDHVLQCGQAFRWIWNHEKRYYSASMLLND
                     KLGYRIIVLKQPDQCSIEFSVAGNKDDDCSGAARQWLMRYLRMEVNLEALLAEWQKAD
                     TRFIGKTHRGVRILRQEPWETLCSFICSSNNNIGRITKMCHALCSQYGSFLGELDGTP
                     YYSFPTSKQLMEGASEDALRDLGFGYRAKYIMAAAEWMDSSKPAHMSDTEHLESWLDM
                     ISREEIRQRFMEVPGVGPKVADCVCLMGMQMDDHVPVDVHINRIAQRDYKFNASAAKI
                     AALKARYKDLPSVRKKLNMELELVREMFIQKWGPYAGWAQGVLFAQEINKSDTATKQG
                     PASNQEVAVAKRKVEEKDFLHEAGSEAAVVEVALDGVEFSASGRPLRTASKRIRYST"
     gene            <880109..>882517
                     /locus_tag="AGOS_AER128W"
                     /old_locus_tag="AER128W"
                     /db_xref="GeneID:4621193"
     mRNA            <880109..>882517
                     /locus_tag="AGOS_AER128W"
                     /old_locus_tag="AER128W"
                     /product="AER128Wp"
                     /transcript_id="NM_210341.1"
                     /db_xref="GeneID:4621193"
     CDS             880109..882517
                     /locus_tag="AGOS_AER128W"
                     /old_locus_tag="AER128W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML061C (PIF1)"
                     /codon_start=1
                     /product="AER128Wp"
                     /protein_id="NP_984987.1"
                     /db_xref="GeneID:4621193"
                     /translation="MLKYCRQLKTLHALQVRGTIHAGSKSYLVMKNRLEGSWAFNSDA
                     KRFKHDGSMVQELEGEGKRGNASVLEEAWDTSGDDDILQHIAALEERRGEPDPSMCSG
                     VASGTRLEVQMQRTEAEIKQSKEAPEPLIELPDVQILGSKTVDSKESIKNSAAGTQEL
                     AFLTQRPTLHEHISADQPQASDQRPSASPKRVQCFMLSDEQRNVLKLAEEGTNIFYTG
                     SAGTGKSILLRELIKKLKTVHGRQGAVAVTASTGLAACNIGGITVHSFAGIGLGNSPK
                     ENLLKKVKRSRKHVQRWQNCKCLIIDEISMIDGELLDKLDYIARKIKKSKAPFGGIQL
                     ILCGDFFQLPPVTRDNQQPNFAFDSEAWKQAITATIVLTRVYRQQGDTKFIQMLNDMR
                     LGKISEETEAEFRKLSRPLVTDDIIPAQLFSTRVEVERANGSQLAKLPGKRRAYNAID
                     GGDLSDEELKQRLLANFLAPKRLELKVGAQVMNIKNFDDTLVNGSLGKVIDFIDEATF
                     MFYQSVRDDDLDVAEWEKYRDALAKNDWNAPELDEDEEPKKETRTSMVKKALREKFRT
                     IDTDDTVDHLGDTIFDFLKDDREVTDPEVKANLERKKQLLQEVHMSSKGKKLPLVQFF
                     QPDNTTRTVLVREEAWAIEDENEKPLVTRVQLPLMLAWALSIHKSQGQTLNKVKVDLR
                     RVFEKGQAYVALSRAVSRGGLQVLNFDKEKIQAHSKVVEFYDSLVSANDAVKMRKDVQ
                     RKISFPITKSKAPNAPTLPLAPQLRGNSIITLLERSNKNSGRSLSQKFSYVPSQSNNQ
                     APSP"
     gene            complement(<882583..>884658)
                     /locus_tag="AGOS_AER129C"
                     /old_locus_tag="AER129C"
                     /db_xref="GeneID:4621194"
     mRNA            complement(<882583..>884658)
                     /locus_tag="AGOS_AER129C"
                     /old_locus_tag="AER129C"
                     /product="AER129Cp"
                     /transcript_id="NM_210342.1"
                     /db_xref="GeneID:4621194"
     CDS             complement(882583..884658)
                     /locus_tag="AGOS_AER129C"
                     /old_locus_tag="AER129C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR440C (SEC39)"
                     /codon_start=1
                     /product="AER129Cp"
                     /protein_id="NP_984988.1"
                     /db_xref="GeneID:4621194"
                     /translation="MKQDTVMLKDRLYILLSVLATRGDVERVEKCVVYDSELSVQEVL
                     EVICVFWPEVDDPERLWFVYEGIERERQSTGELEFELINSEAELQALVDADADVVRGR
                     AEMLRSHVRSRLEAHSVAVDVADCAGTFARARTVLVNEVEPDVLFHSGIIRRLRRGGR
                     CAAVTAWERGILRPLAHANCSISRPLLVSAFEQLTPAEALELFVEPRSDEPAVHRAVL
                     LHEVVPYVTFKQAYQEFLDVFLTPEQFPLTTLENFEFLKYMTKTVRPLFAEQPGKKKV
                     FDRKLLQLLYDRGESLAEIPLPDLPRELYGLLLLIDETVTLSDGVSVKDLIEYTKYMD
                     AANNYSLKSMRSLANADELAQLASFNSISHYLLAESPSVQTLQFLLSSSKLYPKLTKE
                     NQESAIIETLLSLSEFTLLHDFSLQAGFQVEKSVILKYFWRFFNSAPNGSRDRPEMTK
                     ARNNLRLLPKKDYYYLETLLDVADALAKYSLSYSRGQPFRPSHILDLKDDPFRIISKL
                     LETNPSLYRDVETTFEILKQLYEGLQLQPHDPKYTSEYTRLLVCHIDCALANMEFKFA
                     YDKVIELLENHDGLGEHWSTIFQVGKYIDPTWPDNEVPTEIIYLQMEVLSRLLHICPV
                     EDVEAVVSTWSGLELELSTRTDVRDVYSLSNNSTNPKHLRKEIVQQVSSSVSNFLSDG
                     IKWAIGEGK"
     gene            <884809..>885876
                     /locus_tag="AGOS_AER130W"
                     /old_locus_tag="AER130W"
                     /db_xref="GeneID:4621195"
     mRNA            <884809..>885876
                     /locus_tag="AGOS_AER130W"
                     /old_locus_tag="AER130W"
                     /product="AER130Wp"
                     /transcript_id="NM_210343.1"
                     /db_xref="GeneID:4621195"
     CDS             884809..885876
                     /locus_tag="AGOS_AER130W"
                     /old_locus_tag="AER130W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML062C (MFT1)"
                     /codon_start=1
                     /product="AER130Wp"
                     /protein_id="NP_984989.1"
                     /db_xref="GeneID:4621195"
                     /translation="MITQDQMQQVQKRLAVYQQGSYFASYLSSVGQVHELCQAILLGQ
                     LDEEHAFSQEAVQRLRDDIKVKYLENKIMIESDKLRTDLQDSAVETGVGLLKERLPER
                     MAAVEELAKEMEVRNARLRQMTRDVEAFNRETRQLATNATTLRWERKEWENLLGVEEF
                     GRLLESGIFQQERSGLYLVKERLFEGEDELQRINALMKADIERLSRELQQYQARWLQN
                     AGVLERIGQILEQETLLRKGGQASDDVDMDENDGNEEDEEDEADDESFARRLDGSGSS
                     DNELDHESEAMDTSESESDMESQKLEEERPASDAQLSNAEEDSAKAGSEGLDGSSEPR
                     GSPALADPGTHREDSPDQSDT"
     gene            complement(<886024..>886794)
                     /locus_tag="AGOS_AER131C"
                     /old_locus_tag="AER131C"
                     /db_xref="GeneID:4621196"
     mRNA            complement(<886024..>886794)
                     /locus_tag="AGOS_AER131C"
                     /old_locus_tag="AER131C"
                     /product="40S ribosomal protein S1"
                     /transcript_id="NM_210344.1"
                     /db_xref="GeneID:4621196"
     CDS             complement(886024..886794)
                     /locus_tag="AGOS_AER131C"
                     /old_locus_tag="AER131C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML063W (RPS1B) and YLR441C (RPS1A)"
                     /codon_start=1
                     /product="40S ribosomal protein S1"
                     /protein_id="NP_984990.1"
                     /db_xref="GeneID:4621196"
                     /translation="MAVGKNKRLSKGKKGLKKKVVDPFTRKEWYDIKAPSTFENRNVG
                     KTLVNKSTGLKNAADFLKGRVVEVCLADLQGSEDHSFRKVKLRVDEVQGKNLLTNFHG
                     LDFTTDKLRSMVRKWQTLIEANVTVKTADDYVLRVFAIAFTRRQSNQIKKTSYAQSSH
                     IRAIRKVISEILTREVQNATLAQLTSKLIPEVINKEIENATKDIFPLQNVHIRKVKLL
                     KQPKFDLGALMTLHGESSGEEKGKKVAGGFKDEILETV"
     gene            <887237..>887935
                     /locus_tag="AGOS_AER132W"
                     /old_locus_tag="AER132W"
                     /db_xref="GeneID:4621197"
     mRNA            <887237..>887935
                     /locus_tag="AGOS_AER132W"
                     /old_locus_tag="AER132W"
                     /product="AER132Wp"
                     /transcript_id="NM_210345.1"
                     /db_xref="GeneID:4621197"
     CDS             887237..887935
                     /locus_tag="AGOS_AER132W"
                     /old_locus_tag="AER132W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML064C (TEM1)"
                     /codon_start=1
                     /product="AER132Wp"
                     /protein_id="NP_984991.1"
                     /db_xref="GeneID:4621197"
                     /translation="MASENTIPQLKNEVKIKIGLIGDAQVGKTSLMVKYVQNVFDEEY
                     TQTLGVHYLERKINLGSTDVIFSIMDLGGQREFINMLPLVSNRAVAIIFLFDLTRPET
                     LTSIREWYRQARGFNETAIPLLVGTKYDLFVNLDVAYQEELSKTSMRYAQVMGAPLVF
                     CSTASSINVQKIFKVIIAKAFNLTLRIPEIKDMGDPLLIYKSLGNAPQRVPSEYTHHG
                     RYRQPEHIRNMAEQ"
     gene            complement(<888143..>891136)
                     /locus_tag="AGOS_AER133C"
                     /old_locus_tag="AER133C"
                     /db_xref="GeneID:4621198"
     mRNA            complement(<888143..>891136)
                     /locus_tag="AGOS_AER133C"
                     /old_locus_tag="AER133C"
                     /product="AER133Cp"
                     /transcript_id="NM_210346.2"
                     /db_xref="GeneID:4621198"
     CDS             complement(888143..891136)
                     /locus_tag="AGOS_AER133C"
                     /old_locus_tag="AER133C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML065W (ORC1) and YLR442C (SIR3)"
                     /codon_start=1
                     /product="AER133Cp"
                     /protein_id="NP_984992.2"
                     /db_xref="GeneID:4621198"
                     /translation="MAATLADFKGWQIIVTDESGSVIKDTGRRRRRRGDSKEIVRLQR
                     KSDGLQLSCADSIVCKDPQTNSLSIYMIHEIRLNTASNYVELWCFGYLCWYEINPEEY
                     YAQFLPEALDSCPDSLSSVERADYFREKFQLECNRSELYLTAELSEIYLKDLVSLAQV
                     YDTDSFSPECVTQENQMTTFVVSSACEPDGNNFVAINIREVEDKIRRSDPETSKRYVK
                     ELTAITPAPVAKKKVTVQVSQRRRGEQPRREAANLKRVIVKHEEANDGQPCISPAPAK
                     KELSQTIPAPSQDKDSNKEPTPAVAAPIKEQTPTTMASVDVSPKGPTLARKNSDRRAK
                     NKTKEEQPPRRDTRGSIPDLNKRSEKPSRSQNSKAKSFVNSETDEEVSSPSDDHVTED
                     ESDEYISDASTNSIQHRDLEGGLGKRGRNKENEEEADGAERRSSRARKGTSGPQKRKA
                     SRSPTKESRLATPKRAITKKNVSRAKKAYTPFSKLYKDPGEIPDLNKNKDFYRENHDW
                     DISALENHFRSPTKQKSVETIFSKVKRQLNSTHSKEEIVKASNFEDYLPARENEFATI
                     YLSMYSAIEAGTGTSIYIAGTPGVGKTLTVREVVKELLISSDRKELPQFQYIEINGLK
                     MVKASDSYEVLWKKISGSTLTSGAAMESLEYYFKEVPQTKKRPVVVLLDELDALVTKN
                     QDVMYNFFNWTTYENSKFVVVAVANTMDLPERQLGNKVSSRIGFTRIMFTGYTHEELK
                     TIINLRLMDLNDSHFYVDPETGNSYLIQDGDTTQLPKDVSKLQKVRLKISEDAVEIAS
                     RKIASVSGDARRALKVCKRAVEIAEQDYMEKHGYAFDGQAQQRTSAFQPTSEELQKVE
                     IHHITKALQETITSPTDTYLRRMSFTSKLFLYALVNLIKKSGAHEQTLGDIVDEIRLL
                     LEVNGKNKYILEMKRVLFVGDNDEEENEQLRIISWDYLIDQLVETGIIIKQNLKNERM
                     CAIKLNISFEEVCRNIMEDEVLKTL"
     gene            <891889..>893154
                     /locus_tag="AGOS_AER134W"
                     /old_locus_tag="AER134W"
                     /db_xref="GeneID:4621199"
     mRNA            <891889..>893154
                     /locus_tag="AGOS_AER134W"
                     /old_locus_tag="AER134W"
                     /product="AER134Wp"
                     /transcript_id="NM_210347.2"
                     /db_xref="GeneID:4621199"
     CDS             891889..893154
                     /locus_tag="AGOS_AER134W"
                     /old_locus_tag="AER134W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR443W (ECM7)"
                     /codon_start=1
                     /product="AER134Wp"
                     /protein_id="NP_984993.2"
                     /db_xref="GeneID:4621199"
                     /translation="MTKSGLVGSFKAALKRPFQNLNTIDRIVQALRLTSSLMVIILGL
                     VSTIGAVAYPDTLYAAKFTTARDRIANGLFKMLSSNVGPVDGLGLTSSEVVILTQYTS
                     SRVQDVPAYVLSGVYGLCRVSSVVPEQPTDNCTCTTLGEGYVLDYRELLRDIGLNIVL
                     EYTYRNRDGAIRDSDGRHDDSPGVRSSTDDSTYRMPDYISHMEHVSKTKRQMIQMLYA
                     VMVLEFLSLVGMFHYYSIKGKMLSTYRERAMVHLLSLTSLVILNLSLVAVIKLVLLFK
                     AFQNQVTKELKEFGFAYELGGNWFICLGTLVGFSFVSFLVWTGLEWCIMDPDSGVQKI
                     SNMQMSVATTAVPGGYAQKVNNTTLDDPLPQTTLLRVEEPTPPPHSSVKHLSVPIAPP
                     SYPPGMSSASDVSLGSSPRVMVAASTFKF"
     gene            <893279..>894436
                     /locus_tag="AGOS_AER135W"
                     /old_locus_tag="AER135W"
                     /db_xref="GeneID:4621200"
     mRNA            <893279..>894436
                     /locus_tag="AGOS_AER135W"
                     /old_locus_tag="AER135W"
                     /product="AER135Wp"
                     /transcript_id="NM_210348.1"
                     /db_xref="GeneID:4621200"
     CDS             893279..894436
                     /locus_tag="AGOS_AER135W"
                     /old_locus_tag="AER135W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML066C (SMA2)"
                     /codon_start=1
                     /product="AER135Wp"
                     /protein_id="NP_984994.1"
                     /db_xref="GeneID:4621200"
                     /translation="MGSRLLQFQSYGKWFMLLSLATAICLLHLPSYSCTYSRDLPICT
                     PQVSFQLTNTTPTATLFLSTVKEVSMLLSYVAIDLGWNVNFPKPNDYDTSNLVNTFDP
                     SNKYHVNLFGYCKWQPLSNKATWYCMDNPNGLDIISMIVRDLGAQLGVLSHTNTKILS
                     DSLWILYRSIFDSFYKFVHDDDYRADKVASFLQSLQQGGPLPSVDQFKTVTLLLKCFE
                     KLTNAIQVTELCSFALIIIAIALATVACVMDILAAREEKHSATSDKLPKALFFKQITL
                     KLSYAVVTCSLFYQIGMAVYFLALFSIRYPYDYKVKVMTFNPDTGYWLSVLRFVMEFW
                     FAVACYIGLSLSRRRPSKEVDDLDWKDEEQTPDSGETAICVSTRGSTRIQV"
     gene            <894645..>895718
                     /locus_tag="AGOS_AER136W"
                     /old_locus_tag="AER136W"
                     /db_xref="GeneID:4621201"
     mRNA            join(<894645..894675,894727..>895718)
                     /locus_tag="AGOS_AER136W"
                     /old_locus_tag="AER136W"
                     /product="AER136Wp"
                     /transcript_id="NM_210349.2"
                     /db_xref="GeneID:4621201"
     CDS             join(894645..894675,894727..895718)
                     /locus_tag="AGOS_AER136W"
                     /old_locus_tag="AER136W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML067C (ERV41); 1-intron"
                     /codon_start=1
                     /product="AER136Wp"
                     /protein_id="NP_984995.1"
                     /db_xref="GeneID:4621201"
                     /translation="MASLRTFDAFPKTDQQHVRRSSRGGIMSIMMYLFLLFIAWGEFG
                     SYFGGYLDEQYIIDPELRQTTQINMDVMVQMPCKYLDVKATDITRDINDVSKRLVFKN
                     IPFFVPYGTTFDSVNEVRTPDIDGMLADAIPLKFRENIPDADLPEEFEFNGCHIYGSI
                     PVNRVKGELHITPKGWRYSSRQRVPHDEINLTHIFNEFSFGEFFPYIDNTLDQVGRYA
                     QQRLTRFHYFVSVLPTIYRKMGAVVDTNQYSVSHNDITYTSSRLYTPGIFILYNFEAL
                     TVVVQDKRISFWAFLIRLVTMLSFIVYIAAWAFRLVDWLLISTLGPRWSLRYGEPHDS
                     SKGLLE"
     gene            <895839..>896388
                     /locus_tag="AGOS_AER137W"
                     /old_locus_tag="AER137W"
                     /db_xref="GeneID:4621202"
     mRNA            join(<895839..896153,896209..>896388)
                     /locus_tag="AGOS_AER137W"
                     /old_locus_tag="AER137W"
                     /product="AER137Wp"
                     /transcript_id="NM_210350.2"
                     /db_xref="GeneID:4621202"
     CDS             join(895839..896153,896209..896388)
                     /locus_tag="AGOS_AER137W"
                     /old_locus_tag="AER137W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR445W; 1-intron"
                     /codon_start=1
                     /product="AER137Wp"
                     /protein_id="NP_984996.1"
                     /db_xref="GeneID:4621202"
                     /translation="MTNGSSEDSVRQTSNGEGVGRDKLAAEWIQPGYRAEVQSKMLEN
                     QVLQRVREATDLIKSVKLERNEEQPVVSMDWDQLYDVSSNIMEEFTKEMDEIVAELNQ
                     SFKKQLLWQEAAFTVDSHRGATRFGAAESWMKSKETHLEQKRRELNASARIIKSTLEN
                     LTQG"
     gene            complement(<896466..>898094)
                     /locus_tag="AGOS_AER138C"
                     /old_locus_tag="AER138C"
                     /db_xref="GeneID:4621203"
     mRNA            complement(<896466..>898094)
                     /locus_tag="AGOS_AER138C"
                     /old_locus_tag="AER138C"
                     /product="AER138Cp"
                     /transcript_id="NM_210351.1"
                     /db_xref="GeneID:4621203"
     CDS             complement(896466..898094)
                     /locus_tag="AGOS_AER138C"
                     /old_locus_tag="AER138C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML069W (POB3)"
                     /codon_start=1
                     /product="AER138Cp"
                     /protein_id="NP_984997.1"
                     /db_xref="GeneID:4621203"
                     /translation="MSTDFDRIYYNQSKVSGRFRLGEGGLGWKASATGGSAAMQNNEP
                     ILLTADELASVQWSRGCRGYELKINTKNKGVVQLDGFSQEDFTLLKNDLQRRFNVQLE
                     HKDHSLRGWNWGTTDLTRNELIFSLNGKPTFEIPYSHISNTNLTSKNEVALEFDLQKD
                     GYNPAGDELVEMRLYVPGVVTQEDRHSSPAEDADVDMEKDNKEEKSIAEAFYEELRAK
                     AEIGEVSGDAIISFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIFSLP
                     KADDIHHLMVLSIEPPLRQGQTTYPYLVLQFQKDEETEVQLNVEDDEFERLYKDKLKK
                     QYDAKTHVVLSHVLKGLTDTRVVVPGEYKSKHEQCAVSCSFKANEGHLYPLDNAFMFL
                     TKPTLYIPFQDVSSVNISRAGQATTSSRTFDLEVVLRSNRGSTTFANISKEEQQILES
                     FLKSKNVRVKNEEKETQQRLQTALGSDSEDEDVNMGSAAEDDESVDEDFQAESEDDDV
                     AEEFDSDAGVSESETEAADGADTEDRPSKKAKLA"
     gene            complement(<898327..>900093)
                     /locus_tag="AGOS_AER139C"
                     /old_locus_tag="AER139C"
                     /db_xref="GeneID:4621204"
     mRNA            complement(<898327..>900093)
                     /locus_tag="AGOS_AER139C"
                     /old_locus_tag="AER139C"
                     /product="AER139Cp"
                     /transcript_id="NM_210352.2"
                     /db_xref="GeneID:4621204"
     CDS             complement(898327..900093)
                     /locus_tag="AGOS_AER139C"
                     /old_locus_tag="AER139C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML070W (DAK1)"
                     /codon_start=1
                     /product="AER139Cp"
                     /protein_id="NP_984998.2"
                     /db_xref="GeneID:4621204"
                     /translation="MSVNKSFELDNSLRYSLHGFSLANPSVTLIEREKILYRKLTKES
                     VALVSGGGCGHEPAHSGYVGEGMLAAAVAGDIFASPSTAQILTAIRIATKQAAGALLI
                     VKNYTGDVLHFGLAAERARSMGIDCRVVIVGDDVAVGRTKGAGVGRRGLAGTVLVHKI
                     AGEFARSYSADYGLDEVANVAEIVNDNLVTIGASLSHCKVPGRDFESSLTDSQMELGM
                     GIHNEPGVQVLEPIPSTDELIEEHMLPKLLSKDDNERYYVDFSPDDEVILLVNNLGGI
                     SNYMMAALTAKVSESLAKYGIRPVRTVYGSVMTAFNGNGFSITLLNVTRSEARLQDLL
                     QSPISLLELFDAPTSAPAWPRIDTGNDAHASGETDLVLNTPSAAPFGRFDYDFFAALV
                     RAGSKQVRESEPHITHLDNIVGDGDCGTTLAAGAQAIEDALEQLRGLSFSEAIGQASQ
                     IIEASMGGTSGALYSILLSGICHEITELCSSPDDEVTLELLGTALQRALHALYKYSGA
                     RPGDCTMIDALEPFISSLYQERDFAKAVEAAEEGARATAKMAAKFGRASYVSDTTDVP
                     DPGAVGFVAFLRGMRAAFEKWN"
     gene            complement(<900284..>901528)
                     /locus_tag="AGOS_AER140C"
                     /old_locus_tag="AER140C"
                     /db_xref="GeneID:4621205"
     mRNA            complement(<900284..>901528)
                     /locus_tag="AGOS_AER140C"
                     /old_locus_tag="AER140C"
                     /product="AER140Cp"
                     /transcript_id="NM_210353.1"
                     /db_xref="GeneID:4621205"
     CDS             complement(900284..901528)
                     /locus_tag="AGOS_AER140C"
                     /old_locus_tag="AER140C"
                     /note="NOHBY516; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B04862g"
                     /codon_start=1
                     /product="AER140Cp"
                     /protein_id="NP_984999.1"
                     /db_xref="GeneID:4621205"
                     /translation="MNELSDQLSQNLKCDITLIGQRVMRAPQLIKDKLDIGFQFKDKS
                     FDVIQETFNHIHNSVLTLDTECTRFSTQITNLMNHTQNLNRGFQEIISRGAWDNIQVG
                     SPVSPNSVMSPVGRDFSPAVATPTTKRFNFSKYVDRFQTTIVKIKSDQQQFQTRVVLP
                     LLQLKDLGLRIQKPLEERRNLVLDINSYSSKVEKYNQRVHTNELTLKGEQKRMKYDKK
                     LEDVRFKYEALNSILKVELQVYFDLFRDFLSAWFPLYLYITYSLYYNLYQFLGNCPEV
                     RKLLEKSGFSSLAPVSSVVNTSRNLVEDFHVSFDGAMKHLQSLNIINYKKLCALVYAG
                     ENDDGSRANAFSGIIPTVYATALYDYDPQFNDPQYLSIKKGDIIQVITQSKNGWWYGD
                     LLRTKTKGLFPQSYVQVQDYGL"
     gene            complement(<901662..>903599)
                     /locus_tag="AGOS_AER141C"
                     /old_locus_tag="AER141C"
                     /db_xref="GeneID:4621206"
     mRNA            complement(<901662..>903599)
                     /locus_tag="AGOS_AER141C"
                     /old_locus_tag="AER141C"
                     /product="AER141Cp"
                     /transcript_id="NM_210354.2"
                     /db_xref="GeneID:4621206"
     CDS             complement(901662..903599)
                     /locus_tag="AGOS_AER141C"
                     /old_locus_tag="AER141C"
                     /note="NOHBY517; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B04840g"
                     /codon_start=1
                     /product="AER141Cp"
                     /protein_id="NP_985000.2"
                     /db_xref="GeneID:4621206"
                     /translation="MVGIYDSKRRTKPCSNCKQTKVKCEYIQALPCSRCTRNGLECYF
                     PDRIGGAGSSDLEATAVPGIEGCDVDPQWMRGINDRLTTFESALESILAVVQTGQIQQ
                     QQQINLLQQQMSQQQQLPDISQLLVPTILDSSGLIKQYTDVRDFRAENVISRQQAAEL
                     LQLFVSRYAGHLFGFLLSDLSIDELWTNSPILLAAICTVTCRQQQQAAHLALQLRQSL
                     DWFTTRLANTRRRPSKSAEMEHTLLGLLIAALWLHSNQLYISVVLHLARVWRIDQLCT
                     ALDADDRLMKLWHLLYILDGNELLVSNRRPIIYHTVEPSLLGARDWYLKRLDDDTVRE
                     VLVATDTRGINLVNHRQLQLLNEVGREKVNTSTSILQEMRLLSQLEFHTAIESIFHSD
                     NSLPQFGPPAGLSLLEPSKFGIPWKHNMDIDRWMISWTIALQEINVQQNVWCLKSTLL
                     YYHFARMYINAKDSIDASKDKLFAGSTEPAVDDLKERERKHDPCHQIAHSAAHSILRL
                     VTRDKDVRSIFQFLPIHMYIMVFYASIILLDPTDTCDVTVGSGAETSMKEAFLLVSKF
                     KHMLATMASSDLEFQNELVSQLQRHLLNFNKACSSYPVCGKRIQEILNDAQCHVEQGL
                     DENESKIKHIVAWPGTNHGHP"
     gene            <903875..>904351
                     /locus_tag="AGOS_AER142W"
                     /old_locus_tag="AER142W"
                     /db_xref="GeneID:4621207"
     mRNA            <903875..>904351
                     /locus_tag="AGOS_AER142W"
                     /old_locus_tag="AER142W"
                     /product="AER142Wp"
                     /transcript_id="NM_210355.1"
                     /db_xref="GeneID:4621207"
     CDS             903875..904351
                     /locus_tag="AGOS_AER142W"
                     /old_locus_tag="AER142W"
                     /note="NOHBY518; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B04818g"
                     /codon_start=1
                     /product="AER142Wp"
                     /protein_id="NP_985001.1"
                     /db_xref="GeneID:4621207"
                     /translation="MSQKALGEFFGPRTVYFVIGKVYQKGHFANRIVEWFVRRELPVV
                     PVSPHGGAMTVASNAERTLQIQPDLRSAIDALAGSDYENVSVVFVTPPAVSLTLLSEL
                     RELRLPLRGVWFQPGAWDSKCTQYGETGLGLPANRVITDCVLVNGDMNYQRSQVKL"
     gene            <904680..>905957
                     /locus_tag="AGOS_AER143W"
                     /old_locus_tag="AER143W"
                     /db_xref="GeneID:4621208"
     mRNA            <904680..>905957
                     /locus_tag="AGOS_AER143W"
                     /old_locus_tag="AER143W"
                     /product="AER143Wp"
                     /transcript_id="NM_210356.1"
                     /db_xref="GeneID:4621208"
     CDS             904680..905957
                     /locus_tag="AGOS_AER143W"
                     /old_locus_tag="AER143W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR446W"
                     /codon_start=1
                     /product="AER143Wp"
                     /protein_id="NP_985002.1"
                     /db_xref="GeneID:4621208"
                     /translation="MRLSKLERATEARNALIAGYEDLSVNQVSRKVAQELQLRLETST
                     VSMLSSAVIPEDLCEARSASTVAEDFLLAIDIGGTTLKSAIISTVDFQVTAQWAYDIP
                     HRIVDIAFFNRIVQWVCERVFMHVGRSRYRFLLGITFSFPLNTKNEITTMGKGFQMTE
                     EVRNVSLRQILEQSFAHIMAHNTKYRFQVSLGGIVNDTVAVFWTNKMLHGGDNIAMIL
                     GTGINFCFALPFAAVPRAKMPIACSEDVRLLINSEAGFLGANFLPLSQFDQHQGEQAA
                     PFMPLEYLTAGKWIPLSLRNALAYCDISSVRDIEFTGELLGAILDGRASDFFRADEFP
                     AVQDLARTLVDRAAFCLHATIYGIHRFRHGDDPTGAITISFAGSFLRFCTYYYEKLKE
                     VSDGKIKYTFLPDSNLLGASLFAAYQAAKSGRA"
     gene            complement(<905966..>906490)
                     /locus_tag="AGOS_AER144C"
                     /old_locus_tag="AER144C"
                     /db_xref="GeneID:4621209"
     mRNA            complement(<905966..>906490)
                     /locus_tag="AGOS_AER144C"
                     /old_locus_tag="AER144C"
                     /product="AER144Cp"
                     /transcript_id="NM_210357.1"
                     /db_xref="GeneID:4621209"
     CDS             complement(905966..906490)
                     /locus_tag="AGOS_AER144C"
                     /old_locus_tag="AER144C"
                     /note="NOHBY519; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B04796g"
                     /codon_start=1
                     /product="AER144Cp"
                     /protein_id="NP_985003.1"
                     /db_xref="GeneID:4621209"
                     /translation="MSDKGAGVRNGHARFGVLDVVRMAIGAGIGLWLLAKAGAWMGLQ
                     PRVSRDRGADLQPSQYWAEHGMEIPHVFTATELSQYSAGTGGTRPVLLAVLGHVYEVT
                     RAPRLYGTKGPYRRFTGRDCSNLFGYAMWELGAMRAAACSSNVSNTTEVQLQRIRGWQ
                     RFYQERYPYVGVLV"
     gene            <906931..>910269
                     /locus_tag="AGOS_AER145W"
                     /old_locus_tag="AER145W"
                     /db_xref="GeneID:4621210"
     mRNA            <906931..>910269
                     /locus_tag="AGOS_AER145W"
                     /old_locus_tag="AER145W"
                     /product="AER145Wp"
                     /transcript_id="NM_210358.2"
                     /db_xref="GeneID:4621210"
     CDS             906931..910269
                     /locus_tag="AGOS_AER145W"
                     /old_locus_tag="AER145W"
                     /note="NOHBY520; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B04774g"
                     /codon_start=1
                     /product="AER145Wp"
                     /protein_id="NP_985004.1"
                     /db_xref="GeneID:4621210"
                     /translation="MHGAKLRQWQCHRKSALSNLVECDGQGGCGGVSGKMRYGRQYGD
                     SQDAGHGRVRLRGFSGSGAASFKRVGGRKEGEEPHADDSSAEGRENGRNDTCSGEEHA
                     DFLVECTGHAQGGLGDVSPLFLERLMDLSMFRNVPRTFYAAIAVKMKVLLYHTHECIV
                     KMGEPAEAIYWILYGAADVTSPDGKVTHAVLVQGAHFGEIGLLFKSPRVATVVAKSKI
                     LVGMLAADDFNQVLASYPAVERQLRDEAQQRLAMQEKRWKVSKQPLSQYAMGTWSPGG
                     AQPSPDTPFVCPANVTVQLSRYISQNGLEMHSNLEGIDDSISTLQFLKSLPLFARLPV
                     DIIHEFALSVKILQVPAFQYIIRKGEVGRDVYFILTGKFEVLDRCKDSSQSVSLLAQL
                     GPGQYFGEMGFLDALDGNHDENAKSVRSADIRSISASTLLVLAGDTFSYFCSRYPWIK
                     CEIRKIAGERNRNNSHIASRAAQITTGNSFVLPRGPTMGGNRGDLPVLPTFLNESKPC
                     LESIPDSKFDDNPASFCQEDRPFEIVPVVNSVANPRSRSFYLPVNMAAKSSSTVGRRK
                     SKKRVAASSSYFPSSSASSSAVSVAKIRTTAKLGANKLIGNLNCTPPFLKPPLSFHQK
                     YGAVFLPPPTGALSDNIQMTSPLPSFSLISSLSTYCPLPRILPQVLEDQARWLPTAAE
                     HSPFVSASTSTMRSLPEKILLQCFRFLTLPELMKLRIVCRRWRQLLYITPGLFTKLDL
                     TPWNNSIDDKALMQVTDFVGSRPKSVDLSNCYHITDNGFSYMINEIGIGGQLKRVNIK
                     SCWEVSAMAIMDLAVPSIGGSLEEIDLTNCRKVRDEVIQRLIGWEPSTTIFGPPMNDT
                     LLDNLQGTPLIQHDHTDFRTLHPIQNTVPEVSHFTTNCTPTLNQIGCRSLHKLVLRYC
                     KNITDTTLYHISIYAKERLTYLDLTRCTGLTDMGFSYWSSQLFMNLHTLILTECIFLT
                     DVGIRSIVNCAPNLEHLNLSFCCSLTELAVELLWIGCLHLRTLDLSFCGRAVNNVSLL
                     GISMHLRKLQRIILKGCPRITRSGVDSLLGGFAPLAYIDISQCRNAHMYQGGPPATKF
                     NLAPGCKSIHLTMEGSGRCVEVVV"
     gene            complement(<910361..>911404)
                     /locus_tag="AGOS_AER146C"
                     /old_locus_tag="AER146C"
                     /db_xref="GeneID:4621211"
     mRNA            complement(<910361..>911404)
                     /locus_tag="AGOS_AER146C"
                     /old_locus_tag="AER146C"
                     /product="AER146Cp"
                     /transcript_id="NM_210359.2"
                     /db_xref="GeneID:4621211"
     CDS             complement(910361..911404)
                     /locus_tag="AGOS_AER146C"
                     /old_locus_tag="AER146C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR447C (VMA6)"
                     /codon_start=1
                     /product="AER146Cp"
                     /protein_id="NP_985005.2"
                     /db_xref="GeneID:4621211"
                     /translation="MEGVFFNVDNGYIEGVVRGYRNGLLTSSQYLNLTQCDTLDDLKL
                     QLSSTDYGGFLSNVASEALTTSVIQERASHKLYQQFQYIRDQSSGTTRRFMDYITYGY
                     MIDNVALMITGTVHERDKAEILPRCHPLGWFDTLPTLTVATDLESLYQTVLVDTPLAP
                     YFRDCFDGADELDDLNIEIIRNKLYRAYLHDFHEFVSSEVPEPAREVMQSLLEFEADR
                     RAINIALNSLQSSDVITSELKRELLPNMGKLYPTITEQLATQAMDFEGLRTVLSNVHE
                     YRGIFDTGNIEDQFYKIEMELCRDAFTQQFTVSTIWAWMKSREQEVRNITWIAECIAQ
                     NQRERINNYISIY"
     gene            <911580..>913019
                     /locus_tag="AGOS_AER147W"
                     /old_locus_tag="AER147W"
                     /db_xref="GeneID:4621212"
     mRNA            <911580..>913019
                     /locus_tag="AGOS_AER147W"
                     /old_locus_tag="AER147W"
                     /product="AER147Wp"
                     /transcript_id="NM_210360.2"
                     /db_xref="GeneID:4621212"
     CDS             911580..913019
                     /locus_tag="AGOS_AER147W"
                     /old_locus_tag="AER147W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML071C (COG8)"
                     /codon_start=1
                     /product="AER147Wp"
                     /protein_id="NP_985006.2"
                     /db_xref="GeneID:4621212"
                     /translation="MPANGARSPGSWSWHSGPLYPLPGPTGPQLSPFLPCTASALGRS
                     SRPARKVCRNHHHSPAGSAAEEKDSKMDLAVRDVLGDVNSYPKAADALVREVLTERRS
                     YDGYFVSQAVAGSIVEDIAETEAAIAGLERQLRERLLAQKRQLVAELRGSDVLEELAG
                     ISREIEQLWELDSGRAGKPADESLEDVEAPEEAEDAFHASLRRLRTEGRSGADDGLGV
                     VLGNLGRVCGLLEVPALVSTCIRTGYYQEALMCHGYVRSLQHKFPGVELVARIAAAVQ
                     ADISQTMLQGLSRLLTTALTINAMKKITDYLASIDPFQDAPSALQQLFLSARFRFIAG
                     EIDSYAAAPDVSDAVREMLLKRKIECVREHVYGNLVVFNSRFVPDTRPIAIGLFGAPA
                     TPLPTSPLLLHFVDRCCTHLVRQLPAHMPFVAPDSVCLQLVYCSFRLADLNPNFHHLF
                     MNALLASGAFSRAELDAALAKRLELVATY"
     gene            <913213..>917721
                     /locus_tag="AGOS_AER148W"
                     /old_locus_tag="AER148W"
                     /db_xref="GeneID:4621213"
     mRNA            <913213..>917721
                     /locus_tag="AGOS_AER148W"
                     /old_locus_tag="AER148W"
                     /product="AER148Wp"
                     /transcript_id="NM_210361.1"
                     /db_xref="GeneID:4621213"
     CDS             913213..917721
                     /locus_tag="AGOS_AER148W"
                     /old_locus_tag="AER148W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML072C (TCB3)"
                     /codon_start=1
                     /product="AER148Wp"
                     /protein_id="NP_985007.1"
                     /db_xref="GeneID:4621213"
                     /translation="MANRIIVEPLTTEDSLALDNFVTLDPRVQEARACRKDVAREDVA
                     KEDPARRINAQAAERRQTLQNGYTVSTAMAVKRTPTEKSEKPAASTSRPRADTAAMLE
                     KVQQGGEAFFPWWEVGSFARDGHGRLATENNKMVKAYITEHWYNDWYHNTSIVVGTCF
                     FAWLAAYVGLCWWALGLVFFCTGSVYRAEMRRFARNTRDDLVRVTTAENLDQRPETTA
                     WLNTFLAKFWVIYMPVLSQQVKEAVNPQLAGTAPGYGIDALTLDEFTLGSKAPTIDEI
                     RSYPKKGANVVEMDWKFSFTPNDVADMTAKEVKNKVNPKIALGVTVGKGFVSKSLPIL
                     VEDINVAGRMRITLLFGDTFPNIKTASISFLEPPMIDFALKPVGGDTLGLDIMSFLPG
                     LKSFVKGIIDSNLRPMLYAPNKMDIDVEEIMAAQSQDAIGVVAVTLKSAQGLKMSGTV
                     NPFIELTTDNEIVGIEKEVRSKVINDSKAPNWDETKFVLVNTLQQKLHLKCFHMGGYR
                     KSNFIGEAEFDLSELYQQSEQEGLVYELENGGKSKGILKCDIRWFPVASADKDKEKDK
                     EKQKEKLKEDGKDSQEDGDTTLESDEPSTTESEEDLQAIESGIVKFVLHKVKYLSTST
                     SITGSLSPSAELFVDSKKVKSYRTLRHMNEPSWEDPVEILIPSKRTTEFTLKIYDERF
                     SGKELICEFSAPFEELLNIASSDSEYLTGSPQGEIYFTAVWKPVNLPEGTMETTQQMV
                     SPLGVIRMHIREASVQGELEGVGDIDPYFVISADKSVLFRSNFFSDQSNPKFNNLVYV
                     PITSPNQTVTLDLYDYQKIGKDRFIGSCHFKAANIMEKDPGTDKYVPSGSADEVLEWV
                     LSDKSKRATRSIVTASVSFIPAVPVYAPYELARVEELEKKVAENEEKFEAEQATLREE
                     MEKNPAEYEVVEIEVDDKATARLGQKEKMSFEKLVSHNSGVLSFRIPTGKLTKSDAFL
                     QVLFDDFSYPAATSSRARTGTVLPLHGEFFVRDLKHSIITFRVAKRQIIKNPDDIISE
                     YTFQTLSLLEKGYEHPTTVDVKGSTVDICFMYTPSAVPMPSSESVLDTGFLELQVVSA
                     EDVPSHDRNGLSDPFTIIKVDGTKIFKSEVIKKTLTPVWNARTNIPIPSRTRSKVDIE
                     VYDWDRSGSNDILSKCSLPLEELVPNQEKAFSLKLRPQGIIHLKGRFVPEYIRPAVNV
                     GEGGFASMPFKAVGTVANIGKGVAGVGVGAAVNVASFGVGTAVNVADFGIGGLQKGGR
                     LLKGIGGFGSSTPKQDHSSKSGAEKQPAPNAIPNNSYVPVERQHTVLPNSSGTANEAS
                     GEPNKQKLSDTTRDTANETAADDACSIGGAPGPIPRRQLSQASVFTRSLAPNSIYSGT
                     VTLVSAENLGKTVQLRISLTKDGKLKHLYRTEKQKADVNGVCTFQETCDFQAPPEASL
                     IFGAVAHHTFSKDTNLGIAQVALNDSQIRQDGQILIKLGPGHLIFKLSYGKDVPPVPV
                     IPTAYQEN"
     gene            <918166..>918939
                     /locus_tag="AGOS_AER149W"
                     /old_locus_tag="AER149W"
                     /db_xref="GeneID:4621214"
     mRNA            join(<918166..918180,918421..>918939)
                     /locus_tag="AGOS_AER149W"
                     /old_locus_tag="AER149W"
                     /product="60S ribosomal protein L6"
                     /transcript_id="NM_210362.1"
                     /db_xref="GeneID:4621214"
     CDS             join(918166..918180,918421..918939)
                     /locus_tag="AGOS_AER149W"
                     /old_locus_tag="AER149W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR448W (RPL6B) and YML073C (RPL6A); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L6"
                     /protein_id="NP_985008.1"
                     /db_xref="GeneID:4621214"
                     /translation="MSAQKAPKWYPSEDVSAPKQTRKTNRPQKLRASLVPGTVLILLA
                     GRFRGKRVVYLKQLEDNTLLVSGPFKANGVPLRRVNARYVIATSTRVSLEGVDVEKFN
                     VEYFAREKLTRKQKAEANFFNEQQPKKEIKAERIEDQKTVDKALLAQINKTPLLKQYL
                     AASFSLKNGEKPHLLKF"
     gene            <919320..>920573
                     /locus_tag="AGOS_AER150W"
                     /old_locus_tag="AER150W"
                     /db_xref="GeneID:4621215"
     mRNA            <919320..>920573
                     /locus_tag="AGOS_AER150W"
                     /old_locus_tag="AER150W"
                     /product="AER150Wp"
                     /transcript_id="NM_210363.2"
                     /db_xref="GeneID:4621215"
     CDS             919320..920573
                     /locus_tag="AGOS_AER150W"
                     /old_locus_tag="AER150W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML074C (FPR3) and YLR449W (FPR4)"
                     /codon_start=1
                     /product="AER150Wp"
                     /protein_id="NP_985009.2"
                     /db_xref="GeneID:4621215"
                     /translation="MSELLPMATYNLNIEPYSPTPAIDVTVPVTVRLTMAAIDPESLD
                     DEKKPATLRLIRRNPAFDDEDDLLADSEEEEEEESEEESEPETKKPKKKAAKAESEEE
                     DSEEEDSEGEDSDDEFEEFVLATLSPESQYQQTLDLVISPEEEVQFVVTGSYRVSLSG
                     NYVQHPYDDEDSYDEDHEGCGENCACDDDHEGCGDDCACDDDSDYDLTPDEEDILDME
                     DASDVEAKIEELVEQEEANEKRKADEDEPKAAKKQKKDQKDTKKDAKKDAKKDQKDQK
                     DAKKDAKKEKKVEFKKDLEEGPSKKKDDKPKTKILEGGVVIEDRVVGSGKAAKKGARV
                     GMRYIGKLKNGKVFDKNTSGKPFVFKLGHGEVIKGWDIGVAGMAVGGERRIVIPAAYA
                     YGKQALPGIPANSELTFDVKLVSLK"
     gene            <921228..>924314
                     /locus_tag="AGOS_AER152W"
                     /old_locus_tag="AER152W"
                     /db_xref="GeneID:4621216"
     mRNA            <921228..>924314
                     /locus_tag="AGOS_AER152W"
                     /old_locus_tag="AER152W"
                     /product="AER152Wp"
                     /transcript_id="NM_210364.2"
                     /db_xref="GeneID:4621216"
     CDS             921228..924314
                     /locus_tag="AGOS_AER152W"
                     /old_locus_tag="AER152W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML075C (HMG1) and YLR450W (HMG2)"
                     /codon_start=1
                     /product="AER152Wp"
                     /protein_id="NP_985010.2"
                     /db_xref="GeneID:4621216"
                     /translation="MPLLFKQIKHVVTPFALSAYFCAKHPIHVLMATLIFASTAYLTV
                     VDEYFKGWQLDAKSIFAQPALADECVHYYRAPASDNWTQVTAGQLQGMSADHYYLMEV
                     EFDATNATQPLPAMDNIVHREGHSQYVLQDSLALPPVLRTGDAVWKLRAHRHKIYDIR
                     HYLQSAYNDLRGRIFDAEPFDVFIIGSAYLGMLYTIVGLFLDMRKVGSKFWIGLSALF
                     NSVFAFVFALYTCQYVLEKPVSLLSLVEGIPFVVAVVGFRHKIKLAAFVVTHFKNFGI
                     SKRETAGDIVYEALRQEGQRLVQDHFLCILAFSGCSLYASSLEVLTNFCVLAALLLLY
                     DLLLTCTFYASVLALKLEINLIHRSTAIKQALEEDGVFTSTAGIVSDAETKSMLSLLT
                     SNTSITLLKLVIVLGFIGVNFYNFGTRWTYNALPPIAPALRAGPVPTFIASQIGPSAI
                     ISMPPVQYYEPMKVYFQVEDTILSSLRFISVAIRDRFISKLVLFALAISASINVYLLN
                     IARIHTEFTTNELNNKKKARKTASFSVGSTPIVVPARETIPKSTVSSSETKVVGSVAS
                     SIVPSDDETETEDEAEPVRPLATLIDVLRKGAVKTLKNKEVVSLVVNSELPLYALEKQ
                     LGDTTRAVIVRRKALAKLADAPVLETERLPYKHYDYDRVFGACCENVIGYMPLPVGVI
                     GPLVIDGVAYHIPMATTEGCLVASAMRGCKAINAGGGVTTVLTKDGMTRGPCVRFPSL
                     ARAGACKLWLDSEEGQARVKRAFNSTSRFARLQHVQTALAGDLLFIRFRTTTGDAMGM
                     NMISKGVEFALHQMGAEFGWHDMEIVAVSGNYCTDKKPAAINWIEGRGKSVVAEATVP
                     ADVVRKVLKSDVAALVDVNISKNLVGSAMAGAVGGFNAHASNLVTALYLALGQDPAQN
                     VESSNCITLMRDVGGDLRVSVSMPSIEVGTIGGGTILGPQSAMLDLLGVRGPHPSAPG
                     TNARQLAKIVASAVLAGELSLCSALAAGHLVQSHMIHNRAKTPADPEVPCRRPACI"
     gene            <925137..>927383
                     /locus_tag="AGOS_AER153W"
                     /old_locus_tag="AER153W"
                     /db_xref="GeneID:4621217"
     mRNA            <925137..>927383
                     /locus_tag="AGOS_AER153W"
                     /old_locus_tag="AER153W"
                     /product="AER153Wp"
                     /transcript_id="NM_210365.1"
                     /db_xref="GeneID:4621217"
     CDS             925137..927383
                     /locus_tag="AGOS_AER153W"
                     /old_locus_tag="AER153W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML076C (WAR1)"
                     /codon_start=1
                     /product="AER153Wp"
                     /protein_id="NP_985011.1"
                     /db_xref="GeneID:4621217"
                     /translation="MDYSVAKTIIVGIPADDPRHHTPISQEIGSNGKPKRNTFACTSC
                     HAVKQRCIPTDMGDIYRKPCSRCVKLRKPCEFDLSKRTRRKRRAAGARPRRRAGRARE
                     RAAVRWAGRGAPLSPASGLAAPPPLEGGAEADGLTEAEEEEDAQAQLARELARVDGSA
                     RRLEALAEMLAAESRGWGAFLEGSAAVPTLSDPVSLGIVTLAEAEYRLDCYREVVAGG
                     MRLPFLRVPKSCTAEQLRVEQPILFATVLSMASLVLPGAAGQEVVNMKLDNFVLTLVT
                     HYCMRIGDRTVELLKSLILLCMWCNYPEWSHKTRYHYFNYLCCNLVRDLGMPYAYRPI
                     LVGEDEGQQRKLSAMLEQDPEYPRLILLAYIISLNMSVFLQQPIQFHWSPVVEKACSD
                     ILDARYVSELYSAEDNQMLMLFAKLHLCMERAYSMQRVNSGYSFVAADNDDTFCSLFR
                     ELEGIKMQMPKHYCTGYILTVEAYVYESAVSCYLLRNGALNYPLPDNISDAFLTATER
                     SVAAMKDLLSSGNDIIPSIQLLGASRIIYTMGMSLLKLRYNALTMPAFEPLRSSTEEI
                     LPLLQRIATFLDQLHESYPYNRSISKLQYVSALFLHTYHQKIKKCIYRQETTTFPTLC
                     MPVTPTLDRSSPSSAQLLSESLGFANIPTGTNNDIQAGLLRAPSSIIEPDEKKFHTIK
                     VNSIYKHIAGTPSAEFSGGQLFCEPSSAPHSVDYLSDYLMDNAFVESDYDAFNDEVYG
                     TAFFPQLK"
     gene            complement(<927517..>928046)
                     /locus_tag="AGOS_AER154C"
                     /old_locus_tag="AER154C"
                     /db_xref="GeneID:4621218"
     mRNA            complement(join(<927517..927953,928010..>928046))
                     /locus_tag="AGOS_AER154C"
                     /old_locus_tag="AER154C"
                     /product="AER154Cp"
                     /transcript_id="NM_210366.1"
                     /db_xref="GeneID:4621218"
     CDS             complement(join(927517..927953,928010..928046))
                     /locus_tag="AGOS_AER154C"
                     /old_locus_tag="AER154C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML077W (BET5); 1-intron"
                     /codon_start=1
                     /product="AER154Cp"
                     /protein_id="NP_985012.1"
                     /db_xref="GeneID:4621218"
                     /translation="MAIYSFWIFDKHCNCIFDREWTLQADSSSGTTNSKQNEDTAKLI
                     YGIIFSLQSISTRIGSQSNSVKTISTGKYRIHLLTTPTGLRFVLFSDLNHQDLAHVLQ
                     YLYGEVYVRYVARNMLSPVDFAESASETRGQGFRKINNRNFLSAVERFLGPMLGQ"
     gene            complement(<928230..>929324)
                     /locus_tag="AGOS_AER155C"
                     /old_locus_tag="AER155C"
                     /db_xref="GeneID:4621219"
     mRNA            complement(<928230..>929324)
                     /locus_tag="AGOS_AER155C"
                     /old_locus_tag="AER155C"
                     /product="AER155Cp"
                     /transcript_id="NM_210367.2"
                     /db_xref="GeneID:4621219"
     CDS             complement(928230..929324)
                     /locus_tag="AGOS_AER155C"
                     /old_locus_tag="AER155C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR125C (ENT3)"
                     /codon_start=1
                     /product="AER155Cp"
                     /protein_id="NP_985013.1"
                     /db_xref="GeneID:4621219"
                     /translation="MSLEDAIGKLSLYDAKKYFRKAQNVMLNYTGMEAKVREATNNEP
                     WGASSTLMTQIAQGTYNFREREEILAMILRRFLEKSANEWRQIYKSMQLLEYLVKHGS
                     ERFIDDVRSNLNLIRMLETFHYIDSQGRDQGINVRNRTKALVKLLEDDELIRAERKKA
                     RSMQEKYKGMAGGRPSHIPGQSVNAAAGFTRSAARGISVSADYDSDDDEGYQKPAPYA
                     TPGATGFEEYAPRVQAAADEEADEFSDFQAAPPPPRQNAALIDLLQSADSSAGGQDLR
                     IPPPASVTPAIIEVSRKGDPFGSLFSSAKNSASPTDSASAALQPVSSDPPPSSHRSDD
                     EEEDIFGELTSAPRLTKAKPIDQGPDLLSF"
     gene            complement(<929761..>930327)
                     /locus_tag="AGOS_AER156C"
                     /old_locus_tag="AER156C"
                     /db_xref="GeneID:4621220"
     mRNA            complement(<929761..>930327)
                     /locus_tag="AGOS_AER156C"
                     /old_locus_tag="AER156C"
                     /product="AER156Cp"
                     /transcript_id="NM_210368.1"
                     /db_xref="GeneID:4621220"
     CDS             complement(929761..930327)
                     /locus_tag="AGOS_AER156C"
                     /old_locus_tag="AER156C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML078W (CPR3)"
                     /codon_start=1
                     /product="AER156Cp"
                     /protein_id="NP_985014.1"
                     /db_xref="GeneID:4621220"
                     /translation="MLANSSRSLLPSSRRLFSSSAASLGTKVFFDTSINGAKAGRIEF
                     ELYDDVVPKTAENFRALCTGEKGWGYKGVPFHRIIPDFMLQGGDTDLTNGFGGKSIYG
                     ARFPDENFTKKHTRAGLLSMANAGRNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDV
                     VKAIESYGTGNGQPSAKVVIEDAGELKE"
     gene            complement(<930412..>932769)
                     /locus_tag="AGOS_AER157C"
                     /old_locus_tag="AER157C"
                     /db_xref="GeneID:4621221"
     mRNA            complement(<930412..>932769)
                     /locus_tag="AGOS_AER157C"
                     /old_locus_tag="AER157C"
                     /product="AER157Cp"
                     /transcript_id="NM_210369.1"
                     /db_xref="GeneID:4621221"
     CDS             complement(930412..932769)
                     /locus_tag="AGOS_AER157C"
                     /old_locus_tag="AER157C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR126C (VPS70)"
                     /codon_start=1
                     /product="AER157Cp"
                     /protein_id="NP_985015.1"
                     /db_xref="GeneID:4621221"
                     /translation="MATNENLVDETNPLLPRPNTFAERQVLAAGARPRTNSVASLLAR
                     GRSNTIDSLRTTYAVVRRHRTGFAFILFVTFLVYCAFVLAFLPSTSISRDFRRLHFAK
                     VTKDEAYRLFVTSLLWENYAKGHMRHIASKNHPAGDSRALKYTMRELRAYGLNPVCET
                     YYPYFNTPIRTEVSIWTNGLEAEKLSTWEDVLDQSQSTNISVAGFHGYSADGDVTAAY
                     VYCGYGSAEEYFYLLQNGIQLAGKVHIVREGRLHPGQKIRYAEAYGAVGVITYSDSCD
                     DGNVTTVHGYAPYPFGPAAHPSRLRRDSVLFSNEIPGDPTTPGSVPWSPRTRRQLMNA
                     RVPRIPSVPISEREASKLLKLLNGKGVRVGLGGNTKGFDYHSGPSDSNVQVRVLNRQN
                     YGMHAITNVIAEVPGILKDQEVVIGANRDSWAVGAGESASATSILLEIARGLGAARKK
                     GWKPLRSIKLISWDGEELGLLGSTSHGAAHNTSISDKTIAYFNLGNPVTGTDFECEAH
                     PLVAGHLLDASKATNFKEKFSDTLYDYWRNQSNLSIASPVSSSSYATFQHHLGVPSAE
                     CRFVNNRKDDAIHHGHSSYDTYTWMEKLLDPDYELHNTLAMFVGLSALMLAENELVPF
                     RTTDYMIELWRIYEDLHQPLKKAFLHNEEVCVLYSALSSQLQLAAFHTAVSFDAFTAS
                     VRSKTIVDYPWWKLREKLRIYNNLTSSNRRMKLLDRIFIKQLGLAGRPWMKHTVFAPA
                     GNNCANCTMLPGLSEAIHAKDANSTIKWLKSLSTQVDRVISLLTV"
     gene            complement(<933183..>934487)
                     /locus_tag="AGOS_AER158C"
                     /old_locus_tag="AER158C"
                     /db_xref="GeneID:4621222"
     mRNA            complement(<933183..>934487)
                     /locus_tag="AGOS_AER158C"
                     /old_locus_tag="AER158C"
                     /product="AER158Cp"
                     /transcript_id="NM_210370.2"
                     /db_xref="GeneID:4621222"
     CDS             complement(933183..934487)
                     /locus_tag="AGOS_AER158C"
                     /old_locus_tag="AER158C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML080W (DUS1)"
                     /codon_start=1
                     /product="AER158Cp"
                     /protein_id="NP_985016.2"
                     /db_xref="GeneID:4621222"
                     /translation="MSTASDVGKAQSSKLAGRALFERIGKPTKIVAPMVDQSELAWRI
                     LSRRYGATLAYTPMLHAKLFATSEKYRRDMWSDLDGDESIDRPLVVQFCANDPEYLLK
                     AAQLVENKCDAVDLNLGCPQGIAKKGHYGSFLMEEWDLVANLINTLHTKLAVPVTAKI
                     RIFPDREKTLAYAKMVLDAGAQFLTVHGRLREQKGQQTGLADWATIKYLRDNLPSDTV
                     FFANGNILYPEDIPRCMTELGCDAVMSAEGNLYNPGVFNIEHIGDKEKTFPRVDKVLR
                     EYFEIVKQHNCSVASRTAMKNHFFKILRPFLPNHVDIRSQLAQLSPKHPFEEWENVVA
                     AVEQAVLDIFAQPDIATKDVITTHAPQAWGGAYKTVPYWRCQPYFRPVNGVTADKRVA
                     QQFADKDDVDIPSCTPSAVKRDADQDLESDKRKELRKEPAST"
     gene            complement(<934716..>938306)
                     /locus_tag="AGOS_AER159C"
                     /old_locus_tag="AER159C"
                     /db_xref="GeneID:4621223"
     mRNA            complement(<934716..>938306)
                     /locus_tag="AGOS_AER159C"
                     /old_locus_tag="AER159C"
                     /product="AER159Cp"
                     /transcript_id="NM_210371.2"
                     /db_xref="GeneID:4621223"
     CDS             complement(934716..938306)
                     /locus_tag="AGOS_AER159C"
                     /old_locus_tag="AER159C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML081W (TDA9) and YJR127C (RSF2)"
                     /codon_start=1
                     /product="AER159Cp"
                     /protein_id="NP_985017.2"
                     /db_xref="GeneID:4621223"
                     /translation="MELRSAESDGSGRAGATGRQKTTDSVRGRAGGKHSGVIVMRHTP
                     GVSKETGARGGGREDDGIVPIPKKSRTIKTDKPRPFLCPVCTRGFARQEHLKRHQRSH
                     TNEKPFLCAFCGRCFARRDLVLRHQQKLHASLMDQDKDLRESAVTKDEKQQINEKHII
                     TKPGNKRTMLPTPQPPTSDMFEETRNVELPVQTENEDDGVLPEDLSEGQLTGEVRESK
                     APKRKRHASFSAAHTLSYVQEKDMQETAKREMSDIPHQVSFSTPQMTAQQLFERATKS
                     GIDLNRITIPEFQLSSSDVELPTVDNDADGKLAQSPNGEQRATSDTGTLVMPSMRASH
                     EFIAPTLVHTPLIMDFLQIGSSVGGAGGFTGVDTADPTLDYFNYKESSHHEPRLKPSD
                     GVFCGTATANMEHIGNSGSKKPLTTKCGVEPERDEEHEQKGYKINEFKHDEHEHWLSE
                     FINTHLDGNFKVNMSNFNEIGFSFSMSSSSTGTAAAVAQAQAILPVHQAELTTVPVSS
                     SVSEYLTASSPENNEATPLTRTSSGSVIHQMELSNAYPSQDIPSFFKSRQVDLFKQIM
                     KFQSTYNPPSTEHTKIHKNDKLVFFTEDLCNHILHENNLTPAEFPTLGELNSYVQLYQ
                     YEFHKFFPFIHLHSIEPTKDVYPLLLSIAVIGALYGFHSSHAMLLFNISRFHIREYLE
                     REKEHLGDTPLWIIQSMVLLIFIGIFNNDQAITQTMNTQVMSLIELIKLNQLNMPLEN
                     FVQPPIDSDHILMYQDQPQMHEEIQRKYQTPEQMQKNYDYFIKAQSRIRTCHTVLLIS
                     NMFTSLAGLDCSFHSIDLGCGIPCYHEELFLCDSYQAWWNLLNKYHIVLDSKFSLIQL
                     SNGGESYRNCLVYLTSGHQFFYDNKRISFETLLSLLISIHEKILIERHALEGEPNLHK
                     RELKWRMNSRPIIDSLLKFWEALYIKNGGILIPNEYNVQIIGSNPSLRLIIPLLCFAK
                     MRKCVSLTGVLNKIWLKDWKGMNELLESSYHDRETLREATDHALDTVKFWIDFVSIMN
                     NAEQTSIRTPIFSITCIFSSILVMAEYLKRIEKWAQTISSDSTSSDMLKAVDRTIWLK
                     SEIILKKIETHLLPKGYNRQSYAEFLRIQANGALDVEVLDDASAKHAMDPNTSLDQTI
                     DVILKARLSSRSLYLGVRILGDAPIWPIALLFAHALQLRAIYNLDNHLSK"
     gene            938751..938800
                     /locus_tag="AGOS_AgSNR3"
                     /old_locus_tag="AgSNR3"
                     /db_xref="GeneID:4621224"
     ncRNA           938751..938800
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR3"
                     /old_locus_tag="AgSNR3"
                     /product="AgSNR3"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR3; start and end coordinates are
                     approximate; in synteny"
                     /transcript_id="NR_149372.1"
                     /db_xref="GeneID:4621224"
     gene            complement(<939001..>939252)
                     /locus_tag="AGOS_AER160C"
                     /old_locus_tag="AER160C"
                     /db_xref="GeneID:4621225"
     mRNA            complement(<939001..>939252)
                     /locus_tag="AGOS_AER160C"
                     /old_locus_tag="AER160C"
                     /product="AER160Cp"
                     /transcript_id="NM_210372.1"
                     /db_xref="GeneID:4621225"
     CDS             complement(939001..939252)
                     /locus_tag="AGOS_AER160C"
                     /old_locus_tag="AER160C"
                     /note="NOHBY521; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B04466g"
                     /codon_start=1
                     /product="AER160Cp"
                     /protein_id="NP_985018.1"
                     /db_xref="GeneID:4621225"
                     /translation="MALHNYIYLKNKTHDQACHKLIARDHDPRPIMSKPAEGVTQEAQ
                     QSPCKTKPSKSGCTCTHPPERCSGSRAGDAKPNASDITW"
     gene            complement(<939696..>941048)
                     /locus_tag="AGOS_AER160CA"
                     /db_xref="GeneID:9487592"
     mRNA            complement(<939696..>941048)
                     /locus_tag="AGOS_AER160CA"
                     /product="AER160C-Ap"
                     /transcript_id="NM_001355328.1"
                     /db_xref="GeneID:9487592"
     CDS             complement(939696..941048)
                     /locus_tag="AGOS_AER160CA"
                     /note="NOHBY536; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B04455g"
                     /codon_start=1
                     /product="AER160C-Ap"
                     /protein_id="NP_001342270.1"
                     /db_xref="GeneID:9487592"
                     /translation="MAVSIAAGDTSGAKGPYTKNLTKLENQIVRFEKEQEHYEEALLE
                     KDLLIKSQTNKIRELSEQAQQVTLELKSERERLDELLHQWEDTNRELRQALEMAKANC
                     GIYQRRANKYQEENRLLELELGELKLQYDGVIAQLCSLERVVAEAPADCGLGGDMLDE
                     APASAVSQMGMLDIWIQESGTTVGADELHSHNNHTTHNNTHCKSANTNNDNDNNSANV
                     NTVNINVDYSGAESDEDFPTFDEDQDLQERLFNDVIETDESVHEQGNHSSFLAEEMAD
                     SYKQYIRKLELENEMLLRQNRGLIRRCEELHIQSGLTAKYDIIRSASAGNKDAGYSEY
                     GSKRSVSFHMTLPRLGQGEPLQLWNADPVRPSTTFTASHAGEYTEFFPATGICGLKWH
                     TFVPKNAMDVLIFQRALSQVKGSGSVGARAPPRTAPQASTSGNSQITGQLGQYVTCVD
                     "
     gene            complement(<941194..>942144)
                     /locus_tag="AGOS_AER161C"
                     /old_locus_tag="AER161C"
                     /db_xref="GeneID:4621226"
     mRNA            complement(<941194..>942144)
                     /locus_tag="AGOS_AER161C"
                     /old_locus_tag="AER161C"
                     /product="AER161Cp"
                     /transcript_id="NM_210373.1"
                     /db_xref="GeneID:4621226"
     CDS             complement(941194..942144)
                     /locus_tag="AGOS_AER161C"
                     /old_locus_tag="AER161C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR129C"
                     /codon_start=1
                     /product="AER161Cp"
                     /protein_id="NP_985019.1"
                     /db_xref="GeneID:4621226"
                     /translation="MEEEQLYARLHQRYPIARLPALLAALSNPVLHVALLIKNFELIC
                     ERNAHYAKRLLKWMVDEPIEKHVRLEAGSEDEDFSEWSYARYATLLSLGARDPSAADV
                     VRYTFAAGVAIDVRETPGVIAAAGTTGHRTWEAALYLADYLCRVPLRQSVALELGAGT
                     GLVSLAWLRSRPESSAYITDGDSALLEGHLAENLALNGLRSSPRASLRRLWWNVDEVP
                     QNDIVLAADVTYDSTVLPDLCACIHHSLADCGSQLALVAATVRNELTVANFERELERL
                     GIAHTIVSSTETSEAEADRFSTNYIFQASVAPIRIYKLTL"
     gene            complement(<942202..>943275)
                     /locus_tag="AGOS_AER162C"
                     /old_locus_tag="AER162C"
                     /db_xref="GeneID:4621227"
     mRNA            complement(<942202..>943275)
                     /locus_tag="AGOS_AER162C"
                     /old_locus_tag="AER162C"
                     /product="AER162Cp"
                     /transcript_id="NM_210374.1"
                     /db_xref="GeneID:4621227"
     CDS             complement(942202..943275)
                     /locus_tag="AGOS_AER162C"
                     /old_locus_tag="AER162C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIR029W (DAL2)"
                     /codon_start=1
                     /product="AER162Cp"
                     /protein_id="NP_985020.1"
                     /db_xref="GeneID:4621227"
                     /translation="MSYVSGSGETAVIRFSDKQRAEFERQVAKTWGAVDVVCRRLGSE
                     VISCSDEWFGEAARLVHESAPVREAGRFTEAGAWYDGWETRRHNPAPYDWVIIKLGVY
                     SARIVGCEVDTAYFDGNHAPSISVDALRAETGPVEEDDPRWAEVVPRVECGPSRRHFF
                     LRKHRTDAAYTHVKLKMYPDGGIARFRLYGQVLPVPASGLYGTAHQDGSFTINLAGVH
                     QGAVALQASDQHFGNVENLLLPGRGHDMSDGWETRRSREPGHCDWAIIRLARRSHYLS
                     RIVVDTIHFRGNFPQYVTVHGICKDSPPEHDDPGWQLIVDRSATGPDQEHEYAVDKFI
                     FLTHVKLTIIPDGGVKRLCVWGY"
     gene            <943741..>943923
                     /locus_tag="AGOS_AER163W"
                     /old_locus_tag="AER163W"
                     /db_xref="GeneID:4621228"
     mRNA            <943741..>943923
                     /locus_tag="AGOS_AER163W"
                     /old_locus_tag="AER163W"
                     /product="AER163Wp"
                     /transcript_id="NM_210375.2"
                     /db_xref="GeneID:4621228"
     CDS             943741..943923
                     /locus_tag="AGOS_AER163W"
                     /old_locus_tag="AER163W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YML081C-A (ATP18)"
                     /codon_start=1
                     /product="AER163Wp"
                     /protein_id="NP_985021.2"
                     /db_xref="GeneID:4621228"
                     /translation="MIKKFPTPVLKPFWPFFVSGAAIYWAMSKLADASSNSAEFINDP
                     RHPRFARGEKPVELAK"
     gene            complement(<944054..>945991)
                     /locus_tag="AGOS_AER164C"
                     /old_locus_tag="AER164C"
                     /db_xref="GeneID:4621229"
     mRNA            complement(<944054..>945991)
                     /locus_tag="AGOS_AER164C"
                     /old_locus_tag="AER164C"
                     /product="AER164Cp"
                     /transcript_id="NM_210376.2"
                     /db_xref="GeneID:4621229"
     CDS             complement(944054..945991)
                     /locus_tag="AGOS_AER164C"
                     /old_locus_tag="AER164C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR130C (STR2) and YML082W"
                     /codon_start=1
                     /product="AER164Cp"
                     /protein_id="NP_985022.2"
                     /db_xref="GeneID:4621229"
                     /translation="MIAREIGEPIPPNTRHAISVSLPTWDATVGYEEGREEVVKRMET
                     GYPRFYLHKQIQRLATVLEEKYAKEGEACLILPSYAVAKRCREFMQVQATARGRAPRV
                     RILQLATAKPQGVAERAWRRESRIAVVFFPREEYGAAKRYWQHTGEVVSSRQAEYVLH
                     ELFELERAQRRRGVQEETDEVIRDEEDFIEQRYGRNLDFSYADRAKELIRRRIAKHLV
                     DVPEEAASAGPGSAVEFVAVDRAREDTAASEDAAVQAELIEPVGPGGAEEARAAVRDA
                     GSAVDPEKDVFLFPSGMAAIFCAHRLLLQLDAVRVNRTRQDDASPSGYASPHSPNGAL
                     VGYGPPYKKTVMFGFPYTDTLSILRVFNHTHFLGSGDHKAMAQLEDILHSGEPILAVF
                     IETPSNPLLKMGDLQALRRLADIYGFYLVVDDTLGGFVNIDVLPHADLVCSSLTKIFS
                     GDSNVMAGSLVVNPASRLYDFAQGFFHNGSYEDLLWCEDAIYLERNSRDCASRSLRVN
                     KNTELLLEKVLLPHQGSLFKKIFYPTLTSEETKRNYDAVRCKPDGGYGGLFSLTFHEE
                     NRAKVFFDTLELCKGPSLGTNFTLACPYTVLAHYAEMDVVAEYGLERSLVRVSVGLED
                     FDHLRKVFQRAIDKALATRTA"
     gene            <946208..>947866
                     /locus_tag="AGOS_AER165W"
                     /old_locus_tag="AER165W"
                     /db_xref="GeneID:4621230"
     mRNA            <946208..>947866
                     /locus_tag="AGOS_AER165W"
                     /old_locus_tag="AER165W"
                     /product="AER165Wp"
                     /transcript_id="NM_210377.1"
                     /db_xref="GeneID:4621230"
     CDS             946208..947866
                     /locus_tag="AGOS_AER165W"
                     /old_locus_tag="AER165W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJR131W (MNS1)"
                     /codon_start=1
                     /product="AER165Wp"
                     /protein_id="NP_985023.1"
                     /db_xref="GeneID:4621230"
                     /translation="MTKIGMRRIVKWISCLATVYFAYSYMQRHRFTTATDDTGGTEAQ
                     YAVEKVFLESWQDYVAHAWGYDVFNAASGQGQNFGEKPLGWMIVDALDTMMLMQAHTK
                     DVRHRLRLRREVARCEAWIRDELDYDMNTEVSVFETTIRMLGGLLSAHHLAETLGVGT
                     PAVYAAKAEELGARLVPAFLASPVGIPYSSVNLRTGEAVKSMGIGEASLAEFTTLQLE
                     FKQLAYVTGNATYWKLAEAVYKPFFRENDYPAAYDGIAPVGVLPDTGKFFTPAFKIGA
                     RGDSYYEYLLKQYLQTREPLYWKLYQTTMTGMAKHMIARSVPDDYLYIGERYGTLSGP
                     FMPQMDHLVCFIGGLYAMAATEGVPLAKAEQQPWFDGDRALYWQIAEDVTYTCYRTYH
                     ETPTGLAAEISFFSVREDEAHDSWWESPSRNFFIKPTDVQNLQRPETVESIMYMWHLS
                     GDSKYRQWNWEIFEAFRKNTAYYRPDGSLTYTSINSVVAEGQTTPRDNMESFWLAETL
                     KYVYLTFVDDFDLSKVVFNTEAHPLPVLDPEELARRGLVTGWDL"
     gene            complement(<947900..>948301)
                     /locus_tag="AGOS_AER166C"
                     /old_locus_tag="AER166C"
                     /db_xref="GeneID:4621231"
     mRNA            complement(<947900..>948301)
                     /locus_tag="AGOS_AER166C"
                     /old_locus_tag="AER166C"
                     /product="AER166Cp"
                     /transcript_id="NM_210378.1"
                     /db_xref="GeneID:4621231"
     CDS             complement(947900..948301)
                     /locus_tag="AGOS_AER166C"
                     /old_locus_tag="AER166C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR191C (CTF8)"
                     /codon_start=1
                     /product="AER166Cp"
                     /protein_id="NP_985024.1"
                     /db_xref="GeneID:4621231"
                     /translation="MPSVTISVNKLASVTEGSGKPLTVTTELGSTIIEIQGDLQIPSQ
                     RPQEAGTDPEHRFVEHEGRDILRFGEVSYDMETKKACMYVGRKQRLLGTVVKLDPPLG
                     ILRFRAETSSVELEDVIRYKLLFKDRPLPII"
     gene            <948456..>949274
                     /locus_tag="AGOS_AER167W"
                     /old_locus_tag="AER167W"
                     /db_xref="GeneID:4621232"
     mRNA            <948456..>949274
                     /locus_tag="AGOS_AER167W"
                     /old_locus_tag="AER167W"
                     /product="AER167Wp"
                     /transcript_id="NM_210379.1"
                     /db_xref="GeneID:4621232"
     CDS             948456..949274
                     /locus_tag="AGOS_AER167W"
                     /old_locus_tag="AER167W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR192W"
                     /codon_start=1
                     /product="AER167Wp"
                     /protein_id="NP_985025.1"
                     /db_xref="GeneID:4621232"
                     /translation="MLRVLGGLLGGKPKEHVIDKYTRDLTAVTFTIHELDKRLKRNDE
                     VLMRWQHRLKIYGTTLVVLFGAMAYSNYRSLPVTGLTFLLGLLAILGLSRLLCKVFEY
                     QRRNIVIKLDKARAQHQGTLEDLKKATNFYSTHSLIQRFSSGPLQSQDASTLMDEELQ
                     SKYDELQNLQKELAQLRGDSSGKSTNEAREETDRWFDKVLDVLSGGGFAIENNLVPVT
                     CRKCAKTSGCYVVRNTEWTYVCPHCGEQQTNSAEPEGTTSRSPSGDMKDKNSTT"
     gene            complement(<949318..>949824)
                     /locus_tag="AGOS_AER168C"
                     /old_locus_tag="AER168C"
                     /db_xref="GeneID:4621233"
     mRNA            complement(<949318..>949824)
                     /locus_tag="AGOS_AER168C"
                     /old_locus_tag="AER168C"
                     /product="AER168Cp"
                     /transcript_id="NM_210380.1"
                     /db_xref="GeneID:4621233"
     CDS             complement(949318..949824)
                     /locus_tag="AGOS_AER168C"
                     /old_locus_tag="AER168C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR193C (EGD2)"
                     /codon_start=1
                     /product="AER168Cp"
                     /protein_id="NP_985026.1"
                     /db_xref="GeneID:4621233"
                     /translation="MSEIPENSKVSIYSKNEKKARELIQKFSMKPMPGITRVTFRKKN
                     NQIFAIDNPDVYKTQGGNYVVFGEPKVDDFTRRLARAQQQAASAAKDPQSIQADMAAA
                     AAAPAAPAAPAAAPEEDEAGQVDESGLDGQDIELVMQQANVSRNKAVKALREHNSDIV
                     NAIMSLSK"
     gene            complement(949963..950051)
                     /locus_tag="AGOS_t0117"
                     /db_xref="GeneID:4621234"
     tRNA            complement(join(949963..949998,950015..950051))
                     /locus_tag="AGOS_t0117"
                     /product="tRNA-Phe"
                     /codon_recognized="UUC"
                     /db_xref="GeneID:4621234"
     gene            complement(<950361..>952649)
                     /locus_tag="AGOS_AER169C"
                     /old_locus_tag="AER169C"
                     /db_xref="GeneID:4621235"
     mRNA            complement(<950361..>952649)
                     /locus_tag="AGOS_AER169C"
                     /old_locus_tag="AER169C"
                     /product="AER169Cp"
                     /transcript_id="NM_210381.1"
                     /db_xref="GeneID:4621235"
     CDS             complement(950361..952649)
                     /locus_tag="AGOS_AER169C"
                     /old_locus_tag="AER169C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR080C (SEC18)"
                     /codon_start=1
                     /product="AER169Cp"
                     /protein_id="NP_985027.1"
                     /db_xref="GeneID:4621235"
                     /translation="MDKLGLSGRLPSFGRASHSPPDKKYVDMPPRNMKIANCPNNALA
                     LANVAAVSPSDFPDNIYIAVDEFFVFTTQHSSSVEPGTIGFNGNQRTWGGWSLNQEVR
                     VRPFDLFRQSGKQAYLGALDLEISFRNRSKAVDTQFDQDELAKHFLKTFDSQVFSATQ
                     YLVFEFKGHIFDLRVRSLQTIDLGDVEVISPVANGIEAKGILVKQTQVNYYKGRDGLV
                     NLKSSNSLRPRSDAVIRPDFKFEDLGVGGLDREFTKIFRRAFASRIFPPAVIEKLGIS
                     HVKGLLLYGPPGTGKTLIARKIGTMLNAREPKIVNGPEILSKYVGSSEENIRNLFKDA
                     EAEYKSKGEESSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMDGVDQLNNI
                     LVIGMTNRRDLIDNALLRPGRFEVQVEIQLPDEPGRLQIFEIQTKKMRENGMLATDVD
                     LKELAALTKNFSGAEIEGLVKSASSFAINKTVNIGEGKTRMNDKEIARMKVTREDFLN
                     ALSEVTPAFGISEEDLKTCVEGGVIHYSPRVEQILKHGSRYVRQVKDSERSRLVSLLV
                     HGPAGSGKTALAAAIALKSGFPFIRMISPVEIAGMSEAAKIAYIDNTFRDAYKSPLNI
                     LVVDSLETLVDWVPIGPRFSNSILQVLKVYLKRKPPSGRRLLIISTTSTYSVLQQMDI
                     LSCFDNEIAVPNISSIDEFNNVMIETNFLDDAGRVQVINQLANVSPKLNIGIKRALTN
                     IETARHDEDPANEIVELMAQAV"
     gene            complement(<952857..>953488)
                     /locus_tag="AGOS_AER170C"
                     /old_locus_tag="AER170C"
                     /db_xref="GeneID:4621236"
     mRNA            complement(join(<952857..953192,953243..>953488))
                     /locus_tag="AGOS_AER170C"
                     /old_locus_tag="AER170C"
                     /product="AER170Cp"
                     /transcript_id="NM_210382.1"
                     /db_xref="GeneID:4621236"
     CDS             complement(join(952857..953192,953243..953488))
                     /locus_tag="AGOS_AER170C"
                     /old_locus_tag="AER170C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR056C; 1-intron"
                     /codon_start=1
                     /product="AER170Cp"
                     /protein_id="NP_985028.1"
                     /db_xref="GeneID:4621236"
                     /translation="MIPRASAWLLLLFSRALAVLFEQQLLLYAEDLALRDRRPLAALW
                     HTEGEFEVSDMNDALPPGEYCVGAALPGKNYSCFSYIDLASPWHYDLVVDTDARGNII
                     KLSLRPNPATEGLRPVVRQATPGPHAAITKLRKRTKTYEDRKAGAKSATAAFEEDIEP
                     DNRSFLMKNWKLVLIGIVVYVLMGSAAKKEGAE"
     gene            <953634..>954899
                     /locus_tag="AGOS_AER171W"
                     /old_locus_tag="AER171W"
                     /db_xref="GeneID:4621237"
     mRNA            <953634..>954899
                     /locus_tag="AGOS_AER171W"
                     /old_locus_tag="AER171W"
                     /product="AER171Wp"
                     /transcript_id="NM_210383.1"
                     /db_xref="GeneID:4621237"
     CDS             953634..954899
                     /locus_tag="AGOS_AER171W"
                     /old_locus_tag="AER171W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR057W (YOS9)"
                     /codon_start=1
                     /product="AER171Wp"
                     /protein_id="NP_985029.1"
                     /db_xref="GeneID:4621237"
                     /translation="MWRWSTGVRTMLGYAMCFLALGSALTVRLHSTRTNLPQYLTREI
                     GDDEFEELLRSSASAGHKWHVEQFVDGSRCYVPETEQNMAPVPDDLLERGIKLVEEAT
                     VGKKLEYLPISYWGYKFINSELNKTVIQHKDQHQVLLGSMVKADPQTVQHSLERDEDS
                     YYISERFGDGDLCSLLEEDRTVEVQYRCKYDTPLEIILDLKEYETCRYTMLVSIPSLC
                     ELPEFGPYTRQTPANTIYCTAPATPEFNIATLVEAYKPTFLGHGFYHLAPHANLTHKE
                     TTAMLMYHQQPIPGNEEDDGTMDSAFIKHSTMAYMQLLEMGLLNGPDGLPFSEEGNFT
                     VYAKVIGFDGGLITVTRFQISHGEVIIDHVVPEVLEDMEQGNSEDYEQQAPEQLDEEE
                     AELTSQSDDPAIMRVHLQEFITPEYDAIE"
     gene            complement(<955183..>958989)
                     /locus_tag="AGOS_AER172C"
                     /old_locus_tag="AER172C"
                     /db_xref="GeneID:4621238"
     mRNA            complement(<955183..>958989)
                     /locus_tag="AGOS_AER172C"
                     /old_locus_tag="AER172C"
                     /product="AER172Cp"
                     /transcript_id="NM_210384.1"
                     /db_xref="GeneID:4621238"
     CDS             complement(955183..958989)
                     /locus_tag="AGOS_AER172C"
                     /old_locus_tag="AER172C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR081C (SPT7)"
                     /codon_start=1
                     /product="AER172Cp"
                     /protein_id="NP_985030.1"
                     /db_xref="GeneID:4621238"
                     /translation="MHEVPIVNYQRSSTWRLLKLAESLHSRDIFGQYLSPPQLIVLNH
                     ILDIPDAASKRMVWEQLIRGNVVLNVEKTEEHGSPENAAAEGDEGDVAPAIAPSPATE
                     ATVNGSSSDEGADYSTESNVTDFSELDLEELKQNTDGAEFIGNLSLKIRYVLWQFAID
                     ALYPTDHDHDPLEYVILGEGEDKEDDNAHPLANSAGAVAGDLNVREEDDDYDFDEDDN
                     SEPAASSVTRDTSERNTNIELQTDSQGKLVVHLQISKDTLPKLRVNKTQDIVENFNKI
                     YHNFENDKETLLKRLKLEENDKLLEYDKKRKYSDKANEEAGIDSIIEDSEPDVKKSRN
                     SISSLPVNLGVTNLSLKHLLAKIQENKSKLTISDYELKHLIMDVRKNRSKWASDDKIG
                     QEELYDACEKVVLELRNYTEHSTAFLNKVSKRDAPNYYQIIKKPMDLNTVLKKLKTFQ
                     YRSKQQFTDDIMLIWKNCLTYNSDPKHFLRAHAIAMQKKSQQLIPFIPDIVVRDRYEV
                     EKELEKEGRYEEEDDEEVVGTGRKGGIVRRGIQTIQEDEDDEDYIPADKRGKSAPAGK
                     RSKSSESHAGKGPLEDRDGSNAISSKQIHTVPGSQATDEKTGLADGQKRIQEDHSQQK
                     EPKPKVEPNYGIDNELTGEDHIDEEEEEEEEEEEGEVSQNLYTEKDDGDDDFELSTWK
                     NLTAKVRAEICIRRSDLFKHGRLNGDATAMLRNPSKMKEFQHALREYKEQQRAEQERK
                     QAEQESMMKNGFGAVIKQENHQDSLESHESQQAIGNNLEKDAEEVDFDNSLFLTEYNV
                     INTYPDIIHKGVSSEMLDKEEEAMVKKILDHSDRKKSIFLQNKDVGLTPKMNRNIQLI
                     YEIRGICHKISLIRMLQNQSQSKSTPFPQRLKMAAINDDLDLDPVSQLETRNFRNDKQ
                     LAWRIMHKNVSKIAMSHGFESTEPTAINALTEIAGDYISNLIKSVKIHYETNSLNKRK
                     ADQILCMSLLENGINRPDDLYTYIETEFTKKTRKLSDIKHKLNNFLKDLLRPTLQDLS
                     ERNFEDESQSFLTGDFSTELTGDDFFGFKELGLEKEFGVLSNAVPLQLLTFQFRSKGA
                     QTKEKDKKIQAEEFDSVVYHKITKESLDSRSYLGLVTPLLTKAYDRCNLYHLKLAKSK
                     NADQVPENYDSPTFPILEDDELPKSKGATRARLPPTGKINANYKKKPITEAYLLPDEL
                     VQPADQKGTGSAKPPNTSTSQDTDPAVDGLFGSPAADLNDYENGFGFNTTSPNGSFSL
                     SLPRVN"
     gene            959166..959237
                     /locus_tag="AGOS_t0118"
                     /db_xref="GeneID:4621239"
     tRNA            959166..959237
                     /locus_tag="AGOS_t0118"
                     /product="tRNA-Arg"
                     /codon_recognized="AGA"
                     /db_xref="GeneID:4621239"
     gene            complement(<959607..>960050)
                     /locus_tag="AGOS_AER173C"
                     /old_locus_tag="AER173C"
                     /db_xref="GeneID:4621240"
     mRNA            complement(<959607..>960050)
                     /locus_tag="AGOS_AER173C"
                     /old_locus_tag="AER173C"
                     /product="AER173Cp"
                     /transcript_id="NM_210385.1"
                     /db_xref="GeneID:4621240"
     CDS             complement(959607..960050)
                     /locus_tag="AGOS_AER173C"
                     /old_locus_tag="AER173C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR082C (UBC4) and YDR059C (UBC5)"
                     /codon_start=1
                     /product="AER173Cp"
                     /protein_id="NP_985031.1"
                     /db_xref="GeneID:4621240"
                     /translation="MSLKRITKELNDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSP
                     YAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTISKV
                     LLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEATAKEWTKKYAV"
     gene            <960469..>963384
                     /locus_tag="AGOS_AER174W"
                     /old_locus_tag="AER174W"
                     /db_xref="GeneID:4621241"
     mRNA            <960469..>963384
                     /locus_tag="AGOS_AER174W"
                     /old_locus_tag="AER174W"
                     /product="AER174Wp"
                     /transcript_id="NM_210386.2"
                     /db_xref="GeneID:4621241"
     CDS             960469..963384
                     /locus_tag="AGOS_AER174W"
                     /old_locus_tag="AER174W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR060W (MAK21)"
                     /codon_start=1
                     /product="AER174Wp"
                     /protein_id="NP_985032.2"
                     /db_xref="GeneID:4621241"
                     /translation="MLDLSGLKAKVNAKLADAQAKKAVPRASKGETSEQRAMMRREAL
                     ALGASEDDVALVEGLSDADELSEQAFSGDEGDGDAGLQNDVQRLLANMGLPAAAAAAA
                     AAESSEPEDSLEEQAEEQAEEQAEEQAEEQAEEQAEEDSDAAESAGEAGESDAGFDAE
                     SAGEEPARGMVDDLRSVRSGNLLVPADMPWHEVPLDAEASREQEPLSTEKVELLYKRG
                     KEALEADNAQYYEEFTKNSSQRKFMSQILADGTLNDKISSLTLLVQESPLHNVKSLDM
                     LLGFCSKKSRNAALQTLIALQDMFVNGLLPDRKLRYFKNQNLSLLLNKRTLAVFYFED
                     YLKKTYFKMLEILEKLSHDPIVHVRTQVLTCVFQLLTMKPEQEFNLLRLGCNKLGDID
                     NKVASKASYQLLKLQQAHPNMKAVVVDAVVDMAVKPKADYHTTYYAALTLNQTILRKS
                     ETQLANQLVKTYLTLFEKFLSTTDGDNEERGDHSAQTHKSYEARRKKNFKKGKRGGRS
                     VTQDKSDKDVLDEKNAKLFSAILTGLNRAFPFADMPAAVYTDHLETLFRITHSCNFNT
                     SVQALVLVHQLVTRTGLPPDRYYRTLYESLLDPRLVHSSKQGLYLNLLYKSLRADPLD
                     ARVDAFVKRILQVALGWLNAGAAAGMLYLLQQLCRHAPRVRNLLLNAPRDHEYAGTAA
                     PPRYDPRKRDPAHANADAASLWELLLFHAHFHPAVAAHAAALADDRDIAKPDLGLHTL
                     AHFLDRFVYRHARARPAERGASIMQPLPGPHAGPLLVRAPAAPALPPNAADWLATRAA
                     DVRPDERFFYHYFAGRAAPRRAAPAPDAPLDEDDVWAALVRSRPDVEADSDDGLSPAD
                     FADDSDLASDAELSDADLSDASDLSAADLSDAAADLDSAPHIADAASDDSALVSDAAS
                     GLSDSGSTDRKRPRAAREGYKKGAANGRPKRQKRRSLRDLPTFAAAEDYAQYLSEPE"
     gene            <963802..>966177
                     /locus_tag="AGOS_AER177W"
                     /old_locus_tag="AER177W"
                     /db_xref="GeneID:4621243"
     mRNA            <963802..>966177
                     /locus_tag="AGOS_AER177W"
                     /old_locus_tag="AER177W"
                     /product="AER177Wp"
                     /transcript_id="NM_210388.2"
                     /db_xref="GeneID:4621243"
     CDS             963802..966177
                     /locus_tag="AGOS_AER177W"
                     /old_locus_tag="AER177W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR083W (TEC1)"
                     /codon_start=1
                     /product="AER177Wp"
                     /protein_id="NP_985034.2"
                     /db_xref="GeneID:4621243"
                     /translation="MNEEGAGARFENLFNSQMYYGDGRDGRDGREGGGGRRWHPSQTR
                     VFDVFLGDSPRVRQPDIFAYEGKGGKEEEEEEGVALVNTGQGLARGGGALAQETPPAT
                     ADEERLGEQVGGLGSRSNSLPTPLSTASQGDKWPPQVESAFLSALKVIMKNGTSKIKL
                     REKNYGRNELISLFIKHRCGEVRTKKQISSHIQVWKKSILNKVSNSIETNEFEKELLN
                     LIEHGAAQTSESWRLFEETFNEILDAEESTTDGSLSSERSTPGGAQGLLVHSPCLTGM
                     GTLPQQPSILGPMEYKKEPTTPLEYAQEIYSHLKSYKCVPVNTERQIYSPTFPPATAT
                     RPPVAANAAPTGDESHKRIIEAAKEVEFQQRRLIEELFQQQPHNMKQRGPMKAPTSSP
                     GGFTSYRMDDQIQTPYSAGYPSNNKPMPRYYGVSSQQRYAYPMLQQMSFSTWVPRMSP
                     TSHGYPSQQQSPLAPQVALHQQHLQQRPQSSHMLSQQQQQQQQQQQQQQQQQQQQQQQ
                     EQQEQQQHSPAQHAQQSQSRQPVQNSQQHSLSQSPVLTQQQVSLQQHSQQRPHPQHPQ
                     QQHLQQLQQHSRQIHLQSSEQQTRSSQQSQPPPQPSSQHPQSSQKRHQQPQLQHHLPL
                     QLQHPPQTHHPHHHLQQQQNHLQQHHLQQQQQQQQQQQQAQQQSQLQNPEKQHLHKQP
                     ASPPPQPQAQPQVQQQAQQQQQQAQHQSSQPPQQQAQPQAQAQAQPPSTAPAPQQHQR
                     QPNQPQAPQPHPNSQEITQQLPHRQAHALQQTQPAQAISPHNKEYSGDESA"
     gene            <966622..>969519
                     /locus_tag="AGOS_AER178W"
                     /old_locus_tag="AER178W"
                     /db_xref="GeneID:4621244"
     mRNA            <966622..>969519
                     /locus_tag="AGOS_AER178W"
                     /old_locus_tag="AER178W"
                     /product="AER178Wp"
                     /transcript_id="NM_210389.1"
                     /db_xref="GeneID:4621244"
     CDS             966622..969519
                     /locus_tag="AGOS_AER178W"
                     /old_locus_tag="AER178W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR084W (MIS1)"
                     /codon_start=1
                     /product="AER178Wp"
                     /protein_id="NP_985035.1"
                     /db_xref="GeneID:4621244"
                     /translation="MLRTFTEWSILRSNTQLGAFSCPVRRHYHLISGKSIAKTIRDNA
                     LREVKEIRQQVPDFNPKLKILQVGSRPDSSAYVRMKLKASTESGVECDVEKLPEDITQ
                     LELLRKIEKINSDAEVHGILIQLPLPKHLDEVTVTNAVDHEKDVDGFHRYNVGELAKR
                     GGKPYFLPCTPNACIQLLKECGVEIRGKQAVVIGRSDIVGTPVATMLKNLDATVTVAH
                     RHTTNLPQVLSTADIVVAACGVPNYIKGEWLKDGAVVIDVGINYVQDSTKKSGQRLVG
                     DVDFESAKEKASHITPVPGGVGPMTVAMLVQNVLTAAKRSLQKDAEVPVITPLPVNFE
                     MPVPSDIDISRKQNPKHISQVAAELGIRDHELELFGHYKAKISPKLLQRLHANQNANY
                     VLVAGITPTPLGEGKSTTTMGLVQALSAHLGKRAIANVRQPSMGPTFGVKGGAAGGGY
                     AQVIPMDEFNLHLTGDIHAISAANNLLAAAIDTRMFHEHTQKNDATFYNRLVPKKGGS
                     RKFTKSMLKRLQKLGINKTDPDSLSPKEIKRFARLNIDTDTITIKRVVDVNDRLLRQI
                     TIGQAHTEKGFTRTTGFDITVASELMAILALSKDFADMRERVGRMVVAANLDGEPITA
                     EDVGCAGAVAALLKDAIKPTLMQSLEGTPVLVHAGPFANISIGASSVIADRIALKLVG
                     TSPHSPEGTDAGYVVTEAGFDFTMGGERFLNIKCRSSGLKPNTIVIVATVRALKLHGG
                     GPEVKPGQPLTPHYTEENLELVTRGAANLQKQIRNAKLFGVPVVVAVNRFESDTDAEI
                     EIIQKAAKEAGAHDAIAANHWAEGGKGAVTLAEAVINSCKQPSSFKFLYDVDQPVTEK
                     LSTIVRKMYGGSAIDLSPTAQKKIALYTAQGFDKLPICIAKTQYSLSHDATLKNVPSD
                     FVFPIRDIRASIGAGYLYALAAEIQTIPGLSTNAGYMNVEVSDDGEIEGLF"
     gene            <969887..>970141
                     /locus_tag="AGOS_AER178WA"
                     /old_locus_tag="AER178W-A"
                     /db_xref="GeneID:9487593"
     mRNA            <969887..>970141
                     /locus_tag="AGOS_AER178WA"
                     /old_locus_tag="AER178W-A"
                     /product="AER178W-Ap"
                     /transcript_id="NM_001355329.1"
                     /db_xref="GeneID:9487593"
     CDS             969887..970141
                     /locus_tag="AGOS_AER178WA"
                     /old_locus_tag="AER178W-A"
                     /note="NOHBY542; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0B06622g"
                     /codon_start=1
                     /product="AER178W-Ap"
                     /protein_id="NP_001342271.1"
                     /db_xref="GeneID:9487593"
                     /translation="MDLMVINKDDWVYVQSEGDHSGDHTYFESTITSSLRDTKRHALF
                     PPIVREQFIQGKDMCLPIYHDGIKEQAALEYDGTGALCGL"
     gene            complement(<970355..>971149)
                     /locus_tag="AGOS_AER179C"
                     /old_locus_tag="AER179C"
                     /db_xref="GeneID:4621245"
     mRNA            complement(join(<970355..970922,971148..>971149))
                     /locus_tag="AGOS_AER179C"
                     /old_locus_tag="AER179C"
                     /product="60S ribosomal protein L19"
                     /transcript_id="NM_210390.2"
                     /db_xref="GeneID:4621245"
     CDS             complement(join(970355..970922,971148..971149))
                     /locus_tag="AGOS_AER179C"
                     /old_locus_tag="AER179C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR084C-A (RPL19A) and YBL027W (RPL19B); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L19"
                     /protein_id="NP_985036.2"
                     /db_xref="GeneID:4621245"
                     /translation="MANLRTQKRLAASVVGVGKRKIWMDPSETAEIAQANSRNAIRKL
                     VKNGTIVKKPTRVHSRSRTRAMAESKRNGRHTGYGKRKGTKEARLPSQVVWIRRLRVL
                     RRLLAKYRDAGKIDRHLYHSLYKAAKGNTFKHKRSLVEHIIQAKADAQREKALKEEAE
                     ARRLKNRAARERRAQRIAEKREALLKEDA"
     gene            <971573..>971878
                     /locus_tag="AGOS_AER180W"
                     /old_locus_tag="AER180W"
                     /db_xref="GeneID:4621246"
     mRNA            <971573..>971878
                     /locus_tag="AGOS_AER180W"
                     /old_locus_tag="AER180W"
                     /product="AER180Wp"
                     /transcript_id="NM_210391.1"
                     /db_xref="GeneID:4621246"
     CDS             971573..971878
                     /locus_tag="AGOS_AER180W"
                     /old_locus_tag="AER180W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL028C"
                     /codon_start=1
                     /product="AER180Wp"
                     /protein_id="NP_985037.1"
                     /db_xref="GeneID:4621246"
                     /translation="MAKSLRAKTHLKAKSVKRKGVFQKTTDERAQRLAEKLKSNLLEQ
                     KAGAQPDGKMEIDGDSTASTEKVAKVSTSGWRDARHLNYKRAKKLRKTKHKGSFVKF"
     gene            complement(<972593..>973906)
                     /locus_tag="AGOS_AER181C"
                     /old_locus_tag="AER181C"
                     /db_xref="GeneID:4621247"
     mRNA            complement(<972593..>973906)
                     /locus_tag="AGOS_AER181C"
                     /old_locus_tag="AER181C"
                     /product="AER181Cp"
                     /transcript_id="NM_210392.1"
                     /db_xref="GeneID:4621247"
     CDS             complement(972593..973906)
                     /locus_tag="AGOS_AER181C"
                     /old_locus_tag="AER181C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL029W"
                     /codon_start=1
                     /product="AER181Cp"
                     /protein_id="NP_985038.1"
                     /db_xref="GeneID:4621247"
                     /translation="MLFSGVEDYSLFENNLVFLDDSGEGEESRGRVDSAAKTEVGFGY
                     PSAGLPWTGGVPMDAPGNSSVLSYSSMSTEGSAFGGAPFYDVDLFSTSGTRGVMMTRT
                     SSLDNGPAQPMEPSVAALLTPNVDPLMSYSACAGLASLPPASETERVSPLSFPTALKL
                     EDPLHVVPAAENTVKPKAPPALETAASSAVSSRSSSGGSFGQTYRYVSEGDEYAEADA
                     EADADDDDDDDDGGYGSGSQGRVPRQRRCSRRSTSLPTVISTAKKVSDSRLSAQGLAE
                     VLKLGSAEEALRRERFVLDILENDLHYPLGYKTWVRDTSKDYRNQLLDQLHKRVKVKY
                     PEYDKPVLETIIRRATYYMMQSRLRRERRAKAKAKRDSVYNFKADTKERFNSVSSSAS
                     GPPTSPNVLRSTANISPNRSGSIGESSSFMLCEPACRTRKNTFTN"
     gene            <974731..>975039
                     /locus_tag="AGOS_AER182W"
                     /old_locus_tag="AER182W"
                     /db_xref="GeneID:4621248"
     mRNA            <974731..>975039
                     /locus_tag="AGOS_AER182W"
                     /old_locus_tag="AER182W"
                     /product="AER182Wp"
                     /transcript_id="NM_210393.1"
                     /db_xref="GeneID:4621248"
     CDS             974731..975039
                     /locus_tag="AGOS_AER182W"
                     /old_locus_tag="AER182W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL029C-A"
                     /codon_start=1
                     /product="AER182Wp"
                     /protein_id="NP_985039.1"
                     /db_xref="GeneID:4621248"
                     /translation="MFFCLPVWFGKRSWDRAYGDEGHYSGLYCPRCQSFAVSPVKRRE
                     FVTLLWVPFVPLYWGNQLRCAACGWRQDFKSQAQLEKVRAEQDNIRGGRYGAAPPAYY
                     "
     gene            complement(<975066..>977705)
                     /locus_tag="AGOS_AER183C"
                     /old_locus_tag="AER183C"
                     /db_xref="GeneID:4621249"
     mRNA            complement(<975066..>977705)
                     /locus_tag="AGOS_AER183C"
                     /old_locus_tag="AER183C"
                     /product="AER183Cp"
                     /transcript_id="NM_210394.2"
                     /db_xref="GeneID:4621249"
     CDS             complement(975066..977705)
                     /locus_tag="AGOS_AER183C"
                     /old_locus_tag="AER183C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YOL089C (HAL9)"
                     /codon_start=1
                     /product="AER183Cp"
                     /protein_id="NP_985040.1"
                     /db_xref="GeneID:4621249"
                     /translation="MEGANFSVRFGPEQRRSPIGWRGRFRERHKLKSAWPSSEASSCW
                     VQSWSKNCCAAALTHRFAPEAMTETKTVMRKRVSKACDICRAKKIRCNGEEPCVNCEK
                     FNLGCTYTHVIKRRQAAPTRVSNRKLLGDLSARLQRLEHVLVRMSAQLGGEAWRAPAE
                     TEVAEVEEEGESSEDSEEEWTPPRVQRADSVSSYESASSDVALTRLVQNDNKPDTYFG
                     THTSFSLFSRRGLRWLYRVLGGRNEFLLPLLKLNSFIKHNHEQFYDKFLAAVDVAALP
                     SWPDMERCEMLRDVFLRDLQPTYSVVSREEVLAVFERLRFVSPEQLSIPEQLLLCTVM
                     LTAAIGIGFQQDADTALWDTVANQMLTRTVNIVQTTWMMPMTDPVGYMQAIILLSVYL
                     ENSPVPQTTYLQLSFAIRLGQTLGLHQRESYMHIKDIAERNRRLNVWWWCYRYDKVLS
                     VCTGRPSLIHEHDNTAFNDWDYYQLLKWQMKPAEVLDSRPSPPAGFDLPEALESLLTF
                     GAQSLTNLNYTLNYHLYKLYRIQSETYTNLSCNRVPSGEDIQIRMRHVNYILQCLDGW
                     WDSVPEMLRAREEVADIEAIHTQLSSMRREDEDPELVDHIFSRILLLYLNYYWTRSGA
                     VRALFHMPLSRLQPSEASKIIFRKLPVFENSFKNSVSMIKLVNYMLTRDADRLHVEPL
                     FAYLGGFLSLVSISFFLERFPRDHIMLLDSCCKAAIARARHGTTTATWKWTIVSLITT
                     HFLKLAVDRYNDSCADDGLPLSTSQYATTLRELQQQLVSSYKKIYAFLDNFERESRES
                     AAMRQCDEVLRQPLDDWFNLDLGAHDVGAVPDPLLATLSMPAPEPDHTLPADPLAYAE
                     PDFPLDSFFMNDYTFSMPGFFGQ"
     gene            <977968..>978885
                     /locus_tag="AGOS_AER184W"
                     /old_locus_tag="AER184W"
                     /db_xref="GeneID:4621250"
     mRNA            <977968..>978885
                     /locus_tag="AGOS_AER184W"
                     /old_locus_tag="AER184W"
                     /product="ADP/ATP carrier protein"
                     /transcript_id="NM_210395.1"
                     /db_xref="GeneID:4621250"
     CDS             977968..978885
                     /locus_tag="AGOS_AER184W"
                     /old_locus_tag="AER184W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL030C (PET9) and YBR085W (AAC3)"
                     /codon_start=1
                     /product="ADP/ATP carrier protein"
                     /protein_id="NP_985041.1"
                     /db_xref="GeneID:4621250"
                     /translation="MSDNKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEML
                     KQGSLDRRYNGIVDCFKRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFG
                     FRKEVDGYAKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGL
                     VDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASF
                     LLGWAVTTGASTASYPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCG
                     ANILRGVAGAGVISLYDQLQLVLFGKKFK"
     gene            complement(<979199..>980629)
                     /locus_tag="AGOS_AER185C"
                     /old_locus_tag="AER185C"
                     /db_xref="GeneID:4621251"
     mRNA            complement(<979199..>980629)
                     /locus_tag="AGOS_AER185C"
                     /old_locus_tag="AER185C"
                     /product="AER185Cp"
                     /transcript_id="NM_210396.2"
                     /db_xref="GeneID:4621251"
     CDS             complement(979199..980629)
                     /locus_tag="AGOS_AER185C"
                     /old_locus_tag="AER185C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL031W (SHE1)"
                     /codon_start=1
                     /product="AER185Cp"
                     /protein_id="NP_985042.2"
                     /db_xref="GeneID:4621251"
                     /translation="MPEAPEMLRTQESPRLRSRDLEDTEQLIDDIGVSKRLGNSVLSE
                     LDHRATNLLANLTTSTLSAASTLTDPELCDEAAHKGVSRFETVHGELIESMDSIDTHY
                     AVKRNRHGLNVPATPKRYSIQDAMSSVSAARETDRAELLYHKRARDAMGNIVERLTTS
                     PVTDITRRIRRLRMNMSTPREHHREQERQRRRSSIIRQSLTGNSDKENHVPRSKGFAN
                     LYGEMRAVSSSAISVAAHESGAPTFAKPTITSRQKTVNTLLRNPHDATSFFASFRRRS
                     PISSSPTPSFQHRQPSPIPTPRQQLSVPDRASPARTSPTVASVPTSSKFRPLLTLNSQ
                     NISTTSSSTSPDCEAHKPRVVASKSVFDRLYHQPTTAAQQKTLGIRKSKTQGDLHYIS
                     KPPKSSYASSGSAATSGSDATLDDSSDATMDSTQESKLPRSKSIADLKVPKVRHPMPL
                     HRSSTGSEISMTSSGASVASRRPLWR"
     gene            complement(<981243..>982193)
                     /locus_tag="AGOS_AER186C"
                     /old_locus_tag="AER186C"
                     /db_xref="GeneID:4621252"
     mRNA            complement(<981243..>982193)
                     /locus_tag="AGOS_AER186C"
                     /old_locus_tag="AER186C"
                     /product="AER186Cp"
                     /transcript_id="NM_210397.1"
                     /db_xref="GeneID:4621252"
     CDS             complement(981243..982193)
                     /locus_tag="AGOS_AER186C"
                     /old_locus_tag="AER186C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL032W (HEK2)"
                     /codon_start=1
                     /product="AER186Cp"
                     /protein_id="NP_985043.1"
                     /db_xref="GeneID:4621252"
                     /translation="MTMTDSSSPAPEGPAAPAEAAAPAKVDAQAPLVTLRLLLSLKEA
                     ARILGRGGNTIDNIRKANGVKIGISTKEKSCSDRLLEVTGSIDAVANSLADVVKVLTA
                     DDTNEEDAEPEPEQHIFKHLNFILPPPSPDEAEDPMKVKQIGNLRLIVTNSQVSSIIG
                     TAGSKIKKLIDTHSSKLVVSKTFLPDSQDRILEIQGFPNSIANCIKDISQTLIKDDVL
                     DTKEKRYYPHSKHSKDIHVTATVAIPAEYVGALLGHGGNRIANLRKYTRTKITVAQEP
                     NQNNEREFTITGNDQKSVKLAQNMIMKNLGTEKERRLEKQ"
     gene            <983059..>985008
                     /locus_tag="AGOS_AER187W"
                     /old_locus_tag="AER187W"
                     /db_xref="GeneID:4621253"
     mRNA            <983059..>985008
                     /locus_tag="AGOS_AER187W"
                     /old_locus_tag="AER187W"
                     /product="AER187Wp"
                     /transcript_id="NM_210398.2"
                     /db_xref="GeneID:4621253"
     CDS             983059..985008
                     /locus_tag="AGOS_AER187W"
                     /old_locus_tag="AER187W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YBL075C (SSA3) and YER103W (SSA4)"
                     /codon_start=1
                     /product="AER187Wp"
                     /protein_id="NP_985044.2"
                     /db_xref="GeneID:4621253"
                     /translation="MSKAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTD
                     TERLIGDAAKNQAAINPSNTVFDAKRLIGRKHDDPEVANDAKHFPFKIVNKEGKPNIQ
                     VEFKGETKTFTPEEISSMVLGKMKETAEQFLGCKVNDAVVTVPAYFNDSQRQATKDAG
                     TIAGLNVLRIINEPTAAAIAYGLDKKGKSEHNVLIFDLGGGTFDVSLLSIDDGIFEVK
                     ATAGDTHLGGEDFDNRLVNHLAQEFKRKNKKDLSTNQRSLRRLRTAAERAKRALSSSS
                     QTSIEIDSLFEGVDFYTSITRARFEELCSDLFRSTLDPVEKVLRDSKLDKSQIDEIVL
                     VGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDTSSKTQDLLLL
                     DVAPLSLGIETAGGIMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERTRTKD
                     NNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRL
                     SKEDIERMVSEAEKFKEEDEREAERVQAKNGLEAYAFNLKNTIEESGFKDKVGEDDYK
                     KLQTAAQDTISWLDSSQAASTEEYKDKQKELEDVANPIMTKFYSAGGAPPGGAPAGGF
                     PGAGGPGGPAPGAGGDSGPTVEEVD"
     gene            985396..985496
                     /locus_tag="AGOS_t0119"
                     /db_xref="GeneID:4621254"
     tRNA            join(985396..985432,985452..985496)
                     /locus_tag="AGOS_t0119"
                     /product="tRNA-Ser"
                     /codon_recognized="AGC"
                     /db_xref="GeneID:4621254"
     gene            complement(<985710..>992234)
                     /locus_tag="AGOS_AER188C"
                     /old_locus_tag="AER188C"
                     /db_xref="GeneID:4621255"
     mRNA            complement(<985710..>992234)
                     /locus_tag="AGOS_AER188C"
                     /old_locus_tag="AER188C"
                     /product="AER188Cp"
                     /transcript_id="NM_210399.2"
                     /db_xref="GeneID:4621255"
     CDS             complement(985710..992234)
                     /locus_tag="AGOS_AER188C"
                     /old_locus_tag="AER188C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR019W (FAB1)"
                     /codon_start=1
                     /product="AER188Cp"
                     /protein_id="NP_985045.2"
                     /db_xref="GeneID:4621255"
                     /translation="MDQEGGTHLGAAVGPTDQAEYLKQRASVSKAASQAHSETVLGEL
                     QRPMEDLGVSSESGMCNPIPIPQADTVKDELDYSSPSSGSSKLVSFQNSGVSVEDRTR
                     TLHFSLGNGANNKRSSIYESKSTVTAIPIRTPKTHEFDDIASTKSVSSSLTASFSRNF
                     LYGFYNTKKGQPRNRAILSKDYWMKDESAKECFACTKTFNTFRRKHHCRICGQIFCSN
                     CTFLVHGDRFGYSGKMRICNGCSEHANNYEDSSDESSVDETSHVDQVSTTHIDPVNAL
                     HDDDMQSILTTGEDPRFLITPTPPPKMAIPATRQGESLEISFPSASGTNHHYPHFSYY
                     HSNHHGHNHQENMHRQRRSNRDRYSLRDVDILSPITQESNSTLLQSSAQRSNSNIRSL
                     QLGNLRQSLTSYINGHNNSAYAPLLPKQQTQAPNSIIGNGGHSTFKFEFNYGNDAPSA
                     PKPAVHFQTSPSGTMLSPDPHDQPDDNCSEDEGSMSLYCSLNEPRASHQNPIRSLRNT
                     SKSSQRAQASLQRMRSRRKSRSKSISVYNTGGKDTSILNYSAPNLLSVVSSDTELCSR
                     TKDVSNLLRPRLWNEVLSSRDLRRVISSSSAFRLVSREGKSDLNEVSALHIDALLKQV
                     LNDQELPTLSEWEKIFQPFLLKVQAVHLDARKLDDLDFKQHYLKIKRIAGGKIHDSCL
                     LHGIVYSKGLPLKSMPRELHNPRILLIMFPLEYQKSENQLLSLVSVMAQEKEYLNKLV
                     SRLTSLNPDIIFVGANVSGYALKILNDLGIVVQYNVKPQVIERIAKLTESDIAISVDK
                     LATNIKLGTCEKFEVQSFIYQNLSKTYSFLTGCKPSLGATIVLRGEDNLTLRKIKDVT
                     EFMVYSVFCLRLESSFFNDNFLQLSTAVYKDREAKRRNVVATGYFANFMDKYNARIFS
                     VSPTVEFPEPYLLRKARELEAKLNQKLEELKQLEQSNNPKNLAIGLHIEGLNAQLLRP
                     QDYSYLIKFIQEKEIEDLQLKFQRRKRQWEVSYSSSQNLLGTGSHQNITVLYSVISTK
                     TATPCIGPQLVTIDYFWDNDVSMGQFIENVVATAYKPCGHSCGGLMLDHYRSYVHGNG
                     KVDVLIEKFQSKIPLIQNIIFSWSYCKKCGNTTPTIQMSDRTWNYSLGKYLELLFWNT
                     RDGLLGIGSCSHDFSKDHIRYFRLNDSIVRMEYSDIEVHELITPCPKITWRPHMDIKL
                     KIESYYLILDKINAFYFSVIDRLDRVKLDSLPEDRMQSGQAKISELKAKAEDEKKQLI
                     QYVDIIYRDTPGDKHLHMNATIRALHNNAAGWDADFSEFEKKFLPTDKDIARVTALQL
                     KKLFVDSKREEKPTTDADKYKDSNIEGIPEEFSSDGLDQDASVEQSQLQDMPEVKMGD
                     STKPSASNSAKSHVLQRSRGSQGSQLSTHSQSSQSSHNSSRSLQLTEGSQLSRNSRGS
                     QGSKGSLASKGSQPMLNVEPLDPEYLKRTSKEHYHVSTLEPLKQTLKDERKKSRVLDE
                     AYKFEELIRQTSETQVPRCPFAGSQTAPVLRTIGTTVPSPEEYGNTNSSTKAETAHKD
                     IRPALKDLRKLSMSSNNSSITQRSKDFPTDGKVGQLASFFDQIHFDALSKEFELQREM
                     ERLQMNKNKYKAMRVKSSKPIVEVYKNVKDAVDGPMKEETRNSTKMSVGNNTILNHHA
                     TQPFQNDLGTTSPEAVITEMPLRKGLETELENSIHLWSESILHANKQKDTKSTELLSG
                     SNKNTQNEPLPPVTTTATVNMDNSSVPAPSEKLSLMKTLANFWADRSSTSWKPLEYPT
                     TQSEHIFMDNAVIIREDEPSSLIAFCLSCSDYVKKINNMRSFGPGRPDSEICNMKQKK
                     GLENESRRSFTESLDEAPDTESASPAIAADAEPLDLEKIMTKKTGMHLRYQFQDGSSV
                     MSCKIFFYEQFEAFRRRCGCGDENFIQSLSRCVKWDSTGGKSGSAFLKTLDDRFVIKE
                     LSHAEIDAFVKFAPSYFEYMGQALFHELPTALAKIFGFFQIQIRNSATGKSFKMDVII
                     MENLFYDKKTTRIFDLKGTMRNRHVEQTGKENEVLLDENMVEYIYESPIFVREYDKRL
                     LRASLWNDTLFLAKMNVMDYSLVIGVDNENHNLTVGIIDCIRTFTWDKKLESWVKEKG
                     LVGGSTKEPTVVTPRQYKNRFREAMERYILMVPDPWYQEPHK"
     gene            <992536..>993531
                     /locus_tag="AGOS_AER189W"
                     /old_locus_tag="AER189W"
                     /db_xref="GeneID:4621256"
     mRNA            <992536..>993531
                     /locus_tag="AGOS_AER189W"
                     /old_locus_tag="AER189W"
                     /product="AER189Wp"
                     /transcript_id="NM_210400.2"
                     /db_xref="GeneID:4621256"
     CDS             992536..993531
                     /locus_tag="AGOS_AER189W"
                     /old_locus_tag="AER189W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR018C"
                     /codon_start=1
                     /product="AER189Wp"
                     /protein_id="NP_985046.2"
                     /db_xref="GeneID:4621256"
                     /translation="MLRGTSIWCLVWYLAWQAAVGVLWAGRTRAHLLGQGHYGGTLEL
                     AMGLERATNASLLRPFNRTRVSGSAGSHSVQEFVRSYFAGLKQPWQAETQQFSEAGHK
                     FANMVFTLGGGERQLVLAAHYDSLARPEGFIGAIDSAASCAMLLYVAQVLEALRIDFP
                     LDGEERFTGLKLVFFDGEEAFEQWSPEDSLYGSRHMAEKWERDGTLQDVQLLVLLDLL
                     GGPGEDLVPSYFKETHHYYEDLWVIEAKYNSEYSVSTSYLDPSAKARVYIDDDHMPFL
                     RRGVPVLHLIPSRFPPNWHTLEDDFAHLDAEAVKKWTVMLVEFTLLQLGCYWDWE"
     gene            <993718..>996753
                     /locus_tag="AGOS_AER190W"
                     /old_locus_tag="AER190W"
                     /db_xref="GeneID:4621257"
     mRNA            <993718..>996753
                     /locus_tag="AGOS_AER190W"
                     /old_locus_tag="AER190W"
                     /product="AER190Wp"
                     /transcript_id="NM_210401.1"
                     /db_xref="GeneID:4621257"
     CDS             993718..996753
                     /locus_tag="AGOS_AER190W"
                     /old_locus_tag="AER190W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR011C (ADP1) and YOL075C"
                     /codon_start=1
                     /product="AER190Wp"
                     /protein_id="NP_985047.1"
                     /db_xref="GeneID:4621257"
                     /translation="MVRCATLFTFLTACISLGSAVQVVQRIQALPHRRPGPGDGDKEK
                     CPPCFNCMLPGFECKQYSKCNPFTGRCDCRPGFGGDDCSQPLCGALSDRNDYRPARPQ
                     NEVCECGPGWGGINCNMCEEDAACDSMVPSGVRGTCYRGGMIVHSLHQGCNITNEKIV
                     EMLGDKKPQVTFACNKTAGECDFQFWIDQEESFYCGLNECNFNYDLGSNSTHYECSEI
                     RCECIPGRMLCGQKGSIDISEFLTEEIRGPGEFSCNVGTKECHFSEPSMDELIGTIFG
                     DSYIKLRCSSGECLHYSEVPGYLPPPKQKLNFFGYLVLSVTSAVLMGSISLVVLFISR
                     SPLFSNGHIELPEYDSMEEDFLKSGSMATLTFENLCYKVFPSRSSPVRILNSISGYVS
                     PGEILAVMGGSGAGKTCLLDILGMKNKAGEVSGTVKINGVPITKHTVSKVVGFVDQDN
                     HLLPTLTVYETVLNSALLRLPRSMSFAAKQKRVYQVLEELRIFDIRDRLIGNDFERGI
                     SGGEKRRVSIACELVTSPLILFLDEPTSGLDSNNANNVIECLVRLASQYRRTLVLSIH
                     QPRSNIFRLFDNLVLLNEGEMVYSGPITRVNDFLRNTGFNCPSDYNIADYLIDINFMS
                     PTAPSLENPDSADVEAEAGKSVENSLHVPELGRSSTQREWEHFALHRDELRSMLQTGE
                     AAGAAGHMSSHNLSRLFKEGSHFGELLSHIEDVNKECHSNKLTLPSSYQGASFLQQLS
                     ILNSRSFKNIYRNPKLLIGNYVLTVILGLFLGALYYGIENDISGFQNRLGLFFFVLTY
                     FGFLTFTGLSSFAQERIIFVKERSNNYYSPVAFYVSKVLSDILPLRVVPPILLCLVIY
                     PLVGLNMSNGAFLNCIGILVLFNLSISMEILAVGLFFEDLNNSIVFSVLILLGSLLFC
                     GLFVNTQRITNFAFRYMKNLSVFYYAYEALIINEVKSLTLRDKKYGLNIEIPGATILS
                     SFGFSVQHLQLDIEMLGACCAVFLLAGYLVLQLLVIEHK"
     gene            <996899..>997843
                     /locus_tag="AGOS_AER191W"
                     /old_locus_tag="AER191W"
                     /db_xref="GeneID:4621258"
     mRNA            <996899..>997843
                     /locus_tag="AGOS_AER191W"
                     /old_locus_tag="AER191W"
                     /product="AER191Wp"
                     /transcript_id="NM_210402.1"
                     /db_xref="GeneID:4621258"
     CDS             996899..997843
                     /locus_tag="AGOS_AER191W"
                     /old_locus_tag="AER191W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR003C (RPC34)"
                     /codon_start=1
                     /product="AER191Wp"
                     /protein_id="NP_985048.1"
                     /db_xref="GeneID:4621258"
                     /translation="MNSLIQNNIKLSDTAQELHDKMIGMQPGTLFSQQELQAMIGSPS
                     LSNLMAHAQELLDKNLIRLVKQNNELRFQAVNVSEAQKKSGMSSDEALVYSYIEASGR
                     EGIWTKTIKAKTNLHQHVVLKCLKSLESQRYVKSVKSVKYPTRKIYMLYNLQPSIDVT
                     GGPWFTDSELDVEFINSLLTIVWRHTSERTYPNGFNNFGTGRDKEVLYTHTVKNYSTT
                     EEILKFISAARVSTVELSKSDIRSLCEVLVYDGKLEKVAFDCYRVTLQSVLQMTQPAG
                     GEPGAGVADQDFSVFDYASVISPSAGDKEAVYIDEWNL"
     gene            <998107..>998931
                     /locus_tag="AGOS_AER192W"
                     /old_locus_tag="AER192W"
                     /db_xref="GeneID:4621259"
     mRNA            <998107..>998931
                     /locus_tag="AGOS_AER192W"
                     /old_locus_tag="AER192W"
                     /product="AER192Wp"
                     /transcript_id="NM_210403.2"
                     /db_xref="GeneID:4621259"
     CDS             998107..998931
                     /locus_tag="AGOS_AER192W"
                     /old_locus_tag="AER192W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR010C (ADY2) and YNR002C (ATO2)"
                     /codon_start=1
                     /product="AER192Wp"
                     /protein_id="NP_985049.2"
                     /db_xref="GeneID:4621259"
                     /translation="MASDRMEEYDIDNRLAKTTAPPGTPDSKGSGEHVERIRTAGEHN
                     EYIYIGRQKFLKSDLYEAFGGTLNPGLAPAPAHKFANPAPLGLSAFALTTFVLSMYNC
                     GARGVAVPNVAVALAMFYGGLVQLAAGMWEMAMENTFGATALSSYGGFWLSYGAINIP
                     WFGVKDAYAASEAQLVDAIGIYLLAWAIFTYMLTMLTLKSTLAFFSLFFLLGTTFLLL
                     AIAEFARSDRVKRAAGVVGVIVAFIAWYNAYAGIASRENAYIMARPIPLPRNQKWW"
     gene            <999087..>999884
                     /locus_tag="AGOS_AER193W"
                     /old_locus_tag="AER193W"
                     /db_xref="GeneID:4621260"
     mRNA            <999087..>999884
                     /locus_tag="AGOS_AER193W"
                     /old_locus_tag="AER193W"
                     /product="AER193Wp"
                     /transcript_id="NM_210404.1"
                     /db_xref="GeneID:4621260"
     CDS             999087..999884
                     /locus_tag="AGOS_AER193W"
                     /old_locus_tag="AER193W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR009C (RVS161)"
                     /codon_start=1
                     /product="AER193Wp"
                     /protein_id="NP_985050.1"
                     /db_xref="GeneID:4621260"
                     /translation="MSWEGFKKAINRAGNSVIIKNVDKTVDKDYDLEERRYRVLERAG
                     RELQKEAKGYLDSLRAVTASQVTIAEVISSLYDDSKAAGGGGYNVGNYYLQCVRDFDT
                     ETVKQLDGPFRETVLDPISKFALYFEEIEGAIKKRDHKKQDYDAAKARVRRLVDKPAK
                     DATKLPRAEKELALAKDVFESLNEQLKTELPQLVALRVPYYDPSFEALVKIQLRFCTE
                     GYTRLAQIQQYLDQQSRDDYANGLLDERIEQLLQQMTNLNICALGHK"
     gene            <1000315..>1004097
                     /locus_tag="AGOS_AER194W"
                     /old_locus_tag="AER194W"
                     /db_xref="GeneID:4621261"
     mRNA            <1000315..>1004097
                     /locus_tag="AGOS_AER194W"
                     /old_locus_tag="AER194W"
                     /product="AER194Wp"
                     /transcript_id="NM_210405.1"
                     /db_xref="GeneID:4621261"
     CDS             1000315..1004097
                     /locus_tag="AGOS_AER194W"
                     /old_locus_tag="AER194W"
                     /note="NOHBY523; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E11957g"
                     /codon_start=1
                     /product="AER194Wp"
                     /protein_id="NP_985051.1"
                     /db_xref="GeneID:4621261"
                     /translation="MGAVELLRMSLRKCRLRSVCRRWLKEHFLAMSVWVAQWAKLCIS
                     CSMLLTLLLGYPALGTNRGAHCASGGYLSAVGQEREHPASSANSTFAQFLFRANDNSN
                     VLSKGFLVETLAFQQRLLQDADSAPSFSKHSIFGLWGDDMEKLQLDEEPVYTVNQHWN
                     EMPQSLLQGVMHVNSYISSAQSLSLMLLMQGGNPDRRALLDRNIKALKSVSNLTKFYL
                     FDDAPATVASGPGDANRLLLRFTLVPLTWLDYCWIALAYIAIFAYLIYAIMLYPITKT
                     RISLFMAVLCQYSLVLASSKTLACFLNQKATENTPWMLLYIPVLIVFCSNTVDLLFSS
                     LGTKCTLPPAFKLRKKRLQAHKLTENKESVNQKNFFESVADSHTKSFFTLVICVLMIY
                     MFFPFSRKTSCFISIALFTNYLLNLLSLSAILSIEQRRLTLRNNLFAKENDGILDVSL
                     DDGYVKVNFARWWSHIIENNRVAGALWFSKSAVLLAVYFMLFNWRFSDIRSSTSICDM
                     FKAKTSILNGVNPFYPGFLIDEAYVAREIMRSLAHTGARNSEKILYTLAIERPIFVVK
                     DVIGNFTHDDFYAILQSFNSSMIFSYKFDGYYFLELFLSLLLIGSFSLFLLQLMSQSI
                     ESESTLSYGYSELETTKGTRGSVGLLANAIPGADDDVEGADIFHAKELAQYGHILDIT
                     YIATSASPFIVSIGMDHKVFVWSPAAKPLPKPLPLPLDRSFRYISHASISNSGLYIAI
                     FNNFGKVTCWSRCRMDFIWTIDLREPVVTLEAFFRSRTMPTMMRKRMMRGSTEVRTPT
                     SNYNTANNSTSRAPVSRRNSIRSITSIGTGSAAAVDSSYENPTTFFSSEELYGEDEFV
                     FVTTTGKMYMVDIEGHMTIEQLTDGLTPVKSCKELQSPRVNDRLVLCDTGGKIYVSTV
                     VNNAWRTKVLTIKSSFSYTNAPQGQKQEPEGQHQSILASGNALSGYANNLGDSDNTLL
                     LVPFIGFIGRTQGSYIELVDAQTGTFIRHFKIGNFKPSSIKIFHDQPTHCKFCGSASV
                     AFFAIAYTDKESSDFVMHVYQLESRTKNSICLRVERDPREIRCLGLESVTEKVHYVPD
                     VEDWDVADNNAVLGIRRKPEAIERFSAGSTSLCRSRLEVCSRKNTYQRGTKTAGSKAQ
                     PGSSFSIHNIWEGWTITPSGQVAYYEIPMGTNGLIVNKIGTLKKFGNKSIVVAFGNIM
                     KMFYLGKEELIFPVDGVSSSEEETGLKFVNKRRDRLNRKVFISPNYNRIDAIKLEH"
     gene            complement(<1004611..>1006125)
                     /locus_tag="AGOS_AER195C"
                     /old_locus_tag="AER195C"
                     /db_xref="GeneID:4621262"
     mRNA            complement(<1004611..>1006125)
                     /locus_tag="AGOS_AER195C"
                     /old_locus_tag="AER195C"
                     /product="AER195Cp"
                     /transcript_id="NM_210406.2"
                     /db_xref="GeneID:4621262"
     CDS             complement(1004611..1006125)
                     /locus_tag="AGOS_AER195C"
                     /old_locus_tag="AER195C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YCR008W (SAT4)"
                     /codon_start=1
                     /product="AER195Cp"
                     /protein_id="NP_985052.1"
                     /db_xref="GeneID:4621262"
                     /translation="MGTSSAVLAPQAQRPRKNTLSSKLGKLFGGPRGARDVGSSPVTL
                     CGTPSPAASGASMGAPTRPLSPPSSAGARDDGQSVRSAGSRGSEGTRESGGSGRTSPA
                     ASRASPTAAAQASGRFVVHEDGTHEHSLKNAKRQEKLSSMIRNMLGAQKLRGEAKSAV
                     PEILLGAKKPGAAEGDLPTLFSGLFSQTAQDSDGLRTPHRPTPDPDAPAAGKDYLSFA
                     EKYGRCQEVIGKGAFGVVRICHKKDANGTEALYAVKEFKKRPSEDQEKYSRRLTSEFC
                     LSSSLKHTNIINTLDLFQDAKGDYCEVMEYCSGGDLFSLIVTAGKLEYMEADCFFKQM
                     IRGVVYMHDMGVCHRDLKPENLILTANGVLKITDFGNGECFRMAWEKDIHLSGGVCGS
                     SPYIAPEEYSMEEFDPRPVDIWACGTIYMAMRTGRQLWRTAQKEDEFYARYLRGRKDE
                     AGYEPIEQLKRARCRNVIYSILDPVPSRRINGKQILNSEWGREIKCCVDSHPLH"
     gene            <1006871..>1008559
                     /locus_tag="AGOS_AER196W"
                     /old_locus_tag="AER196W"
                     /db_xref="GeneID:4621263"
     mRNA            <1006871..>1008559
                     /locus_tag="AGOS_AER196W"
                     /old_locus_tag="AER196W"
                     /product="AER196Wp"
                     /transcript_id="NM_210407.2"
                     /db_xref="GeneID:4621263"
     CDS             1006871..1008559
                     /locus_tag="AGOS_AER196W"